Anda di halaman 1dari 609

Prefeitura Municipal de Paulínia do Estado de São Paulo

PAULÍNIA-SP
Concurso Público CPPMP 001/2018
DADOS DA OBRA

Título da obra: Prefeitura Municipal de Paulínia do Estado de São Paulo

(Baseado no Concurso Público CPPMP 001/2018)

• Língua Portuguesa
• Matemática
Fundamentos Da Educação
• Legislação
• Publicações Institucionais
• Conhecimentos Pedagógicos
• 5HIHUrQFLD%LEOLRJUiÀFD²3DUWH3HGDJyJLFD
• 5HIHUrQFLD%LEOLRJUiÀFD

Gestão de Conteúdos
Emanuela Amaral de Souza

Diagramação/ Editoração Eletrônica


Elaine Cristina
Igor de Oliveira
Ana Luiza Cesário
Thais Regis

Produção Editoral
Suelen Domenica Pereira
Julia Antoneli
Leandro Filho

Capa
Joel Ferreira dos Santos
APRESENTAÇÃO

PARABÉNS! ESTE É O PASSAPORTE PARA SUA APROVAÇÃO.

A Nova Concursos tem um único propósito: mudar a vida das pessoas.


Vamos ajudar você a alcançar o tão desejado cargo público.
Nossos livros são elaborados por professores que atuam na área de Concursos Públicos. Assim a
PDWpULDpRUJDQL]DGDGHIRUPDTXHRWLPL]HRWHPSRGRFDQGLGDWR$ÀQDOFRUUHPRVFRQWUDRWHPSR
por isso a preparação é muito importante.
$SURYHLWDQGRFRQYLGDPRVYRFrSDUDFRQKHFHUQRVVDOLQKDGHSURGXWRV´&XUVRVRQOLQHµFRQWH~GRV
SUHSDUDWyULRVHSRUHGLWDOPLQLVWUDGRVSHORVPHOKRUHVSURIHVVRUHVGRPHUFDGR
(VWDUjIUHQWHpQRVVRREMHWLYRVHPSUH
Contamos com índice de aprovação de 87%*.
O que nos motiva é a busca da excelência. Aumentar este índice é nossa meta.
Acesse www.novaconcursos.com.brHFRQKHoDWRGRVRVQRVVRVSURGXWRV
2IHUHFHPRVXPDVROXomRFRPSOHWDFRPIRFRQDVXDDSURYDomRFRPRDSRVWLODVOLYURVFXUVRVRQ
OLQHTXHVW}HVFRPHQWDGDVHWUHLQDPHQWRVFRPVLPXODGRVRQOLQH
'HVHMDPRVOKHPXLWRVXFHVVRQHVWDQRYDHWDSDGDVXDYLGD
2EULJDGRHERQVHVWXGRV

*Índice de aprovação baseado em ferramentas internas de medição.

CURSO ONLINE

PASSO 1
Acesse:
www.novaconcursos.com.br/passaporte

PASSO 2
Digite o código do produto no campo indicado no
site.
O código encontra-se no verso da capa da apostila.
*Utilize sempre os 8 primeiros dígitos.
Ex: FV054-18

PASSO 3
Pronto!
Você já pode acessar os conteúdos online.
SUMÁRIO

Língua Portuguesa

Todo Conteúdo Programático até o Ensino Médio, como por exemplo: Ortografia; Estrutura e Formação das
palavras; Divisão Silábica; Vogais; Semivogais; Gênero, Número; Frases; Sinais de Pontuação; Acentuação; Fonética e
IRQRORJLD&RQFHLWRVEiVLFRV&ODVVLÀFDomRGRVIRQHPDV5HODomRHQWUHSDODYUDV8VRGDFUDVHVLQ{QLPRVKRP{QLPRV
HDQW{QLPRV)RQHPDVHOHWUDV6XEVWDQWLYR$GMHWLYR$UWLJR1XPHUDO$GYpUELR9HUERV&RQMXJDomRGHYHUERV3UR-
nomes; Preposição; Conjunção; Interjeição; Encontros vocálicos; Encontros consonantais e dígrafo; Tonicidade das pala-
YUDV6tODEDW{QLFD6XMHLWRHSUHGLFDGR)RUPDVQRPLQDLV/RFXo}HVYHUEDLV7HUPRVOLJDGRVDRYHUER$GMXQWRDGYHUELDO
Agente da Passiva, Objeto direto e indireto, Vozes Verbais; Termos Essenciais da Oração; Termos Integrantes da Oração;
Termos Acessórios da Oração; Orações Coordenadas e Subordinadas; Período; Concordância nominal; Concordância
verbal; Regência verbal; Vozes verbais; Regência nominal; Predicação verbal; Aposto; Vocativo; Derivação e Composição;
8VRGRKtIHQ9R]DWLYD9R]SDVVLYD9R]UHÁH[LYD)XQo}HVH&DUJRVGDVSDODYUDV´TXHµH´VHµ8VRGR3RUTXr3UHÀ[RV
6XÀ[RV$À[RV5DGLFDLV)RUPDVYHUEDLVVHJXLGDVGHSURQRPHV)OH[mRQRPLQDOHYHUEDO(PSUHJRGHORFXo}HV6LQWD[H
de Concordância; Sintaxe de Regência; Sintaxe de Colocação; Comparações; Criação de palavras; Uso do travessão;
'LVFXUVRGLUHWRHLQGLUHWR,PDJHQV3HVVRDGRGLVFXUVR5HODo}HVHQWUHQRPHHSHUVRQDJHP+LVWyULDHPTXDGULQKRV
5HODomRHQWUHLGHLDV,QWHQVLÀFDo}HV3HUVRQLÀFDomR2SRVLomR3URYpUELRV'LVFXUVRGLUHWR2QRPDWRSHLDV$OLWHUDomR
Assonância; Repetições; Relações; Expressões ao pé da letra; Palavras e ilustrações; Metáfora; Associação de ideias. De-
notação e Conotação; Eufemismo; Hipérbole; Ironia; Prosopopeia; Catacrese; Paradoxo; Metonímia; Elipse; Pleonasmo;
Silepse; Antítese; Sinestesia; Vícios de Linguagem. .................................................................................................................................. 01
ANÁLISE, COMPREENSÃO E INTERPRETAÇÃO DE TEXTO: Tipos de Comunicação: Descrição; Narração; Dissertação; Ti-
pos de Discurso; Coesão Textual. ...................................................................................................................................................................... 93

Matemática

Números inteiros; Números Naturais; Numeração decimal; Operações fundamentais como: Adição, Subtração, Divisão
H0XOWLSOLFDomR6LPSOLÀFDomR0HGLQGRRWHPSRKRUDVPLQXWRVHVHJXQGRV3UREOHPDVPDWHPiWLFRVUDGLFLDomRSR-
tenciação; máximo divisor comum; mínimo divisor comum; ................................................................................................................ 01
Sistema de medidas: medidas de comprimento, superfície, volume, capacidade, tempo, massa, m² e metro linear; problemas
XVDQGRDVTXDWURRSHUDo}HV............................................................................................................................................................................. 07
Conjunto de números: naturais, inteiros, racionais, irracionais, reais, operações, expressões (cálculo); .............................. 12
Matemática Financeira; Porcentagem; Juros Simples e Composto; ................................................................................................... 12
Regras de três simples e composta; ................................................................................................................................................................ 21
6LVWHPD0RQHWiULR1DFLRQDO 5HDO (TXDomRGHžJUDXUHVROXomR3UREOHPDVGHžJUDX,QHTXDo}HVGRžJUDX(TXD-
omRGHžJUDXUHVROXomRGDVHTXDo}HVFRPSOHWDVLQFRPSOHWDVSUREOHPDVGRžJUDX ...................................................... 28
(TXDo}HVIUDFLRQiULDV .......................................................................................................................................................................................... 28
Relação e Função: domínio, contradomínio e imagem; .......................................................................................................................... 33
)XQomRGRžJUDXIXQomRFRQVWDQWH ........................................................................................................................................................... 33
Razão e Proporção; ................................................................................................................................................................................................ 38
Grandezas Proporcionais; .................................................................................................................................................................................... 43
Expressões Algébricas; Fração Algébrica; ...................................................................................................................................................... 48
Sistemas de numeração; Operações no conjunto dos números naturais; Operações fundamentais com números racio-
nais; Múltiplos e divisores em N; Radiciação; Conjunto de números fracionários; Operações fundamentais com números
fracionários; Problemas com números fracionários; Números decimais; ......................................................................................... 50
Geometria Analítica; .............................................................................................................................................................................................. 51
Geometria Espacial; ............................................................................................................................................................................................... 56
Geometria Plana: Plano, Área, Perímetro, Ângulo, Reta, Segmento de Reta e Ponto; Teorema de Tales; Teorema de Pitá-
goras; ........................................................................................................................................................................................................................... 63
Noções de trigonometria; ................................................................................................................................................................................... 70
5HODomRHQWUHJUDQGH]DVWDEHODVHJUiÀFRV ............................................................................................................................................... 73
Progressão Aritmética (PA) e Progressão Geométrica (PG); .................................................................................................................. 77
Sistemas Lineares; .................................................................................................................................................................................................. 85
SUMÁRIO

Números complexos; ............................................................................................................................................................................................ 96


)XQomRH[SRQHQFLDOHTXDomRHLQHTXDomRH[SRQHQFLDO)XQomRORJDUtWPLFD .............................................................................. 98
Análise combinatória; ........................................................................................................................................................................................... 98
Probabilidade; .......................................................................................................................................................................................................... 99
Estatística; ................................................................................................................................................................................................................101
)XQomRGRžJUDX ..............................................................................................................................................................................................103
Trigonometria da 1ª volta: seno, cosseno, tangente, relação fundamental. ...................................................................................103

Fundamentos da Educação

Fundamentação, Finalidades e Conceituação da Educação Infantil, do Ensino Fundamental, Educação de Jovens e Adul-
WRVH(GXFDomR(VSHFLDOGHFRQIRUPLGDGHFRPD/'%(1 /HL)HGHUDOQž H3&1 3DUkPHWURV&XUULFXODUHV1D-
cionais); ........................................................................................................................................................................................................................ 01
)XQGDPHQWRV)LORVRÀDGD(GXFDomR.............................................................................................................................................................. 18
História da Educação, ............................................................................................................................................................................................. 19
Sociologia, .................................................................................................................................................................................................................. 24
Psicologia da Educação, ........................................................................................................................................................................................ 25
Didática e Metodologia do Ensino; .................................................................................................................................................................. 27
Processo de Avaliação do desempenho escolar como instrumento de acompanhamento do seu próprio trabalho e dos
avanços da aprendizagem; .................................................................................................................................................................................. 28
O trabalho coletivo como fator de aperfeiçoamento da prática docente; o uso de metodologias voltadas para práticas
inovadoras; ................................................................................................................................................................................................................. 33
3URFHVVRGH(VFRODUL]DomRVXFHVVRVHIUDFDVVRVHYDVmRH5HSHWrQFLDFDXVDVFRQVHTXrQFLDVHDOWHUQDWLYDV ................ 37
Escola inclusiva como espaço de acolhimento, de aprendizagem e de socialização; o conhecimento das identidades
nacionais, étnicos-raciais e diferenças culturais. ......................................................................................................................................... 37
0HGLDomRHJHVWmRGHFRQÁLWRV ........................................................................................................................................................................ 51
Questões Políticas Educacionais Brasileiras; e Gestão Educacional (Gestão Participativa e Participação Comunitária)..............52

Legislação

&RQVWLWXLomRGD5HS~EOLFD)HGHUDWLYDGR%UDVLOSURPXOJDGDHPGHRXWXEURGH$UWLJRVžDRDRH
artigo 60 das disposições Constitucionais Transitórias. ..............................................................................................................................................01
Emenda 14/96. ................................................................................................................................................................................................................................35
/HL)HGHUDOQžGHGHMXOKRGH²(VWDWXWRGD&ULDQoDHGR$GROHVFHQWH .............................................................................36
/HL)HGHUDOQžGHGHDJRVWRGH²1RYD/HLGDDGRomRHDVDOWHUDo}HVQR(&$ ..........................................................90
/HL)HGHUDOQžGHGHGH]HPEURGH/'%(1/HLGH'LUHWUL]HVH%DVHVGD(GXFDomR1DFLRQDO(PHQGD&RQV-
WLWXFLRQDOQž........................................................................................................................................................................................................................99
/HL)HGHUDOQžGHGHMXQKRGH3ODQR1DFLRQDOGH(GXFDomR31( ...............................................................................99
/HL)HGHUDOQžGH²$OWHUDD/HLPRGLÀFDGDSHOD/HLTXHHVWDEHOHFHDV'LUHWUL]HVH%DVHV
GD(GXFDomR1DFLRQDOSDUDLQFOXLUQRFXUUtFXORRÀFLDOGDUHGHGHHQVLQRDREULJDWRULHGDGHGDWHPiWLFD´+LVWyULDH&XOWXUD
$IUR%UDVLOHLUDH,QGtJHQDµ....................................................................................................................................................................................................115

Publicações Institucionais

BRASIL. Ministério da Educação. Secretaria de Educação Básica. Base Nacional Comum Curricular, 2017. .....................................01
BRASIL. Ministério da Educação. Secretaria de Educação Fundamental. Parâmetros Curriculares Nacionais. Brasília. MEC/SEF,
2000. (Volumes de I a X 1ª a 4ª série do Ensino Fundamental)...............................................................................................................................01
BRASIL. Ministério da Educação. Secretaria da Educação Fundamental. Parâmetros Curriculares Nacionais: Temas Transver-
sais. Brasília: MEC/SEF, 1998......................................................................................................................................................................................................01
BRASIL. Ministério da Educação. Secretaria de Educação Fundamental. Parâmetros Curriculares Nacionais: Adaptações Curricula-
UHV²HVWUDWpJLDVSDUDDHGXFDomRGHDOXQRVFRPQHFHVVLGDGHVHGXFDFLRQDLVHVSHFLDLV%UDVtOLD0(&6()6((63..................01
SUMÁRIO

BRASIL. Ministério da Educação. Secretaria Especial de Políticas de Promoção da Igualdade Racial. Diretrizes Curriculares
Nacionais para a Educação das relações Étnico-Raciais e para o Ensino de História e Cultura Afro-Brasileira e Africana. Brasília,
junho, 2005. ......................................................................................................................................................................................................................................01
BRASIL. Ministério da Educação. Secretaria de Educação Básica. Ensino fundamental de 9 anos: orientações para a inclusão
da criança de 6 anos de idade. Brasília: Ministério da Educação, Secretaria de Educação Básica, 2007. ...........................................12
PAULÍNIA. Secretaria Municipal de Educação. Currículo da Rede Municipal de Ensino de Paulínia- Educação Infantil. 2011 ..........12
3$8/Ì1,$6HFUHWDULD0XQLFLSDOGH(GXFDomR&XUUtFXORGD5HGH0XQLFLSDOGH(QVLQRGH3DXOtQLD(QVLQR)XQGDPHQWDO²DQRV
iniciais. 2011......................................................................................................................................................................................................................................13

Conhecimentos Pedagógicos

Currículo e cidadania: saberes voltados para o desenvolvimento de competências cognitivas, afetivas, sociais e culturais.............01
Escola inclusiva como espaço de acolhimento, de aprendizagem e de socialização. .................................................................................10
3HGDJRJLDVGLIHUHQFLDGDVSURJUHVVmRFRQWLQXDGDFRUUHomRGHÁX[RDYDOLDomRSRUFRPSHWrQFLDVÁH[LELOL]DomRGRFXUUtFXOR
e da trajetória escolar. ..................................................................................................................................................................................................................23
A construção coletiva da proposta pedagógica da escola: expressão das demandas sociais, das características multiculturais
e das expectativas dos alunos e dos pais. O trabalho coletivo como fator de aperfeiçoamento da prática docente.................26
O papel do professor na integração escola- família.....................................................................................................................................................30
$IRUPDomRFRQWLQXDGDFRPRFRQGLomRGHFRQVWUXomRSHUPDQHQWHGDVFRPSHWrQFLDVTXHTXDOLÀFDPDSUiWLFDGRFHQWH ..........33
O ensino centrado em conhecimentos contextualizados e ancorados na ação. ...........................................................................................36
O reforço e recuperação: parte integrante do processo de ensino e de aprendizagem............................................................................40
A relação professor-aluno: construção de valores éticos e desenvolvimento de atitudes cooperativas, solidárias e responsá-
veis. .......................................................................................................................................................................................................................................................50

5HIHUrQFLD%LEOLRJUiÀFD²3DUWH3HGDJyJLFD

3$5,$106LOYLD$(VFRODTXHQmRHQVLQDHVFUHYHU6mR3DXOR0RGHUQD .........................................................................................01
O construtivismo na sala de aula. São Paulo: Ática, 1996. .........................................................................................................................................01
)5(,5(3DXOR3HGDJRJLDGDDXWRQRPLD²6DEHUHVQHFHVViULRVjSUiWLFDHGXFDWLYD6mR3DXOR(G3D]H7HUUD .............04
*$5'1(5+RZDUG3(5.,16'DYLG3(5521(9LWRHFRODERUDGRUHV(QVLQRSDUDDFRPSUHHQVmR$SHVTXLVDQDSUiWLFD
Porto Alegre: Artmed, 2007. .....................................................................................................................................................................................................09
HOFFMANN, Jussara. Avaliar para promover: as setas do caminho. Porto Alegre: Mediação, 2001. .................................................17
LUCKESI, Cipriano Carlos - Avaliação de Aprendizagem escolar. São Paulo: Editora Cortez, 2002. ......................................................27
MACEDO, Lino de. Ensaios pedagógicos: Como construir uma escola para todos? Porto Alegre: Artmed, 2005. ......................32
0$172$10DULD7HUHVD(JOpU,QFOXVmRHVFRODU²2TXHp"3RUTXr"&RPRID]HU"(G0RGHUQD ........................................32
MANTOAN EGLER, Maria Teresa, SANTOS DOS TEIXEIRA, Maria Terezinha. Atendimento Educacional Especializado: Políticas
Públicas e Gestão nos Municípios. São Paulo. Ed Moderna, n/d. PATTO, Maria Helena Souza. A produção do fracasso escolar.
São Paulo. Ed. T.A. Queiroz, 1996. ..........................................................................................................................................................................................35
SASSAKI, R. K. Inclusão: construindo uma sociedade para todos. 5ª ed. Rio de Janeiro: WVA, 2003. .................................................35
SAVIANI, Demerval. Escola e Democracia. São Paulo: Autores Associados, 2008. ........................................................................................35
SEBER, M. G. Construção da inteligência pela criança. São Paulo: Scipione, 2002. ......................................................................................36
7$5',)0DXULFH6DEHUHVGRFHQWHVHIRUPDomRSURÀVVLRQDO3HWUySROLV9R]HV...............................................................................37
VYGOTSKY, L.S., Luria, A.R. Leontiev, A.N. Linguagem, Desenvolvimento e Aprendizagem. São Paulo: Ícone, 1988. ..................38
WEISZ, Telma, O diálogo entre o ensino e a aprendizagem. São Paulo, Editora Ática, 2000. ..................................................................39
ZABALA, Antoni. A prática educativa: como ensinar. Porto Alegre: Artmed, 1998........................................................................................47

5HIHUrQFLD%LEOLRJUiÀFD

BRASIL, Ministério da Educação e Cultura. Secretaria da Educação Básica. Pró-letramento Alfabetização e Linguagem. Progra-
ma de Formação Continuada de Professores dos Anos/Séries Iniciais do Ensino Fundamental, Brasília: SEB, 2007. http://portal.
mec.gov.br/publicacoes. .............................................................................................................................................................................................................01
SUMÁRIO

BRASIL, Ministério da Educação e Cultura. Secretaria da Educação Básica. Pró-letramento Matemática. Programa de Forma-
ção Continuada de Professores dos Anos/Séries Iniciais do Ensino Fundamental, Brasília: SEB, 2007. http://portal.mec.gov.br/
publicacoes. ......................................................................................................................................................................................................................................01
CAGLIARI, Luiz Carlos. Alfabetização & linguística. São Paulo: Scipione, 1991. ..............................................................................................01
&2/(//2*$63$5,$106LOYLD$(VFRODTXHQmRHQVLQDHVFUHYHU6mR3DXOR0RGHUQD ...........................................................02
'2/=-H6&+1(8:/<%*rQHURVHSURJUHVVmRHPH[SUHVVmRRUDOHHVFULWD(OHPHQWRVSDUDUHÁH[}HVVREUHXPDH[SHULrQ-
FLDVXtoD IUDQFyIRQD ,Q´*rQHURVRUDLVHHVFULWRVQDHVFRODµ&DPSLQDV 63 0HUFDGRGH/HWUDV.........................................02
FERREIRO, Emília. Psicogênese da língua escrita. Porto Alegre: Artes Médicas, 1988. ................................................................................14
)(55(,52(5HÁH[}HVVREUHDOIDEHWL]DomR6mR3DXOR&RUWH]$XWRUHV$VVRFLDGRV ....................................................................15
)5(,5(3DXOR$LPSRUWkQFLDGRDWRGHOHUHPWUrVDUWLJRVTXHVHFRPSOHWDP(G6mR3DXOR&RUWH] .....................15
KLEIMAN, Ângela B. Preciso ensinar o letramento? Não basta ensinar a ler e escrever? Campinas: CEFIEL/UNICAMP, 2005. ................20
/(51(5'HOLD3,=$1,$OLFLD3$DSUHQGL]DJHPGDOtQJXDHVFULWDQDHVFRODUHÁH[}HVVREUHDSUiWLFDSHGDJyJLFDFRQVWUXWL-
vista. Porto Alegre: Artes Médicas, 1995. ...........................................................................................................................................................................21
/(51(5'HOLD/HUH(VFUHYHUQDHVFROD²RUHDORSRVVtYHOHRQHFHVViULR3RUWR$OHJUH$UWPHG ........................................23
0$57,16-RmR/XLV48(,52=7DQLD'LDV3HGDJRJLD/~GLFD²-RJRVHEULQFDGHLUDVGH$D=6mR3DXOR(G5LGHHO ..........28
MANTOAN EGLER, Maria Teresa, SANTOS DOS TEIXEIRA, Maria Terezinha. Atendimento Educacional Especializado: Políticas
Públicas e Gestão nos Municípios. São Paulo. Ed Moderna, n/d. ..........................................................................................................................29
PATTO, Maria Helena Souza. A produção do fracasso escolar. São Paulo. Ed. T.A. Queiroz, 1996. ........................................................29
VASCONCELLOS, Celso dos Santos. (In)Disciplina: Construção da Disciplina Consciente e Interativa em Sala de Aula e na Es-
cola. São Paulo: Libertad, 1994................................................................................................................................................................................................29
SMOLE, K. S.; DINIZ, M. I. (org.) Ler, escrever e resolver problemas: habilidades básicas para aprender matemática. Porto Ale-
gre: Artmed, 2001. .........................................................................................................................................................................................................................29
SMOLKA, Ana Luíza B. A criança na fase inicial da escrita: a alfabetização como processo discursivo. 2 ed., São Paulo: Cortez/
Campinas: Editora da Unicamp, 1989. .................................................................................................................................................................................31
SOARES, Magda. Alfabetização e letramento. São Paulo: Contexto, 2003........................................................................................................33
SOLÉ, Isabel. Estratégias de leitura. Porto Alegre: Artmed, 1999. ..........................................................................................................................34
=81,12'HOLD/HUQHU$0DWHPiWLFDQDHVFRODDTXLHDJRUD3RUWR$OHJUH$UWHV0pGLFDV.....................................................41
LÍNGUA PORTUGUESA

2UWRJUDÀD(VWUXWXUDH)RUPDomRGDVSDODYUDV'LYLVmR6LOiELFD9RJDLV6HPLYRJDLV*rQHUR1~PHUR)UDVHV6LQDLVGH
3RQWXDomR$FHQWXDomR)RQpWLFDHIRQRORJLD&RQFHLWRVEiVLFRV&ODVVLÀFDomRGRVIRQHPDV5HODomRHQWUHSDODYUDV8VR
GDFUDVHVLQ{QLPRVKRP{QLPRVHDQW{QLPRV)RQHPDVHOHWUDV6XEVWDQWLYR$GMHWLYR$UWLJR1XPHUDO$GYpUELR9HUERV
&RQMXJDomRGHYHUERV3URQRPHV3UHSRVLomR&RQMXQomR,QWHUMHLomR(QFRQWURVYRFiOLFRV(QFRQWURVFRQVRQDQWDLVHGt-
JUDIR7RQLFLGDGHGDVSDODYUDV6tODEDW{QLFD6XMHLWRHSUHGLFDGR)RUPDVQRPLQDLV/RFXo}HVYHUEDLV7HUPRVOLJDGRVDR
YHUER$GMXQWRDGYHUELDO$JHQWHGD3DVVLYD2EMHWRGLUHWRHLQGLUHWR9R]HV9HUEDLV7HUPRV(VVHQFLDLVGD2UDomR7HUPRV
,QWHJUDQWHVGD2UDomR7HUPRV$FHVVyULRVGD2UDomR2UDo}HV&RRUGHQDGDVH6XERUGLQDGDV3HUtRGR&RQFRUGkQFLDQR-
PLQDO&RQFRUGkQFLDYHUEDO5HJrQFLDYHUEDO9R]HVYHUEDLV5HJrQFLDQRPLQDO3UHGLFDomRYHUEDO$SRVWR9RFDWLYR'HUL-
YDomRH&RPSRVLomR8VRGRKtIHQ9R]DWLYD9R]SDVVLYD9R]UHÁH[LYD)XQo}HVH(PSUHJRVGDVSDODYUDV´TXHµH´VHµ8VR
GR´3RUTXrµ3UHÀ[RV6XÀ[RV$À[RV5DGLFDLV)RUPDVYHUEDLVVHJXLGDVGHSURQRPHV)OH[mRQRPLQDOHYHUEDO(PSUHJR
GHORFXo}HV6LQWD[HGH&RQFRUGkQFLD6LQWD[HGH5HJrQFLD6LQWD[HGH&RORFDomR&RPSDUDo}HV&ULDomRGHSDODYUDV8VR
GRWUDYHVVmR'LVFXUVRGLUHWRHLQGLUHWR,PDJHQV3HVVRDGRGLVFXUVR5HODo}HVHQWUHQRPHHSHUVRQDJHP+LVWyULDHP
TXDGULQKRV5HODomRHQWUHLGHLDV,QWHQVLÀFDo}HV3HUVRQLÀFDomR2SRVLomR3URYpUELRV'LVFXUVRGLUHWR2QRPDWRSHLDV
$OLWHUDomR$VVRQkQFLD5HSHWLo}HV5HODo}HV([SUHVV}HVDRSpGDOHWUD3DODYUDVHLOXVWUDo}HV0HWiIRUD$VVRFLDomRGH
LGHLDV'HQRWDomRH&RQRWDomR(XIHPLVPR+LSpUEROH,URQLD3URVRSRSHLD&DWDFUHVH3DUDGR[R0HWRQtPLD(OLSVH3OHR-
QDVPR6LOHSVH$QWtWHVH6LQHVWHVLD9tFLRVGH/LQJXDJHP01
$1É/,6(&2035((16®2(,17(535(7$d®2'(7(;727LSRVGH&RPXQLFDomR'HVFULomR1DUUDomR'LVVHUWDomR7LSRV
GH'LVFXUVR&RHVmR7H[WXDO93
LÍNGUA PORTUGUESA

ORTOGRAFIA; ESTRUTURA E FORMAÇÃO DAS PALAVRAS; DIVISÃO SILÁBICA; VOGAIS;


SEMIVOGAIS; GÊNERO, NÚMERO; FRASES; SINAIS DE PONTUAÇÃO; ACENTUAÇÃO; FONÉTICA
E FONOLOGIA: CONCEITOS BÁSICOS; CLASSIFICAÇÃO DOS FONEMAS; RELAÇÃO ENTRE
PALAVRAS; USO DA CRASE; SINÔNIMOS, HOMÔNIMOS E ANTÔNIMOS; FONEMAS E LETRAS;
SUBSTANTIVO; ADJETIVO; ARTIGO; NUMERAL; ADVÉRBIO; VERBOS; CONJUGAÇÃO DE
VERBOS; PRONOMES; PREPOSIÇÃO; CONJUNÇÃO; INTERJEIÇÃO; ENCONTROS VOCÁLICOS;
ENCONTROS CONSONANTAIS E DÍGRAFO; TONICIDADE DAS PALAVRAS; SÍLABA TÔNICA;
SUJEITO E PREDICADO; FORMAS NOMINAIS; LOCUÇÕES VERBAIS; TERMOS LIGADOS AO VERBO:
ADJUNTO ADVERBIAL, AGENTE DA PASSIVA, OBJETO DIRETO E INDIRETO, VOZES VERBAIS;
TERMOS ESSENCIAIS DA ORAÇÃO; TERMOS INTEGRANTES DA ORAÇÃO; TERMOS ACESSÓRIOS
DA ORAÇÃO; ORAÇÕES COORDENADAS E SUBORDINADAS; PERÍODO; CONCORDÂNCIA
NOMINAL; CONCORDÂNCIA VERBAL; REGÊNCIA VERBAL; VOZES VERBAIS; REGÊNCIA
NOMINAL; PREDICAÇÃO VERBAL; APOSTO; VOCATIVO; DERIVAÇÃO E COMPOSIÇÃO; USO DO
HÍFEN; VOZ ATIVA; VOZ PASSIVA; VOZ REFLEXIVA; FUNÇÕES E EMPREGOS DAS PALAVRAS
“QUE” E “SE”; USO DO “PORQUÊ”; PREFIXOS; SUFIXOS; AFIXOS; RADICAIS; FORMAS VERBAIS
SEGUIDAS DE PRONOMES; FLEXÃO NOMINAL E VERBAL; EMPREGO DE LOCUÇÕES; SINTAXE DE
CONCORDÂNCIA; SINTAXE DE REGÊNCIA; SINTAXE DE COLOCAÇÃO; COMPARAÇÕES; CRIAÇÃO
DE PALAVRAS; USO DO TRAVESSÃO; DISCURSO DIRETO E INDIRETO; IMAGENS; PESSOA DO
DISCURSO; RELAÇÕES ENTRE NOME E PERSONAGEM; HISTÓRIA EM QUADRINHOS; RELAÇÃO
ENTRE IDEIAS; INTENSIFICAÇÕES; PERSONIFICAÇÃO; OPOSIÇÃO; PROVÉRBIOS; DISCURSO
DIRETO; ONOMATOPEIAS; ALITERAÇÃO; ASSONÂNCIA; REPETIÇÕES; RELAÇÕES; EXPRESSÕES
AO PÉ DA LETRA; PALAVRAS E ILUSTRAÇÕES; METÁFORA; ASSOCIAÇÃO DE IDEIAS. DENOTAÇÃO
E CONOTAÇÃO; EUFEMISMO; HIPÉRBOLE;IRONIA; PROSOPOPEIA; CATACRESE; PARADOXO;
METONÍMIA; ELIPSE; PLEONASMO; SILEPSE; ANTÍTESE; SINESTESIA; VÍCIOS DE LINGUAGEM.

ORTOGRAFIA

$RUWRJUDÀDpDSDUWHGDOtQJXDUHVSRQViYHOSHODJUDÀDFRUUHWDGDVSDODYUDV(VVDJUDÀDEDVHLDVHQRSDGUmRFXOWRGD
OtQJXD
$VSDODYUDVSRGHPDSUHVHQWDULJXDOGDGHWRWDORXSDUFLDOQRTXHVHUHIHUHDVXDJUDÀDHSURQ~QFLDPHVPRWHQGRVLJ-
QLÀFDGRVGLIHUHQWHV(VVDVSDODYUDVVmRFKDPDGDVGHhomônimas FDQWRGRJUHJRVLJQLÀFDkQJXORFDQWRGRODWLPVLJ-
QLÀFDP~VLFDYRFDO $VSDODYUDVKRP{QLPDVGLYLGHPVHHPhomógrafasTXDQGRWrPDPHVPDJUDÀD gostoVXEVWDQWLYRH
gostoSHVVRDGRVLQJXODUGRYHUERJRVWDU HhomófonasTXDQGRWrPRPHVPRVRP paço, palácio ou passoPRYLPHQWR
GXUDQWHRDQGDU 
4XDQWRjJUDÀDFRUUHWDHPOtQJXDSRUWXJXHVDGHYHPVHREVHUYDUDVVHJXLQWHVUHJUDV

O fonema s:

Escreve-se com S e não com C/ÇDVSDODYUDVVXEVWDQWLYDGDVGHULYDGDVGHYHUERVFRPUDGLFDLVHPQGUJUWSHOFRUUH


VHQWpretender - pretensão / expandir - expansão / ascender - ascensão / inverter - inversão / aspergir aspersão / submergir -
submersão / divertir - diversão / impelir - impulsivo / compelir - compulsório / repelir - repulsa / recorrer - recurso / discorrer
- discurso / sentir - sensível / consentir - consensual

Escreve-se com SS e não com C e Ç RVQRPHVGHULYDGRVGRVYHUERVFXMRVUDGLFDLVWHUPLQHPHPJUHGFHGSULPRXFRP


YHUERVWHUPLQDGRVSRUWLURXPHWHUagredir - agressivo / imprimir - impressão / admitir - admissão / ceder - cessão / exceder -
excesso / percutir - percussão / regredir - regressão / oprimir - opressão / comprometer - compromisso / submeter - submissão
TXDQGRRSUHÀ[RWHUPLQDFRPYRJDOTXHVHMXQWDFRPDSDODYUDLQLFLDGDSRU´Vµ([HPSORVa + simétrico - assimétrico
/ re + surgir - ressurgir
QRSUHWpULWRLPSHUIHLWRVLPSOHVGRVXEMXQWLYR([HPSORVÀFDVVHIDODVVH

Escreve-se com C ou Ç e não com S e SS RVYRFiEXORVGHRULJHPiUDEHcetim, açucena, açúcar


RVYRFiEXORVGHRULJHPWXSLDIULFDQDRXH[yWLFDcipó, Juçara, caçula, cachaça, cacique
RVVXÀ[RVDoDDoRDomRoDUHFHULoDQoDXoDXoXXoRbarcaça, ricaço, aguçar, empalidecer, carniça, caniço, esperan-
ça, carapuça, dentuço

1
LÍNGUA PORTUGUESA

QRPHV GHULYDGRV GR YHUER WHU abster - abstenção / O fonema ch:


deter - detenção / ater - atenção / reter - retenção
DSyVGLWRQJRVfoice, coice, traição Escreve-se com X e não com CH:
SDODYUDVGHULYDGDVGHRXWUDVWHUPLQDGDVHPWHWR U  DVSDODYUDVGHRULJHPWXSLDIULFDQDRXH[yWLFDaba-
marte - marciano / infrator - infração / absorto - absorção caxi, muxoxo, xucro.
DV SDODYUDV GH RULJHP LQJOHVD VK  H HVSDQKROD - 
O fonema z: xampu, lagartixa.
GHSRLVGHGLWRQJRfrouxo, feixe
Escreve-se com S e não com Z: GHSRLVGH´HQµenxurrada, enxoval.
RVVXÀ[RVrVHVDHVLDHLVDTXDQGRRUDGLFDOpVXEV-
WDQWLYR RX HP JHQWtOLFRV H WtWXORV QRELOLiUTXLFRV: freguês, Observação  ([FHomR TXDQGR D SDODYUD GH RULJHP
freguesa, freguesia, poetisa, baronesa, princesa, HWF QmRGHULYHGHRXWUDLQLFLDGDFRPch - Cheio - (enchente)
RVVXÀ[RVJUHJRVDVHHVHLVHHRVHcatequese, me-
Escreve-se com CH e não com X:
tamorfose
DV SDODYUDV GH RULJHP HVWUDQJHLUD Fhave, chumbo,
DVIRUPDVYHUEDLVS{UHTXHUHUpôs, pus, quisera, quis,
chassi, mochila, espadachim, chope, sanduíche, salsicha.
quiseste.
QRPHVGHULYDGRVGHYHUERVFRPUDGLFDLVWHUPLQDGRV
As letras e e i:
HP ´Gµ aludir - alusão / decidir - decisão / empreender -
empresa / difundir - difusão RVGLWRQJRVQDVDLVVmRHVFULWRVFRP´Hµmãe, põem
RVGLPLQXWLYRVFXMRVUDGLFDLVWHUPLQDPFRP´VµLuís - &RP´LµVyRGLWRQJRLQWHUQRcãibra
Luisinho / Rosa - Rosinha / lápis - lapisinho RVYHUERVTXHDSUHVHQWDPLQÀQLWLYRHPRDUXDUVmR
DSyVGLWRQJRVcoisa, pausa, pouso HVFULWRV FRP ´Hµcaçoe, tumultue (VFUHYHPRV FRP ´Lµ RV
HP YHUERV GHULYDGRV GH QRPHV FXMR UDGLFDO WHUPLQD YHUERVFRPLQÀQLWLYRHPDLURHUHXLUtrai, dói, possui
FRP´Vµanális(e) + ar - analisar / pesquis(a) + ar - pesquisar  DWHQomR SDUD DV SDODYUDV TXH PXGDP GH VHQWLGR
TXDQGRVXEVWLWXtPRVDJUDÀD´HµSHODJUDÀD´Lµárea (su-
Escreve-se com Z e não com S: perfície), ária (melodia) / delatar (denunciar), dilatar (expan-
RVVXÀ[RV´H]µH´H]DµGDVSDODYUDVGHULYDGDVGHDGMH- dir) / emergir (vir à tona), imergir (mergulhar) / peão (de
WLYRmacio - maciez / rico - riqueza estância, que anda a pé), pião (brinquedo).
RV VXÀ[RV ´L]DUµ GHVGH TXH R UDGLFDO GD SDODYUD GH
RULJHPQmRWHUPLQHFRPV ÀQDOÀQDOL]DUFRQFUHWRFRQ- )RQWH
cretizar KWWSZZZSFLFRQFXUVRVFRPEUDXODVSRUWXJXHVRU-
FRPRFRQVRDQWHGHOLJDomRVHRUDGLFDOQmRWHUPLQDU WRJUDÀD
FRPVSpLQKRSH]LQKRFDIpDOFDIH]DOOiSLV
inho - lapisinho 4XHVW}HVVREUH2UWRJUDÀD

O fonema j:  (VFUHYHQWH7-63²9XQHVS $VVLQDOHDDOWHU-


QDWLYDTXHSUHHQFKHFRUUHWDHUHVSHFWLYDPHQWHDVODFXQDV
Escreve-se com G e não com J: GRWUHFKRDVHJXLUGHDFRUGRFRPDQRUPDSDGUmR
DV SDODYUDV GH RULJHP JUHJD RX iUDEHtigela, girafa, Além disso, ___certamente ____entre nós ____do fenôme-
gesso no da corrupção e das fraudes
HVWUDQJHLULVPRFXMDOHWUD*pRULJLQiULDsargento, gim $ D¬FRQFHQVR¬DFHUFD
% Ki¬FRQVHQVR¬DFHUFD
DV WHUPLQDo}HV DJHP LJHP XJHP HJH RJH FRP
& D¬FRQFHQVR¬DFHUFD
SRXFDVH[FHo}HV imagem, vertigem, penugem, bege, foge.
' D¬FRQVHQVR¬KiFHUFD
( Ki¬FRQVHQoR¬DFHUFD
Observação([FHomRpajem
DVWHUPLQDo}HViJLRpJLRtJLRyJLRXJLRsortilégio,  (VFUHYHQWH7-63²9XQHVS $VVLQDOHDDOWHU-
litígio, relógio, refúgio. QDWLYDFXMDVSDODYUDVVHDSUHVHQWDPÁH[LRQDGDVGHDFRUGR
RVYHUERVWHUPLQDGRVHPJHUHJLUeleger, mugir FRPDQRUPDSDGUmR
GHSRLVGDOHWUD´UµFRPSRXFDVH[FHo}HVemergir, sur- $ 2VWDEHOLmRVGHYHPSUHSDUDURGRFXPHQWR
gir % (VVHVFLGDG}HVWLQKDPDXWRUL]DomRSDUDSRUWDUIX]LV
GHSRLVGDOHWUD´DµGHVGHTXHQmRVHMDUDGLFDOWHUPL- & 3DUDDXWHQWLFDUDVFHUWLGmRVSURFXUHRFDUWyULROR-
QDGRFRPMágil, agente FDO
' $RGHVFHUHVXELUHVFDGDVVHJXUHVHQRVFRUULPmRV
Escreve-se com J e não com G: ( &XLGDGRFRPRVGHJUDLVTXHVmRSHULJRVRV
DVSDODYUDVGHRULJHPODWLQDVjeito, majestade, hoje
DV SDODYUDV GH RULJHP iUDEH DIULFDQD RX H[yWLFD ji-  $JHQWH GH 9LJLOkQFLD H 5HFHSomR ² 981(63 ²
boia, manjerona.  6XSRQKDVHTXHRFDUWD]DVHJXLUVHMDXWLOL]DGRSDUD
DVSDODYUDVWHUPLQDGDFRPDMHaje, ultraje. LQIRUPDURVXVXiULRVVREUHRIHVWLYDO6RXQGHUJURXQG

2
LÍNGUA PORTUGUESA

Prezado Usuário &  ,1&2 0,18726 jV YH]HV GXUD PDLV PDV QmR D
________ de oferecer lazer e cultura aos passageiros do PDWHPSRULVVR
metrô, ________ desta segunda-feira (25/02), ________ 17h30, ' ,1&20,18726DVYH]HVGXUDPDLVPDVQmROKH
começa o Sounderground, festival internacional que presti- PDWHPSRULVVR
gia os músicos que tocam em estações do metrô. (  ,1&2 0,18726 jV YH]HV GXUD PDLV PDV QmR D
&RQÀUDRGLDHDHVWDomRHPTXHRVDUWLVWDVVHDSUHVHQ- PDWHPSRULVVR
WDUmRHGLYLUWDVH
3DUD TXH R WH[WR DWHQGD j QRUPDSDGUmR GHYHPVH GABARITO
SUHHQFKHU DV ODFXQDV FRUUHWD H UHVSHFWLYDPHQWH FRP DV
H[SUHVV}HV 01. B 02. D 03. C 04. C 05. B 06. C
$ $ÀPDSDUWLUDV
% $ÀPjSDUWLUjV RESOLUÇÃO
& $ÀPDSDUWLUjV
' $ÀPDSDUWLUjV   2 H[HUFtFLR TXHU D DOWHUQDWLYD TXH DSUHVHQWD FRU-
( $ÀPjSDUWLUDV UHomRRUWRJUiÀFD1DSULPHLUDODFXQDXWLOL]DUHPRV´KiµMi
TXH HVWi HPSUHJDGR QR VHQWLGR GH ´H[LVWLUµ QD VHJXQGD
 $VVLQDOH D DOWHUQDWLYD TXH QmR DSUHVHQWD HUUR GH ´FRQVHQVRµ FRP ´Vµ QD WHUFHLUD ´DFHUFDµ VLJQLÀFD ´D UHV-
RUWRJUDÀD SHLWRGHµRTXHVHHQFDL[DSHUIHLWDPHQWHQRFRQWH[WR´+i
$ (ODLQWHUURPSHXDUHXQLmRGHUUHSHQWH FHUFDµ WHPFHUFD GHDUDPHFHUFDYLYDHQÀP ´DFHUFDµ
% 2JRYHUQDGRUSRGHUiWHUVHXPDQGDWRFDoDGR DFHUFDHVWiGHVWUXtGD DUDPHPDGHLUD
& 2VHVSHFWDGRUHVDSODXGLUDPRPLQLVWUR
' 6DLXFRPGHVFULomRGDVDOD  
$ 2VWDEHOLmRVGHYHPSUHSDUDURGRFXPHQWR WD-
(PTXDOGDVDOWHUQDWLYDVDIUDVHHVWiFRUUHWDPHQWH EHOLmHV
% (VVHVFLGDG}HVWLQKDPDXWRUL]DomRSDUDSRUWDUIX]LV
HVFULWD"
FLGDGmRV
$  2 PLQGLQJR QmR GHSRVLWRX QD FDUGHQHWD GH SRX-
& 3DUDDXWHQWLFDUDVFHUWLGmRVSURFXUHRFDUWyULROR-
SDQVD
FDO FHUWLG}HV
% 2PHQGLJRQmRGHSRVLWRXQDFDGHUQHWDGHSRXSDQ-
( &XLGDGRFRPRVGHJUDLVTXHVmRSHULJRVRV GH-
oD
JUDXV
& 2PLQGLJRQmRGHSR]LWRXQDFDUGHQHWDGHSRXSDQV-
VD
 3UH]DGR8VXiULR
' 2PHQGLQJRQmRGHSR]LWRXQDFDUGHUQHWDGHSRX-
$ ÀP GH RIHUHFHU OD]HU H FXOWXUD DRV SDVVDJHLURV GR
SDQVD PHWU{DSDUWLUGHVWDVHJXQGDIHLUD  jVKFR-
PHoDR6RXQGHUJURXQGIHVWLYDOLQWHUQDFLRQDOTXHSUHVWLJLD
 75,%81$/'(-867,d$'2(67$'2'(6®23$8- RVP~VLFRVTXHWRFDPHPHVWDo}HVGRPHWU{
/2 ² $'92*$'2  981(63  $QDOLVH D SURSDJDQGD &RQÀUDRGLDHDHVWDomRHPTXHRVDUWLVWDVVHDSUHVHQ-
GRSURJUDPDLQFR0LQXWRV WDUmRHGLYLUWDVH
$ ÀP  LQGLFD ÀQDOLGDGH D SDUWLU VHPSUH VHSDUDGR
DQWHVGHKRUDVKiFUDVH

 
$ (ODLQWHUURPSHXDUHXQLmRGHUUHSHQWH GHUHSHQWH
% 2JRYHUQDGRUSRGHUiWHUVHXPDQGDWRFDoDGR 
FDVVDGR
' 6DLXFRPGHVFULomRGDVDOD GLVFULomR

 
$  2 PLQGLQJR QmR GHSRVLWRX QD FDUGHQHWD GH SRX-
SDQVD PHQGLJRFDGHUQHWDSRXSDQoD
& 2PLQGLJRQmRGHSR]LWRXQDFDUGHQHWDGHSRXSDQV-
VD PHQGLJRFDGHUQHWDSRXSDQoD
' 2PHQGLQJRQmRGHSR]LWRXQDFDUGHUQHWDGHSRX-
(P QRUPDSDGUmR GD OtQJXD SRUWXJXHVD D IUDVH GD SDQVD PHQGLJRGHSRVLWRXFDGHUQHWDSRXSDQoD
SURSDJDQGDDGDSWDGDDVVXPHDVHJXLQWHUHGDomR
$ ,1&20,18726jVYH]HVGXUDPDLVPDVQmRPD-   $ TXHVWmR HQYROYH FRORFDomR SURQRPLQDO H RUWR-
WHPQDSRULVVR JUDÀD &RPHFHPRV SHOD PDLV IiFLO RUWRJUDÀD $ SDODYUD
% ,1&20,18726DVYH]HVGXUDPDLVPDVQmRPD- ´SRULVVRµpHVFULWDVHSDUDGDPHQWH$VVLPMiGHVFDUWDPRV
WHPQDSRULVVR GXDVDOWHUQDWLYDV ´$µH´(µ 4XDQWRjFRORFDomRSURQRPL-

3
LÍNGUA PORTUGUESA

QDOWHPRVDSUHVHQoDGRDGYpUELR´QmRµTXHVDEHPRVVHU 1DVIRUPDo}HVHPTXHRSUHÀ[RWHPFRPRVHJXQ-
XP´tPmµSDUDRSURQRPHREOtTXRID]HQGRQRVDSOLFDUD GR WHUPR XPD SDODYUD LQLFLDGD SRU ´Kµsub-hepático, ele-
UHJUDGDSUyFOLVH SURQRPHDQWHVGRYHUER (QWmRDIRU- tro-higrómetro, geo-história, neo-helênico, extra-humano,
PDFRUUHWDp´PDVQmR$PDWHPµ SRUTXH$HQmR/+(" semi-hospitalar, super- -homem.
3RUTXH TXHP PDWD PDWD DOJR RX DOJXpP REMHWR GLUHWR
2´OKHµpXVDGRSDUDREMHWRLQGLUHWR6HQmRWLYpVVHPRVD 1DVIRUPDo}HVHPTXHRSUHÀ[RRXSVHXGRSUHÀ[R
FRQMXQomR´PDVµQHPRDGYpUELR´QmRµDIRUPD´PDWHP WHUPLQDQDPHVPDYRJDOGRVHJXQGRHOHPHQWRmicro-on-
QDµHVWDULDFRUUHWDMiTXHDSyVYtUJXODRLGHDOpTXHXWLOL- das, eletro-ótica, semi-interno, auto-observação,HWF
]HPRVrQFOLVH²SURQRPHREOtTXRDSyVRYHUER 
Obs2KtIHQpVXSULPLGRTXDQGRSDUDIRUPDURXWURV
2 hífen p XP VLQDO GLDFUtWLFR TXH GLVWLQJXH  XVDGR WHUPRVreaver, inábil, desumano, lobisomem, reabilitar
SDUDOLJDURVHOHPHQWRVGHSDODYUDVFRPSRVWDV FRXYHÁRU
ex-presidente HSDUDXQLUSURQRPHViWRQRVDYHUERV ofe- - Lembre-seDRVHSDUDUSDODYUDVQDWUDQVOLQHDomR PX-
receram-me; vê-lo-ei  GDQoDGHOLQKD FDVRD~OWLPDSDODYUDDVHUHVFULWDVHMDIRU-
6HUYH LJXDOPHQWH SDUD ID]HU D WUDQVOLQHDomR GH SDOD- PDGDSRUKtIHQUHSLWDRQDSUy[LPDOLQKD([HPSORHVFUH-
YUDVLVWRpQRÀPGHXPDOLQKDVHSDUDUXPDSDODYUDHP YHUHLDQWLLQÁDPDWyULRHDRÀQDOFRXEHDSHQDV´DQWLµ1D
GXDVSDUWHV ca-/sa; compa-/nheiro  OLQKD GHEDL[R HVFUHYHUHL ´LQÁDPDWyULRµ KtIHQ HP DPEDV
 DVOLQKDV 
Uso do hífen que continua depois da Reforma Or-
WRJUiÀFD Não se emprega o hífen:

(PSDODYUDVFRPSRVWDVSRUMXVWDSRVLomRTXHIRUPDP  1DV IRUPDo}HV HP TXH R SUHÀ[R RX IDOVR SUHÀ[R
XPDXQLGDGHVHPkQWLFDRXVHMDQRVWHUPRVTXHVHXQHP WHUPLQD HP YRJDO H R VHJXQGR WHUPR LQLFLDVH HP ´Uµ RX
SDUDIRUPDPXPQRYRVLJQLÀFDGRtio-avô, porto-alegrense, ´Vµ1HVVHFDVRSDVVDVHDGXSOLFDUHVWDVFRQVRDQWHVantir-
luso-brasileiro, tenente-coronel, segunda-feira, conta-gotas, religioso, contrarregra, infrassom, microssistema, minissaia,
guarda-chuva, arco- -íris, primeiro-ministro, azul-escuro. PLFURUUDGLRJUDÀDHWF

 (P SDODYUDV FRPSRVWDV SRU HVSpFLHV ERWkQLFDV H 1DVFRQVWLWXLo}HVHPTXHRSUHÀ[RRXSVHXGRSUH-


]RROyJLFDV FRXYHÁRU EHPWHYL EHPPHTXHU DEyERUD À[R WHUPLQD HP YRJDO H R VHJXQGR WHUPR LQLFLDVH FRP
menina, erva-doce, feijão-verde. YRJDOGLIHUHQWHantiaéreo, extraescolar, coeducação, autoes-
trada, autoaprendizagem, hidroelétrico, plurianual, autoes-
1RVFRPSRVWRVFRPHOHPHQWRVDOpPDTXpPUHFpP cola, infraestrutura,HWF
HVHPalém-mar, recém-nascido, sem-número, recém-casa-
GRDTXpPÀDUHWF  1DV IRUPDo}HV HP JHUDO TXH FRQWrP RV SUHÀ[RV
´GrVµH´LQµHRVHJXQGRHOHPHQWRSHUGHXRKLQLFLDOdesu-
1RJHUDODVORFXo}HVQmRSRVVXHPKtIHQPDVDOJX- mano, inábil, desabilitar,HWF
PDVH[FHo}HVFRQWLQXDPSRUMiHVWDUHPFRQVDJUDGDVSHOR
XVRcor- -de-rosa, arco-da-velha, mais-que-perfeito, pé- 1DVIRUPDo}HVFRPRSUHÀ[R´FRµPHVPRTXDQGR
de-meia, água-de- -colônia, queima-roupa, deus-dará. R VHJXQGR HOHPHQWR FRPHoDU FRP ´Rµ cooperação, coo-
brigação, coordenar, coocupante, coautor, coedição, coexistir,
1RVHQFDGHDPHQWRVGHYRFiEXORVFRPRponte Rio- HWF
Niterói, percurso Lisboa-Coimbra-PortoHQDVFRPELQDo}HV
KLVWyULFDVRXRFDVLRQDLVÁustria-Hungria, Angola-Brasil, Al- (PFHUWDVSDODYUDVTXHFRPRXVRDGTXLULUDPQRomR
sácia-LorenaHWF GHFRPSRVLomRpontapé, girassol, paraquedas, paraquedis-
taHWF
1DVIRUPDo}HVFRPRVSUHÀ[RVKLSHULQWHUHVX- (PDOJXQVFRPSRVWRVFRPRDGYpUELR´EHPµbenfei-
SHU TXDQGR DVVRFLDGRV FRP RXWUR WHUPR TXH p LQLFLDGR to, benquerer, benquerido,HWF
SRUUhiper-resistente, inter-racial, super-racional,HWF
Questões sobre Hífen
1DVIRUPDo}HVFRPRVSUHÀ[RVH[YLFHex-diretor,
ex- -presidente, vice-governador, vice-prefeito. $VVLQDOH D DOWHUQDWLYD HP TXH R KtIHQ FRQIRUPH R
QRYR$FRUGRHVWiVHQGRXVDGRFRUUHWDPHQWH
 1DV IRUPDo}HV FRP RV SUHÀ[RV SyV SUp H SUy $ (OHIH]VXDDXWRFUtWLFDRQWHP
pré-natal, pré-escolar, pró-europeu, pós-graduação, HWF % (ODpPXLWRPDOHGXFDGD
& (OHWRPRXXPEHORSRQWDSp
1DrQFOLVHHPHVyFOLVHamá-lo, deixá-lo, dá-se, abra- ' )XLDRVXSHUPHUFDGRPDVQmRHQWUHL
ça-o, lança-o e amá-lo-ei, falar-lhe-ei, HWF ( 2VUDLRVLQIUDYHUPHOKRVDMXGDPHPOHV}HV

4
LÍNGUA PORTUGUESA

$VVLQDOHDDOWHUQDWLYDHUUDGDTXDQWRDRHPSUHJRGR E 8VDVHRKtIHQQRVFRPSRVWRVTXHGHVLJQDPHVSp-
KtIHQ FLHVDQLPDLVHERWkQLFDV QRPHVGHSODQWDVÁRUHVIUXWRV
$  3HOR LQWHUIRQH HOH FRPXQLFRX EHPKXPRUDGR TXH UDt]HVVHPHQWHV WHQKDPRXQmRHOHPHQWRVGHOLJDomR
IDULDXPDVXSHUDOLPHQWDomR F 1mRVHXVDRKtIHQHPFRPSRVWRVTXHDSUHVHQWDP
% 1DVFLUFXQYL]LQKDQoDVKiXPDFDVDPDODVVRPEUDGD HOHPHQWRVGHOLJDomR
& 'HSRLVGHFRPHUDVREUHFR[DWRPRXXPDQWLiFLGR
'  1RVVRV DQWHSDVVDGRV UHDOL]DUDP YiULRV DQWHSURMH-  )H]XPHVIRUoRVREUHKXPDQRSDUDYHQFHURFDP-
WRV SHRQDWRLQWHUUHJLRQDO
( 2DXWRGLGDWDIH]XPDDXWRDQiOLVH 8VDVHRKtIHQGLDQWHGHSDODYUDLQLFLDGDSRUK
 8VDVH R KtIHQ VH R SUHÀ[R WHUPLQDU FRP D PHVPD
$VVLQDOHDDOWHUQDWLYDLQFRUUHWDTXDQWRDRHPSUHJR OHWUDFRPTXHVHLQLFLDDRXWUDSDODYUD
GRKtIHQUHVSHLWDQGRVHRQRYR$FRUGR
$ 2VHPLDQDOIDEHWRGHVHQKRXXPVHPLFtUFXOR ACENTUAÇÃO
% 2PHLDGLUHLWDIH]XPJROGHVHPSXORQDVHPLÀQDO
GRFDPSHRQDWR $acentuaçãopXPGRVUHTXLVLWRVTXHSHUID]HPDVUH-
& (UDXPVHPYHUJRQKDSRLVDQGDYDVHPLQX JUDVHVWDEHOHFLGDVSHOD*UDPiWLFD1RUPDWLYD(VWDVHFRP-
' 2UHFpPFKHJDGRYHLRGHDOpPPDU S}H GH DOJXPDV SDUWLFXODULGDGHV jV TXDLV GHYHPRV HVWDU
( 2YLFHUHLWRUHVWiHPHVWDGRSyVRSHUDWyULR DWHQWRV SURFXUDQGR HVWDEHOHFHU XPD UHODomR GH IDPLOLD-
ULGDGHHFRQVHTXHQWHPHQWHFRORFDQGRDVHPSUiWLFDQD
6HJXQGRRQRYR$FRUGRHQWUHDVSDODYUDVSmRGXUR OLQJXDJHPHVFULWD
DYDUHQWR FRSRGHOHLWH SODQWD HSpGHPROHTXH GRFH R ­PHGLGDTXHGHVHQYROYHPRVRKiELWRGDOHLWXUDHD
KtIHQpREULJDWyULR SUiWLFD GH UHGLJLU DXWRPDWLFDPHQWH DSULPRUDPRV HVVDV
$ HPQHQKXPDGHODV FRPSHWrQFLDVHORJRQRVDGHTXDPRVjIRUPDSDGUmR
% QDVHJXQGDSDODYUD
& QDWHUFHLUDSDODYUD Regras básicas – Acentuação tônica
' HPWRGDVDVSDODYUDV
( QDSULPHLUDHQDVHJXQGDSDODYUD $ DFHQWXDomR W{QLFD LPSOLFD QD LQWHQVLGDGH FRP TXH
VmRSURQXQFLDGDVDVVtODEDVGDVSDODYUDV$TXHODTXHVHGi
)H] XP HVIRUoR BB SDUD YHQFHU R FDPSHRQDWR BB GHIRUPDPDLVDFHQWXDGDFRQFHLWXDVHFRPRsílaba tônica.
4XDODOWHUQDWLYDFRPSOHWDFRUUHWDPHQWHDVODFXQDV" $VGHPDLVFRPRVmRSURQXQFLDGDVFRPPHQRVLQWHQVLGD-
$ VREUHXPDQRLQWHUUHJLRQDO GHVmRGHQRPLQDGDVGHátonas.
% VREUHKXPDQRLQWHUUHJLRQDO 'H DFRUGR FRP D WRQLFLGDGH DV SDODYUDV VmR FODVVLÀ-
& VREUHKXPDQRLQWHUUHJLRQDO FDGDVFRPR
' VREUHKXPDQRLQWHUUHJLRQDO Oxítonas²6mRDTXHODVFXMDVtODEDW{QLFDUHFDLVREUHD
( VREUHKXPDQRLQWHUHJLRQDO ~OWLPDVtODED([café – coração – cajá – atum – caju – papel

GABARITO Paroxítonas ²6mRDTXHODVHPTXHDVtODEDW{QLFDUHFDL


QDSHQ~OWLPDVtODED([útil – tórax – táxi – leque – retrato
01. B 02. B 03. A 04. E 05. C – passível

RESOLUÇÃO Proparoxítonas 6mRDTXHODVHPTXHDVtODEDW{QLFD


HVWiQDDQWHSHQ~OWLPDVtODED([lâmpada – câmara – tím-
  pano – médico – ônibus
$ DXWRFUtWLFD
& SRQWDSp &RPRSRGHPRVREVHUYDURVYRFiEXORVSRVVXHPPDLV
' VXSHUPHUFDGR GHXPDVtODEDPDVHPQRVVDOtQJXDH[LVWHPDTXHOHVFRP
( LQIUDYHUPHOKRV XPDVtODEDVRPHQWHVmRRVFKDPDGRVmonossílabosTXH
TXDQGR SURQXQFLDGRV DSUHVHQWDP FHUWD GLIHUHQFLDomR
 %  1DV FLUFXQYL]LQKDQoDV Ki XPD FDVD PDODVVRP- TXDQWRjLQWHQVLGDGH
EUDGD 7DO GLIHUHQFLDomR Vy p SHUFHELGD TXDQGR RV SURQXQ-
 $ 2VHPLDQDOIDEHWRGHVHQKRXXPVHPLFtUFXOR FLDPRVHPXPDGDGDVHTXrQFLDGHSDODYUDV$VVLPFRPR
SRGHPRVREVHUYDUQRH[HPSORDVHJXLU
  “Sei que não vai dar em nada,
D SmRGXURE FRSRGHOHLWH SODQWD F SpGHPR- Seus segredos sei de cor”
OHTXH GRFH 
D  8VDVH R KtIHQ QDV SDODYUDV FRPSRVWDV TXH QmR 2V PRQRVVtODERV FODVVLÀFDPVH FRPR W{QLFRV RV GH-
DSUHVHQWDPHOHPHQWRVGHOLJDomR PDLVFRPRiWRQRV TXHHPGH 

5
LÍNGUA PORTUGUESA

Os acentos * Cuidado6HRVGLWRQJRVDEHUWRVHVWLYHUHPHPXPD
SDODYUD R[tWRQD herói) RX PRQRVVtODED céu) DLQGD VmR
acento agudo Ž  ² &RORFDGR VREUH DV OHWUDV ªD« ªL« DFHQWXDGRV([herói, céu, dói, escarcéu
ªX«HVREUHRªH«GRJUXSR´HPµLQGLFDTXHHVWDVOHWUDV
UHSUHVHQWDP DV YRJDLV W{QLFDV GH SDODYUDV FRPR Amapá, Antes   Agora
caí, público, parabéns6REUHDVOHWUDV´HµH´RµLQGLFDDOpP DVVHPEOpLD   DVVHPEOHLD
GDWRQLFLGDGHWLPEUHDEHUWR([herói – médico – céu GL- LGpLD   LGHLD
WRQJRVDEHUWRV JHOpLD   JHOHLD
MLEyLD   MLERLD
DFHQWRFLUFXQÁH[R A ²FRORFDGRVREUHDVOHWUDV´Dµ DSyLD YHUERDSRLDU   DSRLD
´HµH´RµLQGLFDDOpPGDWRQLFLGDGHWLPEUHIHFKDGR([ SDUDQyLFR   SDUDQRLFR
tâmara – Atlântico – pêssego – supôs 
4XDQGRDYRJDOGRKLDWRIRU´LµRX´XµW{QLFRVDFRP-
acento grave C ²LQGLFDDIXVmRGDSUHSRVLomR´DµFRP
SDQKDGRVRXQmRGH´VµKDYHUiDFHQWR([saída – faísca
DUWLJRVHSURQRPHV([à – às – àquelas – àqueles
– baú – país – Luís
trema    ² 'H DFRUGR FRP D QRYD UHJUD IRL WRWDO-
PHQWH DEROLGR GDV SDODYUDV Há uma exceção p XWLOL]DGR Observação importante:
HPSDODYUDVGHULYDGDVGHQRPHVSUySULRVHVWUDQJHLURV([ 1mRVHUmRPDLVDFHQWXDGRV´LµH´XµW{QLFRVIRUPDQGR
mülleriano (de Müller) KLDWRTXDQGRYLHUHPGHSRLVGHGLWRQJR([
Antes  Agora
til a ²LQGLFDTXHDVOHWUDV´DµH´RµUHSUHVHQWDPYR- ERFDL~YD  ERFDLXYD
JDLVQDVDLV([coração – melão – órgão – ímã IHL~UD  IHLXUD
6DXtSH 6DXLSH
Regras fundamentais: 2 DFHQWR SHUWHQFHQWH DRV HQFRQWURV ´RRµ H ´HHµ IRL
DEROLGR([
Palavras oxítonas: Antes  Agora
$FHQWXDPVHWRGDVDVR[tWRQDVWHUPLQDGDVHP´Dµ´Hµ FUrHP  FUHHP
´Rµ´HPµVHJXLGDVRXQmRGRSOXUDO V Pará – café(s) – ci- OrHP  OHHP
pó(s) – armazém(s) Y{R  YRR
(VVDUHJUDWDPEpPpDSOLFDGDDRVVHJXLQWHVFDVRV HQM{R  HQMRR
Monossílabos tônicosWHUPLQDGRVHP´Dµ´Hµ´RµVH-
JXLGRVRXQmRGH´Vµ([pá – pé – dó – há $JRUDPHPRUL]HDSDODYUD&5('(/(9È6mRRVYHUERV
Formas verbais WHUPLQDGDVHP´Dµ´Hµ´RµW{QLFRVVH- TXHQRSOXUDOGREUDPR´HµPDVTXHQmRUHFHEHPPDLV
JXLGDVGHORODORVODV([respeitá-lo – percebê-lo – com- DFHQWRFRPRDQWHV&5(5'$5/(5H9(5
pô-lo
5HSDUH
Paroxítonas:  O menino crê em você
$FHQWXDPVHDVSDODYUDVSDUR[tWRQDVWHUPLQDGDVHP Os meninos creem em você.
LLVtáxi – lápis – júri  Elza lê bem!
XVXPXQVvírus – álbuns – fórum
Todas leem bem!
OQU[SVautomóvel – elétron - cadáver – tórax –
 Espero que ele dê o recado à sala.
fórceps
Esperamos que os garotos deem o recado
mmVmRmRVímã – ímãs – órfão – órgãos
 Rubens vê tudo!
 Dica da Zê! 0HPRUL]H D SDODYUD /,185;®2 3DUD Eles veem tudo!
TXr" 5HSDUH TXH HVVD SDODYUD DSUHVHQWD DV WHUPLQDo}HV
GDVSDUR[tWRQDVTXHVmRDFHQWXDGDV/,18 DTXLLQFOXD Cuidado! +iRYHUERYLU
80 IyUXP 5;®®2$VVLPÀFDUiPDLVIiFLODPHPR- Ele vem à tarde!
UL]DomR Eles vêm à tarde!

-ditongo oral FUHVFHQWH RX GHFUHVFHQWH VHJXLGR RX 1mRVHDFHQWXDPR´LµHR´XµTXHIRUPDPKLDWRTXDQ-


QmRGH´Vµágua – pônei – mágoa – jóquei GRVHJXLGRVQDPHVPDVtODEDGHOPQURX]Ra-ul, ru
-im, con-tri-bu-in-te, sa-ir, ju-iz
Regras especiais:
1mRVHDFHQWXDPDVOHWUDV´LµH´XµGRVKLDWRVVHHVWL-
2V GLWRQJRV GH SURQ~QFLD DEHUWD ´HLµ ´RLµ ditongos YHUHPVHJXLGDVGRGtJUDIRQK([ra-i-nha, ven-to-i-nha.
abertos  TXH DQWHV HUDP DFHQWXDGRV perderam o acento
GH DFRUGR FRP D QRYD UHJUD PDV desde que estejam em 1mRVHDFHQWXDPDVOHWUDV´LµH´XµGRVKLDWRVVHYLHUHP
palavras paroxítonas SUHFHGLGDVGHYRJDOLGrQWLFDxi-i-ta, pa-ra-cu-u-ba

6
LÍNGUA PORTUGUESA

$V IRUPDV YHUEDLV TXH SRVVXtDP R DFHQWR W{QLFR QD $VVLQDOHDDOWHUQDWLYDFRUUHWD


UDL]FRP´XµW{QLFRSUHFHGLGRGH´JµRX´TµHVHJXLGRGH $  ´&RQWUiULRµ H ´SUpYLDVµ VmR DFHQWXDGDV SRU VHUHP
´HµRX´LµQmRVHUmRPDLVDFHQWXDGDV([ SDUR[tWRQDVWHUPLQDGDVHPGLWRQJR
Antes   'HSRLV % (P´LQWHUUXSWRUµH´WHVWDULDµWHPRVUHVSHFWLYDPHQ-
DSD]LJ~H DSD]LJXDU  DSD]LJXH WHHQFRQWURFRQVRQDQWDOHKLDWR
DYHULJ~H DYHULJXDU  DYHULJXH & (P´HUURVderivam GRPHVPRrecurso mentalµDV
DUJ~L DUJXLU   DUJXL SDODYUDVJULIDGDVVmRSDUR[tWRQDV
' 1DVSDODYUDV´VHguLGDµ´DquHOHµH´quDQGRµDVSDU-
$FHQWXDPVHRVYHUERVSHUWHQFHQWHVjWHUFHLUDSHVVRD WHVGHVWDFDGDVVmRGtJUDIRV
GRSOXUDOGHele tem – eles têm / ele vem – eles vêm (verbo ( $GLYLVmRVLOiELFDHVWiFRUUHWDHP´FRJQLWLYDµ´S
vir) VLFyORJDµH´DFLRQDµ

$UHJUDSUHYDOHFHWDPEpPSDUDRVYHUERVFRQWHURE- 7RGDVDVSDODYUDVDEDL[RVmRKLDWRV(;&(72
WHUUHWHUGHWHUDEVWHU $ VD~GH
ele contém – eles contêm % FRRSHUDU
ele obtém – eles obtêm & UXLP
ele retém – eles retêm ' FUHHP
ele convém – eles convêm ( SRXFR

1mR VH DFHQWXDP PDLV DV SDODYUDV KRPyJUDIDV TXH  ´2 episódio DFRQWHFHX HP SOHQD YLD S~EOLFD GH
DQWHVHUDPDFHQWXDGDVSDUDGLIHUHQFLiODVGHRXWUDVVHPH- $VVLV'H]PXOKHUHVFRPHoDUDPDFDQWDUP~VLFDVSHODSD]
OKDQWHV UHJUDGRDFHQWRGLIHUHQFLDO $SHQDVHPalgumas PXQGLDO $ SDUWLU GDTXHOH PRPHQWR RXWUDV SHVVRDV TXH
SDVVDYDPSRUDOLGHFLGLUDPLQWHJUDUDRJUXSR5DSLGDPHQ-
exceçõesFRPR
WHXPDPXOWLGmRDGHULXjLGHLD$VVLPFRPHoRXDIRUPD-
$ IRUPD YHUEDO pôde WHUFHLUD SHVVRD GR VLQJXODU GR
omR GR PDLRU FRUDO SRSXODU GH $VVLVµ 2 YRFiEXOR VXEOL-
SUHWpULWRSHUIHLWRGRPRGRLQGLFDWLYR DLQGDFRQWLQXDVHQ-
QKDGRWHPVXDDFHQWXDomRJUiÀFDMXVWLÀFDGDSHORPHVPR
GRDFHQWXDGDSDUDGLIHUHQFLDUVHGHpode WHUFHLUDSHVVRD
PRWLYRGDVSDODYUDV
GRVLQJXODUGRSUHVHQWHGRLQGLFDWLYR ([
$ HPLQrQFLDtPSLRYiFXRHVSpFLHVpULR
Ela pode fazer isso agora. % DOXiFiULHSiWLRDpUHRtQYLR
Elvis não pôde participar porque sua mão não deixou. & FKLQrVYDUtRODUXEpRODSHUtRGRSUrPLR
' ViELRViELDVDELiFXULyVpULR
2PHVPRRFRUUHXFRPRYHUERpôrSDUDGLIHUHQFLDUGD
SUHSRVLomRpor $VVLQDOHDRSomR&255(7$HPTXHWRGDVDVSDOD-
4XDQGRQDIUDVHGHUSDUDVXEVWLWXLUR´SRUµSRU´FR- YUDVHVWmRDFHQWXDGDVQDPHVPDSRVLomRVLOiELFD
ORFDUµ HVWDUHPRV WUDEDOKDQGR FRP XP YHUER SRUWDQWR $ 1D]DUpDOpPDWpHVWiWDPEpP
´S{UµQRVRXWURVFDVRV´SRUµSUHSRVLomR([ % ÉJXDLQtFLRDOpPRiVLVUHOLJLmR
Faço isso por você. & 0XQLFtSLRLQtFLRiJXDVpFXORRiVLV
Posso pôr (colocar) meus livros aqui? ' 6pFXORVtPERORiJXDKLVWyULDVPLVVLRQiULR
( 0LVVLRQiULRVtPERORKLVWyULDVVpFXOR²PXQLFtSLR
4XHVW}HVVREUH$FHQWXDomR*UiÀFD
&RQVLGHUDQGRDVSDODYUDVtambém / revólver / lâm-
´&DGiYHUµpSDUR[tWRQDSRLV pada / lápis$VVLQDOHD~QLFDDOWHUQDWLYDFXMDMXVWLÀFDWLYDGH
$ 7HPD~OWLPDVtODEDFRPRW{QLFD DFHQWXDomRJUiÀFDQmRVHUHIHUHDXPDGHODV
% 7HPDSHQ~OWLPDVtODEDFRPRW{QLFD $ SDODYUDSDUR[tWRQDWHUPLQDGDHPis
& 7HPDDQWHSHQ~OWLPDVtODEDFRPRW{QLFD % SDODYUDSURSDUR[tWRQDWHUPLQDGDHPem
' 1mRWHPVtODEDW{QLFD & SDODYUDSDUR[tWRQDWHUPLQDGDHP r
' SDODYUDSURSDUR[tWRQDWRGDVGHYHPVHUDFHQWXD-
 $VVLQDOHDDOWHUQDWLYDFRUUHWD GDV
$SDODYUDIDOLXFRQWpPXP
$ KLDWR $VVLQDOHDDOWHUQDWLYDLQFRUUHWD
% GtJUDIR $ 2VYRFiEXORVViELRUpJXDHGHFrQFLDVmRSDUR[tWR-
& GLWRQJRGHFUHVFHQWH QRVWHUPLQDGDVHPGLWRQJRVFUHVFHQWHV
' GLWRQJRFUHVFHQWH % 2YRFiEXORDUPD]pPpDFHQWXDGRSRUVHUXPR[tWR-
QRWHUPLQDGRHPHP
 (P ´2 UHVXOWDGR GD experiência IRL OLWHUDOPHQ- & 2VYRFiEXORVED~HFDIHtQDVmRKLDWRV
WHDWHUUDGRUµDSDODYUDGHVWDFDGDHQFRQWUDVHDFHQWXDGD '  2 YRFiEXOR YpX p DFHQWXDGR SRU VHU XP R[tWRQR
SHORPHVPRPRWLYRTXH WHUPLQDGRHPX
$ W~QHO
% YROXQWiULR GABARITO
& DWp
' LQVyOLWR 01. B 02. C 03. B 04. A 05. E
( UyWXORV 06. A 07. A 08. B 09. D

7
LÍNGUA PORTUGUESA

RESOLUÇÃO PONTUAÇÃO

  6HSDUDQGR DV VtODEDV &D ² Gi ² YHU D SHQ~OWLPD 2V sinais de pontuação VmR PDUFDo}HV JUiÀFDV TXH
VtODEDpDW{QLFD PDLVIRUWHQHVVHFDVRDFHQWXDGD 3HQ~O- VHUYHPSDUDFRPSRUDFRHVmRHDFRHUrQFLDWH[WXDODOpP
WLPDVtODEDW{QLFD SDUR[tWRQD GHUHVVDOWDUHVSHFLÀFLGDGHVVHPkQWLFDVHSUDJPiWLFDV9H-
MDPRV DV SULQFLSDLV IXQo}HV GRV VLQDLV GH SRQWXDomR FR-
 IDOLX WHPRV DTXLGXDVYRJDLVQDPHVPD Vt- QKHFLGRVSHORXVRGDOtQJXDSRUWXJXHVD
ODED SRUWDQWR GLWRQJR e GHFUHVFHQWH SRUTXH DSUHVHQWD
XPD YRJDO H XPD VHPLYRJDO 1D FODVVLÀFDomR DPEDV VmR Ponto
VHPLYRJDLVPDVTXDQGRMXQWDVDTXH´DSDUHFHUµPDLVQD ,QGLFDRWpUPLQRGRGLVFXUVRRXGHSDUWHGHOH
SURQ~QFLDVHUiFRQVLGHUDGD´YRJDOµ Façamos o que for preciso para tirá-la da situação em
que se encontra.
 H[²SHUL²rQFLDSDUR[tWRQDWHUPLQDGDHP - Gostaria de comprar pão, queijo, manteiga e leite.
GLWRQJRFUHVFHQWH VHPLYRJDOYRJDO  - Acordei. Olhei em volta. Não reconheci onde estava.
D 7~²QHOSDUR[tWRQDWHUPLQDGDHP/
E YR²OXQWi²ULRSDUR[tWRQDWHUPLQDGDHPGLWRQ-
8VDVHQDVDEUHYLDo}HV9([6U
JR
F $Wp²R[tWRQD
G LQ²Vy²OL²WRSURSDUR[tWRQD Ponto e Vírgula ( ; )
H Uy²WXORV²SURSDUR[tWRQD 6HSDUDYiULDVSDUWHVGRGLVFXUVRTXHWrPDPHVPD
LPSRUWkQFLD
  “Os pobres dão pelo pão o trabalho; os ricos dão pelo
D FRUUHWD pão a fazenda; os de espíritos generosos dão pelo pão a vida;
E LQWH55XSWRUQmRpHQFRQWURFRQVRQDQWDOPDVVLP os de nenhum espírito dão pelo pão a alma...” 9,(,5$
'Ì*5$)2
F WRGDVVmRH[FHWR0(17$/TXHpR[tWRQD 6HSDUDSDUWHVGHIUDVHVTXHMiHVWmRVHSDUDGDVSRU
G VmRGtJUDIRVH[FHWR48$1'2TXH´RXoRµRVRP YtUJXODV
GR8SRUWDQWRQmRpFDVRGHGtJUDIR Alguns quiseram verão, praia e calor; outros, monta-
H FRJ²QLWL²YDSVL²FyORJD nhas, frio e cobertor

 VD~GHFRRSH²UDUUX²LP 6HSDUDLWHQVGHXPDHQXPHUDomRH[SRVLomRGHPR-
FUHHPSRXFR GLWRQJR WLYRVGHFUHWRGHOHLHWF
- Ir ao supermercado;
 HSLVyGLRSDUR[tWRQDWHUPLQDGDHPGL- - Pegar as crianças na escola;
WRQJR - Caminhada na praia;
D RN - Reunião com amigos.
E D²OX²iR[tWRQDHQWmRGHVFDUWHHVVHLWHP
F FKL²QrVR[tWRQDLGHP Dois pontos
G VD²EL²iLGHP $QWHVGHXPDFLWDomR
- Vejamos como Afrânio Coutinho trata este assunto:
 
D R[tWRQD²72'$6 $QWHVGHXPDSRVWR
E  SDUR[tWRQD ² SDUR[tWRQD ² R[tWRQD ² SDUR[tWRQD ²
Três coisas não me agradam: chuva pela manhã, frio à
QmRDFHQWXDGD
tarde e calor à noite.
F SDUR[tWRQD²LGHP²LGHP²SURSDUR[tWRQD²SDUR-
[tWRQD
G SURSDUR[tWRQD²LGHP²SDUR[tWRQD²LGHP²LGHP $QWHVGHXPDH[SOLFDomRRXHVFODUHFLPHQWR
H SDUR[tWRQD²SURSDUR[tWRQD²SDUR[tWRQD²SURSDUR- - Lá estava a deplorável família: triste, cabisbaixa, viven-
[tWRQD²SDUR[tWRQD do a rotina de sempre.

 WDP²EpPR[tWRQDUH²YyO²YHUSDUR[tWRQDOkP (PIUDVHVGHHVWLORGLUHWR
²SD²GDSURSDUR[tWRQDOi²SLVSDUR[tWRQD Maria perguntou:
D pDUHJUDGR/É3,6 - Por que você não toma uma decisão?
E WRGDVDVSURSDUR[tWRQDVVmRDFHQWXDGDVindepen-
dente de sua terminação Ponto de Exclamação
F UHJUDSDUD5(9Ð/9(5 8VDVHSDUDLQGLFDUHQWRQDomRGHVXUSUHVDFyOHUD
G UHODWLYDjSDODYUDOkPSDGD VXVWRV~SOLFDHWF
- Sim! Claro que eu quero me casar com você!
 $VDOWHUQDWLYDV$%H&FRQWrPDÀUPDWLYDVFRUUHWDV 'HSRLVGHLQWHUMHLo}HVRXYRFDWLYRV
1D'KiHUURSRLVYpXpPRQRVVtODERDFHQWXDGRSRUWHU- - Ai! Que susto!
PLQDUHPGLWRQJRDEHUWR - João! Há quanto tempo!

8
LÍNGUA PORTUGUESA

Ponto de Interrogação RDSRVWRSão Paulo, considerada a metrópole brasilei-


8VDVHQDVLQWHUURJDo}HVGLUHWDVHLQGLUHWDVOLYUHV ra, possui um trânsito caótico.
“- Então? Que é isso? Desertaram ambos?” $UWXU$]H- RYRFDWLYROra, Thiago, não diga bobagem.
YHGR
)RQWHV
Reticências KWWSZZZLQIRHVFRODFRPSRUWXJXHVSRQWXDFDR
,QGLFDTXHSDODYUDVIRUDPVXSULPLGDV KWWSZZZEUDVLOHVFRODFRPJUDPDWLFDXVRGDYLUJX-
- Comprei lápis, canetas, cadernos. ODKWP

,QGLFDLQWHUUXSomRYLROHQWDGDIUDVH Questões sobre Pontuação


´ Não... quero dizer... é verdad... Ahµ
 $JHQWH3ROLFLDO²9XQHVS² $VVLQDOHDDOWHU-
,QGLFDLQWHUUXSo}HVGHKHVLWDomRRXG~YLGD
QDWLYDHPTXHDSRQWXDomRHVWiFRUUHWDPHQWHHPSUHJDGD
- Este mal... pega doutor?
GHDFRUGRFRPDQRUPDSDGUmRGDOtQJXDSRUWXJXHVD
$  'LDQWH GD WHVWHPXQKD R KRPHP DEULX D EROVD H
,QGLFDTXHRVHQWLGRYDLDOpPGRTXHIRLGLWR
HPERUDH[SHULPHQWDVVHDVHQVDomRGHYLRODUXPDLQWLPL-
- Deixa, depois, o coração falar.
GDGH SURFXURX D HVPR HQWUH DV FRLVLQKDV WHQWDQGR HQ-
Vírgula FRQWUDUDOJRTXHSXGHVVHDMXGDUDUHYHODUTXHPHUDDVXD
GRQD
Não se usa vírgula %  'LDQWH GD WHVWHPXQKD R KRPHP DEULX D EROVD H
VHSDUDQGRWHUPRVTXHGRSRQWRGHYLVWDVLQWiWLFROL- HPERUDH[SHULPHQWDVVHDVHQVDomRGHYLRODUXPDLQWLPL-
JDPVHGLUHWDPHQWHHQWUHVL GDGH SURFXURX D HVPR HQWUH DV FRLVLQKDV WHQWDQGR HQ-
HQWUHVXMHLWRHSUHGLFDGR FRQWUDUDOJRTXHSXGHVVHDMXGDUDUHYHODUTXHPHUDDVXD
Todos os alunos da sala foram advertidos. GRQD
6XMHLWRSUHGLFDGR &  'LDQWH GD WHVWHPXQKD R KRPHP DEULX D EROVD H
HPERUDH[SHULPHQWDVVHDVHQVDomRGHYLRODUXPDLQWLPLGD-
HQWUHRYHUERHVHXVREMHWRV GHSURFXURXDHVPRHQWUHDVFRLVLQKDVWHQWDQGRHQFRQWUDU
O trabalho custou sacrifício aos realiza- DOJRTXHSXGHVVHDMXGDUDUHYHODUTXHPHUDDVXDGRQD
dores. ' 'LDQWHGDWHVWHPXQKDRKRPHPDEULXDEROVDH
97',2'2, HPERUD H[SHULPHQWDVVH D VHQVDomR GH YLRODU XPD LQWLPL-
GDGH SURFXURX D HVPR HQWUH DV FRLVLQKDV WHQWDQGR HQ-
Usa-se a vírgula: FRQWUDUDOJRTXHSXGHVVHDMXGDUDUHYHODUTXHPHUDDVXD
3DUDPDUFDULQWHUFDODomR GRQD
D GRDGMXQWRDGYHUELDOO café, em razão da sua abun- (  'LDQWH GD WHVWHPXQKD R KRPHP DEULX D EROVD H
dância, vem caindo de preço. HPERUDH[SHULPHQWDVVHDVHQVDomRGHYLRODUXPDLQWLPL-
E GDFRQMXQomROs cerrados são secos e áridos. Estão GDGH SURFXURX D HVPR HQWUH DV FRLVLQKDV WHQWDQGR HQ-
produzindo, todavia, altas quantidades de alimentos. FRQWUDUDOJRTXHSXGHVVHDMXGDUDUHYHODUTXHPHUDDVXD
F GDVH[SUHVV}HVH[SOLFDWLYDVRXFRUUHWLYDVAs indús- GRQD
trias não querem abrir mão de suas vantagens, isto é, não $VVLQDOHDRSomRHPTXHHVWiFRUUHWDPHQWHLQGLFD-
querem abrir mão dos lucros altos. GDDRUGHPGRVVLQDLVGHSRQWXDomRTXHGHYHPSUHHQFKHU
DVODFXQDVGDIUDVHDEDL[R
3DUDPDUFDULQYHUVmR
´4XDQGRVHWUDWDGHWUDEDOKRFLHQWtÀFRBBBGXDVFRLVDV
D GRDGMXQWRDGYHUELDO FRORFDGRQRLQtFLRGDRUDomR 
devem ser consideradas ____ uma é a contribuição teórica
Depois das sete horas, todo o comércio está de portas fe-
que o trabalho oferece ___ a outra é o valor prático que possa
chadas.
E GRVREMHWRVSOHRQiVWLFRVDQWHSRVWRVDRYHUERAos ter.
pesquisadores, não lhes destinaram verba alguma. $ GRLVSRQWRVSRQWRHYtUJXODSRQWRHYtUJXOD
F GRQRPHGHOXJDUDQWHSRVWRjVGDWDVRecife, 15 de % GRLVSRQWRVYtUJXODSRQWRHYtUJXOD
maio de 1982. & YtUJXODGRLVSRQWRVSRQWRHYtUJXOD
' SRQWRVYtUJXODGRLVSRQWRVSRQWRHYtUJXOD
3DUDVHSDUDUHQWUHVLHOHPHQWRVFRRUGHQDGRV GLVSRV- ( SRQWRHYtUJXODYtUJXODYtUJXOD
WRVHPHQXPHUDomR 
Era um garoto de 15 anos, alto, magro.  $JHQWHGH$SRLR$GPLQLVWUDWLYR²)&&² 2V
A ventania levou árvores, e telhados, e pontes, e animais. VLQDLVGHSRQWXDomRHVWmRHPSUHJDGRVFRUUHWDPHQWHHP
$ 'XDVH[SOLFDo}HVGRWUHLQDPHQWRSDUDFRQVXOWRUHV
3DUDPDUFDUHOLSVH RPLVVmR GRYHUER LQLFLDQWHVUHFHEHUDPGHVWDTXHRFRQFHLWRGH33'HDFRQV-
Nós queremos comer pizza; e vocês, churrasco WUXomRGHWDEHODV3ULFHPDVSRURXWURODGRIDOWRXIDODUGDV
3DUDLVRODU PHWDVGHYHQGDVDVVRFLDGDVDRVGRLVWHPDV

9
LÍNGUA PORTUGUESA

%  'XDV H[SOLFDo}HV GR WUHLQDPHQWR SDUD FRQVXOWRUHV $VVLQDOHDVpULHGHVLQDLVFXMRHPSUHJRFRUUHVSRQ-


LQLFLDQWHVUHFHEHUDPGHVWDTXHRFRQFHLWRGH33'HDFRQV- GHQDPHVPDRUGHPDRVSDUrQWHVHVLQGLFDGRVQRWH[WR
WUXomRGHWDEHODV3ULFHPDVSRURXWURODGRIDOWRXIDODUGDV ´Pergunta-se ( ) qual é a ideia principal desse pará-
PHWDVGHYHQGDVDVVRFLDGDVDRVGRLVWHPDV grafo ( ) A chegada de reforços ( ) a condecoração ( ) o
&  'XDV H[SOLFDo}HV GR WUHLQDPHQWR SDUD FRQVXOWRUHV escândalo da opinião pública ou a renúncia do presidente (
LQLFLDQWHVUHFHEHUDPGHVWDTXHRFRQFHLWRGH33'HDFRQV- ) Se é a chegada de reforços ( ) que relação há ( ) ou mos-
WUXomRGHWDEHODV3ULFHPDVSRURXWURODGRIDOWRXIDODUGDV trou seu autor haver ( ) entre esse fato e os restantes  µ
$ YtUJXODYtUJXODLQWHUURJDomRLQWHUURJDomRLQWHUUR-
PHWDVGHYHQGDVDVVRFLDGDVDRVGRLVWHPDV
JDomRYtUJXODYtUJXODYtUJXODSRQWRÀQDO
'  'XDV H[SOLFDo}HV GR WUHLQDPHQWR SDUD FRQVXOWR- % GRLVSRQWRVLQWHUURJDomRYtUJXODYtUJXODLQWHUURJD-
UHV LQLFLDQWHV UHFHEHUDP GHVWDTXH R FRQFHLWR GH 33' H omRYtUJXODWUDYHVVmRWUDYHVVmRLQWHUURJDomR
DFRQVWUXomRGHWDEHODV3ULFHPDVSRURXWURODGRIDOWRX & WUDYHVVmRLQWHUURJDomRYtUJXODYtUJXODSRQWRÀQDO
IDODUGDVPHWDVGHYHQGDVDVVRFLDGDVDRVGRLVWHPDV WUDYHVVmRWUDYHVVmRSRQWRÀQDOSRQWRÀQDO
(  'XDV H[SOLFDo}HV GR WUHLQDPHQWR SDUD FRQVXOWR- ' GRLVSRQWRVLQWHUURJDomRYtUJXODSRQWRÀQDOWUD-
UHVLQLFLDQWHVUHFHEHUDPGHVWDTXHRFRQFHLWRGH33'HD YHVVmRYtUJXODYtUJXODYtUJXODLQWHUURJDomR
FRQVWUXomRGHWDEHODV3ULFHPDVSRURXWURODGRIDOWRXIDODU ( GRLVSRQWRVSRQWRÀQDOYtUJXODYtUJXODLQWHUURJD-
GDVPHWDVGHYHQGDVDVVRFLDGDVDRVGRLVWHPDV omRYtUJXODYtUJXODWUDYHVVmRLQWHUURJDomR

 (VFUHYHQWH7-63²9XQHVS $VVLQDOHDDOWHU-  65) 'DVUHGDo}HVDEDL[RDVVLQDOHDTXHQmRHVWi


QDWLYD HP TXH R SHUtRGR DGDSWDGR GD UHYLVWD 3HVTXLVD SRQWXDGDFRUUHWDPHQWH
)DSHVSGHMXQKRGHHVWiFRUUHWRTXDQWRjUHJrQFLD $ 2VFDQGLGDWRVHPÀODDJXDUGDYDPDQVLRVRVRUH-
VXOWDGRGRFRQFXUVR
QRPLQDOHjSRQWXDomR
% (PÀODRVFDQGLGDWRVDJXDUGDYDPDQVLRVRVRUH-
$  1mR Ki G~YLGD TXH DV PXOKHUHV DPSOLDP UDSLGD-
VXOWDGRGRFRQFXUVR
PHQWHVHXHVSDoRQDFDUUHLUDFLHQWtÀFDDLQGDTXHRDYDQoR & $QVLRVRVRVFDQGLGDWRVDJXDUGDYDPHPÀODRUH-
VHMDPDLVQRWiYHOHPDOJXQVSDtVHVR%UDVLOpXPH[HPSOR VXOWDGRGRFRQFXUVR
GRTXHHPRXWURV ' 2VFDQGLGDWRVDQVLRVRVDJXDUGDYDPRUHVXOWDGRGR
%  1mR Ki G~YLGD GH TXH DV PXOKHUHV DPSOLDP UD- FRQFXUVRHPÀOD
SLGDPHQWH VHX HVSDoR QD FDUUHLUD FLHQWtÀFD DLQGD TXH R ( 2VFDQGLGDWRVDJXDUGDYDPDQVLRVRVHPÀODRUHVXO-
DYDQoRVHMDPDLVQRWiYHOHPDOJXQVSDtVHVR%UDVLOpXP WDGRGRFRQFXUVR
H[HPSORGRTXHHPRXWURV
&  1mR Ki G~YLGD GH TXH DV PXOKHUHV DPSOLDP UD- $IUDVHHPTXHGHYHULDKDYHUXPDYtUJXODp
SLGDPHQWH VHX HVSDoR QD FDUUHLUD FLHQWtÀFD DLQGD TXH R $ &RPLXPDIUXWDSHODPDQKmHRXWUDjWDUGH
DYDQoRVHMDPDLVQRWiYHOHPDOJXQVSDtVHVR%UDVLOpXP % (XXVHLXPYHVWLGRYHUPHOKRQDIHVWDHPLQKDLUPm
H[HPSORGRTXHHPRXWURV XVRXXPYHVWLGRD]XO
& (ODWHPOiELRVHQDUL]YHUPHOKRV
' 1mRKiG~YLGDGHTXHDVPXOKHUHVDPSOLDPUDSLGD-
' 1mROLPSDUDPDVDODQHPDFR]LQKD
PHQWHVHXHVSDoRQDFDUUHLUDFLHQWtÀFDDLQGDTXHRDYDQoR
VHMDPDLVQRWiYHOHPDOJXQVSDtVHV²R%UDVLOpXPH[HPSOR GABARITO
²GRTXHHPRXWURV
(  1mR Ki G~YLGD TXH DV PXOKHUHV DPSOLDP UDSLGD- 01. C 02. C 03. B 04. D 05. E
PHQWHVHXHVSDoRQDFDUUHLUDFLHQWtÀFDDLQGDTXHRDYDQ- 06. B 07. B 08. B
oRVHMDPDLVQRWiYHOHPDOJXQVSDtVHV R%UDVLOpXPH[HP-
SOR GRTXHHPRXWURV RESOLUÇÃO
 3DSLORVFRSLVWD 3ROLFLDO ² 9XQHVS ²  ² DGDS 
$VVLQDOH D DOWHUQDWLYD HP TXH D IUDVH PDQWpPVH FRUUHWD 1- Assinalei com um (X) as pontuações inadequadas
DSyVRDFUpVFLPRGDVYtUJXODV $  'LDQWH GD WHVWHPXQKD R KRPHP DEULX D EROVD H
$ 6HDFULDQoDVHSHUGHUTXHPHQFRQWUiODYHUiQD HPERUD ; H[SHULPHQWDVVH ; DVHQVDomRGHYLRODUXPD
SXOVHLUDLQVWUXo}HVSDUDTXHHQYLHXPDPHQVDJHPHOHWU{- LQWLPLGDGHSURFXURXDHVPRHQWUHDVFRLVLQKDVWHQWDQGR
QLFDDRJUXSRRXDFLRQHRFyGLJRQDLQWHUQHW HQFRQWUDU DOJR TXH SXGHVVH DMXGDU D UHYHODU TXHP HUD D
VXDGRQD
%  8P JHRORFDOL]DGRU WDPEpP DYLVDUi RV SDLV GH
% 'LDQWH ; GDWHVWHPXQKDRKRPHPDEULXDEROVD
RQGHRFyGLJRIRLDFLRQDGR HHPERUDH[SHULPHQWDVVHDVHQVDomR ; GHYLRODUXPD
& $VVLPTXHRFyGLJRpGLJLWDGRIDPLOLDUHVFDGDVWUD- LQWLPLGDGHSURFXURXDHVPRHQWUHDVFRLVLQKDVWHQWDQGR
GRV UHFHEHP DXWRPDWLFDPHQWH XPD PHQVDJHP GL]HQGR HQFRQWUDU DOJR TXH SXGHVVH DMXGDU D UHYHODU TXHP HUD D
TXHDFULDQoDIRLHQFRQWUDGD VXDGRQD
'  'H IDEULFDomR FKLQHVD D QRYD SXOVHLULQKD FKHJD ' 'LDQWHGDWHVWHPXQKDRKRPHP ; DEULXDEROVD
SULPHLURjVDUHLDVGR*XDUXMi H HPERUD H[SHULPHQWDVVH D VHQVDomR GH YLRODU XPD LQWL-
( 2VLVWHPDSHUPLWHDLQGDFDGDVWUDURQRPHHRWH- PLGDGHSURFXURXDHVPRHQWUHDVFRLVLQKDVWHQWDQGR ; 
OHIRQHGHTXHPDHQFRQWURXHLQIRUPDUXPSRQWRGHUH- HQFRQWUDU DOJR TXH SXGHVVH DMXGDU D UHYHODU TXHP HUD D
IHUrQFLD VXDGRQD

10
LÍNGUA PORTUGUESA

(  'LDQWH GD WHVWHPXQKD R KRPHP DEULX D EROVD H & $VVLPTXHRFyGLJRpGLJLWDGRIDPLOLDUHVFDGDVWUD-


HPERUD ; H[SHULPHQWDVVHDVHQVDomRGHYLRODUXPDLQ- GRV ; UHFHEHP  DXWRPDWLFDPHQWHXPDPHQVDJHP
WLPLGDGH SURFXURX D HVPR HQWUH DV FRLVLQKDV WHQWDQGR  GL]HQGRTXHDFULDQoDIRLHQFRQWUDGD
; HQFRQWUDUDOJRTXHSXGHVVHDMXGDUDUHYHODUTXHPHUD ' 'HIDEULFDomRFKLQHVDDQRYDSXOVHLULQKD ; FKH-
DVXDGRQD JDSULPHLURjV ; DUHLDVGR*XDUXMi

 4XDQGRVHWUDWDGHWUDEDOKRFLHQWtÀFRGXDVFRLVDV  3HUJXQWDVH  TXDOpDLGHLDSULQFLSDOGHVVHSD-


GHYHP VHU FRQVLGHUDGDV :  XPD p D FRQWULEXLomR WHyULFD UiJUDIR
TXH R WUDEDOKR RIHUHFH  ;  D RXWUD p R YDORU SUiWLFR TXH  " $FKHJDGDGHUHIRUoRV  DFRQGHFRUDomR  R
SRVVDWHU HVFkQGDORGDRSLQLmRS~EOLFDRXDUHQ~QFLDGRSUHVLGHQWH
" 6HpDFKHJDGDGHUHIRUoRV  TXHUHODomRKi  
vírgula, dois pontos, ponto e vírgula RXPRVWURXVHXDXWRUKDYHU  HQWUHHVVHIDWRHRVUHV-
WDQWHV "
 $VVLQDOHLFRP ; RQGHHVWmRDVSRQWXDo}HVLQDGH-
TXDGDV  (PÀODRVFDQGLGDWRV ; DJXDUGDYDPDQVLRVRVR
$ 'XDVH[SOLFDo}HV ; GRWUHLQDPHQWRSDUDFRQVXO- UHVXOWDGRGRFRQFXUVR
WRUHV LQLFLDQWHV UHFHEHUDP GHVWDTXH  ;   R FRQFHLWR GH
33'HDFRQVWUXomRGHWDEHODV3ULFHPDVSRURXWURODGR  (XXVHLXPYHVWLGRYHUPHOKRQDIHVWDHPLQKD
IDOWRXIDODUGDVPHWDVGHYHQGDVDVVRFLDGDVDRVGRLVWHPDV LUPmXVRXXPYHVWLGRD]XO
&  'XDV H[SOLFDo}HV GR WUHLQDPHQWR SDUD FRQVXOWRUHV +iVLWXDo}HVHPTXHpSRVVtYHOXVDUDYtUJXODDQWHVGR
LQLFLDQWHVUHFHEHUDPGHVWDTXH ; RFRQFHLWRGH33'HD ´Hµ,VVRRFRUUHTXDQGRDFRQMXQomRDGLWLYDFRRUGHQDRUD-
FRQVWUXomRGHWDEHODV3ULFH ; PDVSRURXWURODGRIDOWRX o}HVGHVXMHLWRVGLIHUHQWHVQDVTXDLVDOHLWXUDÁXHQWHSRGH
IDODUGDVPHWDVGHYHQGDVDVVRFLDGDVDRVGRLVWHPDV VHUSUHMXGLFDGDSHODDXVrQFLDGDSRQWXDomR
' 'XDVH[SOLFDo}HVGRWUHLQDPHQWRSDUDFRQVXOWRUHV
LQLFLDQWHV ; UHFHEHUDPGHVWDTXHRFRQFHLWRGH33'HD CRASE
FRQVWUXomRGHWDEHODV3ULFH ; PDVSRURXWURODGRIDOWRX
IDODUGDVPHWDVGHYHQGDVDVVRFLDGDVDRVGRLVWHPDV $SDODYUDcrasepGHRULJHPJUHJDHVLJQLÀFD´IXVmRµ
( 'XDVH[SOLFDo}HV ; GRWUHLQDPHQWRSDUDFRQVXO- ´PLVWXUDµ 1D OtQJXD SRUWXJXHVD p R QRPH TXH VH Gi j
WRUHVLQLFLDQWHV ; UHFHEHUDPGHVWDTXH ; RFRQFHLWR ´MXQomRµGHGXDVYRJDLVLGrQWLFDVeGHJUDQGHLPSRUWkQ-
GH33'HDFRQVWUXomRGHWDEHODV3ULFH ; PDVSRURXWUR FLD D FUDVH GD SUHSRVLomR ´Dµ FRP R DUWLJR IHPLQLQR ´Dµ
ODGRIDOWRXIDODUGDVPHWDV ; GHYHQGDVDVVRFLDGDVDRV V  FRP R ´Dµ LQLFLDO GRV SURQRPHV DTXHOH V  DTXHOD V 
GRLVWHPDV DTXLORHFRPR´DµGRUHODWLYRDTXDO DVTXDLV 1DHVFUL-
WD XWLOL]DPRV R DFHQWR JUDYH  C  SDUD LQGLFDU D FUDVH 2
 $VVLQDOHLFRP ; RQGHHVWmRDVSRQWXDo}HVLQDGH- XVRDSURSULDGRGRDFHQWRJUDYHGHSHQGHGDFRPSUHHQVmR
TXDGDV GDIXVmRGDVGXDVYRJDLVeIXQGDPHQWDOWDPEpPSDUDR
$  1mR Ki G~YLGD GH TXH DV PXOKHUHV DPSOLDP  ;  HQWHQGLPHQWRGDFUDVHGRPLQDUDUHJrQFLDGRVYHUERVH
UDSLGDPHQWH ; VHXHVSDoRQDFDUUHLUDFLHQWtÀFD  DLQGD QRPHVTXHH[LJHPDSUHSRVLomR´Dµ$SUHQGHUDXVDUDFUD-
TXHRDYDQoRVHMDPDLVQRWiYHOHPDOJXQVSDtVHVR%UDVLOp VHSRUWDQWRFRQVLVWHHPDSUHQGHUDYHULÀFDUDRFRUUrQFLD
XPH[HPSORGRTXHHPRXWURV VLPXOWkQHD GH XPD SUHSRVLomR H XP DUWLJR RX SURQRPH
% 1mRKiG~YLGDGHTXH ; DVPXOKHUHV ; DP- 2EVHUYH
SOLDP UDSLGDPHQWH VHX HVSDoR QD FDUUHLUD FLHQWtÀFD  ;  9RXDDLJUHMD
DLQGDTXHRDYDQoRVHMDPDLVQRWiYHO ; HPDOJXQVSDt- Vou à igreja.
VHVR%UDVLOpXPH[HPSOR ; GRTXHHPRXWURV
& 1mRKiG~YLGDGHTXHDVPXOKHUHV ; DPSOLDP 1RH[HPSORDFLPDWHPRVDRFRUUrQFLDGDSUHSRVLomR
UDSLGDPHQWHVHXHVSDoR ; QDFDUUHLUDFLHQWtÀFD ; DLQ- ´DµH[LJLGDSHORYHUERLU LUDDOJXPOXJDU HDRFRUUrQFLD
GDTXHRDYDQoRVHMDPDLVQRWiYHOHPDOJXQVSDtVHV ; R GRDUWLJR´DµTXHHVWiGHWHUPLQDQGRRVXEVWDQWLYRIHPLQL-
%UDVLOpXPH[HPSORGRTXHHPRXWURV QRLJUHMD4XDQGRRFRUUHHVVHHQFRQWURGDVGXDVYRJDLVH
( 1mRKiG~YLGDGHTXHDVPXOKHUHVDPSOLDPUDSLGD- HODVVHXQHPDXQLmRGHODVpLQGLFDGDSHORDFHQWRJUDYH
PHQWH ; VHXHVSDoRQDFDUUHLUDFLHQWtÀFDDLQGDTXH ;  2EVHUYHRVRXWURVH[HPSORV
RDYDQoRVHMDPDLVQRWiYHOHPDOJXQVSDtVHV R%UDVLOpXP Conheço a aluna.
H[HPSOR GRTXHHPRXWURV 5HÀURPHjDOXQD

 $VVLQDOHLFRP ; RQGHHVWmRDVSRQWXDo}HVLQDGH- 1RSULPHLURH[HPSORRYHUERpWUDQVLWLYRGLUHWR FR-


TXDGDV QKHFHU DOJR RX DOJXpP  ORJR QmR H[LJH SUHSRVLomR H D
$ 6HDFULDQoDVHSHUGHUTXHPHQFRQWUiOD ; YHUi FUDVH QmR SRGH RFRUUHU1R VHJXQGR H[HPSOR R YHUER p
QDSXOVHLUDLQVWUXo}HVSDUDTXHHQYLH ; XPDPHQVDJHP WUDQVLWLYRLQGLUHWR UHIHULUVHDDOJRRXDDOJXpP HH[LJH
HOHWU{QLFDDRJUXSRRXDFLRQHRFyGLJRQDLQWHUQHW DSUHSRVLomR´Dµ3RUWDQWRDFUDVHpSRVVtYHOGHVGHTXHR
%  8P JHRORFDOL]DGRU WDPEpP  ;   DYLVDUi  ;   RV WHUPR VHJXLQWH VHMD IHPLQLQR H DGPLWD R DUWLJR IHPLQLQR
SDLVGHRQGHRFyGLJRIRLDFLRQDGR ´DµRXXPGRVSURQRPHVMiHVSHFLÀFDGRV

11
LÍNGUA PORTUGUESA

Casos em que a crase NÃO ocorre:

- diante de substantivos masculinos:


Andamos a cavalo.
Fomos a pé.
Passou a camisa a ferro.
Fazer o exercício a lápis.
Compramos os móveis a prazo.

GLDQWHGHYHUERVQRLQÀQLWLYR
A criança começou a falar.
Ela não tem nada a dizer.
2EVFRPRRVYHUERVQmRDGPLWHPDUWLJRVR´DµGRVH[HPSORVDFLPDpDSHQDVSUHSRVLomRORJRQmRRFRUUHUiFUDVH

- diante da maioria dos pronomes e das expressões de tratamento, com exceção das formas senhora, senhorita
e dona:
Diga a ela que não estarei em casa amanhã.
Entreguei a todos os documentos necessários.
Ele fez referência a Vossa Excelência no discurso de ontem.
Peço a Vossa Senhoria que aguarde alguns minutos.
2VSRXFRVFDVRVHPTXHRFRUUHFUDVHGLDQWHGRVSURQRPHVSRGHPVHULGHQWLÀFDGRVSHORPpWRGRWURTXHDSDODYUD
IHPLQLQDSRUXPDPDVFXOLQDFDVRQDQRYDFRQVWUXomRVXUJLUDIRUPDDRRFRUUHUiFUDVH3RUH[HPSOR
5HÀURPHjPHVPDSHVVRD 5HÀURPHDRPHVPRLQGLYtGXR
Informei o ocorrido à senhora ,QIRUPHLRRFRUULGRDRVHQKRU
Peça à própria Cláudia para sair mais cedo 3HoDDRSUySULR&OiXGLRSDUDVDLUPDLVFHGR

- diante de numerais cardinais:


Chegou a duzentos o número de feridos.
Daqui a uma semana começa o campeonato.

Casos em que a crase SEMPRE ocorre:

- diante de palavras femininas:


Amanhã iremos à festa de aniversário de minha colega.
Sempre vamos à praia no verão.
Ela disse à irmã o que havia escutado pelos corredores.
Sou grata à população.
Fumar é prejudicial à saúde.
Este aparelho é posterior à invenção do telefone.

- diante da palavra “moda”, com o sentido de “à moda de” PHVPRTXHDH[SUHVVmRPRGDGHÀTXHVXEHQWHQGLGD 


O jogador fez um gol à (moda de) Pelé.
Usava sapatos à (moda de) Luís XV.
Estava com vontade de comer frango à (moda de) passarinho.
O menino resolveu vestir-se à (moda de) Fidel Castro.

- na indicação de horas:
Acordei às sete horas da manhã.
Elas chegaram às dez horas.
Foram dormir à meia-noite

- em locuções adverbiais, prepositivas e conjuntivas de que participam palavras femininas3RUH[HPSOR


jWDUGH  jVRFXOWDV jVSUHVVDV jPHGLGDTXH
jQRLWH  jVFODUDV jVHVFRQGLGDV jIRUoD
jYRQWDGH  jEHoD  jODUJD  jHVFXWD
jVDYHVVDV  jUHYHOLD jH[FHomRGH jLPLWDomRGH
jHVTXHUGD  jVWXUUDV jVYH]HV jFKDYH
jGLUHLWD  jSURFXUD jGHULYD jWRD
jOX]  jVRPEUDGH jIUHQWHGH jSURSRUomRTXH
jVHPHOKDQoDGH jVRUGHQV jEHLUDGH

12
LÍNGUA PORTUGUESA

Crase diante de Nomes de Lugar Crase com os Pronomes Relativos A Qual, As Quais

$OJXQVQRPHVGHOXJDUQmRDGPLWHPDDQWHSRVLomRGR $ RFRUUrQFLD GD FUDVH FRP RV SURQRPHV UHODWLYRV a


DUWLJR´Dµ2XWURVHQWUHWDQWRDGPLWHPRDUWLJRGHPRGR quaOHas quaisGHSHQGHGRYHUER6HRYHUERTXHUHJHHV-
TXHGLDQWHGHOHVKDYHUiFUDVHGHVGHTXHRWHUPRUHJHQWH VHVSURQRPHVH[LJLUDSUHSRVLomR´DµKDYHUiFUDVHeSRV-
H[LMDDSUHSRVLomR´Dµ3DUDVDEHUVHXPQRPHGHOXJDUDG- VtYHOGHWHFWDUDRFRUUrQFLDGDFUDVHQHVVHVFDVRVXWLOL]DQGR
PLWHRXQmRDDQWHSRVLomRGRDUWLJRIHPLQLQR´DµGHYHVH DVXEVWLWXLomRGRWHUPRUHJLGRIHPLQLQRSRUXPWHUPRUH-
VXEVWLWXLURWHUPRUHJHQWHSRUXPYHUERTXHSHoDDSUHSR- JLGRPDVFXOLQR3RUH[HPSOR
VLomR´GHµRX´HPµ$RFRUUrQFLDGDFRQWUDomR´GDµRX´QDµ $LJUHMDjTXDOPHUHÀURÀFDQRFHQWURGDFLGDGH
SURYDTXHHVVHQRPHGHOXJDUDFHLWDRDUWLJRHSRULVVR 2 PRQXPHQWR DR TXDO PH UHÀUR ÀFD QR FHQWUR GD FL-
KDYHUiFUDVH3RUH[HPSOR dade.
Vou à França 9LPGD>GHD@)UDQoD(VWRXQD>HPD@ &DVRVXUMDDIRUPDDRFRPDWURFDGRWHUPRRFRUUHUiD
)UDQoD FUDVH9HMDRXWURVH[HPSORV
Cheguei à Grécia 9LPGD*UpFLD(VWRXQD*UpFLD São normas às quais todos os alunos devem obedecer.
Retornarei à Itália 9LPGD,WiOLD(VWRXQD,WiOLD Esta foi a conclusão à qual ele chegou.
Vou a Porto Alegre. 9LPGH3RUWR$OHJUH(VWRXHP3RU- Várias alunas às quais ele fez perguntas não souberam
WR$OHJUH  responder nenhuma das questões.
A sessão à qual assisti estava vazia.
*- Dica da Zê!XVHDUHJULQKD´9RX$YROWR'$FUDVH
+ÉYRX$YROWR'(FUDVH35$48È"µ Crase com o Pronome Demonstrativo “a”
([Vou a Campinas. = Volto de Campinas.
 Vou à praia. = Volto da praia. $RFRUUrQFLDGDFUDVHFRPRSURQRPHGHPRQVWUDWLYR
´DµWDPEpPSRGHVHUGHWHFWDGDDWUDYpVGDVXEVWLWXLomRGR
ATENÇÃOTXDQGRRQRPHGHOXJDUHVWLYHUHVSHFLÀ- WHUPR UHJHQWH IHPLQLQR SRU XP WHUPR UHJLGR PDVFXOLQR
FDGRRFRUUHUiFUDVH9HMD 9HMD
Retornarei à São Paulo dos bandeirantes.   PHVPR Minha revolta é ligada à do meu país.
TXHSHODUHJULQKDDFLPDVHMDDGR´92/72'(µ Meu luto é ligado ao do meu país.
Irei à Salvador de Jorge Amado. As orações são semelhantes às de antes.
Os exemplos são semelhantes aos de antes.
Crase diante dos Pronomes Demonstrativos
Suas perguntas são superiores às dele.
Seus argumentos são superiores aos dele.
Aquele (s), Aquela (s), Aquilo
Sua blusa é idêntica à de minha colega.
+DYHUi FUDVH GLDQWH GHVVHV SURQRPHV VHPSUH TXH R Seu casaco é idêntico ao de minha colega.
WHUPRUHJHQWHH[LJLUDSUHSRVLomR´Dµ3RUH[HPSOR
5HÀURPH D DTXHOH DWHQWDGR A Palavra Distância
3UHSRVLomR 3URQRPH
5HÀURPHjTXHOHDWHQWDGR 6HDSDODYUDGLVWkQFLDHVWLYHUHVSHFLÀFDGDGHWHUPLQD-
GDDFUDVHGHYHRFRUUHU3RUH[HPSOR6XDFDVDÀFDjGLV-
2WHUPRUHJHQWHGRH[HPSORDFLPDpRYHUERWUDQVL- tância de 100km daqui. $SDODYUDHVWiGHWHUPLQDGD
WLYR LQGLUHWR UHIHULU UHIHULUVH D DOJR RX DOJXpP  H H[LJH 7RGRVGHYHPÀFDUjGLVWkQFLDGHPHWURVGRSDOFR $
SUHSRVLomR SRUWDQWR RFRUUH D FUDVH 2EVHUYH HVWH RXWUR SDODYUDHVWiHVSHFLÀFDGD
H[HPSOR
Aluguei aquela casa. 6HDSDODYUDGLVWkQFLDQmRHVWLYHUHVSHFLÀFDGDDFUDVH
QmRSRGHRFRUUHU3RUH[HPSOR
2YHUER´DOXJDUµpWUDQVLWLYRGLUHWR DOXJDUDOJR HQmR 2VPLOLWDUHVÀFDUDPDGLVWkQFLD
H[LJHSUHSRVLomR/RJRDFUDVHQmRRFRUUHQHVVHFDVR9HMD Gostava de fotografar a distância.
RXWURVH[HPSORV Ensinou a distância.
Dediquei àquela senhora todo o meu trabalho. Dizem que aquele médico cura a distância.
Quero agradecer àqueles que me socorreram. Reconheci o menino a distância.
5HÀURPHjTXLORTXHDFRQWHFHXFRPVHXSDL
Não obedecerei àquele sujeito. 2EVHUYDomRSRUPRWLYR GHFODUH]Dpara evitar ambi-
$VVLVWLjTXHOHÀOPHWUrVYH]HV guidade, pode-se usar a crase.9HMD
Espero aquele rapaz. Gostava de fotografar à distância.
Fiz aquilo que você disse. Ensinou à distância.
Comprei aquela caneta. Dizem que aquele médico cura à distância.

13
LÍNGUA PORTUGUESA

Casos em que a ocorrência da crase é FACULTATIVA  $JHQWHGH$SRLR$GPLQLVWUDWLYR²)&&² /HLD


RWH[WRDVHJXLU
- diante de nomes próprios femininos: )RLSRUHVVHWHPSRTXH5LWDGHVFRQÀDGDHPHGURVDFRU-
2EVHUYDomRpIDFXOWDWLYRRXVRGDFUDVHGLDQWHGHQR- reu ______ cartomante para consultá-la sobre a verdadeira
PHVSUySULRVIHPLQLQRVSRUTXHpIDFXOWDWLYRRXVRGRDU- causa do procedimento de Camilo. Vimos que ______ carto-
WLJR2EVHUYH PDQWHUHVWLWXLXOKHBBBBBBFRQÀDQoDHTXHRUDSD]UHSUHHQ-
Paula é muito bonita. Laura é minha amiga. deu-a por ter feito o que fez.
A Paula é muito bonita. A Laura é minha amiga. 0DFKDGRGH$VVLV$FDUWRPDQWH,Q9iULDVKLVWyULDV
5LRGH-DQHLUR*ORERS
&RPRSRGHPRVFRQVWDWDUpIDFXOWDWLYRRXVRGRDUWLJR
3UHHQFKHPFRUUHWDPHQWHDVODFXQDVGDIUDVHDFLPDQD
IHPLQLQRGLDQWHGHQRPHVSUySULRVIHPLQLQRVHQWmRSRGH-
RUGHPGDGD
PRVHVFUHYHUDVIUDVHVDEDL[RGDVVHJXLQWHVIRUPDV
Entreguei o cartão a Paula. Entreguei o cartão a Ro- $ j²D²D
berto. % D²D²j
Entreguei o cartão à Paula. Entreguei o cartão ao Ro- & j²D²j
berto. ' j²j²D
- diante de pronome possessivo feminino: ( D²j²j
2EVHUYDomRpIDFXOWDWLYRRXVRGDFUDVHGLDQWHGHSUR-
QRPHVSRVVHVVLYRVIHPLQLQRVSRUTXHpIDFXOWDWLYRRXVRGR “Nesta oportunidade, volto ___ referir-me ___ proble-
DUWLJR2EVHUYH mas já expostos ___ V. Sª ___ alguns dias”
Minha avó tem setenta anos. Minha irmã está esperan- D jjTXHOHVDKi
do por você. E DjTXHOHVDKi
A minha avó tem setenta anos. A minha irmã está es- F DDTXHOHVjD
perando por você. G jjTXHOHVDD
6HQGRIDFXOWDWLYRRXVRGRDUWLJRIHPLQLQRGLDQWHGH H DDTXHOHVjKi
SURQRPHVSRVVHVVLYRVIHPLQLQRVHQWmRSRGHPRVHVFUHYHU
DVIUDVHVDEDL[RGDVVHJXLQWHVIRUPDV  $JHQWH7pFQLFR²)&&²DGDS Claro que não
Cedi o lugar a minha avó. Cedi o lugar a meu avô. me estou referindo a essa vulgar comunicação festiva e
Cedi o lugar à minha avó. Cedi o lugar ao meu avô.
efervescente.

2YRFiEXORaGHYHUiUHFHEHURVLQDOLQGLFDWLYRGHFUDVH
- depois da preposição até:
Fui até a praia. ou Fui até à praia. VHRVHJPHQWRJULIDGRIRUVXEVWLWXtGRSRU
Acompanhe-o até a porta. ou Acompanhe-o $ OHLWXUDDSUHVVDGDHVHPSURIXQGLGDGH
até à porta. % FDGDXPGHQyVQHVWHIRUPLJXHLUR
A palestra vai até as cinco horas da tarde. ou A & H[HPSORGHREUDVSXEOLFDGDVUHFHQWHPHQWH
palestra vai até às cinco horas da tarde. ' XPDFRPXQLFDomRIHVWLYDHYLUWXDO
( UHVSHLWRGHDXWRUHVUHFRQKHFLGRVSHORS~EOLFR
Questões sobre Crase
 $JHQWHGH(VFROWDH9LJLOkQFLD3HQLWHQFLiULD²98-
 (VFUHYHQWH7-63²9XQHVS No Brasil, as dis- 1(63² 
cussões sobre drogas parecem limitar-se ______aspectos ju- O Instituto Nacional de Administração Prisional (INAP)
rídicos ou policiais. É como se suas únicas consequências também desenvolve atividades lúdicas de apoio______ res-
estivessem em legalismos, tecnicalidades e estatísticas cri- socialização do indivíduo preso, com o objetivo de prepará-
minais. Raro ler ____respeito envolvendo questões de saúde -lo para o retorno______ sociedade. Dessa forma, quando em
pública como programas de esclarecimento e prevenção, de OLEHUGDGH HOH HVWDUi FDSDFLWDGRBBBBBB WHU XPD SURÀVVmR H
tratamento para dependentes e de reintegração desses____ uma vida digna.
vida. Quantos de nós sabemos o nome de um médico ou 'LVSRQtYHOHPZZZPHWURSROLWDQDFRPEUEORJ
clínica ____quem tentar encaminhar um drogado da nossa
TXDOBHBDBLPSRUWDQFLDBGDBUHVVRFLDOL]DFDRBGHBSUHVRV$FHV-
própria família?
VRHP$GDSWDGR
5X\&DVWUR'DQRVVDSUySULDIDPtOLD)ROKDGH63DX-
OR$GDSWDGR
$VVLQDOHDDOWHUQDWLYDTXHSUHHQFKHFRUUHWDHUHVSHFWL-
$VODFXQDVGRWH[WRGHYHPVHUSUHHQFKLGDVFRUUHWDH YDPHQWHDVODFXQDVGRWH[WRGHDFRUGRFRPDQRUPDSD-
UHVSHFWLYDPHQWHFRP GUmRGDOtQJXDSRUWXJXHVD
$ DRV¬j¬D¬D $ j¬j¬j
% DRV¬D¬j¬D % D¬D¬j
& D¬D¬j¬j & D¬j¬j
' j¬j¬j¬j ' j¬jD
( D¬D¬D¬D ( D¬j¬D

14
LÍNGUA PORTUGUESA

 O Ministro informou que iria resistir _____ pressões   FRUUHX Bj  SDUD D  FDUWRPDQWH SDUD FRQVXOWiOD
FRQWUiULDV BBBBB PRGLÀFações relativas _____ aquisição da VREUHDYHUGDGHLUDFDXVDGRSURFHGLPHQWRGH&DPLOR9L-
casa própria. PRVTXHBDBBFDUWRPDQWH REMHWRGLUHWR UHVWLWXLXOKHBBBDBBB
D jVjTXHODVBj FRQÀDQoD REMHWRGLUHWR HTXHRUDSD]UHSUHHQGHXDSRU
E DVDTXHODVD WHUIHLWRRTXHIH]
F jVjTXHODVD
G jVDTXHODVj  ´1HVWDRSRUWXQLGDGHYROWRBDBUHIHULUPHjTXHOHVBB
H DVjTXHODVj SUREOHPDVMiH[SRVWRVDB96BKiBDOJXQVGLDVµ
DUHIHULU DQWHVGHYHUERQRLQÀQLWRQmRKiFUDVH
 $JHQWHGH(VFROWDH9LJLOkQFLD3HQLWHQFLiULD²98- TXHPID]UHIHUrQFLDID]UHIHUrQFLD$DOJRRX$DO-
1(63²DGDS 2DFHQWRLQGLFDWLYRGHFUDVHHVWiFRU- JXpP DUHJrQFLDGRYHUERSHGHSUHSRVLomR
UHWDPHQWHHPSUHJDGRHP DQWHVGHSURQRPHGHWUDWDPHQWRQmRKiFUDVH H[FH-
$ 7HQGrQFLDVDJUHVVLYDVFRPHoDPjVHUUHODFLRQDGDV omRjVHQKRUDTXHDGPLWHDUWLJR 
FRPDVGLÀFXOGDGHVSDUDOLGDUFRPDVIUXVWUDo}HVGHVHXV KiQRVHQWLGRGHWHPSRSDVVDGR
GHVHMRV
%  $ DJUHVVLYLGDGH LPSXOVLYD GHYHVH j SHUWXUEDo}HV  &ODURTXHQmRPHHVWRXUHIHULQGRjOHLWXUDDSUHVVD-
QRVPHFDQLVPRVELROyJLFRVGHFRQWUROHHPRFLRQDO GDHVHPSURIXQGLGDGH
& $YLROrQFLDXUEDQDpFRPSDUDGDjXPDHQIHUPLGDGH DFDGDXPGHQyVQHVWHIRUPLJXHLUR DQWHVGHSURQR-
' &RQGLo}HVGHULVFRDOLDGDVjH[HPSORGHLPSXQLGD- PHLQGHÀQLGR
GHDOLPHQWDPDYLROrQFLDFUHVFHQWHQDVFLGDGHV DH[HPSORGHREUDVSXEOLFDGDVUHFHQWHPHQWH SDODYUD
( 8PDPELHQWHGHVIDYRUiYHOjIRUPDomRGDSHUVRQDOL- PDVFXOLQD
GDGHDWLQJHRVPDLVYXOQHUiYHLV DXPDFRPXQLFDomRIHVWLYDHYLUWXDO DUWLJRLQGHÀQL-
 $JHQWHGH9LJLOkQFLDH5HFHSomR²981(63²  GR
2VLQDOLQGLFDWLYRGHFUDVHHVWiFRUUHWRHP DUHVSHLWRGHDXWRUHVUHFRQKHFLGRVSHORS~EOLFR SD-
$  (VWH FLHQWLVWD WHP VH GHGLFDGR j XPD SHVTXLVD QD ODYUDPDVFXOLQD
iUHDGHELRWHFQRORJLD
% 2VSDLVQmRSRGHPVHURPLVVRVHGHYHPVHGHGLFDU
  2 ,QVWLWXWR 1DFLRQDO GH $GPLQLVWUDomR 3ULVLR-
jHGXFDomRGRVÀOKRV
QDO ,1$3  WDPEpP GHVHQYROYH DWLYLGDGHV O~GLFDV GH
& 1RVVDVtQGLFDGHGLFDVHLQWHJUDOPHQWHjFRQVHUYDU
DSRLRBBBjBBUHVVRFLDOL]DomRGRLQGLYtGXRSUHVRFRPRRE-
DVLQVWDODo}HVGRSUpGLR
MHWLYRGHSUHSDUiORSDUDRUHWRUQRBBBjBBVRFLHGDGH'HVVD
'  2 ERPEHLUR GHYH GHGLFDU VXD DWHQomR j TXDOTXHU
IRUPD TXDQGR HP OLEHUGDGH HOH HVWDUi FDSDFLWDGRBBDBBB
GHWDOKHTXHHQYROYDDVHJXUDQoDGDVSHVVRDV
WHUXPDSURÀVVmRHXPDYLGDGLJQD
(  e IXQomR GD SROtWLFD p GHGLFDUVH j WRGR SUREOHPD
TXHFRPSURPHWDREHPHVWDUGRFLGDGmR $SRLRD"5HJrQFLDQRPLQDOSHGHSUHSRVLomR
UHWRUQRD"UHJrQFLDQRPLQDOSHGHSUHSRVLomR
 $JHQWH (GXFDFLRQDO ² 981(63 ²   $VVLQDOH DQWHVGHYHUERQRLQÀQLWLYRQmRKiFUDVH
DDOWHUQDWLYDHPTXHDVHTXrQFLDGDIUDVHDVHJXLUWUD]R
XVRFRUUHWRGRDFHQWRLQGLFDWLYRGHFUDVHGHDFRUGRFRPD  20LQLVWURLQIRUPRXTXHLULDUHVLVWLUBjVBBSUHVV}HV
QRUPDSDGUmRGDOtQJXDSRUWXJXHVD FRQWUiULDV jTXHODVB PRGLÀFDo}HV UHODWLYDV BBjB DTXLVLomR
GDFDVDSUySULD
Um bom conhecimento de matemática é indispensável UHVLVWLUD"UHJrQFLDYHUEDOSHGHSUHSRVLomR
$ jWRGRHTXDOTXHUHVWXGDQWH FRQWUiULDD"UHJrQFLDQRPLQDOSHGHSUHSRVLomR
% jHVWXGDQWHVGHQtYHOVXSHULRU UHODWLYDVD"UHJrQFLDQRPLQDOSHGHSUHSRVLomR
& jTXHPSUHWHQGHFDUUHLUDVQRFDPSRGHH[DWDV
' jFRQVWUXomRGRVDEHUQDVPDLVGLYHUVDViUHDV  
( jXPDERDIRUPDomRSURÀVVLRQDO $ 7HQGrQFLDVDJUHVVLYDVFRPHoDPjVHUUHODFLRQDGDV
FRPDVGLÀFXOGDGHVSDUDOLGDUFRPDVIUXVWUDo}HVGHVHXV
GABARITO GHVHMRV DQWHVGHYHUERQRLQÀQLWLYRQmRKiFUDVH
%  $ DJUHVVLYLGDGH LPSXOVLYD GHYHVH j SHUWXUEDo}HV
01. B 02. A 03. B 04. A 05. D QRV PHFDQLVPRV ELROyJLFRV GH FRQWUROH HPRFLRQDO    VH
06. A 07. E 08. B 09. D R´DµHVWiQRVLQJXODUHDQWHFHGHSDODYUDQRSOXUDOQmRKi
FUDVH
RESOLUÇÃO & $YLROrQFLDXUEDQDpFRPSDUDGDjXPDHQIHUPLGDGH
DUWLJRLQGHÀQLGR
 OLPLWDUVHBDRVBDVSHFWRVMXUtGLFRVRXSROLFLDLV ' &RQGLo}HVGHULVFRDOLDGDVjH[HPSORGHLPSXQLGD-
5DUROHUBBDBBUHVSHLWR DQWHVGHSDODYUDPDVFXOLQD GH DOLPHQWDP D YLROrQFLD FUHVFHQWH QDV FLGDGHV SDODYUD
QmRKiFUDVH GHUHLQWHJUDomRGHVVHVBjBYLGD UHLQWHJUDU PDVFXOLQD
DDYLGD j RQRPHGHXPPpGLFRRXFOtQLFDBBDBTXHP ( 8PDPELHQWHGHVIDYRUiYHOjIRUPDomRGDSHUVRQDOL-
WHQWDU HQFDPLQKDU XP GURJDGR GD QRVVD SUySULD IDPtOLD" GDGHDWLQJHRVPDLVYXOQHUiYHLV correta UHJrQFLDQRPL-
DQWHVGHSURQRPHLQGHÀQLGRUHODWLYR QDOGHVIDYRUiYHOa"

15
LÍNGUA PORTUGUESA

  &ODVVLÀFDomRGRV)RQHPDV
$  (VWH FLHQWLVWD WHP VH GHGLFDGR j XPD SHVTXLVD QD
iUHDGHELRWHFQRORJLD DUWLJRLQGHÀQLGR 2V IRQHPDV FODVVLÀFDPVH HP YRJDLV VHPLYRJDLV H
% 2VSDLVQmRSRGHPVHURPLVVRVHGHYHPVHGHGLFDU FRQVRDQWHV
jHGXFDomRGRVÀOKRV correta UHJrQFLDYHUEDOGHGLFDU
D Vogais: VmR IRQHPDV UHVXOWDQWHV GDV YLEUDo}HV GDV
& 1RVVDVtQGLFDGHGLFDVHLQWHJUDOPHQWHjFRQVHUYDU FRUGDVYRFDLVHHPFXMDSURGXomRDFRUUHQWHGHDUSDVVD
DVLQVWDODo}HVGRSUpGLR YHUERQRLQÀQLWLYR OLYUHPHQWH QD FDYLGDGH EXFDO $V YRJDLV SRGHP VHU RUDLV
'  2 ERPEHLUR GHYH GHGLFDU VXD DWHQomR j TXDOTXHU HQDVDLV
GHWDOKHTXHHQYROYDDVHJXUDQoDGDVSHVVRDV SURQRPH Orais:TXDQGRDFRUUHQWHGHDUSDVVDDSHQDVSHODFDYL-
LQGHÀQLGR GDGHEXFDO6mRHODVDprLy{X([HPSORVMáSéYê
(  e IXQomR GD SROtWLFD p GHGLFDUVH j WRGR SUREOHPD DOiSóGoUuYD
Nasais: TXDQGR D FRUUHQWH GH DU SDVVD SHOD FDYLGDGH
TXHFRPSURPHWDREHPHVWDUGRFLGDGmR SURQRPHLQ-
EXFDO H QDVDO $ QDVDOLGDGH SRGH VHU LQGLFDGD SHOR WLO a 
GHÀQLGR
RXSHODVOHWUDVQHP([HPSORVPãHYenGDOinGRSomED
 8PERPFRQKHFLPHQWRGHPDWHPiWLFDpLQGLVSHQ-
QunFD
ViYHOjFRQVWUXomRGRVDEHUQDVPDLVGLYHUVDViUHDV
$ jWRGRHTXDOTXHUHVWXGDQWH SURQRPHLQGHÀQLGR 2EVHUYDomR$VYRJDLVDLQGDSRGHPVHUW{QLFDVRXiWR-
% jHVWXGDQWHVGHQtYHOVXSHULRU ´DµQRVLQJXODUDQWHV QDVGHSHQGHQGRGDLQWHQVLGDGHFRPTXHVmRSURQXQFLD-
GHSDODYUDQRSOXUDO GDV$YRJDOW{QLFDpSURQXQFLDGDFRPPDLRULQWHQVLGDGH
&  j TXHP SUHWHQGH FDUUHLUDV QR FDPSR GH H[DWDV FDIéEoODYiGUR$YRJDOiWRQDpSURQXQFLDGDFRPPHQRU
SURQRPHLQGHÀQLGRUHODWLYR LQWHQVLGDGHFaIpEROaYLGUo
( jXPDERDIRUPDomRSURÀVVLRQDO DUWLJRLQGHÀQLGR
Semivogais:VmRRVIRQHPDVLHXTXDQGRMXQWRV
GHXPDYRJDOIRUPDPFRPHODXPDPHVPDVtODED2EVHU-
LETRA E FONEMA YH SRU H[HPSOR D SDODYUD SDSDL (OD p IRUPDGD GH GXDV
VtODEDVSDSDL1DVtODEDSDLRIRQHPDYRFiOLFRLQmRp
Letra p R VLQDO JUiÀFR GD HVFULWD ([HPSORV SLSRFD WmRIRUWHTXDQWRRIRQHPDYRFiOLFRDQHVVHFDVRRLp
WHPOHWUDV KRMH WHPOHWUDV  VHPLYRJDO

Fonema p R PHQRU HOHPHQWR VRQRUR FDSD] GH HVWD- Consoantes:VmRRVIRQHPDVHPTXHDFRUUHQWHGHDU


EHOHFHU XPD GLVWLQomR GH VLJQLÀFDGR HQWUH SDODYUDV 9HMD HPLWLGD SDUD VXD SURGXomR WHYH GH IRUoDU SDVVDJHP QD
QRV H[HPSORV RV IRQHPDV TXH PDUFDP D GLVWLQomR HQWUH ERFDRQGHGHWHUPLQDGRPRYLPHQWRDUWLFXODWyULROKHFULRX
RVSDUHVGHSDODYUDV HPEDUDoR([HPSORVgatRpHnDladR

bDU²mDUtHOD²vHODVeOD²VaOD Encontro Vocálicos

1mRFRQIXQGDRVIRQHPDVFRPDVOHWUDV)RQHPDpXP  Ditongos: p R HQFRQWUR GH XPD YRJDO H XPD VHPL-


HOHPHQWRDF~VWLFRHDOHWUDpXPVLQDOJUiÀFRTXHUHSUH- YRJDO RX YLFHYHUVD  QXPD PHVPD VtODED ([HPSORV Sai
VHQWD R IRQHPD 1HP VHPSUH R Q~PHUR GH IRQHPDV GH YRJDOVHPLYRJDO GLWRQJRGHFUHVFHQWH JLQiVio VHPL-
XPDSDODYUDFRUUHVSRQGHDRQ~PHURGHOHWUDVTXHXVDPRV YRJDOYRJDO GLWRQJRFUHVFHQWH 
Tritongos:pRHQFRQWURGHXPDVHPLYRJDOFRPXPD
SDUD HVFUHYrOD 1D SDODYUD FKXYD SRU H[HPSOR WHPRV
YRJDOHRXWUDVHPLYRJDOQXPDPHVPDVtODED([HPSOR3D-
TXDWUR IRQHPDV LVWR p TXDWUR XQLGDGHV VRQRUDV >[XYD@ H
raguai
FLQFROHWUDV
 Hiatos: p D VHTXrQFLD GH GXDV YRJDLV QXPD PHVPD
&HUWRVIRQHPDVSRGHPVHUUHSUHVHQWDGRVSRUGLIHUHQ-
SDODYUDPDVTXHSHUWHQFHPDVtODEDVGLIHUHQWHVSRLVQXQFD
WHVOHWUDVeRFDVRGRIRQHPDVTXHSRGHVHUUHSUHVHQWD- KiPDLVGHXPDYRJDOQXPDVtODED([HPSORVVaíGD Va-í-
GRSRUs SHQsDU ²ss SDssDGR ²x WURXxH ²ç FDçDU ²sc GD Mui] Mu-i]
QDscHU ²xc HxcHOHQWH ²c cLQWR ²sç GHsçR
Encontro Consonantais
­VYH]HVDOHWUD´[µSRGHUHSUHVHQWDUPDLVGHXPIRQH-
PDFRPRQDSDODYUDWi[L1HVVHFDVRR´[µUHSUHVHQWDGRLV 2FRUUHTXDQGRKiXPJUXSRGHFRQVRDQWHVVHPYRJDO
VRQVSRLVOHPRV´WiNVLµ3RUWDQWRDSDODYUDWi[LWHPTXDWUR LQWHUPHGLiULD([HPSORVÁRUgrDGHGLgnR
OHWUDVHFLQFRIRQHPDV
(P FHUWDV SDODYUDV DOJXPDV OHWUDV QmR UHSUHVHQWDP Dígrafos
QHQKXP IRQHPD FRPR D OHWUD K SRU H[HPSOR HP SDOD-
YUDVFRPRKRUDKRMHHWFRXFRPRDVOHWUDVPHQTXDQGR *UXSRGHGXDVOHWUDVTXHUHSUHVHQWDDSHQDVXPIRQH-
VmRXVDGDVDSHQDVSDUDLQGLFDUDQDVDOL]DomRGHXPDYRJDO PD ([HPSORV SDssR VV  IRQHPD V  QDscLPHQWR VF 
FRPRHPFDQWRWLQWDHWF IRQHPDV quHLMR TX IRQHPDN

16
LÍNGUA PORTUGUESA

Os dígrafos podem ser consonantais e vocálicos. ,QGLTXHDDOWHUQDWLYDFXMDVHTXrQFLDGHYRFiEXORV


DSUHVHQWD QD PHVPD RUGHP R VHJXLQWH GLWRQJR KLDWR
- Consonantais: FK FKXYD  VF QDVFHU  VV RVVR  Vo KLDWRGLWRQJR
GHVoD OK ÀOKR [F H[FHOHQWH TX TXHQWH QK YLQKR UU D MDPDLV'HXVOXDUGDt
IHUUR JX JXHUUD E MRLDVÁXLUMHVXtWDIRJDUpX
- Vocálicos:DPDQ WDPSDFDQWR HPHQ WHPSRYHQ- F yGLRVDJXmROHDOSRHLUD
WR LP LQ OLPSRFLQWR RP RQ FRPSUDUWRQWR XP XQ
G TXDLVIXJLXFDLXKLVWyULD
WXPEDPXQGR
2VYRFDEXOiULRVSDVVDULQKRHTXHULGDSRVVXHP
$WHQomRQRVGtJUDIRVDVGXDVOHWUDVUHSUHVHQWDPXP
VyIRQHPDQRVHQFRQWURVFRQVRQDQWDLVFDGDOHWUDUHSUH- D HIRQHPDVUHVSHFWLYDPHQWH
VHQWDXPIRQHPD E HIRQHPDVUHVSHFWLYDPHQWH
F HIRQHPDVUHVSHFWLYDPHQWH
2EVHUYH GH DFRUGR FRP RV H[HPSORV TXH R Q~PHUR G HIRQHPDVUHVSHFWLYDPHQWH
GHOHWUDVHIRQHPDVQmRSUHFLVDPWHUDPHVPDTXDQWLGDGH H HIRQHPDVUHVSHFWLYDPHQWH
&KXYDWHPOHWUDVHIRQHPDVMiTXHR´FKµWHP
XP~QLFRVRP 4XDQWRVIRQHPDVH[LVWHPQDSDODYUDSDUDOHOHStSH-
+LSRSyWDPRWHPOHWUDVHIRQHPDVMiTXHR´Kµ GR
QmRWHPVRP
*DOLQKDWHPOHWUDVHIRQHPDVMiTXHR´QKµWHP
XP~QLFRVRP D 
3iVVDURWHPOHWUDVHIRQHPDVMiTXHR´VVµVyWHP E 
XP~QLFRVRP F 
1DVFLPHQWROHWUDVHIRQHPDVMiTXHQmRVHSUR- G 
QXQFLDR´VµHR´HQµWHPXP~QLFRVRP H 
([FHomROHWUDVHIRQHPDVMiTXHQmRWHPVRPR
´[µ 2VYRFiEXORVSHTXHQLQRHGUDPDDSUHVHQWDPUHV-
7i[L  OHWUDVH  IRQHPDV Mi TXHR ´[µWHP VRP GH SHFWLYDPHQWH
´NVµ
*XLWDUUDOHWUDVHIRQHPDVMiTXHR´JXµWHPXP
D HIRQHPDV
~QLFRVRPHR´UUµWDPEpPWHPXP~QLFRVRP
4XHLMROHWUDVHIRQHPDVMiTXHR´TXµWHPXP E HIRQHPDV
~QLFRVRP F HIRQHPDV
G HIRQHPDV
5HSDUHTXHDWUDYpVGRH[HPSORDPXGDQoDGHDSHQDV H HIRQHPDV
XPDOHWUDRXIRQHPDJHUDQRYDVSDODYUDV&DYDOR&DY
DGR&DODGR&RODGR6RODGR 2´,µQmRpVHPLYRJDOHP

EXERCÍCIOS D 3DSDL
E $]XLV
 $ SDODYUD TXH DSUHVHQWD WDQWRV IRQHPDV TXDQWDV F 0pGLR
VmRDVOHWUDVTXHDFRPS}HPp
G 5DLQKD
D LPSRUWkQFLD
E PLOKDUHV H +HUyL
F VHTXHU
G WpFQLFD $VVLQDOHDDOWHUQDWLYDTXHDSUHVHQWDDSHQDVKLDWRV
H DGROHVFHQWH
D PXLWRIDtVFDEDOD~VWUH
(PTXDOGDVSDODYUDVDEDL[RDOHWUD[DSUHVHQWDQmR E JXHUUHLURJUDWXLWRLQWXLWR
XPPDVGRLVIRQHPDV" F ÁXLGRIRUWXLWR3LDXt
D H[HPSOR G WXDOXDQXD
E FRPSOH[R H QGD
F SUy[LPRV
G H[HFXWLYR
H OX[R (PTXDOGRVLWHQVDEDL[RWRGDVDVSDODYUDVDSUHVHQ-
WDPGLWRQJRFUHVFHQWH
4XDOSDODYUDSRVVXLGRLVGtJUDIRV"
D IHFKDU D /HL)RLFH5RXER
E VRPEUD E 0XLWR$OHPmR9LX
F QLQKDULD F /LQJXLoD+LVWyULDÉUHD
G FRUUHQGR G +HUyL-HLWR4XLOR
H SrVVHJR H (TXHVWUH7rQXH5LEHLUmR

17
LÍNGUA PORTUGUESA

RESPOSTAS: Acento Tônico

01' (PGDSDODYUDSRVVXLIRQHPDVHOHWUDV1DV 1D HPLVVmR GH XPD SDODYUD GH GXDV RX PDLV VtODEDV
GHPDLVDOWHUQDWLYDVWHPVHD IRQHPDVOHWUDVE  SHUFHEHVHTXHKiXPDVtODEDGHPDLRULQWHQVLGDGHVRQRUD
IRQHPDVOHWUDVF IRQHPDVOHWUDVH IRQHPDV GRTXHDVGHPDLV
OHWUDV  calor DVtODEDlorpDGHPDLRULQWHQVLGDGH
% DSDODYUDFRPSOH[RR[HTXLYDOHDRIRQHPDNV  faceiro - DVtODEDceipDGHPDLRULQWHQVLGDGH
' (PGKiRGtJUDIR´UUµHRGtJUDIRQDVDO´HQµ  sólido DVtODED só pDGHPDLRULQWHQVLGDGH
% 2EVHUYHRVHQFRQWURVRLXLXtHHX 
2EV D SUHVHQoD GD VtODED GH PDLRU LQWHQVLGDGH QDV
''&''&
SDODYUDV HP PHLR j VtODEDV GH PHQRU LQWHQVLGDGH p XP
GRVHOHPHQWRVTXHGmRPHORGLDjIUDVH
SÍLABA
&ODVVLÀFDomRGDVtODEDTXDQWRDLQWHQVLGDGH
$ SDODYUD amor HVWi GLYLGLGD HP JUXSRV GH IRQHPDV
SURQXQFLDGRV VHSDUDGDPHQWH D  PRU $ FDGD XP GHV- -Tônica: pDVtODEDSURQXQFLDGDFRPPDLRULQWHQVLGDGH
VHV JUXSRV SURQXQFLDGRV QXPD Vy HPLVVmR GH YR] GiVH - Átona: pDVtODEDSURQXQFLDGDFRPPHQRULQWHQVLGD-
RQRPHGHsílaba(PQRVVDOtQJXDRQ~FOHRGDVtODEDp GH
VHPSUH XPD YRJDO QmR H[LVWH VtODED VHP YRJDO H QXQFD - Subtônica: p D VtODED GH LQWHQVLGDGH LQWHUPHGLiULD
KiPDLVGRTXHXPDYRJDOHPFDGDVtODED'HVVDIRUPD 2FRUUHSULQFLSDOPHQWHQDVSDODYUDVderivadasFRUUHVSRQ-
SDUDVDEHUPRVRQ~PHURGHVtODEDVGHXPDSDODYUDGHYH- GHQGRjW{QLFDGDSDODYUDSULPLWLYD
PRV SHUFHEHU TXDQWDV YRJDLV WHP HVVD SDODYUD $WHQomR
DVOHWUDViHu PDLVUDUDPHQWHFRPDVOHWUDVeHo SRGHP &ODVVLÀFDomRGDVSDODYUDVTXDQWRjSRVLomRGDVt-
UHSUHVHQWDUVHPLYRJDLV
laba tônica

'HDFRUGRFRPDSRVLomRGDVtODEDW{QLFDRVYRFiEX-
&ODVVLÀFDomRGDVSDODYUDVTXDQWRDRQ~PHURGHVt- ORVGDOtQJXDSRUWXJXHVDTXHFRQWrPGXDVRXPDLVVtODEDV
labas VmRFODVVLÀFDGRVHP
- Oxítonos: VmR DTXHOHV FXMD VtODED W{QLFD p D ~OWLPD
- Monossílabas:SRVVXHPDSHQDVXPDVtODED([HPSORV ([HPSORVDvóXUXbuSDUDEéns
PmHÁRUOiPHX - Paroxítonos: VmRDTXHOHVFXMDVtODEDW{QLFDpDSHQ~O-
- Dissílabas: SRVVXHP GXDV VtODEDV ([HPSORV FDIp WLPD([HPSORVdóFLOVXDYHmenWHEDnaQD
LUDDtWUDQVSRU - Proparoxítonos: VmRDTXHOHVFXMDVtODEDW{QLFDpDDQ-
- Trissílabas: SRVVXHPWUrVVtODEDV([HPSORVFLQHPD WHSHQ~OWLPD([HPSORVmá[LPRSDráERODínWLPR
SUy[LPRSHUVSLFD]2GDLU
- Polissílabas:SRVVXHPTXDWURRXPDLVVtODEDV([HP- 6DLEDTXH
SORV DYHQLGD OLWHUDWXUD DPLJDYHOPHQWH RWRU  6mR SDODYUDV R[tWRQDV HQWUH RXWUDV cateter mister
Nobelnovelruimsutiltransistorureter
ULQRODULQJRORJLVWD
6mRSDODYUDVSDUR[tWRQDVHQWUHRXWUDVavaro, aziago,
boêmia, caracteres, cartomancia, celtibero, circuito, decano,
Divisão Silábica ÀODQWURSR ÁXLGR IRUWXLWR JUDWXLWR +XQJULD LEHUR LPSX-
dico, inaudito, intuito, maquinaria, meteorito, misantropo,
1D GLYLVmR VLOiELFD GDV SDODYUDV FXPSUH REVHUYDU DV necropsia DOJXQVGLFLRQiULRVDGPLWHPWDPEpPnecrópsia ,
VHJXLQWHVQRUPDV Normandia, pegada, policromo, pudico, quiromancia, rubri-
ca, subido(a)
 1mR VH VHSDUDP RV ditongos H tritongos ([HPSORV  6mR SDODYUDV SURSDUR[tWRQDV HQWUH RXWUDV aerólito,
IoiFHDYHULJuou; bávaro, bímano, crisântemo, ímprobo, ínterim, lêvedo, ôme-
1mRVHVHSDUDPRVGtJUDIRVch, lh, nh, gu, qu. ([HP- ga, pântano, trânsfuga
SORVchDYHEDUDlhREDnhDIUHgurVquHL[D  $V VHJXLQWHV SDODYUDV HQWUH RXWUDV DGPLWHP GXSOD
 1mR VH VHSDUDP RV encontros consonantais que ini- WRQLFLGDGH acróbata/acrobata, hieróglifo/hieroglifo, Oceâ-
ciam sílaba. ([HPSORVpsLFyORJRUHfrHVFR nia/Oceania, ortoépia/ortoepia, projétil/projetil, réptil/reptil,
- 6HSDUDPVHDVvogaisdos hiatos([HPSORVFa-aWLQ
zângão/zangão
JDIi-eOVa-úGH Exercícios
- 6HSDUDPVH DV OHWUDV GRV GtJUDIRV rr, ss, sc, sç xc.
([HPSORVFDr-rRSDs-sDUHODGHs-cHUQDs-çRHx-cHOHQ $VVLQDOHRLWHPHPTXHDGLYLVmRVLOiELFDpLQFRUUHWD
WH D JUDWXLWR
- 6HSDUDPVH RV HQFRQWURV FRQVRQDQWDLV GDV VtODEDV E DGYRJDGR
LQWHUQDV H[FHWXDQGRVH DTXHOHV HP TXH D VHJXQGD FRQ- F WUDQVLWyULR
VRDQWH p l RX r ([HPSORV Dp-tR ELs-nHWR FRQYLc-çmR G SVLFRORJLD
a-brLUDplLFDU H LQWHUVWtFLR

18
LÍNGUA PORTUGUESA

$VVLQDOHRLWHPHPTXHDVHSDUDomRVLOiELFDpLQFRU- 1DH[SUHVVmR´$icterícia QDGDWHPDYHUFRPhe-


UHWD modiálise RXGLVHQWHULDµDVSDODYUDVJULIDGDVDSUHVHQWDP
D SVLFyWLFR VHFRUUHWDPHQWHGLYLGLGDVHPVtODEDVQDDOWHUQDWLYD
E SHUPLVVLYLGDGH D LFWHUtFLDKHPRGLiOLVHGLVHQWHULD
F DVVHPEOHLD E LFWHUtFLDKHPRGLiOLVHGLVHQWHULD
G REWHQomR F LFWHUtFLDKHPRGLiOLVHGLVHQWHULD
H IDPtOLD G LFWHUtFLDKHPRGLiOLVHGLVHQWHULD
$VVLQDOHRLWHPHPTXHWRGRVRVYRFiEXORVWrPDV H LFWHUtFLDKHPRGLiOLVHGLVHQWHULD
VtODEDVFRUUHWDPHQWHVHSDUDGDV
 $VVLQDOH D ~QLFD RSomR HP TXH Ki XP YRFiEXOR
D DOGHLDFDDWLQJDWUDQVLomR FXMDVHSDUDomRVLOiELFDQmRHVWDIHLWDGHDFRUGRFRPDQRU-
E SURVVHJXLDFXVWyGLDWUDQVYHUVDO PDRUWRJUiÀFDYLJHQWH
F DEVXUGRSUDLDLQFRQVFLrQFLD D HVFRUUHJRXLQFUtYHLV
G RFFLSWDOJUDWXLWRDEGLFDU E LQIkQFLDFUHVFLD
H PLVWpULRDSWLGmRVXVFHWtYHO F LGHLDOpJXDV
G GHVREHGHFHXFRQVWUXtGD
$VVLQDOHRLWHPHPTXHWRGDVDVVtODEDVHVWmRFRUUH- H YRRXVRUULHP
WDPHQWHVHSDUDGDV
Respostas: 1-E / 2-C / 3-E / 4-D / 5-C / 6-D / 7-A /
D DSWLGmR 8-E / 9-E / 10-D
E VROLWiULR
F FROPHLD SIGNIFICAÇÃO DAS PALAVRAS
G DUPLVWtFLR
H WUDQVDWOkQWLFR &RQVLGHUHPRVDVVHJXLQWHVIUDVHV
Paula tem uma mão para cozinhar que dá inveja!
$VVLQDOHRLWHPHPTXHDGLYLVmRVLOiELFDHVWiHUUDGD Vamos! Coloque logo a mão na massa!
As crianças estão com as mãos sujas.
D WUDQVDWOkQWLFRGHVLQIHWDU
Passaram a mão na minha bolsa e nem percebi.
E VXEVWDEHOHFHUGHVXPDQR
F FLVDQGLQRVXEHVWLPDU
&KHJDPRV j FRQFOXVmR GH TXH VH WUDWD GH SDODYUDV
G DEGLFDomRDEODWLYR
LGrQWLFDVQRTXHVHUHIHUHjJUDÀDPDVVHUiTXHSRVVXHP
H IULLVVLPRPDFLLVVLPR
RPHVPRVLJQLÀFDGR"
([LVWHXPDSDUWHGDJUDPiWLFDQRUPDWLYDGHQRPLQDGD
([LVWHHUURGHGLYLVmRVLOiELFDQRLWHP
6HPkQWLFD(ODWUDEDOKDDTXHVWmRGRVGLIHUHQWHVVLJQLÀFD-
D PHLDSDUDQRLDEDODLR GRVTXHXPDPHVPDSDODYUDDSUHVHQWDGHDFRUGRFRPR
E RFFLSLWDOH[FHVVRSQHXPiWLFR FRQWH[WRHPTXHVHLQVHUH
F VXEVWkQFLDSHUVSHFWLYDIHOGVSDWR 7RPDQGR FRPR H[HPSOR DV IUDVHV Mi PHQFLRQDGDV
G VXEOLQKDUVXEOLQJXDODEUXSWR DQDOLVDUHPRV RV YRFiEXORV GH PHVPD JUDÀD GH DFRUGR
H WUDQVDWOkQWLFRWUDQVFHQGHUWUDQVRFHkQL FRPVHXVHQWLGRGHQRWDWLYRLVWRpDTXHOHUHWUDWDGRSHOR
FR GLFLRQiULR
1DSULPHLUDDSDODYUD´PmRµVLJQLÀFDKDELOLGDGHHÀ-
$~QLFDDOWHUQDWLYDFRUUHWDTXDQWRjGLYLVmRVLOiELFD FLrQFLDGLDQWHGRDWRSUDWLFDGR1DVRXWUDVTXHVHJXHPR
p VLJQLÀFDGR p GH SDUWLFLSDomR LQWHUDomR PHGLDQWH D XPD
WDUHIDUHDOL]DGDPmRFRPRSDUWHGRFRUSRKXPDQRHSRU
D PDTXLQDULDIRUWXLWR ~OWLPRVLPEROL]DRURXERYLVWRGHPDQHLUDSHMRUDWLYD
E WXQJVWrQLRULWPR 5HSRUWDQGRQRVDRFRQFHLWRGH3ROLVVHPLDORJRSHU-
F DQGRULQKDVXERÀFLDO FHEHPRV TXH R SUHÀ[R ´SROLµ VLJQLÀFD PXOWLSOLFLGDGH GH
G ERrPLDDEVFLVVD DOJR3RVVLELOLGDGHVGHYiULDVLQWHUSUHWDo}HVOHYDQGRVHHP
H FRHVmRVLOHQFLRVR FRQVLGHUDomRDVVLWXDo}HVGHDSOLFDELOLGDGH
+iXPDLQÀQLGDGHGHRXWURVH[HPSORVHPTXHSRGH-
,QGLTXHDDOWHUQDWLYDHPTXHDVSDODYUDV´VXVVXUURµ PRVYHULÀFDUDRFRUUrQFLDGDSROLVVHPLDFRPRSRUH[HP-
µLJXDL]LQKRVµH´JQRPRµHVWmRFRUUHWDPHQWHGLYLGLGDVHP SOR
VtODEDV
O rapaz é um tremendo gato.
D VXVVXUURLJXDL]LQKRVJQRPR O gato do vizinho é peralta.
E VXVVXUURLJXDL]LQKRVJQRPR Precisei fazer um gato para que a energia voltasse.
F VXVVXUURLJXDL]LQKRVJQRPR Pedro costuma fazer alguns “bicos” para garantir sua
G VXVVXUURLJXDL]LQKRVJQRPR sobrevivência
H VXVVXUURLJXDL]LQKRVJQRPR O passarinho foi atingido no bico.

19
LÍNGUA PORTUGUESA

Polissemia e homonímia A cobra picou o menino FREUD UpSWLOSHoRQKHQWR


A sogra dele é uma cobra FREUD SHVVRDGHVDJUD-
$FRQIXVmRHQWUHSROLVVHPLDHKRPRQtPLDpEDVWDQWH GiYHOTXHDGRWDFRQGXWDVSRXFRDSUHFLiYHLV
FRPXP4XDQGRDPHVPDSDODYUDDSUHVHQWDYiULRVVLJQLÀ- O cara é cobra em Física! FREUD SHVVRDTXHFR-
FDGRVHVWDPRVQDSUHVHQoDGDSROLVVHPLD3RURXWURODGR QKHFHPXLWRVREUHDOJXPDFRLVD´H[SHUWµ
TXDQGRGXDVRXPDLVSDODYUDVFRPRULJHQVHVLJQLÀFDGRV 1RLWHPDSOLFDVHRWHUPRcobraHPVHXVHQWLGRFR-
GLVWLQWRVWrPDPHVPDJUDÀDHIRQRORJLDWHPRVXPDKR- PXP RXOLWHUDO QRVLWHQVHRWHUPRcobrapDSOLFDGR
PRQtPLD HPVHQWLGRÀJXUDGR
$SDODYUD´PDQJDµpXPFDVRGHKRPRQtPLD(ODSRGH 3RGHPRV HQWmR FRQFOXLU TXH XP PHVPR VLJQLÀFDQWH
SDUWHFRQFUHWD SRGHWHUYiULRVVLJQLÀFDGRV FRQFHLWRV 
VLJQLÀFDU XPD IUXWD RX XPD SDUWH GH XPD FDPLVD 1mR p
SROLVVHPLDSRUTXHRVGLIHUHQWHVVLJQLÀFDGRVSDUDDSDODYUD
Denotação e Conotação
PDQJDWrPRULJHQVGLIHUHQWHVHSRULVVRDOJXQVHVWXGLRVRV
PHQFLRQDPTXHDSDODYUDPDQJDGHYHULDWHUPDLVGRTXH - Denotação: YHULÀFDVH TXDQGR XWLOL]DPRV D SDODYUD
XPDHQWUDGDQRGLFLRQiULR FRPRVHXVLJQLÀFDGRSULPLWLYRHRULJLQDOFRPRVHQWLGR
´/HWUDµpXPDSDODYUDSROLVVrPLFD/HWUDSRGHVLJQLÀFDU GR GLFLRQiULR XVDGD GH PRGR DXWRPDWL]DGR OLQJXDJHP
RHOHPHQWREiVLFRGRDOIDEHWRRWH[WRGHXPDFDQomRRX FRPXP9HMDHVWHH[HPSORCortaram as asas da ave para
D FDOLJUDÀD GH XP GHWHUPLQDGR LQGLYtGXR 1HVWH FDVR RV que não voasse mais.
GLIHUHQWHVVLJQLÀFDGRVHVWmRLQWHUOLJDGRVSRUTXHUHPHWHP $TXLDSDODYUDHPGHVWDTXHpXWLOL]DGDHPVHXVHQWLGR
SDUDRPHVPRFRQFHLWRRGDHVFULWD SUySULRFRPXPXVXDOOLWHUDO

Polissemia e ambiguidade MINHA DICA  3URFXUH DVVRFLDU DHQRWDomR FRP DL-


FLRQiULRWUDWDVHGHGHÀQLomROLWHUDOTXDQGRRWHUPRpXWL-
3ROLVVHPLDHDPELJXLGDGHWrPXPJUDQGHLPSDFWRQD OL]DGRHPVHXVHQWLGRGLFLRQDUtVWLFR
LQWHUSUHWDomR1DOtQJXDSRUWXJXHVDXPHQXQFLDGRSRGH
VHU DPEtJXR RX VHMD DSUHVHQWD PDLV GH XPD LQWHUSUHWD- - Conotação: YHULÀFDVH TXDQGR XWLOL]DPRV D SDODYUD
omR (VVD DPELJXLGDGH SRGH RFRUUHU GHYLGR j FRORFDomR FRPRVHXVLJQLÀFDGRVHFXQGiULRFRPRVHQWLGRDPSOR RX
HVSHFtÀFDGHXPDSDODYUD SRUH[HPSORXPDGYpUELR HP VLPEyOLFR XVDGDGHPRGRFULDWLYRÀJXUDGRQXPDOLQJXD-
JHPULFDHH[SUHVVLYD9HMDHVWHH[HPSOR
XPDIUDVH9HMDPRVDVHJXLQWHIUDVHPessoas que têm uma
Seria aconselhável cortar as asas deste menino, antes
alimentação equilibrada frequentemente são felizes 1HVWH
que seja tarde demais.
FDVRSRGHPH[LVWLUGXDVLQWHUSUHWDo}HVGLIHUHQWHVAs pes- -i QHVWH FDVR R WHUPR DVDV  p HPSUHJDGR GH IRUPD
soas têm alimentação equilibrada porque são felizes ou são ÀJXUDGDID]HQGRDOXVmRjLGHLDGHUHVWULomRHRXFRQWUROH
felizes porque têm uma alimentação equilibrada. GHDo}HVGLVFLSOLQDOLPLWDomRGHFRQGXWDHFRPSRUWDPHQ-
'HLJXDOIRUPDTXDQGRXPDSDODYUDpSROLVVrPLFDHOD WR
SRGHLQGX]LUXPDSHVVRDDID]HUPDLVGRTXHXPDLQWHU-
SUHWDomR3DUDID]HUDLQWHUSUHWDomRFRUUHWDpPXLWRLPSRU- )RQWH
WDQWHVDEHUTXDORFRQWH[WRHPTXHDIUDVHpSURIHULGD KWWSZZZWHFQROHJLVFRPHVWXGRGLULJLGRRÀFLDOGH
MXVWLFDWMPVSOLQJXDSRUWXJXHVDVHQWLGRSURSULRHÀJX-
1DOtQJXDSRUWXJXHVDXPD3$/$95$ GRODWLPparabo- UDGRGDVSDODYUDVKWPO
la, TXHSRUVXDYH]GHULYDGRJUHJR parabolé)SRGHVHUGH-
ÀQLGDFRPRVHQGRXPFRQMXQWRGHOHWUDVRXVRQVGHXPD Questões sobre Denotação e Conotação
OtQJXDMXQWDPHQWHFRPDLGHLDDVVRFLDGDDHVWHFRQMXQWR
  75,%81$/'(-867,d$'2(67$'2'(6®23$8-
Sentido Próprio e Figurado das Palavras /2(6&5(9(17(7e&1,&2-8',&,É5,2²981(63 2
VHQWLGRGHPDUPyUHR DGMHWLYR HTXLYDOHDRGDH[SUHVVmR
3HODSUySULDGHÀQLomRDFLPDGHVWDFDGDSRGHPRVSHU- GHPiUPRUH$VVLQDOHDDOWHUQDWLYDFRQWHQGRDVH[SUHVV}HV
FRPVHQWLGRVHTXLYDOHQWHVUHVSHFWLYDPHQWHDRVGDVSDOD-
FHEHUTXHDSDODYUDpFRPSRVWDSRUGXDVSDUWHVXPDGHODV
YUDVtJQHRHSpWUHR
UHODFLRQDGDDVXDIRUPDHVFULWDHRVVHXVVRQV GHQRPLQDGD
$ 'HFRUGDGHSOiVWLFR
VLJQLÀFDQWH HDRXWUDUHODFLRQDGDDRTXHHOD SDODYUD H[- % 'HIRJRGHPDGHLUD
SUHVVDDRFRQFHLWRTXHHODWUD] GHQRPLQDGDVLJQLÀFDGR  & 'HPDGHLUDGHSHGUD
(P UHODomR DR VHX 6,*1,),&$'2 DV SDODYUDV VXEGLYL- ' 'HIRJRGHSHGUD
GHPVHDVVLP ( 'HSOiVWLFRGHFLQ]D
Sentido PrópriopRVHQWLGROLWHUDORXVHMDRVHQWL-   75,%81$/'(-867,d$'2(67$'2'(6®23$8-
GRFRPXPTXHFRVWXPDPRVGDUDXPDSDODYUD /2  (6&5(9(17( 7e&1,&2 -8',&,É5,2 ² 981(63
Sentido FiguradopRVHQWLGR´VLPEyOLFRµ´ÀJXUD-  $'$37$'2  3DUD UHVSRQGHU j TXHVWmR FRQVLGHUH D VH-
GRµTXHSRGHPRVGDUDXPDSDODYUD JXLQWHSDVVDJHPSem querer estereotipar, mas já estereoti-
9DPRVDQDOLVDUDSDODYUDcobraXWLOL]DGDHPGLIHUHQWHV pando: trata-se de um ser cujas interações sociais terminam,
FRQWH[WRV 99% das vezes, diante da pergunta “débito ou crédito?”.

20
LÍNGUA PORTUGUESA

1HVVHFRQWH[WRRYHUERHVWHUHRWLSDUWHPVHQWLGRGH A marca da solidão


$ FRQVLGHUDUDRDFDVRVHPSUHPHGLWDomR
%  DFHLWDU XPD LGHLD PHVPR VHP HVWDU FRQYHQFLGR Deitado de bruços, sobre as pedras quentes do chão de
GHOD paralelepípedos, o menino espia. Tem os braços dobrados e a
& DGRWDUFRPRUHIHUrQFLDGHTXDOLGDGH testa pousada sobre eles, seu rosto formando uma tenda de
' MXOJDUGHDFRUGRFRPQRUPDVOHJDLV penumbra na tarde quente.
( FODVVLÀFDUVHJXQGRLGHLDVSUHFRQFHELGDV Observa as ranhuras entre uma pedra e outra. Há, den-
tro de cada uma delas, um diminuto caminho de terra, com
  75,%81$/'(-867,d$'2(67$'2'(6®23$8- pedrinhas e tufos minúsculos de musgos, formando peque-
/2(6&5(9(17(7e&1,&2-8',&,É5,2²981(63 QDVSODQWDVtQÀPRVERQVDLVVyYLVtYHLVDRVROKRVGHTXHPp
$'$37$'$  3DUD UHVSRQGHU D HVWD TXHVWmR FRQVLGHUH DV capaz de parar de viver para, apenas, ver. Quando se tem a
SDODYUDVGHVWDFDGDVQDVVHJXLQWHVSDVVDJHQVGRWH[WR marca da solidão na alma, o mundo cabe numa fresta.
6(,;$6+HORtVD&RQWRVPDLVTXHPtQLPRV5LRGH-D-
DesdeRVXUJLPHQWRGDLGHLDGHKLSHUWH[WR QHLUR7LQWDQHJUDED]DUS
LQIRUPDo}HVOLJDGDVespecialmentejSHVTXLVDDFD- 1RSULPHLURSDUiJUDIRDSDODYUDXWLOL]DGDHPVHQWLGR
GrPLFD ÀJXUDGRp
 XPD ´PiTXLQD SRpWLFDµ algo TXH IXQFLRQDVVH SRU $ PHQLQR
DQDORJLDHDVVRFLDomR % FKmR
& WHVWD
Quando R FLHQWLVWD 9DQQHYDU %XVK >@ FRQFHEHX D ' SHQXPEUD
LGHLDGHKLSHUWH[WR ( WHQGD
DQRVdepoisGHVHXDUWLJRIXQGDGRU
  8)700* ² $8;,/,$5 '( %,%/,27(&$ ² 98-
$VSDODYUDVGHVWDFDGDVTXHH[SUHVVDPLGHLDGHWHPSR 1(63  $'$37$'$  /HLD R WH[WR SDUD UHVSRQGHU j
VmR TXHVWmR
$ DOJRHVSHFLDOPHQWHH4XDQGR
% 'HVGHHVSHFLDOPHQWHHDOJR 5,2'(-$1(,52²A Prefeitura do Rio está lançando a
& HVSHFLDOPHQWH4XDQGRHGHSRLV Operação Lixo Zero, que vai multar quem emporcalhar a ci-
' 'HVGH4XDQGRHGHSRLV dade. Em primeira instância, a campanha é educativa. Equi-
( 'HVGHDOJRHGHSRLV pes da Companhia Municipal de Limpeza Urbana estão per-
FRUUHQGRDVUXDVSDUDÁDJUDUPDXVFLGDGmRVMRJDQGRFRLVDV
  75)5(*,®27e&1,&2-8',&,É5,2)&&  onde não devem e alertá-los para o que os espera. Em breve,
A importância de Rodolfo Coelho Cavalcante para o mo- FRPJXDUGDVPXQLFLSDLVSROLFLDLVPLOLWDUHVHÀVFDLVHP
vimento cordelista pode ser comparada à de outros dois ação, as multas começarão a chegar para quem tratar a via
grandes nomes... pública como a casa da sogra.
6HP TXDOTXHU RXWUD DOWHUDomR GD IUDVH DFLPD H VHP Imagina-se que, quando essa lei começar para valer, os
SUHMXt]R GD FRUUHomR R HOHPHQWR JULIDGR SRGH VHU VXEV- recordistas de multas serão os cerca de 300 jovens golpistas
WLWXtGRSRU que, nas últimas semanas, se habituaram a tomar as ruas,
$ FRQWUDVWDGD pichar monumentos, vandalizar prédios públicos, quebrar
% FRQIURQWDGD orelhões, arrancar postes, apedrejar vitrines, depredar ban-
& RPEUHDGD cos, saquear lojas e, por uma estranha compulsão, destruir
' ULYDOL]DGD lixeiras, jogar o lixo no asfalto e armar barricadas de fogo
( HTXLSDUDGD com ele.
É verdade que, no seu “bullying” político, eles não estão
  35()(,785$'(6(57®2=,1+2²$*(17(&208- nem aí para a cidade, que é de todos – e que, por algum
1,7É5,2 '( 6$Ó'( ² 981(63  1R YHUVR ² Não te motivo, parecem querer levar ao colapso.
abras com teu amigo²RYHUERHPGHVWDTXHIRLHPSUHJD- Pois, já que a lei não permite prendê-los por vandalis-
GRHPVHQWLGRÀJXUDGR mo, saque, formação de quadrilha, desacato à autoridade,
$VVLQDOHDDOWHUQDWLYDHPTXHHVVHPHVPRYHUER´DEULUµ resistência à prisão e nem mesmo por ataque aos órgãos
FRQWLQXDVHQGRHPSUHJDGRHPVHQWLGRÀJXUDGR públicos, talvez seja possível enquadrá-los por sujar a rua.
$ $RDEULUDSRUWDQmRKDYLDQLQJXpP 5X\&DVWUR3RUVXMDUDUXD)ROKDGH63DXOR
% (OHQmRS{GHDEULUDODWDSRUTXHQmRWLQKDXPDEUL- $GDSWDGR
GRU
& 3DUDDSUHQGHUpSUHFLVRDEULUDPHQWH 1DRUDomR²SDUHFHPTXHUHUOHYDUDRcolapso² ž
'  3HOD PDQKm TXDQGR DEUL RV ROKRV Mi HVWDYD HP SDUiJUDIR RWHUPRHPGHVWDTXHpVLQ{QLPRGH
FDVD $ SURJUHVVR
( 2VODGU}HVDEULUDPRFRIUHFRPXPPDoDULFR % GHVFDVR
  6$%(6363 ² $7(1'(17( $ &/,(17(6  ² & YLWyULD
)&&  $'$37$'$  $WHQomR 3DUD UHVSRQGHU j TXHV- ' WpGLR
WmRFRQVLGHUHRWH[WRDEDL[R ( UXtQD

21
LÍNGUA PORTUGUESA

  %1'(6 ² 7e&1,&2 $'0,1,675$7,92 ² %1-  


'(6 &RQVLGHUHRHPSUHJRGRYHUEROHYDUQRWUHFKR 1RHQXQFLDGRRYHUER´OHYDUµHVWiHPSUHJDGRFRPR
´Uma competição não dura apenas alguns minutos. Leva VHQWLGRGH´GXUDomRWHPSRµ
anosµ$IUDVHHPTXHHVVHYHUERHVWiXVDGRFRPRPHVPR $ 2PHQLQROHYDRPDWHULDODGHTXDGRSDUDDHVFROD
VHQWLGRp FDUUHJD
$ 2PHQLQROHYDRPDWHULDODGHTXDGRSDUDDHVFROD % -RmROHYRXXPDVXUUDGDPmH DSDQKRX
% -RmROHYRXXPDVXUUDGDPmH
& $HQFKHQWHOHYDWRGRROL[RUXDDEDL[R DUUDVWD
& $HQFKHQWHOHYDWRGRROL[RUXDDEDL[R
' 2WUDEDOKRIHLWRFRPHPSHQKROHYDDRVXFHVVR 
' 2WUDEDOKRIHLWRFRPHPSHQKROHYDDRVXFHVVR
( 2DWOHWDOHYRXDSHQDVGH]VHJXQGRVSDUDWHUPLQDU GLUHFLRQD
DSURYD ( 2DWOHWDOHYRXDSHQDVGH]VHJXQGRVSDUDWHUPLQDUD
SURYD GXUDomRWHPSR
RESOLUÇÃO
5(63267$´(µ
 
4XHVWmRTXHSRGHVHUUHVROYLGDXVDQGRDOyJLFDRXDV- - Sinônimos
VRFLDomRGHSDODYUDV9HMDDLJQLomRGRFDUUROHPEUDQRV 6mRSDODYUDVGHVHQWLGRLJXDORXDSUR[LPDGRalfabeto
IRJRFRPEXVWmR3HGUDSHWULÀFDGR(QFRQWURXDUHVSRV- - abecedário; brado, grito - clamor; extinguir, apagar - abolir
WD"
2EVHUYDomR$FRQWULEXLomRJUHFRODWLQDpUHVSRQViYHO
5(63267$´'µ SHOD H[LVWrQFLD GH QXPHURVRV SDUHV GH VLQ{QLPRV adver-
sário e antagonista; translúcido e diáfano; semicírculo e he-
  miciclo; contraveneno e antídoto; moral e ética; colóquio e
&ODVVLÀFDUFRQIRUPHUHJUDVFRQKHFLGDVPDVQmRFRQ- diálogo; transformação e metamorfose; oposição e antítese.
ÀUPDGDVVHYHUGDGHLUDV
- Antônimos
5(63267$´(µ 6mRSDODYUDVGHVLJQLÀFDomRRSRVWDordem - anarquia;
soberba - humildade; louvar - censurar; mal - bem
  2EVHUYDomR$DQWRQtPLDSRGHRULJLQDUVHGHXPSUH-
$VSDODYUDVTXHQRVGmRDQRomRLGHLDGHWHPSRVmR À[R GH VHQWLGR RSRVWR RX QHJDWLYR bendizer e maldizer;
GHVGHTXDQGRHGHSRLV
simpático e antipático; progredir e regredir; concórdia e dis-
5(63267$´'µ córdia; ativo e inativo; esperar e desesperar; comunista e an-
ticomunista; simétrico e assimétrico.
 
$RSDUWLFLSDUGHXPFRQFXUVRQmRWHPRVDFHVVRDGL- O que são Homônimos e Parônimos:
FLRQiULRVSDUDTXHYHULÀTXHPRVRVLJQLÀFDGRGDVSDODYUDV
SRU LVVR FDVR QmR VDLEDPRV R TXH VLJQLÀFDP GHYHPRV - Homônimos
DQDOLViODVGHQWURGRFRQWH[WRHPTXHVHHQFRQWUDP1R D +RPyJUDIRVVmRSDODYUDVLJXDLVQDHVFULWDHGLIHUHQ-
H[HUFtFLRDFLPDDTXHVH´HQFDL[Dµp´HTXLSDUDGDµ WHVQDSURQ~QFLD
rego (subst.) e rego (verbo);
5(63267$´(µ
colher (verbo) e colher (subst.);
  jogo (subst.) e jogo (verbo);
(P WRGDV DV DOWHUQDWLYDV R YHUER ´DEULUµ HVWi HPSUH- denúncia (subst.) e denuncia (verbo);
JDGR HP VHX VHQWLGR GHQRWDWLYR 1R LWHP & FRQRWDWLYR providência (subst.) e providencia (verbo).
´DEULUDPHQWHµ DEHUWRDPXGDQoDVQRYDVLGHLDV 
E +RPyIRQRVVmRSDODYUDVLJXDLVQDSURQ~QFLDHGL-
5(63267$´&µ IHUHQWHVQDHVFULWD
acender (atear) e ascender (subir);
  concertar (harmonizar) e consertar (reparar);
1RYDPHQWH UHVSRQGHUHPRV FRP IUDVH GR WH[WR VHX cela (compartimento) e sela (arreio);
URVWRIRUPDQGRXPDWHQGD censo (recenseamento) e senso ( juízo);
paço (palácio) e passo (andar).
5(63267$´(µ
 
3HOD OHLWXUD GR WH[WR FRPSUHHQGHVH TXH D LQWHQomR F  +RPyJUDIRV H KRPyIRQRV VLPXOWDQHDPHQWH 6mR
GRDXWRUDRXWLOL]DUDH[SUHVVmRµOHYDUDRFRODSVRµUHIHUHVH SDODYUDVLJXDLVQDHVFULWDHQDSURQ~QFLD
jTXHGDDRÀPjUXtQDGDFLGDGH caminho (subst.) e caminho (verbo);
cedo (verbo) e cedo (adv.);
5(63267$´(µ livre (adj.) e livre (verbo).

22
LÍNGUA PORTUGUESA

- Parônimos % $FRQWDUGH
6mRSDODYUDVSDUHFLGDVQDHVFULWDHQDSURQ~QFLDcoro & (PVXEVWLWXLomRD
e couro; cesta e sesta; eminente e iminente; osso e ouço; sede ' &RPH[FHomRGH
e cede; comprimento e cumprimento; tetânico e titânico; au- ( 1RTXHVHUHIHUHD
WXDUHDWXDUGHJUDGDUHGHJUHGDULQÁLJLUHLQIULQJLUGHIHULU
e diferir; suar e soar. $VVLQDOHDDOWHUQDWLYDTXHDSUHVHQWDXPDQW{QLPR
http://www.coladaweb.com/portugues/sinonimos,-an- SDUD R WHUPR GHVWDFDGR HP ² ¬´1R LQtFLR GDV DXODV HX
tonimos,-homonimos-e-paronimos DFKDYDPHLRchatoPDVGHSRLVIXLPHLQWHUHVVDQGRµGLVVH
$ (VWLPXODQWH
4XHVW}HVVREUH6LJQLÀFDomRGDV3DODYUDV % &DQVDWLYR
& ,UULWDQWH
$VVLQDOHDDOWHUQDWLYDTXHSUHHQFKHFRUUHWDPHQWH ' &RQIXVR
DVODFXQDVGDIUDVHDEDL[R ( ,PSURGXWLYR
Da mesma forma que os italianos e japoneses _________
para o Brasil no século passado, hoje os brasileiros ________  $JHQWHGH(VFROWDH9LJLOkQFLD3HQLWHQFLiULD²98-
para a Europa e para o Japão, à busca de uma vida melhor; 1(63² $QDOLVHDVDÀUPDo}HVDVHJXLU
internamente, __________ para o Sul, pelo mesmo motivo. ,(P²HáVHWHDQRV)UDQVOH\/DSDYDQL6LOYDHVWiSUHVR
D LPLJUDUDPHPLJUDPPLJUDP SRUKRPLFtGLR²RWHUPRHPGHVWDTXHSRGHVHUVXEVWLWXt-
E PLJUDUDPLPLJUDPHPLJUDP GRVHPDOWHUDomRGRVHQWLGRGRWH[WRSRU´fazµ
F HPLJUDUDPPLJUDPLPLJUDP ,,$IUDVH²7RGRSUHVRdesejaDOLEHUWDomR²SRGHVHU
G HPLJUDUDPLPLJUDPPLJUDP UHHVFULWDGDVHJXLQWHIRUPD²7RGRSUHVRaspirajOLEHUWD-
H LPLJUDUDPPLJUDP²HPLJUDP omR
,,,1RWUHFKR²HVWRXVHQGRROKDGRGHIRUPDGLIH-
$JHQWHGH$SRLR²0LFURLQIRUPiWLFD²981(63² UHQWHDTXLQRSUHVtGLRdevido aoERPFRPSRUWDPHQWR²
/HLDRWH[WRSDUDUHVSRQGHUjVTXHVW}HVGHQ~PHURV
SRGHVHVXEVWLWXLUDH[SUHVVmRHPGHVWDTXHSRU´em razão
H
doµVHPDOWHUDURVHQWLGRGRWH[WR
'HDFRUGRFRPDQRUPDSDGUmRGDOtQJXDSRUWXJXHVD
Alunos de colégio fazem robôs com sucata eletrônica
HVWiFRUUHWRRTXHVHDÀUPDHP
$ ,,,H,,,
Você comprou um smartphone e acha que aquele seu
% ,,,DSHQDV
celular antigo é imprestável? Não se engane: o que é lixo
& ,H,,,DSHQDV
para alguns pode ser matéria-prima para outros. O CMID
' ,DSHQDV
– Centro Marista de Inclusão Digital –, que funciona junto
ao Colégio Marista de Santa Maria, no Rio Grande do Sul, ( ,H,,DSHQDV
ensina os alunos do colégio a fazer robôs a partir de lixo
eletrônico. /HLDDVIUDVHVDEDL[R
Os alunos da turma avançada de robótica, por exemplo, 1 - Assisti ao ________ do balé Bolshoi;
constroem carros com sensores de movimento que respon- 2 - Daqui ______ pouco vão dizer que ______ vida em
dem à aproximação das pessoas. A fonte de energia vem de Marte.
baterias de celular. “Tirando alguns sensores, que precisa- 3 - As _________ da câmara são verdadeiros programas
mos comprar, é tudo reciclagem”, comentou o instrutor de de humor.
robótica do CMID, Leandro Schneider. Esses alunos também 4 - ___________ dias que não falo com Alfredo.
aprendem a consertar computadores antigos. “O nosso pro-
jeto só funciona por causa do lixo eletrônico. Se tivéssemos (VFROKD D DOWHUQDWLYD TXH RIHUHFH D VHTXrQFLD FRUUHWD
que comprar tudo, não seria viável”, completou. GHYRFiEXORVSDUDDVODFXQDVH[LVWHQWHV
Em uma época em que celebridades do mundo digital D FRQFHUWR²Ki²D²FHVV}HV²Ki
fazem campanha a favor do ensino de programação nas es- E FRQVHUWR²D²Ki²VHVV}HV²Ki
colas, é inspirador o relato de Dionatan Gabriel, aluno da F FRQFHUWR²D²Ki²VHo}HV²D
turma avançada de robótica do CMID que, aos 16 anos, já G FRQFHUWR²D²Ki²VHVV}HV²Ki
VDEH TXDO VHUi VXD SURÀVVmR ´4XHUR VHU SURJUDPDGRU 1R H FRQVHUWR²Ki²D²VHVV}HV²D
início das aulas, eu achava meio chato, mas depois fui me
interessando”, disse.  $JHQWHGH(VFROWDH9LJLOkQFLD3HQLWHQFLiULD²98-
*LRUGDQR7URQFRZZZWHFKWXGRFRPEU 1(63²DGDS &RQVLGHUHRVHJXLQWHWUHFKRSDUDUHV-
$GDSWDGR SRQGHUjTXHVWmR
$SDODYUDHPGHVWDTXHQRWUHFKR²´TirandoDOJXQV Adolescentes vivendo em famílias que não lhes trans-
VHQVRUHVTXHSUHFLVDPRVFRPSUDUpWXGRUHFLFODJHPµ² mitiram valores sociais altruísticos, formação moral e não
SRGHVHUVXEVWLWXtGDVHPDOWHUDomRGRVHQWLGRGDPHQVD- lhes impuseram limites de disciplina.
JHPSHODVHJXLQWHH[SUHVVmR 2VHQWLGRFRQWUiULR DQW{QLPR GHaltruísticosQHVVH
$ 3HORPHQRV WUHFKRp

23
LÍNGUA PORTUGUESA

$ GHGHVSUHQGLPHQWR  
% GHUHVSRQVDELOLGDGH $VVLVWLDRFRQFHUWRGREDOp%ROVKRL
& GHDEQHJDomR 'DTXLDSRXFRYmRGL]HUTXHKi H[LVWH 
' GHDPRU YLGDHP0DUWH
( GHHJRtVPR ²$VVHVV}HVGDFkPDUDVmRYHUGDGHLURVSUR-
JUDPDVGHKXPRU
  $VVLQDOH R ~QLFR H[HPSOR FXMD ODFXQD GHYH VHU +iGLDVTXHQmRIDORFRP$OIUHGR 
SUHHQFKLGDFRPDprimeiraDOWHUQDWLYDGDVpULHGDGDQRV WHPSRSDVVDGR
SDUrQWHVHV
$  (VWRX DTXL BBBBBBB GH DMXGDU RV ÁDJHODGRV GDV HQ-   $GROHVFHQWHV YLYHQGR HP IDPtOLDV TXH QmR OKHV
FKHQWHV DÀPDÀP  WUDQVPLWLUDPYDORUHVVRFLDLVDOWUXtVWLFRVIRUPDomRPRUDOH
% $EDQGHLUDHVWiBBBBBBBB DUUHDGDDUULDGD  QmROKHVLPSXVHUDPOLPLWHVGHGLVFLSOLQD
&  6HUmR SXQLGRV RV TXH BBBBBBBB R UHJXODPHQWR LQ- 2 VHQWLGR FRQWUiULR DQW{QLPR  GH DOWUXtVWLFRV QHVVH
ÁLQJLUHPLQIULQJLUHP  WUHFKRpGHHJRtVPR
'  6mR VHPSUH YDOLRVRV RV BBBBBBBB GRV PDLV YHOKRV $OWUXtVPR p XP WLSR GH FRPSRUWDPHQWR HQFRQWUDGR
FRQFHOKRVFRQVHOKRV  QRVVHUHVKXPDQRVHRXWURVVHUHVYLYRVHPTXHDVDo}HV
( 0RURBBBBBBBBFHPPHWURVGDSUDoDSULQFLSDO DFHU- GH XP LQGLYtGXR EHQHÀFLDP RXWURV e VLQ{QLPR GH ÀODQ-
FDGHDFHUFDGH  WURSLD1RVHQWLGRFRPXPGRWHUPRpPXLWDVYH]HVSHU-
FHELGD WDPEpP FRPR VLQ{QLPR GH VROLGDULHGDGH (VVH
$VVLQDOHDDOWHUQDWLYDFRUUHWDFRQVLGHUDQGRTXHj FRQFHLWRRS}HVHSRUWDQWRDRHJRtVPRTXHVmRDVLQFOL-
GLUHLWDGHFDGDSDODYUDKiXPVLQ{QLPR QDo}HVHVSHFtÀFDHH[FOXVLYDPHQWHLQGLYLGXDLV SHVVRDLVRX
D HPHUJLU YLUjWRQDLPHUJLU PHUJXOKDU FROHWLYDV 
E HPLJUDU HQWUDU QRSDtV LPLJUDU VDLU GRSDtV
F GHODWDU H[SDQGLUGLODWDU GHQXQFLDU  
G GHIHULU GLIHUHQFLDUGLIHULU FRQFHGHU $ (VWRXDTXLDÀPGHGHDMXGDURVÁDJHODGRVGDV
H GLVSHQVD F{PRGRGHVSHQVD GHVREULJDomR
HQFKHQWHV DÀP 2DGMHWLYR´DÀPµpHPSUHJDGRSDUDLQ-
GLFDUTXHXPDFRLVDWHPDÀQLGDGHFRPDRXWUD+iSHVVRDV
GABARITO
TXHWrPWHPSHUDPHQWRVDÀQVRXVHMDSDUHFLGRV 
% $EDQGHLUDHVWiDUULDGD DUUHDU FRORFDU
01. A 02. D 03. A 04. A
DUUHLRQRFDYDOR
05. D 06. E 07. E 08. A
& 6HUmRSXQLGRVRVTXHLQIULQJLUHPRUHJXODPHQ-
WR LQÁLQJLUHP DSOLFDUHPDSHQD
RESOLUÇÃO
' 6mRVHPSUHYDOLRVRVRVFRQVHOKRVGRVPDLVYH-
  'D PHVPD IRUPD TXH RV LWDOLDQRV H MDSRQHVHV OKRV FRQFHOKRV 3RUomRWHUULWRULDORXSDUWHDGPLQLVWUDWLYD
LPLJUDUDPSDUDR%UDVLOQRVpFXORSDVVDGRKRMHRVEUD- GHXPGLVWULWR 
VLOHLURVHPLJUDPSDUDD(XURSDHSDUDR-DSmRjEXVFD ( 0RURDFHUFDGHFHPPHWURVGDSUDoDSULQFLSDO
GHXPDYLGDPHOKRULQWHUQDPHQWHPLJUDPSDUDR DFHUFDGH $FHUFDGHpVLQ{QLPRGH´DUHVSHLWRGHµ 
6XOSHORPHVPRPRWLYR
 
 ´&RPH[FHomRGHDOJXQVVHQVRUHVTXHSUHFLVDPRV E HPLJUDU HQWUDU QRSDtV LPLJUDU VDLU GRSDtV  
FRPSUDUpWXGRUHFLFODJHPµ VLJQLÀFDGRVLQYHUWLGRV
F GHODWDU H[SDQGLUGLODWDU GHQXQFLDU VLJQLÀ-
 DQW{QLPRSDUDRWHUPRGHVWDFDGR´1RLQtFLRGDV FDGRVLQYHUWLGRV
DXODV HX DFKDYD PHLR FKDWR PDV GHSRLV IXL PH LQWHUHV- G GHIHULU GLIHUHQFLDUGLIHULU FRQFHGHU VLJQLÀ-
VDQGRµ FDGRVLQYHUWLGRV
´1RLQtFLRGDVDXODVHXDFKDYDPHLRHVWLPXODQWHPDV H GLVSHQVD F{PRGRGHVSHQVD GHVREULJDomR 
GHSRLVIXLPHLQWHUHVVDQGRµ VLJQLÀFDGRVLQYHUWLGRV

 
,(P²+iVHWHDQRV)UDQVOH\/DSDYDQL6LOYDHVWiSUHVR FIGURAS DE LINGUAGEM
SRUKRPLFtGLR²RWHUPRHPGHVWDTXHSRGHVHUVXEVWLWXt-
GRVHPDOWHUDomRGRVHQWLGRGRWH[WRSRU´ID]µ FRUUHWD 6HJXQGR0DXUR)HUUHLUDDLPSRUWkQFLDHPUHFRQKHFHU
,,$IUDVH²7RGRSUHVRGHVHMDDOLEHUWDomR²SRGHVHU ÀJXUDVGHOLQJXDJHPHVWiQRIDWRGHTXHWDOFRQKHFLPHQWR
UHHVFULWDGDVHJXLQWHIRUPD²7RGRSUHVRDVSLUDjOLEHUWD- DOpPGHDX[LOLDUDFRPSUHHQGHUPHOKRURVWH[WRVOLWHUiULRV
omR FRUUHWD GHL[DQRV PDLV VHQVtYHLV j EHOH]D GD OLQJXDJHP H DR
,,,1RWUHFKR²HVWRXVHQGRROKDGRGHIRUPDGLIH- VLJQLÀFDGRVLPEyOLFRGDVSDODYUDVHGRVWH[WRV
UHQWHDTXLQRSUHVtGLRGHYLGRDRERPFRPSRUWDPHQWR²  'HÀQLomR Figuras de linguagem são certos recursos
SRGHVHVXEVWLWXLUDH[SUHVVmRHPGHVWDTXHSRU´HPUD]mR não--convencionais que o falante ou escritor cria para dar
GRµVHPDOWHUDURVHQWLGRGRWH[WR FRUUHWD maior expressividade à sua mensagem

24
LÍNGUA PORTUGUESA

Metáfora Antítese
eRHPSUHJRGHXPDSDODYUDFRPRVLJQLÀFDGRGHRXWUD &RQVLVWHQRXVRGHSDODYUDVGHVHQWLGRVRSRVWRV
HP YLVWD GH XPD UHODomR GH VHPHOKDQoDV HQWUH DPEDV e Nada com Deus é tudo.
XPDFRPSDUDomRVXEHQWHQGLGD Tudo sem Deus é nada.
Minha boca é um túmulo. 
Essa rua é um verdadeiro deserto. Eufemismo
 &RQVLVWH HP VXDYL]DU SDODYUDV RX H[SUHVV}HV TXH VmR
Comparação GHVDJUDGiYHLV
&RQVLVWHHPDWULEXLUFDUDFWHUtVWLFDVGHXPVHUDRXWUR Ele foi repousar no céu, junto ao Pai UHSRXVDUQRFpX
HPYLUWXGHGHXPDGHWHUPLQDGDVHPHOKDQoD PRUUHU
O meu coração está igual a um céu cinzento. Os homens públicos envergonham o povo. KRPHQV
O carro dele é rápido como um avião. S~EOLFRV SROtWLFRV


Prosopopeia
Hipérbole
e XPD ÀJXUD GH OLQJXDJHP TXH DWULEXL FDUDFWHUtVWLFDV
e XP H[DJHUR LQWHQFLRQDO FRP D ÀQDOLGDGH GH WRUQDU
KXPDQDVDVHUHVLQDQLPDGRV7DPEpPSRGHPRVFKDPiOD
PDLVH[SUHVVLYDDLGHLD
GH3(5621,),&$d®2
O céu está mostrando sua face mais bela. (ODFKRURXULRVGHOiJULPDV
O cão mostrou grande sisudez. 0XLWDVSHVVRDVPRUULDPGHPHGRGDSHUQDFDEHOXGD
 
Sinestesia Ironia
&RQVLVWH QD IXVmR GH LPSUHVV}HV VHQVRULDLV GLIHUHQWHV &RQVLVWHQDLQYHUVmRGRVVHQWLGRVRXVHMDDÀUPDPRVR
PLVWXUDGRVFLQFRVHQWLGRV  FRQWUiULRGRTXHSHQVDPRV
Raquel tem um olhar frio, desesperador. Que alunos inteligentes, não sabem nem somar.
Aquela criança tem um olhar tão doce. Se você gritar mais alto, eu agradeço.
 
Catacrese Onomatopeia
eRHPSUHJRGHXPDSDODYUDQRVHQWLGRÀJXUDGRSRU &RQVLVWH QD UHSURGXomR RX LPLWDomR GR VRP RX YR]
IDOWDGHXPWHUPRSUySULR QDWXUDOGRVVHUHV
O menino quebrou o braço da cadeira. Com o au-au dos cachorros, os gatos desapareceram.
A manga da camisa rasgou. Miau-miau. – Eram os gatos miando no telhado a noite
 toda.
Metonímia 
e D VXEVWLWXLomR GH XPD SDODYUD SRU RXWUD TXDQGR Aliteração
H[LVWH XPD UHODomR OyJLFD XPD SUR[LPLGDGH GH VHQWLGRV &RQVLVWH QD UHSHWLomR GH XP GHWHUPLQDGR VRP
TXH SHUPLWH HVVD WURFD 2FRUUH PHWRQtPLD TXDQGR FRQVRQDQWDOQRLQtFLRRXLQWHULRUGDVSDODYUDV
HPSUHJDPRV O rato roeu a roupa do rei de Roma.
O autor pela obra. 
Li Jô Soares dezenas de vezes DREUDGH-{6RDUHV Elipse
&RQVLVWHQDRPLVVmRGHXPWHUPRTXHÀFDVXEHQWHQGLGR
- o continente pelo conteúdo. QRFRQWH[WRLGHQWLÀFDGRIDFLOPHQWH
O ginásio aplaudiu a seleção JLQiVLRHVWiVXEVWLWXLQGR
Após a queda, nenhuma fratura.
RVWRUFHGRUHV

Zeugma
- a parte pelo todo.
&RQVLVWH QD RPLVVmR GH XP WHUPR Mi HPSUHJDGR
Vários brasileiros vivem sem teto, ao relento WHWR
VXEVWLWXLFDVD DQWHULRUPHQWH
Ele come carne, eu verduras.
- o efeito pela causa. 
Suou muito para conseguir a casa própria VXRUVXEVWLWXL Pleonasmo
RWUDEDOKR &RQVLVWHQDLQWHQVLÀFDomRGHXPWHUPRDWUDYpVGDVXD
 UHSHWLomRUHIRUoDQGRVHXVLJQLÀFDGR
Perífrase Nós cantamos um canto glorioso.
e D GHVLJQDomR GH XP VHU DWUDYpV GH DOJXPD GH VXDV
FDUDFWHUtVWLFDVRXDWULEXWRVRXGHXPIDWRTXHRFHOHEUL]RX Polissíndeto
A Veneza Brasileira também é palco de grandes e D UHSHWLomR GD FRQMXQomR HQWUH DV RUDo}HV GH XP
espetáculos 9HQH]D%UDVLOHLUD 5HFLIH SHUtRGRRXHQWUHRVWHUPRVGDRUDomR
A Cidade Maravilhosa está tomada pela violência. Chegamos de viagem e tomamos banho e saímos para
&LGDGH0DUDYLOKRVD 5LRGH-DQHLUR dançar.

25
LÍNGUA PORTUGUESA

Assíndeto 2) Apóstrofe
2FRUUHTXDQGRKiDDXVrQFLDGDFRQMXQomRHQWUHGXDV e DVVLP GHQRPLQDGR R FKDPDPHQWR GR UHFHSWRU
RUDo}HV GD PHQVDJHP VHMD HOH GH QDWXUH]D LPDJLQiULD RX QmR e
Chegamos de viagem, tomamos banho, depois saímos XWLOL]DGDSDUDGDUrQIDVHjH[SUHVVmRHUHDOL]DVHSRUPHLR
para dançar. GRYRFDWLYR([HPSORV
 Deus! Ó Deus! Onde estás que não respondes?
Anacoluto Pai Nosso, que estais no céu;
&RQVLVWH QXPD PXGDQoD UHSHQWLQD GD FRQVWUXomR Ó meu querido Santo António;
VLQWiWLFDGDIUDVH
Ele, nada podia assustá-lo. 3) Paradoxo
Nota:RDQDFROXWRRFRUUHFRPIUHTXrQFLDQDOLQJXDJHP eXPDSURSRVLomRDSDUHQWHPHQWHDEVXUGDUHVXOWDQWH
IDODGDTXDQGRRIDODQWHLQWHUURPSHDIUDVHDEDQGRQDQGR GD XQLmR GH LGHLDV TXH VH FRQWUDGL]HP  UHIHULQGRVH DR
RTXHKDYLDGLWRSDUDUHFRQVWUXtODQRYDPHQWH PHVPR WHUPR 2V SDUDGR[RV YLFLRVRV VmR GHQRPLQDGRV
 2[tPRURV RXR[LPRURQ ([HPSORV
Anáfora “Menino do Rio / Calor que provoca arrepio...”
&RQVLVWH QD UHSHWLomR GH XPD SDODYUD RX H[SUHVVmR “Amor é fogo que arde sem se ver; / É ferida que dói e
SDUD UHIRUoDU R VHQWLGR FRQWULEXLQGR SDUD XPD PDLRU não se sente; / É um contentamento descontente; / É dor que
H[SUHVVLYLGDGH desatina sem doer;µ &DP}HV
Cada alma é uma escada para Deus,
Cada alma é um corredor-Universo para Deus, 4) Eufemismo
Cada alma é um rio correndo por margens de Externo &RQVLVWH HP HPSUHJDU XPD H[SUHVVmR PDLV VXDYH
Para Deus e em Deus com um sussurro noturno. PDLVQREUHRXPHQRVDJUHVVLYDSDUDDWHQXDUXPDYHUGDGH
)HUQDQGR3HVVRD WLGDFRPRSHQRVDGHVDJUDGiYHORXFKRFDQWH([HPSORV
 ´(SHODSD]GHUUDGHLUDTXHHQÀPYDLQRVUHGLPLU'HXV
Silepse
lhe pagueµ &KLFR%XDUTXH 
2FRUUHTXDQGRDFRQFRUGkQFLDpUHDOL]DGDFRPDLGHLD
SD]GHUUDGHLUD PRUWH
HQmRVXDIRUPDJUDPDWLFDO([LVWHPWUrVWLSRVGHVLOHSVH
JrQHURQ~PHURHSHVVRD
5) Gradação
1D JUDGDomR WHPRV XPD VHTXrQFLD GH SDODYUDV TXH
- De gênero: Vossa excelência está preocupado com as
LQWHQVLÀFDPDPHVPDLGHLD([HPSOR
notícias. D SDODYUD YRVVD H[FHOrQFLD p IHPLQLQD TXDQWR j
“Aqui... além... mais longe por onde eu movo o passo.”
IRUPD PDV QHVVH H[HPSOR D FRQFRUGkQFLD VH GHX FRP D
&DVWUR$OYHV 
SHVVRD D TXH VH UHIHUH R SURQRPH GH WUDWDPHQWR H QmR
FRPRVXMHLWR 
6) Hipérbole
- 'H Q~PHUR $ ERLDGD ÀFRX IXULRVD FRP R SHmR H e D H[SUHVVmR LQWHQFLRQDOPHQWH H[DJHUDGD FRP R
derrubaram a cerca QHVVHFDVRDFRQFRUGkQFLDVHGHXFRP LQWXLWRGHUHDOoDUXPDLGHLDSURSRUFLRQDQGRXPDLPDJHP
DLGHLDGHSOXUDOGDSDODYUDERLDGD  HPRFLRQDQWHHGHLPSDFWR([HPSORV
“Faz umas dez horas que essa menina penteia esse
- De pessoa: As mulheres decidimos não votar em cabelo”.
determinado partido até prestarem conta ao povo. QHVVH Ele morreu de tanto rir.
WLSR GH VLOHSVH R IDODQWH VH LQFOXL PHQWDOPHQWH HQWUH RV
SDUWLFLSDQWHVGHXPVXMHLWRHPSHVVRD  7) Ironia
2FRUUHLURQLDTXDQGRSHORFRQWH[WRSHODHQWRQDomR
)RQWHKWWSMXOLREDWWLVWLFRPEUWXWRULDLVMRVHEIHUUD] SHOD FRQWUDGLomR GH WHUPRV SUHWHQGHVH TXHVWLRQDU
ÀJXUDVOLQJXDJHPDVS FHUWR WLSR GH SHQVDPHQWR $ LQWHQomR p GHSUHFLDWLYD RX
VDUFiVWLFD([HPSORV
6mRFRQKHFLGDVSHORQRPHGHÀJXUDVGHSHQVDPHQWR
RV UHFXUVRV HVWLOtVWLFRV XWLOL]DGRV SDUD LQFUHPHQWDU R Parece um anjinho aquele menino, briga com todos que
VLJQLÀFDGRGDVSDODYUDVQRVHXDVSHFWRVHPkQWLFR estão por perto.
6mRRLWRDVÀJXUDVGHSHQVDPHQWR “Moça linda, bem tratada, / três séculos de família, /
1) Antítese burra como uma porta: / um amor.” 0iULRGH$QGUDGH 
eDDSUR[LPDomRGHSDODYUDVRXH[SUHVV}HVGHVHQWLGRV
RSRVWRV2FRQWUDVWHTXHVHHVWDEHOHFHVHUYHSDUDGDUXPD  3URVRSRSHLDRX3HUVRQLÀFDomR
rQIDVHDRVFRQFHLWRVHQYROYLGRVRTXHQmRRFRUUHULDFRP &RQVLVWH QD DWULEXLomR GH Do}HV TXDOLGDGHV RX
DH[SRVLomRLVRODGDGRVPHVPRV([HPSORV FDUDFWHUtVWLFDVKXPDQDVDVHUHVQmRKXPDQRV([HPSORV
Viverei para sempre ou morrerei tentando. Chora, viola.
Do riso se fez o pranto. A morte mostrou sua face mais sinistra.
Hoje fez sol, ontem, porém, choveu muito. O morro dos ventos uivantes.

26
LÍNGUA PORTUGUESA

Figuras de construção ou sintaxe LQWHJUDP DV Anáfora


FKDPDGDV ÀJXUDV GH OLQJXDJHP UHSUHVHQWDQGR XP (VVDÀJXUDGHOLQJXDJHPVHFDUDFWHUL]DSHODUHSHWLomR
VXEJUXSRGHVWDV'HVVDIRUPDWHQGRHPYLVWDRSDGUmRQmR LQWHQFLRQDOGHXPWHUPRQRLQtFLRGHXPSHUtRGRIUDVHRX
FRQYHQFLRQDOTXHSUHYDOHFHQDVÀJXUDVGHOLQJXDJHP RX YHUVR2EVHUYHPRVXPFDVRUHSUHVHQWDWLYR
VHMDDVXEMHWLYLGDGHDVHQVLELOLGDGHSRUSDUWHGRHPLVVRU A Estrela
GHL[DQGR jV FODUDV VHXV DVSHFWRV HVWLOtVWLFRV  GHYHPRV
FRPSUHHQGHU VXD GHQRPLQDomR (P RXWUDV SDODYUDV SRU Vi uma estrela tão alta,
TXH´ÀJXUDVGHFRQVWUXomRRXVLQWD[Hµ" Vi uma estrela tão fria!
3RGHPRVDÀUPDUTXHDVVLPVHGHQRPLQDPHPYLUWXGH
Vi uma estrela luzindo
Na minha vida vazia.
GHDSUHVHQWDUHPDOJXPWLSRGHPRGLÀFDomRQDHVWUXWXUD
GDRUDomRWHQGRHPYLVWDRVUHDLVHMiUHVVDOWDGRVREMHWLYRV Era uma estrela tão alta!
GD HQXQFLDomR GR GLVFXUVR  ² VHQGR R SULQFLSDO FRQIHULU Era uma estrela tão fria!
rQIDVHDHOD Era uma estrela sozinha
$VVLPVHQGRFRPHFHPRVHQWHQGHQGRTXHHPWHUPRV /X]LQGRQRÀPGRGLD
FRQYHQFLRQDLV D HVWUXWXUD VLQWiWLFD GD QRVVD OtQJXD VH >@
SHUID] GH XPD VHTXrQFLD GHPDUFDGD SHORV VHJXLQWHV 0DQXHO%DQGHLUD
HOHPHQWRV
1RWDPRV D XWLOL]DomR GH WHUPRV TXH VH UHSHWHP
68-(,7235(',&$'2&203/(0(172 VXFHVVLYDPHQWH HP FDGD YHUVR GD FULDomR GH 0DQXHO
%DQGHLUD
1yV CHEGAMOS ATRASADOS À REUNIÃO.
Polissíndeto
7HPRV DVVLP XP VXMHLWR RFXOWR ² nós XP SUHGLFDGR )LJXUD FXMD SULQFLSDO FDUDFWHUtVWLFD VH GHÀQH SHOD
YHUEDO ² chegamos atrasados; H XP FRPSOHPHQWR UHSHWLomRHQIiWLFDGRFRQHFWLYRJHUDOPHQWHUHSUHVHQWDGR
UHSUHVHQWDGRSRUXPDGMXQWRDGYHUELDOGHOXJDU²à reunião. SHOD FRQMXQomR FRRUGHQDGD ´e” 2EVHUYHPRV XP YHUVR
4XDQGR Ki XPD UXSWXUD GHVVD VHTXrQFLD OyJLFD H[WUDtGR GH XPD FULDomR GH 2ODYR %LODF LQWLWXODGD ´A um
poetaµ´Trabalha e teima, e lima, e sofre, e sua!”
PDWHULDOL]DGD SHOD LQYHUVmR GH WHUPRV UHSHWLomR RX DWp
PHVPRRPLVVmRGHVWHVpMXVWDPHQWHDtTXHDVÀJXUDVHP
Assíndeto
TXHVWmR VH PDQLIHVWDP 'HVVH PRGR HODV VH HQFRQWUDP 'LIHUHQWHPHQWH GR TXH RFRUUH QR SROLVVtQGHWR
PXLWR SUHVHQWHV QD OLQJXDJHP OLWHUiULD QD SXEOLFLWiULD H PDQLIHVWDGR SHOD UHSHWLomR GD FRQMXQomR QR DVVtQGHWR
QDOLQJXDJHPFRWLGLDQDGHIRUPDJHUDO9HMDPRVFDGDXPD RFRUUHDRPLVVmRGHVWH9HMDPRVVim, vi, venci -~OLR&pVDU
GHODVGHPRGRSDUWLFXODU 'HSUHHQGHPRV TXH VH WUDWD GH RUDo}HV DVVLQGpWLFDV
MXVWDPHQWHSHODRPLVVmRGRFRQHFWLYR´e”
Elipse
7DOÀJXUDVHFDUDFWHUL]DSHODRPLVVmRGHXPWHUPRQD Anacoluto
RUDomR QmR H[SUHVVR DQWHULRUPHQWH FRQWXGR IDFLOPHQWH 7UDWDVH GH XPD ÀJXUD TXH VH FDUDFWHUL]D SHOD
LGHQWLÀFDGRSHORFRQWH[WR9HMDPRVXPH[HPSOR LQWHUUXSomR GD VHTXrQFLD OyJLFD GR SHQVDPHQWR RX VHMD
HP WHUPRV VLQWiWLFRV DÀUPDVH TXH Ki XPD PXGDQoD QD
Rondó dos cavalinhos FRQVWUXomR GR SHUtRGR GHL[DQGR DOJXP WHUPR GHVOLJDGR
[...] GRUHVWDQWHGRVHOHPHQWRV9HMDPRV
Essas crianças de hoje, elas estão muito evoluídas.
Os cavalinhos correndo, 1RWDPRV TXH R WHUPR HP GHVWDTXH TXH HUD SDUD
E nós, cavalões, comendo... UHSUHVHQWDURVXMHLWRGDRUDomRHQFRQWUDVHGHVOLJDGRGRV
O Brasil politicando, GHPDLVWHUPRVQmRFXPSULQGRSRUWDQWRQHQKXPDIXQomR
VLQWiWLFD
Nossa! A poesia morrendo...
O sol tão claro lá fora,
Inversão (ou Hipérbato)
O sol tão claro, Esmeralda, 7UDWDVH GD LQYHUVmR GD RUGHP GLUHWD GRV WHUPRV GD
E em minhalma — anoitecendo! RUDomR&RQVWDWHPRVEufórico chegou o menino.
0DQXHO%DQGHLUD 'HGX]LPRVTXHRSUHGLFDWLYRGRVXMHLWR SRLVVHWUDWD
GHXPSUHGLFDGRYHUERQRPLQDO HQFRQWUDVHQRLQtFLRGD
1RWDPRVTXHHPWRGRVRVYHUVRVKiDRPLVVmRGRYHUER RUDomR TXDQGR HVWH GHYHULD HVWDU H[SUHVVR QR ÀQDO RX
estar,VHQGRHVWHIDFLOPHQWHLGHQWLÀFDGRSHORFRQWH[WR VHMDO menino chegou eufórico.

Zeugma Pleonasmo
$R FRQWUiULR GD HOLSVH QD ]HXJPD RFRUUH D RPLVVmR )LJXUDTXHFRQVLVWHQDUHSHWLomRHQIiWLFDGHXPDLGHLD
GHXPWHUPRMiH[SUHVVRQRGLVFXUVR&RQVWDWHPRVMaria DQWHV H[SUHVVD WDQWR GR SRQWR GH YLVWD VLQWiWLFR TXDQWR
gosta de Matemática, eu de Português. VHPkQWLFR QR LQWXLWR GH UHIRUoDU D PHQVDJHP ([HPSOR
2EVHUYDPRVTXHKRXYHDRPLVVmRGRYHUERgostar Vivemos uma vida tranquila.

27
LÍNGUA PORTUGUESA

2 WHUPR HP GHVWDTXH UHIRUoD XPD LGHLD DQWHV Radical:


UHVVDOWDGDXPDYH]TXHYLYHUMiGL]UHVSHLWRjYLGD7HPRV
XPDUHSHWLomRGHRUGHPVHPkQWLFD 2EVHUYHRVHJXLQWHJUXSRGHSDODYUDVOLYUROLYULQKR
A ele nada lhe devo. OLYUHLUR OLYUHFR 9RFr UHSDURX TXH Ki XP HOHPHQWR FR-
PXPQHVVHJUXSR"9RFrUHSDURXTXHRHOHPHQWROLYUVHUYH
3HUFHEHPRVTXHRSURQRPHREOtTXR OKH ID]UHIHUrQFLD GHEDVHSDUDRVLJQLÀFDGR"(VVHHOHPHQWRpFKDPDGRGH
jWHUFHLUDSHVVRDGRVLQJXODUMiH[SUHVVD7UDWDVHSRUWDQWR UDGLFDO RXVHPDQWHPD (OHPHQWREiVLFRHVLJQLÀFDWLYRGDV
GHXPDUHSHWLomRGHRUGHPVLQWiWLFDGHPDUFDGDSHORTXH SDODYUDVFRQVLGHUDGDVVRERDVSHFWRJUDPDWLFDOHSUiWLFR
FKDPDPRVGHobjeto direto pleonástico. eHQFRQWUDGRDWUDYpVGRGHVSRMRGRVHOHPHQWRVVHFXQGi-
ULRV TXDQGRKRXYHU GDSDODYUD([HPSORcertRcertH]D
Observação importante 2 SOHRQDVPR XWLOL]DGR VHP LQcertH]D
DLQWHQomRGHFRQIHULUrQIDVHDRGLVFXUVRWRUQDVHRTXH
GHQRPLQDPRVGHvício de linguagem²RFRUUrQFLDTXHGHYH $À[RV VmR HOHPHQWRV VHFXQGiULRV JHUDOPHQWH VHP
VHU HYLWDGD &RPR SRU H[HPSOR subir para cima, descer YLGDDXW{QRPD TXHVHDJUHJDPDXPUDGLFDORXWHPDSDUD
para baixo, entrar para dentro, HQWUHRXWUDVFLUFXQVWkQFLDV IRUPDU SDODYUDV GHULYDGDV 6DEHPRV TXH R DFUpVFLPR GR
OLQJXtVWLFDV PRUIHPD´menteµSRUH[HPSORFULDXPDQRYDSDODYUDD
SDUWLUGH“certo”certamenteDGYpUELRGHPRGR'HPD-
ESTRUTURA E FORMAÇÃO DE PALAVRAS QHLUDVHPHOKDQWHRDFUpVFLPRGRVPRUIHPDV“a-” H “-ar”
jIRUPD“cert-”FULDRYHUER acertar2EVHUYHTXHa-H-ar
(VWXGDUDHVWUXWXUDpFRQKHFHURVHOHPHQWRVIRUPDGR- VmRPRUIHPDVFDSD]HVGHRSHUDUPXGDQoDGHFODVVHJUD-
UHVGDVSDODYUDV$VVLPFRPSUHHQGHPRVPHOKRURVLJQLÀ- PDWLFDOQDSDODYUDDTXHVmRDQH[DGRV
FDGRGHFDGDXPDGHODV$VSDODYUDVSRGHPVHUGLYLGLGDV 4XDQGRVmRFRORFDGRVDQWHVGRUDGLFDOFRPRDFRQWH-
HPXQLGDGHVPHQRUHVDTXHGDPRVRQRPHGHHOHPHQWRV FHFRP“a-”,RVDÀ[RVUHFHEHPRQRPHGHSUHÀ[RV4XDQ-
PyUÀFRVRXPRUIHPDV GR FRPR “-ar” VXUJHP GHSRLV GR UDGLFDO RV DÀ[RV VmR
9DPRVDQDOLVDUDSDODYUD´cachorrinhasµ1HVVDSDOD- FKDPDGRV GH VXÀ[RV. ([HPSOR in-at-ivo emSREUecer
YUDREVHUYDPRVIDFLOPHQWHDH[LVWrQFLDGHTXDWURHOHPHQ- interQDFLRQal
WRV6mRHOHV
Desinências: VmR RV HOHPHQWRV WHUPLQDLV LQGLFDWLYRV
cachorrHVWHpRHOHPHQWREDVHGDSDODYUDRXVHMD
GDVÁH[}HVGDVSDODYUDV([LVWHPGRLVWLSRV
DTXHOHTXHFRQWpPRVLJQLÀFDGR
- Desinências Nominais:LQGLFDPDVÁH[}HVGHgêne-
inhLQGLFDTXHDSDODYUDpXPGLPLQXWLYR
ro PDVFXOLQRHIHPLQLQR HGHnúmero VLQJXODUHSOXUDO 
aLQGLFDTXHDSDODYUDpIHPLQLQD
GRVQRPHV([HPSORVDOXQRoDOXQRsDOXQaDOXQDs
s LQGLFDTXHDSDODYUDVHHQFRQWUDQRSOXUDO
6ó podemos falar em desinências nominais de gêne-
ros e de números em palavras que DGPLWHPWDLVÁH[}HV
Morfemas:XQLGDGHVPtQLPDVGHFDUiWHUVLJQLÀFDWLYR FRPRQRVH[HPSORVDFLPD(PSDODYUDVFRPRPHVDWULER
([LVWHP SDODYUDV TXH QmR FRPSRUWDP GLYLVmR HP XQLGD- WHOHIRQHPD SRU H[HPSOR QmR WHPRV GHVLQrQFLD QRPLQDO
GHVPHQRUHVWDLVFRPRPDUVROOXDHWF6mRHOHPHQWRV GHJrQHUR-iHPSLUHVOiSLVônibus não temosGHVLQrQFLD
PyUÀFRV QRPLQDOGHQ~PHUR
- Raiz, Radical, Tema: HOHPHQWRVEiVLFRVHVLJQLÀFD- - Desinências Verbais:LQGLFDPDVÁH[}HVGHnúmero
WLYRV H pessoa H GH modo H tempo GRV YHUERV $ GHVLQrQFLD
“-oµSUHVHQWHHP´DP-oµpXPDGHVLQrQFLDnúmero pes-
 $À[RV 3UHÀ[RV 6XÀ[RV  'HVLQrQFLD 9RJDO 7H- soalSRLVLQGLFDTXHRYHUERHVWiQDSULPHLUDSHVVRDGR
mática:HOHPHQWRVPRGLÀFDGRUHVGDVLJQLÀFDomRGRVSUL- VLQJXODU´-vaµGH´DPD-vaµpGHVLQrQFLDmodo-temporal
PHLURV FDUDFWHUL]DXPDIRUPDYHUEDOGRSUHWpULWRLPSHUIHLWRGRLQ-
GLFDWLYRQDFRQMXJDomR
- Vogal de Ligação, Consoante de Ligação:HOHPHQ-
WRVGHOLJDomRRXHXI{QLFRV Vogal Temática: pDYRJDOTXHVHMXQWDDRUDGLFDOSUH-
SDUDQGRRSDUDUHFHEHUDVGHVLQrQFLDV1RVYHUERVGLVWLQ-
Raiz: eRHOHPHQWRRULJLQiULRHLUUHGXWtYHOHPTXHVH JXHPVHWUrVYRJDLVWHPiWLFDV
FRQFHQWUDDVLJQLÀFDomRGDVSDODYUDVFRQVLGHUDGDVGRkQ- &DUDFWHUL]DRVYHUERVGD1ªFRQMXJDomREXVFaUEXV-
JXORKLVWyULFReDUDL]TXHHQFHUUDRVHQWLGRJHUDOFRPXP FaYDVHWF.
jV SDODYUDV GD PHVPD IDPtOLD HWLPROyJLFD ([HPSOR 5DL]  &DUDFWHUL]D RV YHUERV GD 2ª FRQMXJDomR URPSeU
noc >/DWLP nocere  SUHMXGLFDU@ WHP D VLJQLÀFDomR JHUDO URPSePRVHWF
GHFDXVDUGDQRHDHODVHSUHQGHPSHODRULJHPFRPXP &DUDFWHUL]DRVYHUERVGD3ªFRQMXJDomRSURLEiUSURL-
DVSDODYUDVQRFLYRQRFLYLGDGHLQRFHQWHLQRFHQWDULQyFXR EiUiHWF
HWF
Tema: pRJUXSRIRUPDGRSHORUDGLFDOPDLVYRJDOWH-
8PDUDL]SRGHVRIUHUDOWHUDo}HVDWRDWRUDWLYRDo PiWLFD 1RV YHUERV FLWDGRV DFLPD RV WHPDV VmR EXVFD
mRDFLRQDU URPSHSURLEL

28
LÍNGUA PORTUGUESA

Vogais e Consoantes de Ligação: $V YRJDLV H FRQ- desalmado


VRDQWHVGHOLJDomRVmRPRUIHPDVTXHVXUJHPSRUPRWLYRV DOPD²SDODYUDLQLFLDO
HXI{QLFRV RX VHMD SDUD IDFLOLWDU RX PHVPR SRVVLELOLWDU D GHV²SUHÀ[R
SURQ~QFLD GH XPD GHWHUPLQDGD SDODYUD ([HPSORV SDUL- DOP²UDGLFDO
VLHQVH SDULV UDGLFDOHQVH VXÀ[RYRJDOGHOLJDomR i JDV DGR²VXÀ[R
-ôPHWURDOYiQHJURWHFQoFUDFLDSDXlDGDFDIHtHLUD
FKDlHLUDLQVHWiFLGDSHzLQKRSREUeWmRHWF 1mR GHYHPRV FRQIXQGLU GHULYDomR SDUDVVLQWpWLFD HP
TXHRDFUpVFLPRGHVXÀ[RHGHSUHÀ[RpREULJDWRULDPHQWH
Formação das Palavras: e[LVWHP GRLV SURFHVVRV Ei- VLPXOWkQHRFRPFDVRVFRPRRVGDVSDODYUDVGHVYDORUL]D-
VLFRVSHORVTXDLVVHIRUPDPDVSDODYUDVDDerivaçãoHD omRHGHVLJXDOGDGH1HVVDVSDODYUDVRVDÀ[RVVmRDFRSOD-
Composição. $ GLIHUHQoD HQWUH DPERV FRQVLVWH EDVLFD- GRVHPVHTXrQFLDGHVYDORUL]DomRSURYpPGHGHVYDORUL]DU
PHQWHHPTXHQRSURFHVVRGHGHULYDomRSDUWLPRVVHPSUH TXHSURYpPGHYDORUL]DUTXHSRUVXDYH]SURYpPGHYDORU
GHXP~QLFRUDGLFDOHQTXDQWRQRSURFHVVRGHFRPSRVLomR e LPSRVVtYHO ID]HU R PHVPR FRP SDODYUDV IRUPDGDV
VHPSUHKDYHUiPDLVGHXPUDGLFDO SRUSDUDVVtQWHVHQmRVHSRGHGL]HUTXHH[SURSULDUSURYpP
GH“SURSULDUµRXGH´H[SUySULRµSRLVWDLVSDODYUDVQmRH[LV-
Derivação: pRSURFHVVRSHORTXDOVHREWpPXPDSD- WHP/RJRH[SURSULDUSURYpPGLUHWDPHQWHGHSUySULRSHOR
ODYUDQRYDFKDPDGDGHULYDGDDSDUWLUGHRXWUDMiH[LVWHQWH DFUpVFLPRFRQFRPLWDQWHGHSUHÀ[RHVXÀ[R
FKDPDGD SULPLWLYD ([HPSOR 0DU PDUtWLPR PDULQKHLUR - Derivação Regressiva: RFRUUH GHULYDomR UHJUHVVLYD
PDUXMR WHUUD HQWHUUDUWHUUHLURDWHUUDU 2EVHUYDPRVTXH TXDQGR XPD SDODYUD p IRUPDGD QmR SRU DFUpVFLPR PDV
ªPDU«HªWHUUD«QmRVHIRUPDPGHQHQKXPDRXWUDSDODYUD SRUUHGXomRFRPSUDU YHUER FRPSUD VXEVWDQWLYR EHLMDU
PDVDRFRQWUiULRSRVVLELOLWDPDIRUPDomRGHRXWUDVSRU YHUER EHLMR VXEVWDQWLYR 
PHLR GR DFUpVFLPR GH XP VXÀ[R RX SUHÀ[R /RJR PDU H
WHUUDVmRSDODYUDVSULPLWLYDVHDVGHPDLVGHULYDGDV 3DUD GHVFREULUPRV VH XP VXEVWDQWLYR GHULYD GH XP
YHUERRXVHRFRUUHRFRQWUiULRSRGHPRVVHJXLUDVHJXLQWH
RULHQWDomR
Tipos de Derivação
6HRVXEVWDQWLYRGHQRWDDomRVHUiSDODYUDGHULYDGD
'HULYDomR3UHÀ[DORX3UHÀ[DomRUHVXOWDGRDFUpV-
HRYHUERSDODYUDSULPLWLYD
FLPRGHSUHÀ[RjSDODYUDSULPLWLYDTXHWHPRVHXVLJQLÀFD-
6HRQRPHGHQRWDDOJXPREMHWRRXVXEVWkQFLDYHUL-
GRDOWHUDGRFUHUdesFUHUOHUreOHUFDSD]inFDSD]
ÀFDVHRFRQWUiULR
'HULYDomR6XÀ[DORX6XÀ[DomRUHVXOWDGHDFUpVFL-
9DPRVREVHUYDURVH[HPSORVDFLPDFRPSUDHEHLMRLQ-
PRGHVXÀ[RjSDODYUDSULPLWLYDTXHSRGHVRIUHUDOWHUDomR
GLFDPDo}HVORJRVmRSDODYUDVGHULYDGDV2PHVPRQmR
GHVLJQLÀFDGRRXPXGDQoDGHFODVVHJUDPDWLFDODOIDEHWL]D-
RFRUUH SRUpP FRP D SDODYUD âncora TXH p XP REMHWR
ção. 1RH[HPSORRVXÀ[R-ção WUDQVIRUPDHPVXEVWDQWLYR
RYHUERDOIDEHWL]DU (VWHSRUVXDYH]MipGHULYDGRGRVXEV- 1HVWH FDVR XP VXEVWDQWLYR SULPLWLYR TXH Gi RULJHP DR
WDQWLYRDOIDEHWR SHORDFUpVFLPRGRVXÀ[R-izar. YHUERDQFRUDU

$GHULYDomRVXÀ[DOSRGHVHU 3RU GHULYDomR UHJUHVVLYD IRUPDPVH EDVLFDPHQWH


NominalIRUPDQGRVXEVWDQWLYRVHDGMHWLYRVSDSHO² VXEVWDQWLYRVDSDUWLUGHYHUERV3RULVVRUHFHEHPRQRPH
SDSHOaria ULVR²ULVonho GHsubstantivos deverbais. 1RWHTXHQDOLQJXDJHPSRSX-
VerbalIRUPDQGRYHUERVDWXDODWXDOizar ODUVmRIUHTXHQWHVRVH[HPSORVGHSDODYUDVIRUPDGDVSRU
AdverbialIRUPDQGRDGYpUELRVGHPRGRIHOL]²IHOL]- GHULYDomRUHJUHVVLYDRportuga GHSRUWXJXrV Rboteco
mente GHERWHTXLP Rcomuna GHFRPXQLVWD agito GHDJLWDU 
amasso GHDPDVVDU chego GHFKHJDU
- Derivação Parassintética ou Parassíntese: 2FRUUH
TXDQGR D SDODYUD GHULYDGD UHVXOWD GR DFUpVFLPR VLPXOWk- 2 SURFHVVR QRUPDO p FULDU XP YHUER D SDUWLU GH XP
QHR GH SUHÀ[R H VXÀ[R j SDODYUD SULPLWLYD 3RU PHLR GD VXEVWDQWLYR1DGHULYDomRUHJUHVVLYDDOtQJXDSURFHGHHP
SDUDVVtQWHVH IRUPDPVH QRPHV VXEVWDQWLYRV H DGMHWLYRV  VHQWLGRLQYHUVRIRUPDRVXEVWDQWLYRDSDUWLUGRYHUER
HYHUERV&RQVLGHUHRDGMHWLYR“triste”. 'RUDGLFDO´WULVWµ
IRUPDPRV R YHUER enWULVWecer DWUDYpV GD MXQomR VLPXOWk- - Derivação Imprópria: $GHULYDomRLPSUySULDRFRUUH
QHD GR SUHÀ[R  ´HQµ H GR VXÀ[R ´HFHUµ $ SUHVHQoD GH TXDQGRGHWHUPLQDGDSDODYUDVHPVRIUHUTXDOTXHUDFUpVFL-
DSHQDVXPGHVVHVDÀ[RVQmRpVXÀFLHQWHSDUDIRUPDUXPD PRRXVXSUHVVmRHPVXDIRUPDPXGDGHFODVVHJUDPDWLFDO
QRYDSDODYUDSRLVHPQRVVDOtQJXDQmRH[LVWHPDVSDODYUDV 1HVWHSURFHVVR
´HQWULVWHµQHP´WULVWHFHUµ([HPSORV 2V DGMHWLYRV SDVVDP D VXEVWDQWLYRV 2V ERQV VHUmR
FRQWHPSODGRV
emudecer 2V SDUWLFtSLRV SDVVDP D VXEVWDQWLYRV RX DGMHWLYRV
PXGR²SDODYUDLQLFLDO $TXHOHJDURWRDOFDQoRXXPIHLWRSDVVDQGRQRFRQFXUVR
H²SUHÀ[R 2V LQÀQLWLYRV SDVVDP D VXEVWDQWLYRV 2 DQGDU GH 5R-
PXG²UDGLFDO EHUWDHUDIDVFLQDQWH2EDGDODUGRVVLQRVVRRXQDFLGDGH-
HFHU²VXÀ[R ]LQKD

29
LÍNGUA PORTUGUESA

2VVXEVWDQWLYRVSDVVDPDDGMHWLYRV2IXQFLRQiULRIDQ- YRFiEXORV DXW{QRPRV  $OJXQV SUHÀ[RV IRUDP SRXFR RX


WDVPD IRL GHVSHGLGR 2 PHQLQR SURGtJLR UHVROYHX R SUR- QDGDSURGXWLYRVHPSRUWXJXrV2XWURVSRUVXDYH]WLYH-
EOHPD UDPJUDQGHYLWDOLGDGHQDIRUPDomRGHQRYDVSDODYUDVD
2VDGMHWLYRVSDVVDPDDGYpUELRV)DOHLEDL[RSDUDTXH FRQWUDGHVHP RXHQ HVHQWUHUHVXEVXSHU
QLQJXpPHVFXWDVVH DQWL
3DODYUDVLQYDULiYHLVSDVVDPDVXEVWDQWLYRV1mRHQWHQ-
GRRSRUTXrGLVVRWXGR 3UHÀ[RVGH2ULJHP*UHJD
6XEVWDQWLYRV SUySULRV WRUQDPVH FRPXQV $TXHOH
FRRUGHQDGRUpXPFD[LDV FKHIHVHYHURHH[LJHQWH a-, an DIDVWDPHQWR SULYDomR QHJDomR LQVXÀFLrQFLD
FDUrQFLDDQ{QLPRDPRUDODWHXDI{QLFR
2VSURFHVVRVGHGHULYDomRYLVWRVDQWHULRUPHQWHID]HP ana LQYHUVmR PXGDQoD UHSHWLomR DQDORJLD DQiOLVH
SDUWHGD0RUIRORJLDSRUTXHLPSOLFDPDOWHUDo}HVQDIRUPD DQDJUDPDDQDFU{QLFR
GDVSDODYUDV1RHQWDQWRDGHULYDomRLPSUySULDOLGDEDVL- DQÀHPUHGRUHPWRUQRGHXPHRXWURODGRGXSOLFL-
FDPHQWHFRPVHXVLJQLÀFDGRRTXHDFDEDFDUDFWHUL]DQGR GDGHDQÀWHDWURDQItELRDQÀERORJLD
XPSURFHVVRVHPkQWLFR3RUHVVDUD]mRHQWHQGHPRVRPR- antiRSRVLomRDomRFRQWUiULDDQWtGRWRDQWLSDWLDDQ-
WLYRSHORTXDOpGHQRPLQDGD´LPSUySULDµ WDJRQLVWDDQWtWHVH
apo DIDVWDPHQWR VHSDUDomR DSRWHRVH DSyVWROR
Composição: p R SURFHVVR TXH IRUPD SDODYUDV FRP- DSRFDOLSVHDSRORJLD
SRVWDVDSDUWLUGDMXQomRGHGRLVRXPDLVUDGLFDLV([LVWHP arqui-, arceVXSHULRULGDGHKLHUiUTXLFDSULPD]LDH[-
GRLVWLSRV FHVVRDUTXLGXTXHDUTXpWLSRDUFHELVSRDUTXLPLOLRQiULR
cataPRYLPHQWRGHFLPDSDUDEDL[RFDWDSODVPDFD-
- Composição por Justaposição: DR MXQWDUPRV GXDV WiORJRFDWDUDWD
RXPDLVSDODYUDVRXUDGLFDLVQmRRFRUUHDOWHUDomRIRQpWLFD diGXSOLFLGDGHGLVVtODERGLWRQJRGLOHPD
SDVVDWHPSR TXLQWDIHLUD JLUDVVRO FRXYHÁRU (P ªJLUDV- diaPRYLPHQWRDWUDYpVGHDIDVWDPHQWRGLiORJRGLD-
VRO«KRXYHXPDDOWHUDomRQDJUDÀD DFUpVFLPRGHXPªV«  JRQDOGLDIUDJPDGLDJUDPD
MXVWDPHQWHSDUDPDQWHULQDOWHUDGDDVRQRULGDGHGDSDODYUD
disGLÀFXOGDGHSULYDomRGLVSQHLDGLVHQWHULDGLVSHS-
VLDGLVIDVLD
ec-, ex-, exo-, ecto PRYLPHQWR SDUD IRUD HFOLSVH
- Composição por Aglutinação: DR XQLUPRV GRLV RX
r[RGRHFWRGHUPDH[RUFLVPR
PDLV YRFiEXORV RX UDGLFDLV RFRUUH VXSUHVVmR GH XP RX
en-, em-, eSRVLomRLQWHULRUPRYLPHQWRSDUDGHQWUR
PDLVGHVHXVHOHPHQWRVIRQpWLFRVHPERUD HPERDKRUD 
HQFpIDORHPEULmRHOLSVHHQWXVLDVPR
ÀGDOJR ÀOKR GH DOJR  UHIHULQGRVH D IDPtOLD QREUH  KL-
endoPRYLPHQWRSDUDGHQWURHQGRYHQRVRHQGRFDU-
GUHOpWULFR KLGURHOpWULFR SODQDOWR SODQRDOWR $RDJOXWL-
SRHQGRVPRVH
QDUHPVHRVFRPSRQHQWHVVXERUGLQDPVHDXPVyDFHQWR epiSRVLomRVXSHULRUPRYLPHQWRSDUDHSLGHUPHHSt-
W{QLFRRGR~OWLPRFRPSRQHQWH ORJRHSLGHPLDHSLWiÀR
euH[FHOrQFLDSHUIHLomRERQGDGHHXIHPLVPRHXIR-
- Redução: DOJXPDVSDODYUDVDSUHVHQWDPDRODGRGH ULDHXFDULVWLDHXIRQLD
VXDIRUPDSOHQDXPDIRUPDUHGX]LGD2EVHUYHautoSRU hemi PHWDGH PHLR KHPLVIpULR KHPLVWtTXLR KHPL-
DXWRPyYHOcineSRUFLQHPDmicroSRUPLFURFRPSXWD- SOpJLFR
GRUZéSRU-RVp&RPRH[HPSORGHUHGXomRRXVLPSOL- hiper SRVLomR VXSHULRU H[FHVVR KLSHUWHQVmR KLSpU-
ÀFDomRGHSDODYUDVSRGHPVHUFLWDGDVWDPEpPDVsiglas EROHKLSHUWURÀD
PXLWRIUHTXHQWHVQDFRPXQLFDomRDWXDO hipo SRVLomR LQIHULRU HVFDVVH] KLSRFULVLD KLSyWHVH
KLSRGpUPLFR
- Hibridismo: RFRUUH KLEULGLVPR QD SDODYUD HP FXMD meta PXGDQoD VXFHVVmR PHWDPRUIRVH PHWiIRUD
IRUPDomR HQWUDP HOHPHQWRV GH OtQJXDV GLIHUHQWHV DXWR PHWDFDUSR
JUHJR PyYHO ODWLP  paraSUR[LPLGDGHVHPHOKDQoDLQWHQVLGDGHSDUDOHOR
SDUDVLWDSDUDGR[RSDUDGLJPD
- Onomatopeia: QXPHURVDV SDODYUDV GHYHP VXD RUL- peri PRYLPHQWR RX SRVLomR HP WRUQR GH SHULIHULD
JHPDXPDWHQGrQFLDFRQVWDQWHGDIDODKXPDQDSDUDLPL- SHULSpFLDSHUtRGRSHULVFySLR
WDUDVYR]HVHRVUXtGRVGDQDWXUH]D$VRQRPDWRSHLDVVmR proSRVLomRHPIUHQWHDQWHULRULGDGHSUyORJRSURJ-
YRFiEXORVTXHUHSURGX]HPDSUR[LPDGDPHQWHRVVRQVHDV QyVWLFRSURIHWDSURJUDPD
YR]HVGRVVHUHVPLDX]XP]XPSLDUWLQLUXUUDUFKRFDOKDU prosDGMXQomRHPDGLomRDSURVpOLWRSURVyGLD
FRFRULFDUHWF proto LQtFLR FRPHoR DQWHULRULGDGH SURWRKLVWyULD
SURWyWLSRSURWRPiUWLU
3UHÀ[RV RV SUHÀ[RV VmR PRUIHPDV TXH VH FRORFDP poliPXOWLSOLFLGDGHSROLVVtODERSROLVVtQGHWRSROLWHtV-
DQWHV GRV UDGLFDLV EDVLFDPHQWH D ÀP GH PRGLÀFDUOKHV R PR
VHQWLGRUDUDPHQWHHVVHVPRUIHPDVSURGX]HPPXGDQoDGH sin-, sim VLPXOWDQHLGDGH FRPSDQKLD VtQWHVH VLQIR-
FODVVHJUDPDWLFDO2VSUHÀ[RVRFRUUHQWHVHPSDODYUDVSRU- QLDVLPSDWLDVLQRSVH
WXJXHVDVVHRULJLQDPGRODWLPHGRJUHJROtQJXDVHPTXH teleGLVWkQFLDDIDVWDPHQWRWHOHYLVmRWHOHSDWLDWHOp-
IXQFLRQDYDPFRPRSUHSRVLo}HVRXDGYpUELRVORJRFRPR JUDIR

30
LÍNGUA PORTUGUESA

3UHÀ[RVGH2ULJHP/DWLQD trans-, tras-, tres-, tra-PRYLPHQWRSDUDDOpPPRYL-


PHQWRDWUDYpVWUDQVDWOkQWLFRWUHVQRLWDUWUDGLomR
a-, ab-, abs-DIDVWDPHQWRVHSDUDomRDYHUVmRDEXVR ultra-SRVLomRDOpPGROLPLWHH[FHVVRXOWUDSDVVDUXO-
DEVWLQrQFLDDEVWUDomR WUDUURPDQWLVPRXOWUDVVRPXOWUDOHYHXOWUDYLROHWD
a-, ad DSUR[LPDomR PRYLPHQWR SDUD MXQWR DGMXQ- vice-, vis-HPOXJDUGHYLFHSUHVLGHQWHYLVFRQGHYL-
WRDGYRJDGRDGYLUDSRVWR FHDOPLUDQWH
anteDQWHULRULGDGHSURFHGrQFLDDQWHEUDoRDQWHVVD-
ODDQWHRQWHPDQWHYHU 6XÀ[RVVmRHOHPHQWRV LVRODGDPHQWHLQVLJQLÀFDWLYRV 
TXHDFUHVFHQWDGRVDXPUDGLFDOIRUPDPQRYDSDODYUD6XD
ambiGXSOLFLGDGHDPELGHVWURDPELHQWHDPELJXLGD-
GHDPELYDOHQWH
SULQFLSDO FDUDFWHUtVWLFD p D PXGDQoD GH FODVVH JUDPDWLFDO
ben(e)-, bem-EHPH[FHOrQFLDGHIDWRRXDomREHQH-
TXH JHUDOPHQWH RSHUD 'HVVD IRUPD SRGHPRV XWLOL]DU R
ItFLREHQGLWR
bis-, bi-UHSHWLomRGXDVYH]HVELVQHWRELPHVWUDOEL- VLJQLÀFDGR GH XP YHUER QXP FRQWH[WR HP TXH VH GHYH
VDY{ELVFRLWR XVDUXPVXEVWDQWLYRSRUH[HPSOR&RPRRVXÀ[RpFRORFD-
circu(m)- PRYLPHQWR HP WRUQR FLUFXQIHUrQFLD FLU- GRGHSRLVGRUDGLFDODHOHVmRLQFRUSRUDGDVDVGHVLQrQFLDV
FXQVFULWRFLUFXODomR TXHLQGLFDPDVÁH[}HVGDVSDODYUDVYDULiYHLV([LVWHPGRLV
cis-SRVLomRDTXpPFLVDOSLQRFLVSODWLQRFLVDQGLQR JUXSRV GH VXÀ[RV IRUPDGRUHV GH VXEVWDQWLYRV H[WUHPD-
co-, con-, com- FRPSDQKLD FRQFRPLWkQFLD FROpJLR PHQWH LPSRUWDQWHV SDUD R IXQFLRQDPHQWR GD OtQJXD 6mR
FRRSHUDWLYDFRQGXWRU RV TXH IRUPDP QRPHV GH ação H RV TXH IRUPDP QRPHV
contra-RSRVLomRFRQWUDSHVRFRQWUDSRUFRQWUDGL]HU GHDJHQWH
de-PRYLPHQWRGHFLPDSDUDEDL[RVHSDUDomRQHJD-
omRGHFDSLWDUGHFDLUGHSRU 6XÀ[RVTXHIRUPDPQRPHVGHDomR-ada²FDPLQKD-
de(s)-, di(s)-QHJDomRDomRFRQWUiULDVHSDUDomRGHV- GD-ança²PXGDQoD-ância²DEXQGkQFLD-ção²HPRomR
YHQWXUDGLVFyUGLDGLVFXVVmR -dão²VROLGmR-ença²SUHVHQoD-ez(a)²VHQVDWH]EHOH]D
e-, es-, exPRYLPHQWRSDUDIRUDH[FrQWULFRHYDVmR -ismo²FLYLVPR-mento²FDVDPHQWR-são²FRPSUHHQ-
H[SRUWDomRH[SHOLU VmR-tude²DPSOLWXGH-ura²IRUPDWXUD
en-, em-, in-PRYLPHQWRSDUDGHQWURSDVVDJHPSDUD
XPHVWDGRRXIRUPDUHYHVWLPHQWRLPHUJLUHQWHUUDUHP- 6XÀ[RVTXHIRUPDPQRPHVGHDJHQWH-ário(a)²VH-
EHEHULQMHWDULPSRUWDU
FUHWiULR-eiro(a)²IHUUHLUR-ista²PDQREULVWD-or²OXWD-
extra-SRVLomRH[WHULRUH[FHVVRH[WUDGLomRH[WUDRUGL-
GRU-nte ²IHLUDQWH
QiULRH[WUDYLDU
i-, in-, im-VHQWLGRFRQWUiULRSULYDomRQHJDomRLOHJDO
LPSRVVtYHOLPSURGXWLYR 6XÀ[RV TXH IRUPDP QRPHV GH OXJDU GHSRVLWyULR
inter-, entreSRVLomRLQWHUPHGLiULDLQWHUQDFLRQDOLQ- -aria²FKXUUDVFDULD-ário²KHUEDQiULR-eiro²DoXFDUHLUR
WHUSODQHWiULR -or²FRUUHGRU-tério²FHPLWpULR-tório²GRUPLWyULR
intra-SRVLomRLQWHULRULQWUDPXVFXODULQWUDYHQRVRLQ-
WUDYHUEDO 6XÀ[RV TXH IRUPDP QRPHV LQGLFDGRUHV GH DEXQ-
intro- PRYLPHQWR SDUD GHQWUR LQWURGX]LU LQWURYHUWL- dância, aglomeração, coleção: -aço²ULFDoR-ada²SD-
GRLQWURVSHFWLYR SHODGD-agem²IROKDJHP-al²FDSLQ]DO-ame²JHQWDPH
justa-SRVLomRDRODGRMXVWDSRUMXVWDOLQHDU -ario(a)FDVDULRLQIDQWDULD-edo²DUYRUHGR-eria²FRU-
ob-, o-SRVLomRHPIUHQWHRSRVLomRREVWUXLURIXVFDU UHULD-io²PXOKHULR-ume²QHJUXPH
RFXSDUREVWiFXOR
per-PRYLPHQWRDWUDYpVSHUFRUUHUSHUSOH[RSHUIXUDU 6XÀ[RVTXHIRUPDPQRPHVWpFQLFRVXVDGRVQDFLrQ-
SHUYHUWHU cia:
pos-SRVWHULRULGDGHSRVSRUSRVWHULRUSyVJUDGXDGR -ite - EURQTXLWH KHSDWLWH LQÁDPDomR  DPRWLWH IyV-
pre- DQWHULRULGDGH SUHIiFLR SUHYHU SUHÀ[R SUHOLPL- VHLV 
QDU -oma - PLRPDHSLWHOLRPDFDUFLQRPD WXPRUHV 
pro- PRYLPHQWR SDUD IUHQWH SURJUHVVR SURPRYHU
-ato, eto, Ito - VXOIDWR FORUHWR VXOÀWR VDLV  JUDQLWR
SURVVHJXLUSURMHomR
SHGUD 
re- UHSHWLomR UHFLSURFLGDGH UHYHU UHGX]LU UHEDWHU
-ina - FDIHtQDFRGHtQD DOFDORLGHViOFDOLVDUWLÀFLDLV 
UHDWDU
retro-PRYLPHQWRSDUDWUiVUHWURVSHFWLYDUHWURFHVVR -ol - IHQROQDIWRO GHULYDGRGHKLGURFDUERQHWR 
UHWURDJLUUHWUyJUDGR -ema - PRUIHPDIRQHPDVHPHPDVHPDQWHPD FLrQ-
so-, sob-, sub-, su- PRYLPHQWR GH EDL[R SDUD FLPD FLDOLQJXtVWLFD 
LQIHULRULGDGHVRWHUUDUVRESRUVXEHVWLPDU -io - VyGLRSRWiVVLRVHOrQLR FRUSRVVLPSOHV
super-, supra-, sobre-SRVLomRVXSHULRUH[FHVVRVX-
SHUFtOLRVXSpUÁXR 6XÀ[R TXH IRUPD QRPHV GH UHOLJLmR GRXWULQDV À-
soto-, sota-SRVLomRLQIHULRUVRWRPHVWUHVRWDYRJD ORVyÀFDVVLVWHPDVSROtWLFRV- ismo: EXGLVPRNDQWLVPR
VRWRS{U FRPXQLVPR.

31
LÍNGUA PORTUGUESA

6XÀ[RV)RUPDGRUHVGH$GMHWLYRV Exercícios

- de substantivos: DFR – maníaco; DGR – barbado; $VVLQDOHDRSomRHPTXHWRGDVDVSDODYUDVVHIRU-


iFHR D - herbáceo, liláceas; DLFR – prosaico; DO – anual; PDPSHORPHVPRSURFHVVR
-ar – escolar; iULR - diário, ordinário; iWLFR – problemá- D DMRHOKDUDQWHEUDoRDVVLQDWXUD
tico; D] – mordaz; -engo ²PXOKHUHQJRHQWR – cruento; E DWUDVRHPEDUTXHSHVFD
HR – róseo; HVFR – pitoresco; HVWH – agreste; HVWUH – F RMRWDRVLPRWURSHoR
terrestre; HQKR – ferrenho; HQR – terreno; tFLR – ali- G HQWUHJDHVWXSLGH]VREUHYLYHU
mentício; LFR – geométrico; LO – febril; LQR – cristalino; H DQWHSRUH[SRUWDomRVDQJXHVVXJD
LYR – lucrativo; RQKR – tristonho; RVR – bondoso; -udo
²EDUULJXGR $SDODYUD´DJXDUGHQWHµIRUPRXVHSRU
D KLEULGLVPR
- de verbos: E DJOXWLQDomR
 D H L QWH DomR TXDOLGDGH HVWDGR ² semelhante, F MXVWDSRVLomR
doente, seguinte. G SDUDVVtQWHVH
 i t YHOSRVVLELOLGDGHGHSUDWLFDURXVRIUHUXPDDomR H GHULYDomRUHJUHVVLYD
²louvável, perecível, punível.
LR W LYRDomRUHIHUrQFLDPRGRGHVHU²WDUGLRDÀU- 4XHLWHPFRQWpPVRPHQWHSDODYUDVIRUPDGDVSRU
mativo, pensativo. MXVWDSRVLomR"
 G LoR W tFLRSRVVLELOLGDGHGHSUDWLFDURXVRIUHUXPD D GHVDJUDGiYHO²FRPSOHPHQWH
DomRUHIHUrQFLD²movediço, quebradiço, factício. E YDJDOXPHSpGHFDEUD
 G RXUR W yULRDomRSHUWLQrQFLD²casadouro, prepa- F HQFUX]LOKDGD²HVWUHPHFHX
ratório. G VXSHUVWLFLRVD²YDOLRVDV
H GHVDWDUUD[RX²HVWUHPHFHX
6XÀ[RV$GYHUELDLV 1D/tQJXD3RUWXJXHVDH[LVWHDSH-
QDVXP~QLFRVXÀ[RDGYHUELDOeRVXÀ[R“-mente”, GHULYDGR ´6DUDPSRµp
GRVXEVWDQWLYRIHPLQLQRODWLQRmens, mentisTXHSRGHVLJ- D IRUPDSULPLWLYD
QLÀFDU´DPHQWHRHVStULWRRLQWHQWRµ(VWHVXÀ[RMXQWRXVH E IRUPDGRSRUGHULYDomRSDUDVVLQWpWLFD
DDGMHWLYRVQDIRUPDIHPLQLQDSDUDLQGLFDUFLUFXQVWkQFLDV F IRUPDGRSRUGHULYDomRUHJUHVVLYD
HVSHFLDOPHQWH D GH PRGRExemplos: altivaPHQWH, bra- G IRUPDGRSRUGHULYDomRLPSUySULD
vaPHQWH, bondosaPHQWH, nervosaPHQWH, fraca-PHQWH, H IRUPDGRSRURQRPDWRSpLD
piaPHQWH-iRVDGYpUELRVTXHVHGHULYDPGHDGMHWLYRVWHU-
PLQDGRV HP –ês (burgues-PHQWH, portuguesPHQWH, etc.)  1XPHUH DV SDODYUDV GD SULPHLUD FROXQD FRQIRUPH
QmRVHJXHPHVWDUHJUDSRLVHVVHVDGMHWLYRVHUDPRXWURUD RVSURFHVVRVGHIRUPDomRQXPHUDGRVjGLUHLWD(PVHJXL-
XQLIRUPHVExemplos: cabrito PRQWrV / cabrita PRQWrV. GDPDUTXHDDOWHUQDWLYDTXHFRUUHVSRQGHjVHTXrQFLDQX-
PpULFDHQFRQWUDGD
6XÀ[RV 9HUEDLV 2V VXÀ[RV YHUEDLV DJUHJDPVH YLD  DJXDUGHQWH MXVWDSRVLomR
GH UHJUD DR UDGLFDO GH VXEVWDQWLYRV H DGMHWLYRV SDUD IRU-  FDVDPHQWR DJOXWLQDomR
PDU QRYRV YHUERV (P JHUDO RV YHUERV QRYRV GD OtQJXD  SRUWXiULR SDUDVVtQWHVH
IRUPDPVH SHOR DFUpVFLPR GD WHUPLQDomR-ar. Exemplos:  SRQWDSp GHULYDomRVXÀ[DO
esqui-ar; radiograf-ar; (a)doç-ar; nivel-ar D ÀQar; tele-  RVFRQWUDV GHULYDomRLPSUySULD
fon-ar; (a)portugues-ar.  VXEPDULQR GHULYDomRSUHÀ[DO
 KLSyWHVH
2VYHUERVH[SULPHPHQWUHRXWUDVLGHLDVDSUiWLFDGH
DomR D 
-ar: FUX]DUDQDOLVDUOLPSDU E 
-ear: JXHUUHDUJROHDU F 
-entar: DIXJHQWDUDPDPHQWDU G 
ÀFDUGLJQLÀFDUOLTXLGLÀFDU H 
-izar: ÀQDOL]DURUJDQL]DU 
,QGLTXHDSDODYUDTXHIRJHDRSURFHVVRGHIRUPD-
Verbo Frequentativo: é aquele que traduz ação re- omRGHFKDSHFKDSH
petida. D ]XQ]XP
Verbo Factitivo: é aquele que envolve LGHLDGHID]HU E UHFRUHFR
RXFDXVDU F WRTXHWRTXH
Verbo Diminutivo: é aquele que exprime ação pou- G WOLPWOLP
co intensa. H YLYLGR

32
LÍNGUA PORTUGUESA

(PTXHDOWHUQDWLYDDSDODYUDVXEOLQKDGDUHVXOWDGH Adjetivo Pátrio (ou gentílico)


GHULYDomRLPSUySULD"
D ­VVHWHKRUDVGDPDQKmFRPHoRXRWUDEDOKRSULQFL- ,QGLFD D QDFLRQDOLGDGH RX R OXJDU GH RULJHP GR VHU
SDODvotação 2EVHUYHDOJXQVGHOHV
E PereirinhaHVWDYDPHVPRFRPDUD]mR6LJLOR9RWR (VWDGRVHFLGDGHVEUDVLOHLURV
VHFUHWR%REDJHQVEREDJHQV $ODJRDV  DODJRDQR
F 6HPUDGLFDOUHIRUPDGDOHLHOHLWRUDODVHOHLo}HVcon- $PDSi  DPDSDHQVH
$UDFDMX  DUDFDMXDQRRXDUDFDMXHQVH
tinuariamVHQGRXPDIDUVD
G 1mRFKHJDUDPDWURFDUXPistoGHSURVDHVHHQ-
WHQGHUDP $PD]RQDV  DPD]RQHQVHRXEDUp
H  'U 2VPtULR DQGDULD desorientado VHQmR EXIDQGR %HOR+RUL]RQWH EHORKRUL]RQWLQR
GHUDLYD %UDVtOLD  EUDVLOLHQVH
&DER)ULR  FDERIULHQVH
$VVLQDOHDVpULHGHSDODYUDVHPTXHWRGDVVmRIRU- &DPSLQDV  FDPSLQHLURRXFDPSLQHQVH
PDGDVSRUSDUDVVtQWHVH
D DFRUUHQWDUHVEXUDFDUGHVSHGDoDUDPDQKHFHU Adjetivo Pátrio Composto
E VROXomRSDVVLRQDOFRUUXSomRYLVLRQiULR
F HQULMHFHUGHVOHDOGDGHWRUWXUDYLGHQWH 1DIRUPDomRGRDGMHWLYRSiWULRFRPSRVWRRSULPHLUR
G ELRJUDÀDPDFUyELRELEOLRJUDÀDDVWHUyLGH HOHPHQWRDSDUHFHQDIRUPDUHGX]LGDHQRUPDOPHQWHHUX-
H DFURPDWLVPRKLGURJrQLROLWRJUDIDULGLRWLVPR GLWD2EVHUYHDOJXQVH[HPSORV
ÉIULFD DIUR&XOWXUDDIURDPHULFDQD
 $V SDODYUDV FRXYHÁRU SODQDOWR H DJXDUGHQWH VmR
$OHPDQKD JHUPDQR RX WHXWR&RPSHWLo}HV WHXWR
IRUPDGDVSRU
D GHULYDomR LQJOHVDV
E RQRPDWRSHLD $PpULFD DPpULFR&RPSDQKLDDPpULFRDIULFDQD
F KLEULGLVPR %pOJLFD EHOJR$FDPSDPHQWRVEHOJRIUDQFHVHV
G FRPSRVLomR &KLQD VLQR$FRUGRVVLQRMDSRQHVHV
H SUHÀ[DomR (VSDQKD KLVSDQR0HUFDGRKLVSDQRSRUWXJXrV
(XURSD HXUR1HJRFLDo}HVHXURDPHULFDQDV
$VVLQDOHDDOWHUQDWLYDHPTXHXPDGDVSDODYUDVQmR )UDQoD IUDQFRRXJDOR5HXQL}HVIUDQFRLWDOLD-
pIRUPDGDSRUSUHÀ[DomR QDV
D UHDGTXLULUSUHGHVWLQDGRSURSRU *UpFLD JUHFR)LOPHVJUHFRURPDQRV
E LUUHJXODUDPRUDOGHPRYHU ,QJODWHUUD DQJOR/HWUDVDQJORSRUWXJXHVDV
F UHPHWHUFRQWHUDQWHJR]DU ,WiOLD tWDOR6RFLHGDGHtWDORSRUWXJXHVD
G LUUHVWULWRDQWtSRGDSUHYHU -DSmR QLSR$VVRFLDo}HVQLSREUDVLOHLUDV
H GHYHUGHWHUDQWHYHU
3RUWXJDO OXVR$FRUGRVOXVREUDVLOHLURV
Respostas:%%%&(('$
'( Flexão dos adjetivos

2DGMHWLYRYDULDHPJrQHURQ~PHURHJUDX
CLASSES DE PALAVRAS 
Gênero dos Adjetivos
Adjetivo
2V DGMHWLYRV FRQFRUGDP FRP R VXEVWDQWLYR D TXH VH
Adjetivo p D SDODYUD TXH H[SUHVVD XPD TXDOLGDGH RX UHIHUHP PDVFXOLQRHIHPLQLQR 'HIRUPDVHPHOKDQWHDRV
FDUDFWHUtVWLFDGRVHUHVHUHODFLRQDFRPRVXEVWDQWLYR VXEVWDQWLYRVFODVVLÀFDPVHHP
$R DQDOLVDUPRV D SDODYUD bondoso SRU H[HPSOR SHU- Biformes WrPGXDVIRUPDVVHQGRXPDSDUDRPDV-
FHEHPRVTXHDOpPGHH[SUHVVDUXPDTXDOLGDGHHODSRGH FXOLQRHRXWUDSDUDRIHPLQLQR3RUH[HPSORativo e ativa,
VHUFRORFDGDDRODGRGHXPVXEVWDQWLYRKRPHPbondoso
mau e má, judeu e judia.
PRoDbondosaSHVVRDbondosa.
-iFRPDSDODYUDbondadeHPERUDH[SUHVVHXPDTXD- 6H R DGMHWLYR p FRPSRVWR H ELIRUPH HOH ÁH[LRQD QR
OLGDGHQmRDFRQWHFHRPHVPRQmRID]VHQWLGRGL]HUKR- IHPLQLQRVRPHQWHR~OWLPRHOHPHQWR3RUH[HPSORo moço
PHPbondade, PRoDbondadeSHVVRDbondadeBondade norte-americano, a moça norte-americana.
SRUWDQWRQmRpDGMHWLYRPDVVXEVWDQWLYR ([FHomRsurdo-mudo e surda-muda.

Morfossintaxe do Adjetivo Uniformes WrPXPDVyIRUPDWDQWRSDUDRPDVFXOLQR


FRPRSDUDRIHPLQLQR3RUH[HPSOR homem feliz e mulher
2 DGMHWLYR H[HUFH VHPSUH IXQo}HV VLQWiWLFDV IXQomR feliz
GHQWURGHXPDRUDomR UHODWLYDVDRVVXEVWDQWLYRVDWXDQGR 6HRDGMHWLYRpFRPSRVWRHXQLIRUPHÀFDLQYDULiYHOQR
FRPRDGMXQWRDGQRPLQDORXFRPRSUHGLFDWLYR GRVXMHLWR IHPLQLQR3RUH[HPSORFRQÁLWRSROtWLFRVRFLDOHGHVDYHQoD
RXGRREMHWR  político-social.

33
LÍNGUA PORTUGUESA

1~PHURGRV$GMHWLYRV Sou tão alto como você &RPSDUDWLYRGH,JXDOGDGH


1R FRPSDUDWLYR GH LJXDOGDGH R VHJXQGR WHUPR GD
Plural dos adjetivos simples FRPSDUDomRpLQWURGX]LGRSHODVSDODYUDVcomo, quantoRX
quão
2V DGMHWLYRV VLPSOHV ÁH[LRQDPVH QR SOXUDO GH DFRU-
GRFRPDVUHJUDVHVWDEHOHFLGDVSDUDDÁH[mRQXPpULFDGRV Sou mais alto (do) que você &RPSDUDWLYRGH6XSH-
VXEVWDQWLYRVVLPSOHV3RUH[HPSORmau e maus, feliz e feli- ULRULGDGH$QDOtWLFR
zes, ruim e ruins boa e boas 1R FRPSDUDWLYR GH VXSHULRULGDGH DQDOtWLFR HQWUH RV
&DVR R Ddjetivo seja uma palavra que também exerça
GRLV VXEVWDQWLYRV FRPSDUDGRV XP WHP TXDOLGDGH VXSH-
IXQomRGHVXEVWDQWLYRÀFDUiLQYDULiYHORXVHMDVHDSDODYUD
ULRU$IRUPDpDQDOtWLFDSRUTXHSHGLPRVDX[tOLRD´mais...do
TXH HVWLYHU TXDOLÀFDQGR XP HOHPHQWR IRU RULJLQDOPHQWH
XPVXEVWDQWLYRHODPDQWHUiVXDIRUPDSULPLWLYD([HPSOR
queµRX´mais...queµ
DSDODYUDcinzapRULJLQDOPHQWHXPVXEVWDQWLYRSRUpPVH
HVWLYHU TXDOLÀFDQGR XP HOHPHQWR IXQFLRQDUi FRPR DGMH- O Sol é maior (do) que a Terra. &RPSDUDWLYRGH6XSH-
WLYR )LFDUi HQWmR LQYDULiYHO /RJR camisas cinza, ternos ULRULGDGH6LQWpWLFR
cinza.
9HMDRXWURVH[HPSORV $OJXQVDGMHWLYRVSRVVXHPSDUDRFRPSDUDWLYRGHVX-
Motos vinho PDVmotos verdes SHULRULGDGHIRUPDVVLQWpWLFDVKHUGDGDVGRODWLP6mRHOHV
Paredes musgo PDVparedes brancas  bom /melhor, pequeno/menor, mau/pior, alto/superior,
Comícios monstro PDVcomícios grandiosos  grande/maior, baixo/inferior.
2EVHUYHTXH
Adjetivo Composto D $VIRUPDVmenor e piorVmRFRPSDUDWLYRVGHVXSH-
ULRULGDGHSRLVHTXLYDOHPDmais pequeno e mais mauUHV-
e DTXHOH IRUPDGR SRU GRLV RX PDLV HOHPHQWRV 1RU- SHFWLYDPHQWH
PDOPHQWHHVVHVHOHPHQWRVVmROLJDGRVSRUKtIHQ$SHQDV E Bom, mau, grande e pequenoWrPIRUPDVVLQWpWLFDV
R ~OWLPR HOHPHQWR FRQFRUGD FRP R VXEVWDQWLYR D TXH VH melhor, pior, maior e menor)SRUpPHPFRPSDUDo}HVIHL-
UHIHUHRVGHPDLVÀFDPQDIRUPDPDVFXOLQDVLQJXODU&DVR WDVHQWUHGXDVTXDOLGDGHVGHXPPHVPRHOHPHQWRGHYH
XPGRVHOHPHQWRVTXHIRUPDPRDGMHWLYRFRPSRVWRVHMD
VHXVDUDVIRUPDVDQDOtWLFDVmais bom, mais mau,mais gran-
XPVXEVWDQWLYRDGMHWLYDGRWRGRRDGMHWLYRFRPSRVWRÀFD-
de e mais pequeno3RUH[HPSOR
UiLQYDULiYHO3RUH[HPSORDSDODYUD rosapRULJLQDOPHQWH
XPVXEVWDQWLYRSRUpPVHHVWLYHUTXDOLÀFDQGRXPHOHPHQ-
WR IXQFLRQDUi FRPR DGMHWLYR &DVR VH OLJXH D RXWUD SDOD- Pedro é maior do que Paulo&RPSDUDomRGHGRLVHOH-
YUDSRUKtIHQIRUPDUiXPDGMHWLYRFRPSRVWRFRPRpXP PHQWRV
VXEVWDQWLYRDGMHWLYDGRRDGMHWLYRFRPSRVWRLQWHLURÀFDUi   Pedro é mais grande que pequeno  FRPSDUDomRGH
LQYDULiYHO3RUH[HPSOR GXDVTXDOLGDGHVGHXPPHVPRHOHPHQWR
Camisas rosa-claro.
Ternos rosa-claro. Sou menos alto (do) que você &RPSDUDWLYRGH,Q-
Olhos verde-claros. IHULRULGDGH
Calças azul-escuras e camisas verde-mar.  Sou menos passivo (do) que tolerante.
Telhados marrom-café e paredes verde-claras.
Superlativo
2EVAzul-marinho, azul-celeste, ultravioletaHTXDO-
TXHUDGMHWLYRFRPSRVWRLQLFLDGRSRUcor-de-VmRVHPSUH 2 VXSHUODWLYR H[SUHVVD TXDOLGDGHV QXP JUDX PXLWR
LQYDULiYHLV HOHYDGRRXHPJUDXPi[LPR2JUDXVXSHUODWLYRSRGHVHU
2VDGMHWLYRVFRPSRVWRVVurdo-mudo e pele-vermelha DEVROXWRRXUHODWLYRHDSUHVHQWDDVVHJXLQWHVPRGDOLGDGHV
WrPRVGRLVHOHPHQWRVÁH[LRQDGRV Superlativo Absoluto:RFRUUHTXDQGRDTXDOLGDGHGH
XPVHUpLQWHQVLÀFDGDVHPUHODomRFRPRXWURVVHUHV$SUH-
Grau do Adjetivo
VHQWDVHQDVIRUPDV
2VDGMHWLYRVÁH[LRQDPVHHPJUDXSDUDLQGLFDUDLQWHQ-
Analítica:DLQWHQVLÀFDomRVHID]FRPRDX[tOLRGHSDOD-
VLGDGHGDTXDOLGDGHGRVHU6mRGRLVRVJUDXVGRDGMHWLYR YUDVTXHGmRLGHLDGHLQWHQVLGDGH DGYpUELRV 3RUH[HPSOR
Rcomparativo HRsuperlativo O secretário é muito inteligente.
SintéticaDLQWHQVLÀFDomRVHID]SRUPHLRGRDFUpVFL-
Comparativo PRGHVXÀ[RV3RUH[HPSORO secretário é inteligentíssimo.

1HVVHJUDXFRPSDUDPVHDPHVPDFDUDFWHUtVWLFDDWUL- 2EVHUYHDOJXQVVXSHUODWLYRVVLQWpWLFRV
EXtGD D GRLV RX PDLV VHUHV RX GXDV RX PDLV FDUDFWHUtVWL- EHQpÀFR EHQHÀFHQWtVVLPR
FDVDWULEXtGDVDRPHVPRVHU2FRPSDUDWLYRSRGHVHUGH ERP ERQtVVLPRRXyWLPR
LJXDOGDGH GH VXSHULRULGDGH RX GH LQIHULRULGDGH 2EVHUYH FRPXP FRPXQtVVLPR
RVH[HPSORVDEDL[R FUXHO FUXGHOtVVLPR

34
LÍNGUA PORTUGUESA

GLItFLO GLÀFtOLPR 'HSHQGHQGRGDVFLUFXQVWkQFLDVH[SUHVVDVSHORVDGYpU-


GRFH GXOFtVVLPR ELRV HOHV VH FODVVLÀFDP HP GLVWLQWDV FDWHJRULDV XPD YH]
IiFLO IDFtOLPR H[SUHVVDVSRU
ÀHO  ÀGHOtVVLPR de modo:Bem, mal, assim, depressa, devagar, às pres-
 sas, às claras, às cegas, à toa, à vontade, às escondidas, aos
Superlativo Relativo: RFRUUH TXDQGR D TXDOLGDGH GH poucos, desse jeito, desse modo, dessa maneira, em geral,
XPVHUpLQWHQVLÀFDGDHPUHODomRDXPFRQMXQWRGHVHUHV frente a frente, lado a lado, a pé, de cor, em vãoHDPDLRU
(VVDUHODomRSRGHVHU SDUWHGRVTXHWHUPLQDPHPµPHQWHµcalmamente, triste-
mente, propositadamente, pacientemente, amorosamente,
De Superioridade:Clara é a mais bela da sala. docemente, escandalosamente, bondosamente, generosa-
mente
De Inferioridade:Clara é a menos bela da sala.
de intensidadeMuito, demais, pouco, tão, menos, em
1RWHEHP excesso, bastante, pouco, mais, menos, demasiado, quanto,
 2VXSHUODWLYRDEVROXWRDQDOtWLFRpH[SUHVVRSRUPHLR quão, tanto, que HTXLYDOHDTXmR tudo, nada, todo, quase,
GRV DGYpUELRV muito, extremamente, excepcionalmente, de todo, de muito, por completo.
HWFDQWHSRVWRVDRDGMHWLYR
  2 VXSHUODWLYR DEVROXWR VLQWpWLFR DSUHVHQWDVH VRE de tempo: Hoje, logo, primeiro, ontem, tarde outrora,
GXDVIRUPDVXPDHUXGLWDGHRULJHPODWLQDRXWUDSRSXODU amanhã, cedo, dantes, depois, ainda, antigamente, antes,
GH RULJHP YHUQiFXOD $ IRUPD HUXGLWD p FRQVWLWXtGD SHOR doravante, nunca, então, ora, jamais, agora, sempre, já, en-
UDGLFDOGRDGMHWLYRODWLQRXPGRVVXÀ[RV-íssimo, -imo ÀP DÀQDO EUHYH FRQVWDQWHPHQWH HQWUHPHQWHV LPHGLDWD-
ou érrimo3RUH[HPSORÀGHOtVVLPRIDFtOLPRSDXSpUULPR$ mente, primeiramente, provisoriamente, sucessivamente, às
IRUPDSRSXODUpFRQVWLWXtGDGRUDGLFDOGRDGMHWLYRSRUWX- vezes, à tarde, à noite, de manhã, de repente, de vez em
JXrVRVXÀ[R-íssimoSREUtVVLPRDJLOtVVLPR quando, de quando em quando, a qualquer momento, de
  (P YH] GRV VXSHUODWLYRV QRUPDLV seriíssimo, preca- tempos em tempos, em breve, hoje em dia
riíssimo, necessariíssimo,SUHIHUHPVHQDOLQJXDJHPDWXDO
DVIRUPDVseríssimo, precaríssimo, necessaríssimoVHPRGH- de lugar: $qui, antes, dentro, ali, adiante, fora, acolá,
VDJUDGiYHOKLDWRLt atrás, além, lá, detrás, aquém, cá, acima, onde, perto, aí,
abaixo, aonde, longe, debaixo, algures, defronte, nenhures,
Advérbio adentro, afora, alhures, nenhures, aquém, embaixo, exter-
namente, a distância, à distancia de, de longe, de perto, em
2advérbioDVVLP FRPRPXLWDVRXWUDVSDODYUDVH[LV- cima, à direita, à esquerda, ao lado, em volta
WHQWHV QD /tQJXD 3RUWXJXHVD DGYpP GH RXWUDV OtQJXDV
$VVLP VHQGR WDO TXDO R DGMHWLYR R SUHÀ[R ´ad-µ LQGLFD D de negaçãoNão, nem, nunca, jamais, de modo algum,
LGHLDGHSUR[LPLGDGHFRQWLJXLGDGH(VVDSUR[LPLGDGHID] de forma nenhuma, tampouco, de jeito nenhum
UHIHUrQFLDDRSURFHVVRYHUEDOQRVHQWLGRGHFDUDFWHUL]iOR
RXVHMDLQGLFDQGRDVFLUFXQVWkQFLDVHPTXHHVVHSURFHVVR de dúvidaAcaso, porventura, possivelmente, provavel-
VHGHVHQYROYH mente, quiçá, talvez, casualmente, por certo, quem sabe

2DGYpUELRUHODFLRQDVHDRVYHUERVGDOtQJXDQRVHQ- GHDÀUPDomRSim, certamente, realmente, decerto, efe-


WLGRGHFDUDFWHUL]DURVSURFHVVRVH[SUHVVRVSRUHOH&RQWX- tivamente, certo, decididamente, realmente, deveras, indubi-
GRHOHQmRpPRGLÀFDGRUH[FOXVLYRGHVWDFODVVH YHUERV  tavelmente (=sem dúvida).
SRLVWDPEpPPRGLÀFDRDGMHWLYRHDWpRXWURDGYpUELR6H-
JXHPDOJXQVH[HPSORV de exclusão: Apenas, exclusivamente, salvo, senão, so-
Para quem se diz distantemente alheio a esse assunto, mente, simplesmente, só, unicamente
você está até bem informado.
7HPRVRDGYpUELR´GLVWDQWHPHQWHµTXHPRGLÀFDRDG- de inclusão Ainda, até, mesmo, inclusivamente, tam-
MHWLYRDOKHLRUHSUHVHQWDQGRXPDTXDOLGDGHFDUDFWHUtVWLFD bém

O artista canta muito mal. de ordemDepois, primeiramente, ultimamente


1HVVHFDVRRDGYpUELRGHLQWHQVLGDGH´PXLWRµPRGLÀ-
FDRXWURDGYpUELRGHPRGR²´PDOµ(PDPERVRVH[HPSORV de designaçãoEis
SXGHPRVYHULÀFDUTXHVHWUDWDYDGHVRPHQWHXPDSDODYUD
IXQFLRQDQGR FRPR DGYpUELR 1R HQWDQWR HOH SRGH HVWDU de interrogação:RQGH"(lugar), como? (modo), quan-
GHPDUFDGR SRU PDLV GH XPD SDODYUD TXH PHVPR DVVLP do? (tempo), por quê? (causa), quanto? (preço e intensidade),
QmRGHL[DUiGHRFXSDUWDOIXQomR7HPRVDtRTXHFKDPD- SDUDTXr" ÀQDOLGDGH
PRV GH ORFXomR DGYHUELDO UHSUHVHQWDGD SRU DOJXPDV H[-
SUHVV}HVWDLVFRPRàs vezes, sem dúvida, frente a frente, de
modo algum,HQWUHRXWUDV

35
LÍNGUA PORTUGUESA

Locução adverbial Constatemos as circunstâncias


em que os artigos se manifestam
eUHXQLmRGHGXDVRXPDLVSDODYUDVFRPYDORUGHDG-
YpUELR([HPSOR &RQVLGHUDVHREULJDWyULRRXVRGRDUWLJRGHSRLVGR
Carlos saiu às pressas. LQGLFDQGRPRGR QXPHUDO ´DPERVµ Ambos os garotos decidiram participar
Maria saiu à tarde. LQGLFDQGRWHPSR das olimpíadas.

+iORFXo}HVDGYHUELDLVTXHSRVVXHPDGYpUELRVFRUUHV- 1RPHVSUySULRVLQGLFDWLYRVGHOXJDUDGPLWHPRXVR
SRQGHQWHV ([HPSOR Carlos saiu às pressas. = Carlos saiu GRDUWLJRRXWURVQmRSão Paulo, O Rio de Janeiro, Veneza,
apressadamente. A Bahia.
$SHQDV RV DGYpUELRV GH LQWHQVLGDGH GH OXJDU H GH
PRGRVmRÁH[LRQDGRVVHQGRTXHRVGHPDLVVmRWRGRVLQ- 4XDQGRLQGLFDGRQRVLQJXODURDUWLJRGHÀQLGRSRGH
YDULiYHLV $ ~QLFD ÁH[mR SURSULDPHQWH GLWD TXH H[LVWH QD LQGLFDUWRGDXPDHVSpFLH2WUDEDOKRGLJQLÀFDRKRPHP
FDWHJRULDGRVDGYpUELRVpDGHJUDX
SuperlativoDXPHQWDDLQWHQVLGDGH([HPSORVOonge 1RFDVRGHQRPHVSUySULRVSHUVRQDWLYRVGHQRWDQGR
- longíssimo, pouco - pouquíssimo, inconstitucionalmente - DLGHLDGHIDPLOLDULGDGHRXDIHWLYLGDGHpIDFXOWDWLYRRXVR
inconstitucionalissimamente, HWF GRDUWLJRO Pedro é o xodó da família.
Diminutivo GLPLQXL D LQWHQVLGDGH ([HPSORV perto -
pertinho, pouco - pouquinho, devagar - devagarinho. 1RFDVRGHRVQRPHVSUySULRVSHUVRQDWLYRVHVWDUHP
QRSOXUDOVmRGHWHUPLQDGRVSHORXVRGRDUWLJROs Maias,
Artigo os Incas, Os Astecas...

ArtigopDSDODYUDTXHYLQGRDQWHVGHXPVXEVWDQWLYR  8VDVH R DUWLJR GHSRLV GR SURQRPH LQGHÀQLGR WR-


LQGLFDVHHOHHVWiVHQGRHPSUHJDGRGHPDQHLUDGHÀQLGDRX GR D SDUDFRQIHULUXPDLGHLDGHWRWDOLGDGH6HPRXVRGHOH
LQGHÀQLGD$OpPGLVVRRDUWLJRLQGLFDDRPHVPRWHPSRR RDUWLJR RSURQRPHDVVXPHDQRomRGHTXDOTXHU
JrQHURHRQ~PHURGRVVXEVWDQWLYRV Toda a classe parabenizou o professor. DVDODWRGD
Toda classe possui alunos interessados e desinteressa-
&ODVVLÀFDomRGRV$UWLJRV dos. TXDOTXHUFODVVH

$UWLJRV 'HÀQLGRV GHWHUPLQDP RV VXEVWDQWLYRV GH  $QWHV GH SURQRPHV SRVVHVVLYRV R XVR GR DUWLJR p
PDQHLUDSUHFLVDo, a, os, as3RUH[HPSOR Eu matei o animal IDFXOWDWLYR
Adoro o meu vestido longo. Adoro meu vestido longo.
$UWLJRV,QGHÀQLGRVGHWHUPLQDPRVVXEVWDQWLYRVGH
PDQHLUDYDJDum, uma, uns, umas3RUH[HPSOREu matei  $ XWLOL]DomR GR DUWLJR LQGHÀQLGR SRGH LQGLFDU XPD
um animal LGHLDGHDSUR[LPDomRQXPpULFDO máximo que ele deve ter
é uns vinte anos.
Combinação dos Artigos
2DUWLJRWDPEpPpXVDGRSDUDVXEVWDQWLYDUSDODYUDV
ePXLWRSUHVHQWHDFRPELQDomRGRVDUWLJRVGHÀQLGRV RULXQGDVGHRXWUDVFODVVHVJUDPDWLFDLVNão sei o porquê de
HLQGHÀQLGRVFRPSUHSRVLo}HV9HMDDIRUPDDVVXPLGDSRU tudo isso.
HVVDVFRPELQDo}HV
1XQFDGHYHVHUXVDGRDUWLJRGHSRLVGRSURQRPHUH-
Preposições Artigos ODWLYRFXMR HÁH[}HV 
   RRV   Este é o homem cujo amigo desapareceu.
D   DRDRV   Este é o autor cuja obra conheço.
GH   GRGRV  
HP   QRQRV   1mRVHGHYHXVDUDUWLJRDQWHVGDVSDODYUDVFDVD QR
SRU SHU   SHORSHORV VHQWLGRGHODUPRUDGLD HWHUUD QRVHQWLGRGHFKmRÀUPH 
DDV  XPXQV XPDXPDV DPHQRVTXHYHQKDPHVSHFLÀFDGDV
jjV     Eles estavam em casa.
GDGDV  GXPGXQV GXPDGXPDV Eles estavam na casa dos amigos.
QDQDV  QXPQXQV QXPDQXPDV Os marinheiros permaneceram em terra.
SHODSHODV     Os marinheiros permanecem na terra dos anões.

 $V IRUPDV à H às LQGLFDP D IXVmR GD SUHSRVLomR a 1mRVHHPSUHJDDUWLJRDQWHVGRVSURQRPHVGHWUDWD-


FRPRDUWLJRGHÀQLGRa(VVDIXVmRGHYRJDLVLGrQWLFDVp PHQWRFRPH[FHomRGHVHQKRU D VHQKRULWDHGRQDVossa
FRQKHFLGDSRUcrase excelência resolverá os problemas de Sua Senhoria.

36
LÍNGUA PORTUGUESA

1mRVHXQHFRPSUHSRVLomRRDUWLJRTXHID]SDUWHGR $/7(51$7,9$6([SUHVVDPLGHLDGHDOWHUQkQFLD
QRPHGHUHYLVWDVMRUQDLVREUDVOLWHUiULDVLi a notícia em O Ou você sai do telefone ou eu vendo o aparelho.
Estado de S. Paulo. 3ULQFLSDLV FRQMXQo}HV DOWHUQDWLYDV Ou...ou, ora...ora,
quer...quer, já...já.
Morfossintaxe  &21&/86,9$6 6HUYHP SDUD GDU FRQFOXV}HV jV RUD-
o}HV([ Estudei muito, por isso mereço passar.
3DUD GHÀQLU R TXH p DUWLJR p SUHFLVR PHQFLRQDU VXDV 3ULQFLSDLV FRQMXQo}HV FRQFOXVLYDV logo, por isso, pois
UHODo}HVFRPRVXEVWDQWLYR$VVLPQDVRUDo}HVGDOtQJXD GHSRLVGRYHUER  portanto, por conseguinte, assim.
SRUWXJXHVDRDUWLJRH[HUFHDIXQomRGHDGMXQWRDGQRPLQDO
GR VXEVWDQWLYR D TXH VH UHIHUH 7DO IXQomR LQGHSHQGH GD (;3/,&$7,9$6([SOLFDPGmRXPPRWLYRRXUD]mR([
IXQomRH[HUFLGDSHORVXEVWDQWLYR É melhor colocar o casaco porque está fazendo muito frio lá
A existência é uma poesia. fora.
Uma existência é a poesia. 3ULQFLSDLV FRQMXQo}HV H[SOLFDWLYDV que, porque, pois
DQWHVGRYHUER porquanto.
Conjunção
Conjunções subordinativas
ConjunçãopDSDODYUDLQYDULiYHOTXHOLJDGXDVRUDo}HV
RX GRLV WHUPRV VHPHOKDQWHV GH XPD PHVPD RUDomR 3RU &$86$,6
H[HPSOR 3ULQFLSDLVFRQMXQo}HVFDXVDLVporque, visto que, já que,
A menina segurou a boneca e mostrou quando viu as uma vez que, como SRUTXH 
amiguinhas. Ele não fez o trabalho porque não tem livro.

'HVWHH[HPSORSRGHPVHUUHWLUDGDVWUrVLQIRUPDo}HV &203$5$7,9$6
 segurou a boneca a menina mostrou  viu 3ULQFLSDLVFRQMXQo}HVFRPSDUDWLYDVque, do que, tão...
as amiguinhas como, mais...do que, menos...do que.
Ela fala mais que um papagaio.
&DGDLQIRUPDomRHVWiHVWUXWXUDGDHPWRUQRGHXPYHU-
ER segurou, mostrou, viu $VVLP Ki QHVVD IUDVH WUrV RUD- &21&(66,9$6
o}HV 3ULQFLSDLVFRQMXQo}HVFRQFHVVLYDVembora, ainda que,
 RUDomR A menina segurou a boneca    RUDomR e mesmo que, apesar de, se bem que.
mostrou RUDomRquando viu as amiguinhas. ,QGLFDP XPD FRQFHVVmR DGPLWHP XPD FRQWUDGLomR
$VHJXQGDRUDomROLJDVHjSULPHLUDSRUPHLRGR´HµH XPIDWRLQHVSHUDGR7UD]HPVLXPDLGHLDGH´DSHVDUGHµ
DWHUFHLUDRUDomROLJDVHjVHJXQGDSRUPHLRGR´TXDQGRµ Embora estivesse cansada, fui ao shopping. DSHVDUGH
$VSDODYUDV´HµH´TXDQGRµOLJDPSRUWDQWRRUDo}HV HVWDUFDQVDGD
ObserveGosto de natação e de futebol. Apesar de ter chovido fui ao cinema.
1HVVDIUDVHDVH[SUHVV}HVGHQDWDomRGHIXWHEROVmR
SDUWHVRXWHUPRVGHXPDPHVPDRUDomR/RJRDSDODYUD &21)250$7,9$6
´HµHVWiOLJDQGRWHUPRVGHXPDPHVPDRUDomR 3ULQFLSDLV FRQMXQo}HV FRQIRUPDWLYDV como, segundo,
conforme, consoante
Morfossintaxe da Conjunção Cada um colhe conforme semeia.
([SUHVVDPXPDLGHLDGHDFRUGRFRQFRUGkQFLDFRQIRU-
$VFRQMXQo}HVDH[HPSORGDVSUHSRVLo}HVQmRH[HU- PLGDGH
FHPSURSULDPHQWHXPDIXQomRVLQWiWLFDVmRFRQHFWLYRV
&ODVVLÀFDomR &216(&87,9$6
Conjunções Coordenativas ([SUHVVDPXPDLGHLDGHFRQVHTXrQFLD
- Conjunções Subordinativas 3ULQFLSDLV FRQMXQo}HV FRQVHFXWLYDV que DSyV ´WDOµ
´WDQWRµ´WmRµ´WDPDQKRµ 
Conjunções coordenativas )DORXWDQWRTXHÀFRXURXFR

'LYLGHPVHHP ),1$,6
 $',7,9$6 H[SUHVVDP D LGHLD GH DGLomR VRPD ([ ([SUHVVDPLGHLDGHÀQDOLGDGHREMHWLYR
Gosto de cantar e de dançar. Todos trabalham para que possam sobreviver.
3ULQFLSDLV FRQMXQo}HV DGLWLYDV e, nem, não só...mas 3ULQFLSDLV FRQMXQo}HV ÀQDLV SDUD TXH D ÀP GH TXH
também, não só...como também. porque SDUDTXH 

$'9(56$7,9$6([SUHVVDPLGHLDVFRQWUiULDVGHRSR- 352325&,21$,6
VLomRGHFRPSHQVDomR([Estudei, mas não entendi nada. 3ULQFLSDLV FRQMXQo}HV SURSRUFLRQDLV à medida que,
3ULQFLSDLVFRQMXQo}HVDGYHUVDWLYDVmas, porém, contu- quanto mais, ao passo que, à proporção que.
do, todavia, no entanto, entretanto. À medida que as horas passavam, mais sono ele tinha.

37
LÍNGUA PORTUGUESA

7(0325$,6 Ai! Ai! Ai! Machuquei meu pé... DLLQWHUMHLomR VHQWHQ-


3ULQFLSDLV FRQMXQo}HV WHPSRUDLV quando, enquanto, oD VXJHVWmR “Isso está doendo!”RX´Estou com dor!”
logo que. $ LQWHUMHLomR p XP UHFXUVR GD OLQJXDJHP DIHWLYD HP
Quando eu sair, vou passar na locadora. TXHQmRKiXPDLGHLDRUJDQL]DGDGHPDQHLUDOyJLFDFRPR
Diferença entre orações causais e explicativas VmRDVVHQWHQoDVGDOtQJXDPDVVLPDPDQLIHVWDomRGHXP
VXVSLUR XP HVWDGR GD DOPD GHFRUUHQWH GH XPD VLWXDomR
4XDQGRHVWXGDPRV2UDo}HV6XERUGLQDGDV$GYHUELDLV SDUWLFXODUXPPRPHQWRRXXPFRQWH[WRHVSHFtÀFR([HP-
26$ H&RRUGHQDGDV6LQGpWLFDV &6 JHUDOPHQWHQRVGH- SORV
SDUDPRV FRP D G~YLGD GH FRPR GLVWLQJXLU XPD RUDomR Ah, como eu queria voltar a ser criança!
FDXVDOGHXPDH[SOLFDWLYD9HMDRVH[HPSORV DKH[SUHVVmRGHXPHVWDGRHPRWLYR LQWHUMHLomR
ž 1DIUDVH´Não atravesse a rua, porque você pode ser Hum! Esse pudim estava maravilhoso!
atropelado” KXPH[SUHVVmRGHXPSHQVDPHQWRV~ELWR LQWHUMHL-
D 7HPRVXPD&6([SOLFDWLYDTXHLQGLFDXPDMXVWLÀFDWL- omR
YDRXXPDH[SOLFDomRGRIDWRH[SUHVVRQDRUDomRDQWHULRU 
E  $V RUDo}HV VmR FRRUGHQDGDV H SRU LVVR LQGHSHQ-
2VLJQLÀFDGRGDVLQWHUMHLo}HVHVWiYLQFXODGRjPDQHLUD
GHQWHVXPDGDRXWUD1HVWHFDVRKiXPDSDXVDHQWUHDV
FRPRHODVVmRSURIHULGDV'HVVHPRGRRWRPGDIDODpTXH
RUDo}HVTXHYrPPDUFDGDVSRUYtUJXOD
GLWDRVHQWLGRTXHDH[SUHVVmRYDLDGTXLULUHPFDGDFRQWH[-
Não atravesse a rua. Você pode ser atropelado.
2XWUD GLFD p TXDQGR D RUDomR TXH DQWHFHGH D 2& WRGHHQXQFLDomR([HPSORV
2UDomR&RRUGHQDGD YLHUFRPYHUERQRPRGRLPSHUDWLYR Psiu! = FRQWH[WRDOJXpPSURQXQFLDQGRHVVDH[SUHV-
HODVHUiH[SOLFDWLYD VmRQDUXDVLJQLÀFDGRGDLQWHUMHLomR VXJHVWmR “Estou te
Façam silêncio, que estou falando. IDoDP  YHUER LP- chamando! Ei, espere!”
SHUDWLYR Psiu! = FRQWH[WRDOJXpPSURQXQFLDQGRHVVDH[SUHV-
VmRHPXPKRVSLWDOVLJQLÀFDGRGDLQWHUMHLomR VXJHVWmR 
ž  1D IUDVH ´Precisavam enterrar os mortos em outra “Por favor, faça silêncio!”
cidade porque não havia cemitério no localµ Puxa! Ganhei o maior prêmio do sorteio!
D 7HPRVXPD26$&DXVDOMiTXHDRUDomRVXERUGLQDGD SX[DLQWHUMHLomRWRPGDIDODHXIRULD
SDUWH GHVWDFDGD  PRVWUD D FDXVD GD DomR H[SUHVVD SHOR Puxa! Hoje não foi meu dia de sorte!
YHUERGDRUDomRSULQFLSDO2XWUDIRUPDGHUHFRQKHFrODp SX[DLQWHUMHLomRWRPGDIDODGHFHSomR
FRORFiODQRLQtFLRGRSHUtRGRLQWURGX]LGDSHODFRQMXQomR 
comoRTXHQmRRFRUUHFRPD&6([SOLFDWLYD $VLQWHUMHLo}HVFXPSUHPQRUPDOPHQWHGXDVIXQo}HV
Como não havia cemitério no local, precisavam enterrar  6LQWHWL]DUXPDIUDVHH[FODPDWLYDH[SULPLQGRDOHJULD
os mortos em outra cidade. WULVWH]DGRUHWF
E $VRUDo}HVVmRVXERUGLQDGDVHSRULVVRWRWDOPHQWH Você faz o que no Brasil?
GHSHQGHQWHVXPDGDRXWUD Eu? Eu negocio com madeiras.
Ah, deve ser muito interessante.

Interjeição  6LQWHWL]DUXPDIUDVHDSHODWLYD
Cuidado! Saia da minha frente.
Interjeição p D SDODYUD LQYDULiYHO TXH H[SULPH HPR-
o}HV VHQVDo}HV HVWDGRV GH HVStULWR RX TXH SURFXUD DJLU $VLQWHUMHLo}HVSRGHPVHUIRUPDGDVSRU
VREUHRLQWHUORFXWRUOHYDQGRRDDGRWDUFHUWRFRPSRUWD- VLPSOHVVRQVYRFiOLFRVOh!, Ah!, Ó, Ô.
PHQWRVHPTXHSDUDLVVRVHMDQHFHVViULRID]HUXVRGHHV-
SDODYUDVOba!, Olá!, Claro!
WUXWXUDVOLQJXtVWLFDVPDLVHODERUDGDV2EVHUYHRH[HPSOR
JUXSRVGHSDODYUDV ORFXo}HVLQWHUMHWLYDV Meu Deus!,
Droga! Preste atenção quando eu estou falando!
Ora bolas!
1R H[HPSOR DFLPD R LQWHUORFXWRU HVWi PXLWR EUDYR
7RGDVXDUDLYDVHWUDGX]QXPDSDODYUDDroga! (OHSRGHULD $ LGHLD H[SUHVVD SHOD LQWHUMHLomR GHSHQGH PXLWDV YH-
WHU GLWR  Estou com muita raiva de você! 0DV XVRX VLP- ]HVGDHQWRQDomRFRPTXHpSURQXQFLDGDSRULVVRSRGH
SOHVPHQWHXPDSDODYUD(OHHPSUHJRXDLQWHUMHLomRDroga! RFRUUHUTXHXPDLQWHUMHLomRWHQKDPDLVGHXPVHQWLGR3RU
$VVHQWHQoDVGDOtQJXDFRVWXPDPVHRUJDQL]DUGHIRU- H[HPSOR
PDOyJLFDKiXPDVLQWD[HTXHHVWUXWXUDVHXVHOHPHQWRVH Oh! Que surpresa desagradável!  LGHLDGHFRQWUD-
RVGLVWULEXLHPSRVLo}HVDGHTXDGDVDFDGDXPGHOHV$VLQ- ULHGDGH
WHUMHLo}HVSRURXWURODGRVmRXPDHVSpFLHGH´SDODYUDIUD- Oh! Que bom te encontrar.  LGHLDGHDOHJULD
VHµRXVHMDKiXPDLGHLDH[SUHVVDSRUXPDSDODYUD RXXP
FRQMXQWRGHSDODYUDVORFXomRLQWHUMHWLYD TXHSRGHULDVHU &ODVVLÀFDomRGDV,QWHUMHLo}HV
FRORFDGDHPWHUPRVGHXPDVHQWHQoD9HMDRVH[HPSORV
Bravo! Bis! &RPXPHQWHDVLQWHUMHLo}HVH[SUHVVDPVHQWLGRGH
EUDYR H ELV LQWHUMHLomR   VHQWHQoD VXJHVWmR  “Foi  $GYHUWrQFLD Cuidado!, Devagar!, Calma!, Sentido!,
muito bom! Repitam!” Atenção!, Olha!, Alerta!

38
LÍNGUA PORTUGUESA

$IXJHQWDPHQWRFora!, Passa!, Rua!, Xô! +iWDPEpPDVLQWHUMHLo}HVRQRPDWRSDLFDVRXLPLWD-


$OHJULDRX6DWLVIDomROh!, Ah!,Eh!, Oba!, Viva! WLYDVTXHH[SULPHPUXtGRVHYR]HV([Pum! Miau! Bum-
$OtYLRArre!, Uf!, Ufa! Ah! ba! Zás! Plaft! Pof! Catapimba! Tique-taque! Quá-quá-quá!
 $QLPDomR RX (VWtPXOR Vamos!, Força!, Coragem!, HWF
Eia!, Ânimo!, Adiante!, Firme!, Toca! 1mRVHGHYHFRQIXQGLUDLQWHUMHLomRGHDSHOR´yµFRP
 $SODXVR RX $SURYDomR Bravo!, Bis!, Apoiado!, Viva!, D VXD KRP{QLPD ´RKµ TXH H[SULPH DGPLUDomR DOHJULD
Boa! WULVWH]DHWF)D]VHXPDSDXVDGHSRLVGRµRKµH[FODPDWLYR
&RQFRUGkQFLDClaro!, Sim!, Pois não!, Tá!, Hã-hã! HQmRDID]HPRVGHSRLVGR´yµYRFDWLYR
 5HSXOVD RX 'HVDSURYDomR Credo!, Irra!, Ih!, Livra!, “Ó natureza! ó mãe piedosa e pura!” 2ODYR%LODF 
Safa!, Fora!, Abaixo!, Francamente!, Xi!, Chega!, Basta!, Ora! Oh! a jornada negra!µ 2ODYR%LODF
'HVHMRRX,QWHQomROh!, Pudera!, Tomara!, Oxalá!
'HVFXOSDPerdão! 1DOLQJXDJHPDIHWLYDFHUWDVLQWHUMHLo}HVRULJLQDGDV
'RURX7ULVWH]DAi!, Ui!, Ai de mim!, Que pena!, Ah!, GHSDODYUDVGHRXWUDVFODVVHVSRGHPDSDUHFHUÁH[LRQDGDV
Oh!, Eh! QR GLPLQXWLYR RX QR VXSHUODWLYR Calminha! Adeusinho!
 '~YLGD RX ,QFUHGXOLGDGH Qual!, Qual o quê!, Hum!,
Obrigadinho!
Epa!, Ora!
 (VSDQWR RX $GPLUDomR Oh!, Ah!, Uai!, Puxa!, Céus!,
Interjeições, leitura e produção de textos
Quê!, Caramba!, Opa!, Virgem!, Vixe!, Nossa!, Hem?!, Hein?,
Cruz!, Putz!
 ,PSDFLrQFLD RX &RQWUDULHGDGH Hum!, Hem!, Irra!, 8VDGDVFRPPXLWDIUHTXrQFLDQDOtQJXDIDODGDLQIRUPDO
Raios!, Diabo!, Puxa!, Pô!, Ora! TXDQGRHPSUHJDGDVQDOtQJXDHVFULWDDVLQWHUMHLo}HVFRV-
3HGLGRGH$X[tOLRSocorro!, Aqui!, Piedade! WXPDPFRQIHULUOKHFHUWRWRPLQFRQIXQGtYHOGHFRORTXLDOL-
6DXGDomR&KDPDPHQWRRX,QYRFDomRSalve!, Viva!, GDGH$OpPGLVVRHODVSRGHPPXLWDVYH]HVLQGLFDUWUDoRV
Adeus!, Olá!, Alô!, Ei!, Tchau!, Ô, Ó, Psiu!, Socorro!, Valha- SHVVRDLV GR IDODQWH  FRPR D HVFDVVH] GH YRFDEXOiULR R
me, Deus! WHPSHUDPHQWR DJUHVVLYR RX GyFLO DWp PHVPR D RULJHP
6LOrQFLRPsiu!, Bico!, Silêncio! JHRJUiÀFD e QRV WH[WRV QDUUDWLYRV  SDUWLFXODUPHQWH QRV
7HUURURX0HGRCredo!, Cruzes!, Uh!, Ui!, Oh! GLiORJRVTXHFRPXPHQWHVHID]XVRGDVLQWHUMHLo}HVFRP
RREMHWLYRGHFDUDFWHUL]DUSHUVRQDJHQVHWDPEpPJUDoDVj
Saiba que$VLQWHUMHLo}HVVmRSDODYUDVLQYDULiYHLVLVWR VXDQDWXUH]DVLQWpWLFDDJLOL]DUDVIDODV1DWXUH]DVLQWpWLFDH
p QmR VRIUHP YDULDomR HP JrQHUR Q~PHUR H JUDX FRPR FRQWH~GRPDLVHPRFLRQDOGRTXHUDFLRQDOID]HPGDVLQWHU-
RVQRPHVQHPGHQ~PHURSHVVRDWHPSRPRGRDVSHFWR MHLo}HVSUHVHQoDFRQVWDQWHQRVWH[WRVSXEOLFLWiULRV
HYR]FRPRRVYHUERV1RHQWDQWRHPXVRHVSHFtÀFRDO-
JXPDV LQWHUMHLo}HV VRIUHP YDULDomR HP JUDX 'HYHVH WHU )RQWH
FODURQHVWHFDVRTXHQmRVHWUDWDGHXPSURFHVVRQDWXUDO KWWSZZZVRSRUWXJXHVFRPEUVHFRHVPRUIPRUI
GHVVD FODVVH GH SDODYUD PDV WmR Vy XPD YDULDomR TXH D SKS
OLQJXDJHP DIHWLYD SHUPLWH ([HPSORV oizinho, bravíssimo, Numeral
até loguinho.
Numeral p D SDODYUD TXH LQGLFD RV VHUHV HP WHUPRV
Locução Interjetiva QXPpULFRVLVWRpTXHDWULEXLTXDQWLGDGHDRVVHUHVRXRV
VLWXDHPGHWHUPLQDGDVHTXrQFLD
2FRUUH TXDQGR GXDV RX PDLV SDODYUDV IRUPDP XPD Os quatro últimos ingressos foram vendidos há pouco
H[SUHVVmR FRP VHQWLGR GH LQWHUMHLomR 3RU H[HPSOR  Ora >TXDWURQXPHUDO DWULEXWRQXPpULFRGH´LQJUHVVRµ@
bolas! Quem me dera! Virgem Maria! Meu Deus!
Ó de casa! Ai de mim! Valha-me Deus! Graças a Deus!
Eu quero café duplo, e você?
Alto lá! Muito bem!
>GXSORQXPHUDO DWULEXWRQXPpULFRGH´FDIpµ@
Observações
$VLQWHUMHLo}HVVmRFRPRIUDVHVUHVXPLGDVVLQWpWLFDV $SULPHLUDSHVVRDGDÀODSRGHHQWUDUSRUIDYRU
3RU H[HPSOR Ué! = Eu não esperava por essa!, Perdão! = >SULPHLUDQXPHUDO VLWXDRVHU´SHVVRDµQDVHTXrQ-
Peço-lhe que me desculpe. FLDGH´ÀODµ@

$OpPGRFRQWH[WRRTXHFDUDFWHUL]DDLQWHUMHLomRpR 1RWHEHPRVQXPHUDLVWUDGX]HPHPSDODYUDVRTXH
VHX WRP H[FODPDWLYR SRU LVVR SDODYUDV GH RXWUDV FODVVHV RVQ~PHURVLQGLFDPHPUHODomRDRVVHUHV$VVLPTXDQGR
JUDPDWLFDLVSRGHPDSDUHFHUFRPRLQWHUMHLo}HV DH[SUHVVmRpFRORFDGDHPQ~PHURV ƒHWF QmRVH
Viva! Basta! 9HUERV WUDWDGHQXPHUDLVPDVVLPGHDOJDULVPRV
Fora! Francamente! $GYpUELRV $OpPGRVQXPHUDLVPDLVFRQKHFLGRVMiTXHUHÁHWHPD
LGHLDH[SUHVVDSHORVQ~PHURVH[LVWHPPDLVDOJXPDVSDOD-
$LQWHUMHLomRSRGHVHUFRQVLGHUDGDXPD´SDODYUDIUD- YUDVFRQVLGHUDGDVQXPHUDLVSRUTXHGHQRWDPTXDQWLGDGH
VHµ SRUTXH VR]LQKD SRGH FRQVWLWXLU XPD PHQVDJHP ([ SURSRUomR RX RUGHQDomR 6mR DOJXQV H[HPSORV década,
Socorro!, Ajudem-me!, Silêncio!, Fique quieto! dúzia, par, ambos(as), novena.

39
LÍNGUA PORTUGUESA

&ODVVLÀFDomRGRV1XPHUDLV

Cardinais:LQGLFDPFRQWDJHPPHGLGDeRQ~PHUREiVLFRum, dois, cem milHWF

Ordinais:LQGLFDPDRUGHPRXOXJDUGRVHUQXPDVpULHGDGDprimeiro, segundo, centésimo,HWF

FracionáriosLQGLFDPSDUWHGHXPLQWHLURRXVHMDDGLYLVmRGRVVHUHVmeio, terço, dois quintos,HWF

Multiplicativos:H[SUHVVDPLGHLDGHPXOWLSOLFDomRGRVVHUHVLQGLFDQGRTXDQWDVYH]HVDTXDQWLGDGHIRLDXPHQWDGD
dobro, triplo, quíntuplo,HWF

Leitura dos Numerais

6HSDUDQGRRVQ~PHURVHPFHQWHQDVGHWUiVSDUDIUHQWHREWrPVHFRQMXQWRVQXPpULFRVHPIRUPDGHFHQWHQDVHQR
LQtFLRWDPEpPGHGH]HQDVRXXQLGDGHV(QWUHHVVHVFRQMXQWRVXVDVHYtUJXODDVXQLGDGHVOLJDPVHSHODFRQMXQomR´Hµ
1.203.726 = um milhão, duzentos e três mil, setecentos e vinte e seis.
45.520 = quarenta e cinco mil, quinhentos e vinte.

Flexão dos numerais

2VQXPHUDLVFDUGLQDLVTXHYDULDPHPJrQHURVmRum/uma, dois/duasHRVTXHLQGLFDPFHQWHQDVGHduzentos/duzentas
HPGLDQWHtrezentos/trezentas; quatrocentos/quatrocentasHWF&DUGLQDLVFRPRPLOKmRELOKmRWULOKmRYDULDPHPQ~PHUR
milhões, bilhões, trilhões2VGHPDLVFDUGLQDLVVmRLQYDULiYHLV
2VQXPHUDLVRUGLQDLVYDULDPHPJrQHURHQ~PHUR
primeiro segundo milésimo
primeira segunda milésima
primeiros segundos milésimos
primeiras segundas milésimas

2VQXPHUDLVPXOWLSOLFDWLYRVVmRLQYDULiYHLVTXDQGRDWXDPHPIXQo}HVVXEVWDQWLYDVFizeram o dobro do esforço e con-


seguiram o triplo de produção.
4XDQGRDWXDPHPIXQo}HVDGMHWLYDVHVVHVQXPHUDLVÁH[LRQDPVHHPJrQHURHQ~PHURTeve de tomar doses triplas do
medicamento.
2VQXPHUDLVIUDFLRQiULRVÁH[LRQDPVHHPJrQHURHQ~PHUR2EVHUYHum terço/dois terços, uma terça parte/duas terças
partes
2VQXPHUDLVFROHWLYRVÁH[LRQDPVHHPQ~PHURuma dúzia, um milheiro, duas dúzias, dois milheiros.
eFRPXPQDOLQJXDJHPFRORTXLDODLQGLFDomRGHJUDXQRVQXPHUDLVWUDGX]LQGRDIHWLYLGDGHRXHVSHFLDOL]DomRGHVHQ-
WLGReRTXHRFRUUHHPIUDVHVFRPR
“Me empresta duzentinho...”
É artigo de primeiríssima qualidade!
O time está arriscado por ter caído na segundona. VHJXQGDGLYLVmRGHIXWHERO
Emprego dos Numerais

3DUDGHVLJQDUSDSDVUHLVLPSHUDGRUHVVpFXORVHSDUWHVHPTXHVHGLYLGHXPDREUDXWLOL]DPVHRVRUGLQDLVDWpGpFLPR
HDSDUWLUGDtRVFDUGLQDLVGHVGHTXHRQXPHUDOYHQKDGHSRLVGRVXEVWDQWLYR

Ordinais Cardinais
João Paulo II (segundo) Tomo XV (quinze)
D. Pedro II (segundo) Luís XVI (dezesseis)
Ato II (segundo) Capítulo XX (vinte)
Século VIII (oitavo) Século XX (vinte)
Canto IX (nono) João XXIII ( vinte e três)

*3DUDGHVLJQDUOHLVGHFUHWRVHSRUWDULDVXWLOL]DVHRRUGLQDODWpQRQRHRFDUGLQDOGHGH]HPGLDQWH
Artigo 1.° (primeiro) Artigo 10 (dez)
Artigo 9.° (nono) Artigo 21 (vinte e um)

40
LÍNGUA PORTUGUESA

$PERVDPEDVVmRFRQVLGHUDGRVQXPHUDLV6LJQLÀFDP´XPHRXWURµ´RVGRLVµ RX´XPDHRXWUDµ´DVGXDVµ HVmRODU-


JDPHQWHHPSUHJDGRVSDUDUHWRPDUSDUHVGHVHUHVDRVTXDLVMiVHIH]UHIHUrQFLD
3HGURH-RmRSDUHFHPWHUÀQDOPHQWHSHUFHELGRDLPSRUWkQFLDGDVROLGDULHGDGH$PERVDJRUDSDUWLFLSDPGDVDWLYLGDGHV
comunitárias de seu bairro.
2EVDIRUPD´DPERVRVGRLVµpFRQVLGHUDGDHQIiWLFD$WXDOPHQWHVHXXVRLQGLFDDIHWDomRDUWLÀFLDOLVPR

Cardinais Ordinais Multiplicativos Fracionários


XP   SULPHLUR      
GRLV   VHJXQGR   GREURGXSOR  PHLR
WUrV   WHUFHLUR    WULSORWUtSOLFH  WHUoR
TXDWUR  TXDUWR    TXiGUXSOR  TXDUWR
FLQFR  TXLQWR    TXtQWXSOR  TXLQWR
VHLV   VH[WR    Vr[WXSOR  VH[WR
VHWH   VpWLPR    VpWXSOR   VpWLPR
RLWR   RLWDYR    yFWXSOR   RLWDYR
QRYH  QRQR    Q{QXSOR  QRQR
GH]   GpFLPR    GpFXSOR  GpFLPR
RQ]H  GpFLPRSULPHLUR     RQ]HDYRV
GR]H  GpFLPRVHJXQGR     GR]HDYRV
WUH]H  GpFLPRWHUFHLUR      WUH]HDYRV
FDWRU]H  GpFLPRTXDUWR      FDWRU]HDYRV
TXLQ]H  GpFLPRTXLQWR      TXLQ]HDYRV
GH]HVVHLV  GpFLPRVH[WR      GH]HVVHLVDYRV
GH]HVVHWH  GpFLPRVpWLPR      GH]HVVHWHDYRV
GH]RLWR  GpFLPRRLWDYR      GH]RLWRDYRV
GH]HQRYH  GpFLPRQRQR      GH]HQRYHDYRV
YLQWH  YLJpVLPR      YLQWHDYRV
WULQWD  WULJpVLPR      WULQWDDYRV
TXDUHQWD  TXDGUDJpVLPR      TXDUHQWDDYRV
FLQTHQWD  TXLQTXDJpVLPR      FLQTXHQWDDYRV
VHVVHQWD  VH[DJpVLPR      VHVVHQWDDYRV
VHWHQWD  VHSWXDJpVLPR      VHWHQWDDYRV
RLWHQWD  RFWRJpVLPR      RLWHQWDDYRV
QRYHQWD  QRQDJpVLPR      QRYHQWDDYRV
FHP   FHQWpVLPR   FrQWXSOR  FHQWpVLPR
GX]HQWRV  GXFHQWpVLPR      GXFHQWpVLPR
WUH]HQWRV  WUHFHQWpVLPR      WUHFHQWpVLPR
TXDWURFHQWRV TXDGULQJHQWpVLPR     TXDGULQJHQWpVLPR
TXLQKHQWRV  TXLQJHQWpVLPR      TXLQJHQWpVLPR
VHLVFHQWRV  VH[FHQWpVLPR      VH[FHQWpVLPR
VHWHFHQWRV  VHSWLQJHQWpVLPR     VHSWLQJHQWpVLPR
RLWRFHQWRV  RFWLQJHQWpVLPR      RFWLQJHQWpVLPR
QRYHFHQWRV  QRQJHQWpVLPRRXQRQLQJHQWpVLPR   QRQJHQWpVLPR
PLO   PLOpVLPR      PLOpVLPR
PLOKmR  PLOLRQpVLPR      PLOLRQpVLPR
ELOKmR  ELOLRQpVLPR      ELOLRQpVLPR

Preposição

PreposiçãopXPDSDODYUDLQYDULiYHOTXHVHUYHSDUDOLJDUWHUPRVRXRUDo}HV4XDQGRHVWDOLJDomRDFRQWHFHQRUPDO-
PHQWHKiXPDVXERUGLQDomRGRVHJXQGRWHUPRHPUHODomRDRSULPHLUR$VSUHSRVLo}HVVmRPXLWRLPSRUWDQWHVQDHVWUXWXUD
GDOtQJXDSRLVHVWDEHOHFHPDFRHVmRWH[WXDOHSRVVXHPYDORUHVVHPkQWLFRVLQGLVSHQViYHLVSDUDDFRPSUHHQVmRGRWH[WR

Tipos de Preposição

Preposições essenciais:SDODYUDVTXHDWXDPH[FOXVLYDPHQWHFRPRSUHSRVLo}HVa, ante, perante, após, até, com, con-


tra, de, desde, em, entre, para, por, sem, sob, sobre, trás, atrás de, dentro de, para com.

41
LÍNGUA PORTUGUESA

 Preposições acidentais SDODYUDV GH RXWUDV FODVVHV 'HRXWUR GRXWUR V


JUDPDWLFDLVTXHSRGHPDWXDUFRPRSUHSRVLo}HVcomo, du- 'HRXWUD GRXWUD V
rante, exceto, fora, mediante, salvo, segundo, senão, visto (PHVWH V  QHVWH V
(PHVWD V  QHVWD V
 Locuções prepositivas: GXDV RX PDLV SDODYUDV YD- (PHVVH V  QHVVH V
OHQGRFRPRXPDSUHSRVLomRVHQGRTXHD~OWLPDSDODYUDp (PDTXHOH V  QDTXHOH V
XPDGHODVabaixo de, acerca de, acima de, ao lado de, a res- (PDTXHOD V  QDTXHOD V
peito de, de acordo com, em cima de, embaixo de, em frente (PLVWR QLVWR
a, ao redor de, graças a, junto a, com, perto de, por causa de, (PLVVR QLVVR
por cima de, por trás de. (PDTXLOR QDTXLOR
$DTXHOH V  jTXHOH V
$SUHSRVLomRFRPRMiIRLGLWRpLQYDULiYHO1RHQWDQWR $DTXHOD V  jTXHOD V
SRGHXQLUVHDRXWUDVSDODYUDVHDVVLPHVWDEHOHFHUFRQFRU- $DTXLOR jTXLOR
GkQFLDHPJrQHURRXHPQ~PHUR([por + o = pelo por
+ a = pela. Dicas sobre preposição
9DOHUHVVDOWDUTXHHVVDFRQFRUGkQFLDQmRpFDUDFWHUtV-
WLFDGDSUHSRVLomRPDVGDVSDODYUDVjVTXDLVHODVHXQH  2 ´Dµ SRGH IXQFLRQDU FRPR SUHSRVLomR SURQRPH
(VVHSURFHVVRGHMXQomRGHXPDSUHSRVLomRFRPRXWUD SHVVRDO REOtTXR H DUWLJR &RPR GLVWLQJXLORV" &DVR R ´Dµ
SDODYUDSRGHVHGDUDSDUWLUGHGRLVSURFHVVRV VHMDXPDUWLJRYLUiSUHFHGHQGRXPVXEVWDQWLYR(OHVHUYLUi
SDUD GHWHUPLQiOR FRPR XP VXEVWDQWLYR VLQJXODU H IHPL-
&RPELQDomR$SUHSRVLomRQmRVRIUHDOWHUDomR QLQR
SUHSRVLomRDDUWLJRVGHÀQLGRVRRV A dona da casa não quis nos atender.
DR DR Como posso fazer a Joana concordar comigo?
SUHSRVLomRDDGYpUELRRQGH
4XDQGRpSUHSRVLomRDOpPGHVHULQYDULiYHOOLJDGRLV
DRQGH DRQGH
WHUPRVHHVWDEHOHFHUHODomRGHVXERUGLQDomRHQWUHHOHV
&RQWUDomR4XDQGRDSUHSRVLomRVRIUHDOWHUDomR
Cheguei a sua casa ontem pela manhã.
Não queria, mas vou ter que ir à outra cidade para pro-
Preposição + Artigos
curar um tratamento adequado.
'HR V  GR V
'HD V  GD V
-6HIRUSURQRPHSHVVRDOREOtTXRHVWDUiRFXSDQGRR
'HXP GXP
OXJDUHRXDIXQomRGHXPVXEVWDQWLYR
'HXQV GXQV Temos Maria como parte da família. / Nós a temos como
'HXPD GXPD parte da família
'HXPDV GXPDV Creio que conhecemos nossa mãe melhor que ninguém.
(PR V  QR V / Creio que a conhecemos melhor que ninguém.
(PD V  QD V
(PXP QXP $OJXPDVUHODo}HVVHPkQWLFDVHVWDEHOHFLGDVSRUPHLR
(PXPD QXPD GDVSUHSRVLo}HV
(PXQV QXQV 'HVWLQR Irei para casa.
(PXPDV QXPDV 0RGR Chegou em casa aos gritos.
$j V  j V /XJDU 9RXÀFDUHPFDVD
3RUR SHOR V $VVXQWR Escrevi um artigo sobre adolescência.
3RUD SHOD V 7HPSR A prova vai começar em dois minutos.
&DXVD Ela faleceu de derrame cerebral.
Preposição + Pronomes )LPRXÀQDOLGDGH Vou ao médico para começar o tra-
'HHOH V  GHOH V tamento.
'HHOD V  GHOD V ,QVWUXPHQWR Escreveu a lápis.
'HHVWH V  GHVWH V 3RVVH Não posso doar as roupas da mamãe.
'HHVWD V  GHVWD V $XWRULD Esse livro de Machado de Assis é muito bom.
'HHVVH V  GHVVH V &RPSDQKLD Estarei com ele amanhã.
'HHVVD V  GHVVD V 0DWpULD Farei um cartão de papel reciclado.
'HDTXHOH V  GDTXHOH V 0HLR Nós vamos fazer um passeio de barco.
'HDTXHOD V  GDTXHOD V 2ULJHP= Nós somos do Nordeste, e você?
'HLVWR GLVWR &RQWH~GR Quebrei dois frascos de perfume
'HLVVR GLVVR 2SRVLomR Esse movimento é contra o que eu penso
'HDTXLOR GDTXLOR 3UHoR Essa roupa sai por R$ 50 à vista.
'HDTXL GDTXL
'HDt GDt )RQWH
'HDOL GDOL KWWSZZZLQIRHVFRODFRPSRUWXJXHVSUHSRVLFDR

42
LÍNGUA PORTUGUESA

Pronome Pronomes Pessoais

PronomepDSDODYUDTXHVHXVDHPOXJDUGRQRPHRX 6mRDTXHOHVTXHVXEVWLWXHPRVVXEVWDQWLYRVLQGLFDQGR
DHOHVHUHIHUHRXTXHDFRPSDQKDRQRPHTXDOLÀFDQGRR GLUHWDPHQWHDVSHVVRDVGRGLVFXUVR4XHPIDODRXHVFUHYH
GHDOJXPDIRUPD DVVXPHRVSURQRPHV´HXµRX´QyVµXVDRVSURQRPHV´WXµ
´YyVµ´YRFrµRX´YRFrVµSDUDGHVLJQDUDTXHPVHGLULJHH
A moça era mesmo bonita. Ela morava nos meus so- ´HOHµ´HODµ´HOHVµRX´HODVµSDUDID]HUUHIHUrQFLDjSHVVRD
nhos! RXjVSHVVRDVGHTXHPIDOD
>VXEVWLWXLomRGRQRPH@ 2VSURQRPHVSHVVRDLVYDULDPGHDFRUGRFRPDVIXQ-
o}HVTXHH[HUFHPQDVRUDo}HVSRGHQGRVHUGRFDVRUHWR
A moça que morava nos meus sonhos era mesmo bo- RXGRFDVRREOtTXR
nita!
>UHIHUrQFLDDRQRPH@ Pronome Reto

Essa moça morava nos meus sonhos! 3URQRPH SHVVRDO GR FDVR UHWR p DTXHOH TXH QD VHQ-
>TXDOLÀFDomRGRQRPH@ WHQoDH[HUFHDIXQomRGHVXMHLWRRXSUHGLFDWLYRGRVXMHLWR
1yVOKHRIHUWDPRVÁRUHV
*UDQGHSDUWHGRVSURQRPHVQmRSRVVXHPVLJQLÀFDGRV
À[RVLVWRpHVVDVSDODYUDVVyDGTXLUHPVLJQLÀFDomRGHQWUR 2VSURQRPHVUHWRVDSUHVHQWDPÁH[mRGHQ~PHURJr-
GH XP FRQWH[WR R TXDO QRV SHUPLWH UHFXSHUDU D UHIHUrQ- QHUR DSHQDVQDSHVVRD HSHVVRDVHQGRHVVD~OWLPDD
FLD H[DWD GDTXLOR TXH HVWi VHQGR FRORFDGR SRU PHLR GRV SULQFLSDOÁH[mRXPDYH]TXHPDUFDDSHVVRDGRGLVFXUVR
SURQRPHVQRDWRGDFRPXQLFDomR&RPH[FHomRGRVSUR- 'HVVDIRUPDRTXDGURGRVSURQRPHVUHWRVpDVVLPFRQÀ-
QRPHV LQWHUURJDWLYRV H LQGHÀQLGRV RV GHPDLV SURQRPHV JXUDGR
WrPSRUIXQomRSULQFLSDODSRQWDUSDUDDVSHVVRDVGRGLV- 
FXUVRRXDHODVVHUHODFLRQDULQGLFDQGROKHVVXDVLWXDomR
- 1ª pessoa do singular: eu
- 2ª pessoa do singular: tu
QR WHPSR RX QR HVSDoR (P YLUWXGH GHVVD FDUDFWHUtVWLFD
- 3ª pessoa do singular: ele, ela
RVSURQRPHVDSUHVHQWDPXPDIRUPDHVSHFtÀFDSDUDFDGD
- 1ª pessoa do plural: nós
SHVVRDGRGLVFXUVR
- 2ª pessoa do plural: vós
- 3ª pessoa do plural: eles, elas
Minha carteira estava vazia quando eu fui assaltada.
>PLQKDHXSURQRPHVGHSHVVRD DTXHOHTXHIDOD@
Atenção HVVHV SURQRPHV QmR FRVWXPDP VHU XVDGRV
FRPR FRPSOHPHQWRV YHUEDLV QD OtQJXDSDGUmR )UDVHV
FRPR“Vi ele na rua”, “Encontrei ela na praça”, “Trouxeram
Tua carteira estava vazia quando tu foste assaltada?
>WXDWX SURQRPHV GH  SHVVRD  DTXHOH D TXHP VH eu até aqui” FRPXQV QD OtQJXD RUDO FRWLGLDQD GHYHP VHU
IDOD@ HYLWDGDVQDOtQJXDIRUPDOHVFULWDRXIDODGD1DOtQJXDIRU-
PDOGHYHPVHUXVDGRVRVSURQRPHVREOtTXRVFRUUHVSRQ-
A carteira dela estava vazia quando ela foi assaltada. GHQWHV“Vi-o na rua”, “Encontrei-a na praça”, “Trouxeram-
>GHODHOD SURQRPHV GH  SHVVRD  DTXHOH GH TXHP me até aqui”.
VHIDOD@
ObsIUHTXHQWHPHQWHREVHUYDPRVDRPLVVmRGRSUR-
(P WHUPRV PRUIROyJLFRV RV SURQRPHV VmR SDODYUDV QRPHUHWRHP/tQJXD3RUWXJXHVD,VVRVHGiSRUTXHDVSUy-
YDULiYHLVHPJrQHUR PDVFXOLQRRXIHPLQLQR HHPQ~PH- SULDVIRUPDVYHUEDLVPDUFDPDWUDYpVGHVXDVGHVLQrQFLDV
UR VLQJXODU RX SOXUDO  $VVLP HVSHUDVH TXH D UHIHUrQFLD DVSHVVRDVGRYHUERLQGLFDGDVSHORSURQRPHUHWRFizemos
DWUDYpV GR SURQRPH VHMD FRHUHQWH HP WHUPRV GH JrQHUR boa viagem 1yV
HQ~PHUR IHQ{PHQRGDFRQFRUGkQFLD FRPRVHXREMHWR 
PHVPRTXDQGRHVWHVHDSUHVHQWDDXVHQWHQRHQXQFLDGR Pronome Oblíquo

)DODVHGH5REHUWD(OHTXHUSDUWLFLSDUGRGHVÀOHGDQRV- 3URQRPH SHVVRDO GR FDVR REOtTXR p DTXHOH TXH QD


sa escola neste ano. VHQWHQoDH[HUFHDIXQomRGHFRPSOHPHQWRYHUEDO REMHWR
>QRVVDSURQRPHTXHTXDOLÀFD´HVFRODµ FRQFRUGkQFLD GLUHWRRXLQGLUHWR RXFRPSOHPHQWRQRPLQDO
DGHTXDGD@ 2IHUWDUDPQRVÁRUHV REMHWRLQGLUHWR
>QHVWHSURQRPHTXHGHWHUPLQD´DQRµ FRQFRUGkQFLD
DGHTXDGD@ Obs HP YHUGDGH R SURQRPH REOtTXR p XPD IRUPD
>HOHSURQRPHTXHID]UHIHUrQFLDj´5REHUWDµ FRQFRU- YDULDQWH GR SURQRPH SHVVRDO GR FDVR UHWR (VVD YDULDomR
GkQFLDLQDGHTXDGD@ LQGLFDDIXQomRGLYHUVDTXHHOHVGHVHPSHQKDPQDRUDomR
([LVWHPVHLVWLSRVGHSURQRPHVSHVVRDLVSRVVHVVLYRV SURQRPHUHWRPDUFDRVXMHLWRGDRUDomRSURQRPHREOtTXR
GHPRQVWUDWLYRVLQGHÀQLGRVUHODWLYRVHLQWHUURJDWLYRV PDUFDRFRPSOHPHQWRGDRUDomR

43
LÍNGUA PORTUGUESA

2VSURQRPHVREOtTXRVVRIUHPYDULDomRGHDFRUGRFRP Pronome Oblíquo Tônico


DDFHQWXDomRW{QLFDTXHSRVVXHPSRGHQGRVHUiWRQRVRX
W{QLFRV 2VSURQRPHVREOtTXRVW{QLFRVVmRVHPSUHSUHFHGLGRV
SRUSUHSRVLo}HVHPJHUDODVSUHSRVLo}HVa, para, de H com
Pronome Oblíquo Átono 3RU HVVH PRWLYR RV SURQRPHV W{QLFRV H[HUFHP D IXQomR
GHREMHWRLQGLUHWRGDRUDomR3RVVXHPDFHQWXDomRW{QLFD
6mRFKDPDGRViWRQRVRVSURQRPHVREOtTXRVTXHQmR IRUWH
VmRSUHFHGLGRVGHSUHSRVLomR3RVVXHPDFHQWXDomRW{QLFD 2TXDGURGRVSURQRPHVREOtTXRVW{QLFRVpDVVLPFRQ-
IUDFDEle me deu um presente. ÀJXUDGR
2TXDGURGRVSURQRPHVREOtTXRViWRQRVpDVVLPFRQ- - 1ª pessoa do singular (eu): mim, comigo
ÀJXUDGR - 2ª pessoa do singular (tu): ti, contigo
- 1ª pessoa do singular (eu): me - 3ª pessoa do singular (ele, ela): ele, ela
- 2ª pessoa do singular (tu): te - 1ª pessoa do plural (nós): nós, conosco
- 2ª pessoa do plural (vós): vós, convosco
- 3ª pessoa do singular (ele, ela): o, a, lhe
- 3ª pessoa do plural (eles, elas): eles, elas
- 1ª pessoa do plural (nós): nos
- 2ª pessoa do plural (vós): vos
2EVHUYHTXHDV~QLFDVIRUPDVSUySULDVGRSURQRPHW{-
- 3ª pessoa do plural (eles, elas): os, as, lhes
QLFRVmRDSULPHLUDSHVVRD PLP HVHJXQGDSHVVRD WL $V
GHPDLVUHSHWHPDIRUPDGRSURQRPHSHVVRDOGRFDVRUHWR
Observações: $VSUHSRVLo}HVHVVHQFLDLVLQWURGX]HPVHPSUHSURQR-
2 ´OKHµ p R ~QLFR SURQRPH REOtTXR iWRQR TXH Mi VH PHVSHVVRDLVGRFDVRREOtTXRHQXQFDSURQRPHGRFDVR
DSUHVHQWDQDIRUPDFRQWUDtGDRXVHMDKRXYHDXQLmRHQ- UHWR 1RV FRQWH[WRV LQWHUORFXWLYRV TXH H[LJHP R XVR GD
WUHRSURQRPH´RµRX´DµHSUHSRVLomR´DµRX´SDUDµ3RU OtQJXD IRUPDO RV SURQRPHV FRVWXPDP VHU XVDGRV GHVWD
DFRPSDQKDU GLUHWDPHQWH XPD SUHSRVLomR R SURQRPH IRUPD
´OKHµH[HUFHVHPSUHDIXQomRGHREMHWRLQGLUHWRQDRUDomR Não há mais nada entre mim e ti.
2VSURQRPHVme, te, nos H vosSRGHPWDQWRVHUREMHWRV Não se comprovou qualquer ligação entre ti e ela.
GLUHWRVFRPRREMHWRVLQGLUHWRV Não há nenhuma acusação contra mim.
2VSURQRPHVo, a, os H asDWXDPH[FOXVLYDPHQWHFRPR Não vá sem mim.
REMHWRVGLUHWRV
2VSURQRPHVme, te, lhe, nos, vos H lhesSRGHPFRPEL- Atenção+iFRQVWUXo}HVHPTXHDSUHSRVLomRDSHVDU
QDUVHFRPRVSURQRPHVo, os, a, as,GDQGRRULJHPDIRU- GH VXUJLU DQWHSRVWD D XP SURQRPH VHUYH SDUD LQWURGX]LU
PDVFRPRmo, mos , ma, mas; to, tos, ta, tas; lho, lhos, lha, XPDRUDomRFXMRYHUERHVWiQRLQÀQLWLYR1HVVHVFDVRVR
lhas; no-lo, no-los, no-la, no-las, vo-lo, vo-los, vo-la, vo-las YHUERSRGHWHUVXMHLWRH[SUHVVRVHHVVHVXMHLWRIRUXPSUR-
2EVHUYHRXVRGHVVDVIRUPDVQRVH[HPSORVTXHVHJXHP QRPHGHYHUiVHUGRFDVRUHWR
- Trouxeste o pacote? Trouxeram vários vestidos para eu experimentar.
- Sim, entreguei-to ainda há pouco. Não vá sem eu mandar.
- Não contaram a novidade a vocês?
- Não, no-la contaram. $FRPELQDomRGDSUHSRVLomR´FRPµHDOJXQVSURQR-
PHVRULJLQRXDVIRUPDVHVSHFLDLVcomigo, contigo, consigo,
1R SRUWXJXrV GR %UDVLO HVVDV FRPELQDo}HV QmR VmR conosco H convosco. 7DLV SURQRPHV REOtTXRV W{QLFRV IUH-
XVDGDVDWpPHVPRQDOtQJXDOLWHUiULDDWXDOVHXHPSUHJR TXHQWHPHQWH H[HUFHP D IXQomR GH DGMXQWR DGYHUELDO GH
pPXLWRUDUR FRPSDQKLD
Ele carregava o documento consigo.
Atenção: 2V SURQRPHV o, os, a, as DVVXPHP IRUPDV
 $V IRUPDV ´FRQRVFRµ H ´FRQYRVFRµ VmR VXEVWLWXtGDV
HVSHFLDLVGHSRLVGHFHUWDVWHUPLQDo}HVYHUEDLV4XDQGRR
SRU´FRPQyVµH´FRPYyVµTXDQGRRVSURQRPHVSHVVRDLV
YHUERWHUPLQDHP]VRXURSURQRPHDVVXPHDIRUPD
VmRUHIRUoDGRVSRUSDODYUDVFRPRoutros, mesmos, próprios,
lo, los, la RX lasDRPHVPRWHPSRTXHDWHUPLQDomRYHUEDO todos, ambos RXDOJXPQXPHUDO
pVXSULPLGD3RUH[HPSOR Você terá de viajar com nós todos.
À]R ÀOR Estávamos com vós outros quando chegaram as más
fazeis + o = fazei-lo notícias.
dizer + a = dizê-la Ele disse que iria com nós três.

4XDQGRRYHUERWHUPLQDHPVRPQDVDORSURQRPHDV- 3URQRPH5HÁH[LYR
VXPHDVIRUPDVno, nos, na, nas3RUH[HPSOR
viram + o: viram-no 6mRSURQRPHVSHVVRDLVREOtTXRVTXHHPERUDIXQFLR-
repõe + os = repõe-nos QHPFRPRREMHWRVGLUHWRRXLQGLUHWRUHIHUHPVHDRVXMHLWR
retém + a: retém-na GD RUDomR ,QGLFDP TXH R VXMHLWR SUDWLFD H UHFHEH D DomR
tem + as = tem-nas H[SUHVVDSHORYHUER

44
LÍNGUA PORTUGUESA

2TXDGURGRVSURQRPHVUHÁH[LYRVpDVVLPFRQÀJXUDGR
SHVVRDGRVLQJXODU HX PHPLP
Eu não me vanglorio disso.
Olhei para mim no espelho e não gostei do que vi.

SHVVRDGRVLQJXODU WX WHWL
Assim tu te prejudicas.
Conhece a ti mesmo.

SHVVRDGRVLQJXODU HOHHOD VHVLFRQVLJR


Guilherme já se preparou.
Ela deu a si um presente.
Antônio conversou consigo mesmo.

SHVVRDGRSOXUDO QyV QRV


Lavamo-nos no rio

SHVVRDGRSOXUDO YyV YRV


9yVYRVEHQHÀFLDVWHVFRPDHVWDFRQTXLVWD

SHVVRDGRSOXUDO HOHVHODV VHVLFRQVLJR


Eles se conheceram.
Elas deram a si um dia de folga.
A Segunda Pessoa Indireta

$FKDPDGDVHJXQGDSHVVRDLQGLUHWDPDQLIHVWDVHTXDQGRXWLOL]DPRVSURQRPHVTXHDSHVDUGHLQGLFDUHPQRVVRLQWHU-
ORFXWRU SRUWDQWRDVHJXQGDSHVVRD XWLOL]DPRYHUERQDWHUFHLUDSHVVRDeRFDVRGRVFKDPDGRVSURQRPHVGHWUDWDPHQWR
TXHSRGHPVHUREVHUYDGRVQRTXDGURVHJXLQWH

Pronomes de Tratamento

9RVVD$OWH]D   9$  SUtQFLSHVGXTXHV


9RVVD(PLQrQFLD  9(PD V  FDUGHDLV
9RVVD5HYHUHQGtVVLPD  95HYPD V  VDFHUGRWHVHELVSRV
9RVVD([FHOrQFLD  9([ V  DOWDVDXWRULGDGHVHRÀFLDLVJHQHUDLV
9RVVD0DJQLÀFrQFLD  90DJ V  UHLWRUHVGHXQLYHUVLGDGHV
9RVVD0DMHVWDGH  90  UHLVHUDLQKDV
9RVVD0DMHVWDGH,PSHULDO 90,  ,PSHUDGRUHV
9RVVD6DQWLGDGH  96  3DSD
9RVVD6HQKRULD  96 V  WUDWDPHQWRFHULPRQLRVR
9RVVD2QLSRWrQFLD  92  'HXV

7DPEpPVmRSURQRPHVGHWUDWDPHQWRo senhor, a senhoraHvocê, vocês´2VHQKRUµH´DVHQKRUDµVmRHPSUHJDGRVQR


WUDWDPHQWRFHULPRQLRVR´YRFrµH´YRFrVµQRWUDWDPHQWRIDPLOLDU9RFrHYRFrVVmRODUJDPHQWHHPSUHJDGRVQRSRUWXJXrV
GR%UDVLOHPDOJXPDVUHJL}HVDIRUPDWXpGHXVRIUHTXHQWHHPRXWUDVSRXFRHPSUHJDGD-iDIRUPDYyVWHPXVRUHVWULWR
jOLQJXDJHPOLW~UJLFDXOWUDIRUPDORXOLWHUiULD

Observações:
D 9RVVD([FHOrQFLD;6XD([FHOrQFLDRVSURQRPHVGHWUDWDPHQWRTXHSRVVXHP´9RVVD V µVmRHPSUHJDGRVHPUHODomR
jSHVVRDFRPTXHPIDODPRVEspero que V. Ex.ª, Senhor Ministro, compareça a este encontro.

*Emprega-se “Sua (s)” quando se fala a respeito da pessoa.
7RGRVRVPHPEURVGD&3,DÀUPDUDPTXH6XD([FHOrQFLDR6HQKRU3UHVLGHQWHGD5HS~EOLFDDJLXFRPSURSULHGDGH

2VSURQRPHVGHWUDWDPHQWRUHSUHVHQWDPXPDIRUPDLQGLUHWDGHQRVGLULJLUPRVDRVQRVVRVLQWHUORFXWRUHV$RWUDWDU-
PRVXPGHSXWDGRSRU9RVVD([FHOrQFLDSRUH[HPSORHVWDPRVQRVHQGHUHoDQGRjH[FHOrQFLDTXHHVVHGHSXWDGRVXSRVWD-
PHQWHWHPSDUDSRGHURFXSDURFDUJRTXHRFXSD

45
LÍNGUA PORTUGUESA

SHVVRDHPERUDRVSURQRPHVGHWUDWDPHQWRGLUL- (PIUDVHVRQGHVHXVDPSURQRPHVGHWUDWDPHQWR
MDPVH j  SHVVRD toda a concordância deve ser feita RSURQRPHSRVVHVVLYRÀFDQDSHVVRDVossa Excelência
com a 3ª pessoa$VVLPRVYHUERVRVSURQRPHVSRVVHVVL- trouxe sua mensagem?
YRVHRVSURQRPHVREOtTXRVHPSUHJDGRVHPUHODomRDHOHV
GHYHPÀFDUQDSHVVRD 5HIHULQGRVHDPDLVGHXPVXEVWDQWLYRRSRVVHVVL-
Basta que V. Ex.ª cumpra a terça parte das suas promes- YRFRQFRUGDFRPRPDLVSUy[LPRTrouxe-me seus livros e
VDVSDUDTXHVHXVHOHLWRUHVOKHÀTXHPUHFRQKHFLGRV anotações

8QLIRUPLGDGHGH7UDWDPHQWRTXDQGRHVFUHYHPRVRX  (P DOJXPDV FRQVWUXo}HV RV SURQRPHV SHVVRDLV


REOtTXRViWRQRVDVVXPHPYDORUGHSRVVHVVLYRVou seguir-
QRVGLULJLPRVDDOJXpPQmRpSHUPLWLGRPXGDUDRORQJR
lhe os passos 9RXVHJXLUVHXVSDVVRV
GR WH[WR D SHVVRD GR WUDWDPHQWR HVFROKLGD LQLFLDOPHQWH
$VVLP SRU H[HPSOR VH FRPHoDPRV D FKDPDU DOJXpP GH Pronomes Demonstrativos
´YRFrµ QmR SRGHUHPRV XVDU ´WHµ RX ´WHXµ 2 XVR FRUUHWR
H[LJLUiDLQGDYHUERQDWHUFHLUDSHVVRD 2V SURQRPHV GHPRQVWUDWLYRV VmR XWLOL]DGRV SDUD H[-
Quando você vier, eu te abraçarei e enrolar-me-ei nos SOLFLWDUDSRVLomRGHXPDFHUWDSDODYUDHPUHODomRDRXWUDV
teus cabelos HUUDGR RX DR FRQWH[WR (VVD UHODomR SRGH RFRUUHU HP WHUPRV GH
Quando você vier, eu a abraçarei e enrolar-me-ei nos HVSDoRQRWHPSRRXGLVFXUVR
seus cabelos FRUUHWR No espaço
Quando tu vieres, eu te abraçarei e enrolar-me-ei nos Compro este carro DTXL 2SURQRPHHVWHLQGLFDTXHR
teus cabelos FRUUHWR FDUURHVWiSHUWRGDSHVVRDTXHIDOD
Compro esse carro Dt  2 SURQRPH HVVH LQGLFD TXH R
Pronomes Possessivos FDUURHVWiSHUWRGDSHVVRDFRPTXHPIDORRXDIDVWDGRGD
SHVVRDTXHIDOD
6mR SDODYUDV TXH DR LQGLFDUHP D SHVVRD JUDPDWLFDO Compro aquele carro Oi  2 SURQRPH DTXHOH GL] TXH
SRVVXLGRU  DFUHVFHQWDP D HOD D LGHLD GH SRVVH GH DOJR R FDUUR HVWi DIDVWDGR GD SHVVRD TXH IDOD H GDTXHOD FRP
FRLVDSRVVXtGD  TXHPIDOR
Este caderno é meu. PHX  SRVVXLGRU  SHVVRD GR 
VLQJXODU Atenção HP VLWXDo}HV GH IDOD GLUHWD WDQWR DR YLYR
TXDQWR SRU PHLR GH FRUUHVSRQGrQFLD TXH p XPD PRGD-
OLGDGH HVFULWD GH IDOD  VmR SDUWLFXODUPHQWH LPSRUWDQWHV R
NÚMERO PESSOA PRONOME
esteHResseRSULPHLURORFDOL]DRVVHUHVHPUHODomRDR
HPLVVRURVHJXQGRHPUHODomRDRGHVWLQDWiULR7URFiORV
VLQJXODU SULPHLUD PHX V PLQKD V SRGHFDXVDUDPELJXLGDGH
VLQJXODU VHJXQGD WHX V WXD V Dirijo-me a essa universidade com o objetivo de solicitar
VLQJXODU WHUFHLUD  VHX V VXD V informações sobre o concurso vestibular WUDWDVHGDXQLYHU-
SOXUDO SULPHLUD QRVVR V QRVVD V VLGDGHGHVWLQDWiULD 
SOXUDO VHJXQGD YRVVR V YRVVD V 5HDÀUPDPRVDGLVSRVLomRGHVWDXQLYHUVLGDGHHPSDUWL-
SOXUDO WHUFHLUD  VHX V VXD V cipar no próximo Encontro de Jovens WUDWDVHGDXQLYHUVL-
GDGHTXHHQYLDDPHQVDJHP 
1RWHTXH$IRUPDGRSRVVHVVLYRGHSHQGHGDSHVVRD No tempo
JUDPDWLFDODTXHVHUHIHUHRJrQHURHRQ~PHURFRQFRU- Este ano está sendo bom para nós2SURQRPHHVWHVH
GDPFRPRREMHWRSRVVXtGREle trouxe seu apoio e sua con- UHIHUHDRDQRSUHVHQWH
tribuição naquele momento difícil. Esse ano que passou foi razoável 2 SURQRPH HVVH VH
UHIHUHDXPSDVVDGRSUy[LPR
Observações Aquele ano foi terrível para todos 2 SURQRPH DTXHOH
$IRUPD´VHXµQmRpXPSRVVHVVLYRTXDQGRUHVXO- HVWiVHUHIHULQGRDXPSDVVDGRGLVWDQWH
WDUGDDOWHUDomRIRQpWLFDGDSDODYUDVHQKRUMuito obrigado, 
2VSURQRPHVGHPRQVWUDWLYRVSRGHPVHUYDULiYHLVRX
seu José
LQYDULiYHLVREVHUYH
9DULiYHLVeste(s), esta(s), esse(s), essa(s), aquele(s), aque-
  2V SURQRPHV SRVVHVVLYRV QHP VHPSUH LQGLFDP la(s)
SRVVH3RGHPWHURXWURVHPSUHJRVFRPR ,QYDULiYHLVisto, isso, aquilo.
D LQGLFDUDIHWLYLGDGH1mRIDoDLVVRPLQKDÀOKD
7DPEpPDSDUHFHPFRPRSURQRPHVGHPRQVWUDWLYRV
E  LQGLFDU FiOFXOR DSUR[LPDGR Ele já deve ter seus 40  R V  D V  TXDQGR HVWLYHUHP DQWHFHGHQGR R ´TXHµ H
anos SXGHUHPVHUVXEVWLWXtGRVSRUDTXHOH V DTXHOD V DTXLOR
Não ouvi o que disseste 1mRRXYLDTXLORTXHGLVVHVWH
F DWULEXLUYDORULQGHÀQLGRDRVXEVWDQWLYRMarisa tem Essa rua não é a que te indiquei (VWDUXDQmRpDTXHOD
lá seus defeitos, mas eu gosto muito dela. TXHWHLQGLTXHL

46
LÍNGUA PORTUGUESA

 PHVPR V  PHVPD V  Estas são as mesmas pessoas 3URQRPHV,QGHÀQLGRV$GMHWLYRVTXDOLÀFDPXPVHU


que o procuraram ontem. H[SUHVVR QD IUDVH FRQIHULQGROKH D QRomR GH TXDQWLGDGH
DSUR[LPDGD6mRHOHVcada, certo(s), certa(s).
SUySULR V SUySULD V 2VSUySULRVDOXQRVUHVROYHUDP Cada povo tem seus costumes.
RSUREOHPD &HUWDVSHVVRDVH[HUFHPYiULDVSURÀVV}HV

VHPHOKDQWH V Não compre semelhante livro Note que2UDVmRSURQRPHVLQGHÀQLGRVVXEVWDQWLYRV


RUDSURQRPHVLQGHÀQLGRVDGMHWLYRV
WDOWDLVTal era a solução para o problema. algum, alguns, alguma(s), bastante(s) (= muito, muitos),
demais, mais, menos, muito(s), muita(s), nenhum, nenhuns,
Note que: nenhuma(s), outro(s), outra(s), pouco(s), pouca(s), qualquer,
 1mR UDUR RV GHPRQVWUDWLYRV DSDUHFHP QD IUDVH HP quaisquer, qual, que, quanto(s), quanta(s), tal, tais, tanto(s),
FRQVWUXo}HVUHGXQGDQWHVFRPÀQDOLGDGHH[SUHVVLYDSDUD tanta(s), todo(s), toda(s), um, uns, uma(s), vários, várias.
VDOLHQWDUDOJXPWHUPRDQWHULRU3RUH[HPSORManuela, essa
Menos palavras e mais ações.
é que dera em cheio casando com o José Afonso. Desfrutar
Alguns se contentam pouco.
das belezas brasileiras, isso é que é sorte!

2SURQRPHGHPRQVWUDWLYRQHXWURRXSRGHUHSUHVHQ- 2VSURQRPHVLQGHÀQLGRVSRGHPVHUGLYLGLGRVHPYD-
WDUXPWHUPRRXRFRQWH~GRGHXPDRUDomRLQWHLUDFDVR ULiYHLVHLQYDULiYHLV2EVHUYH
HP TXH DSDUHFH JHUDOPHQWH FRPR REMHWR GLUHWR SUHGL- Variáveis algum, nenhum, todo, muito, pouco, vário,
FDWLYRRXDSRVWRO casamento seria um desastre. Todos o tanto, outro, quanto, alguma, nenhuma, toda, muita, pouca,
pressentiam. vária, tanta, outra, quanta, qualquer, quaisquer, alguns, ne-
nhuns, todos, muitos, poucos, vários, tantos, outros, quantos,
 3DUD HYLWDU D UHSHWLomR GH XP YHUER DQWHULRUPHQWH algumas, nenhumas, todas, muitas, poucas, várias, tantas,
H[SUHVVR p FRPXP HPSUHJDUVH HP WDLV FDVRV R YHUER outras, quantas.
ID]HUFKDPDGRHQWmRYHUERYLFiULR TXHVXEVWLWXLTXH Invariáveis = alguém, ninguém, outrem, tudo, nada,
ID]DVYH]HVGH Ninguém teve coragem de falar antes que algo, cada.
HODRÀ]HVVH
6mR ORFXo}HV SURQRPLQDLV LQGHÀQLGDV cada qual,
 (P IUDVHV FRPR D VHJXLQWH este VH UHIHUH j SHVVRD cada um, qualquer um, quantos quer (que), quem quer (que),
PHQFLRQDGD HP ~OWLPR OXJDU aquele j PHQFLRQDGD HP seja quem for, seja qual for, todo aquele (que), tal qual (=
SULPHLUR OXJDU O referido deputado e o Dr. Alcides eram certo), tal e qual, tal ou qual, um ou outro, uma ou outra, HWF
amigos íntimos; aquele casado, solteiro este. [ou então: este Cada um escolheu o vinho desejado.
solteiro, aquele casado]
,QGHÀQLGRV6LVWHPiWLFRV
 2 SURQRPH GHPRQVWUDWLYR WDO SRGH WHU FRQRWDomR
LU{QLFDA menina foi a tal que ameaçou o professor? $R REVHUYDU DWHQWDPHQWH RV SURQRPHV LQGHÀQLGRV
SHUFHEHPRVTXHH[LVWHPDOJXQVJUXSRVTXHFULDPRSRVL-
3RGHRFRUUHUDFRQWUDomRGDVSUHSRVLo}HVa, de, em omRGHVHQWLGReRFDVRGHalgum/alguém/algoTXHWrP
FRPSURQRPHGHPRQVWUDWLYRàquele, àquela, deste, desta, VHQWLGR DÀUPDWLYR H nenhum/ninguém/nada, TXH WrP
disso, nisso, no, HWFNão acreditei no que estava vendo QR
VHQWLGR QHJDWLYR todo/tudo TXH LQGLFDP XPD WRWDOLGDGH
QDTXLOR
DÀUPDWLYD H nenhum/nada TXH LQGLFDP XPD WRWDOLGDGH
3URQRPHV,QGHÀQLGRV
QHJDWLYD alguém/ninguém, TXH VH UHIHUHP j SHVVRD H
6mRSDODYUDVTXHVHUHIHUHPjWHUFHLUDSHVVRDGRGLV- algo/nadaTXHVHUHIHUHPjFRLVDcertoTXHSDUWLFXODUL]D
FXUVRGDQGROKHVHQWLGRYDJR LPSUHFLVR RXH[SUHVVDQGR HqualquerTXHJHQHUDOL]D
TXDQWLGDGHLQGHWHUPLQDGD (VVDVRSRVLo}HVGHVHQWLGRVmRPXLWRLPSRUWDQWHVQD
Alguém entrou no jardim e destruiu as mudas recém FRQVWUXomRGHIUDVHVHWH[WRVFRHUHQWHVSRLVGHODVPXLWDV
-plantadas. YH]HVGHSHQGHPDVROLGH]HDFRQVLVWrQFLDGRVDUJXPHQ-
WRVH[SRVWRV2EVHUYHQDVIUDVHVVHJXLQWHVDIRUoDTXHRV
1mRpGLItFLOSHUFHEHUTXH´DOJXpPµLQGLFDXPDSHVVRD SURQRPHVLQGHÀQLGRVGHVWDFDGRVLPSULPHPjVDÀUPDo}HV
GHTXHPVHIDOD XPDWHUFHLUDSHVVRDSRUWDQWR GHIRUPD GHTXHID]HPSDUWH
LPSUHFLVDYDJDeXPDSDODYUDFDSD]GHLQGLFDUXPVHUKX- Nada do que tem sido feito produziu qualquer resultado
PDQRTXHVHJXUDPHQWHH[LVWHPDVFXMDLGHQWLGDGHpGHV- prático.
FRQKHFLGDRXQmRVHTXHUUHYHODU&ODVVLÀFDPVHHP Certas pessoas conseguem perceber sutilezas: não são
pessoas quaisquer.
3URQRPHV,QGHÀQLGRV6XEVWDQWLYRVDVVXPHPROX-
JDUGRVHURXGDTXDQWLGDGHDSUR[LPDGDGHVHUHVQDIUDVH Pronomes Relativos
6mRHOHValgo, alguém, fulano, sicrano, beltrano, nada, nin-
guém, outrem, quem, tudo. 6mRDTXHOHVTXHUHSUHVHQWDPQRPHVMiPHQFLRQDGRV
Algo o incomoda? DQWHULRUPHQWH H FRP RV TXDLV VH UHODFLRQDP ,QWURGX]HP
Quem avisa amigo é. DVRUDo}HVVXERUGLQDGDVDGMHWLYDV

47
LÍNGUA PORTUGUESA

2UDFLVPRpXPVLVWHPDTXHDÀUPDDVXSHULRULGDGHGH 2SURQRPH´TXHPµVHUHIHUHDSHVVRDVHYHPVHPSUH
um grupo racial sobre outros. SUHFHGLGRGHSUHSRVLomR
DÀUPDDVXSHULRULGDGHGHXPJUXSRUDFLDOVREUHRX- É um professor a quem muito devemos
WURV RUDomRVXERUGLQDGDDGMHWLYD    SUHSRVLomR   
2SURQRPHUHODWLYR´TXHµUHIHUHVHjSDODYUD´VLVWHPDµ
HLQWURGX]XPDRUDomRVXERUGLQDGD'L]VHTXHDSDODYUD ´2QGHµFRPRSURQRPHUHODWLYRVHPSUHSRVVXLDQ-
´VLVWHPDµpDQWHFHGHQWHGRSURQRPHUHODWLYRTXH WHFHGHQWHHVySRGHVHUXWLOL]DGRQDLQGLFDomRGHOXJDUA
2DQWHFHGHQWHGRSURQRPHUHODWLYRSRGHVHURSURQR- casa onde morava foi assaltada.
PHGHPRQVWUDWLYRo, a, os, as
Não sei o que você está querendo dizer.  1D LQGLFDomR GH WHPSR GHYHVH HPSUHJDU quando
Às vezes, o antecedente do pronome relativo não vem RXem que
expresso. Sinto saudades da época em que (quando) morávamos
Quem casa, quer casa. no exterior.

Observe: 3RGHPVHUXWLOL]DGDVFRPRSURQRPHVUHODWLYRVDVSD-
3URQRPHVUHODWLYRVYDULiYHLV o qual, cujo, quanto, os ODYUDV
quais, cujos, quantos, a qual, cuja, quanta, as quais, cujas, FRPR SHORTXDO Não me parece correto o modo
quantas como você agiu semana passada.
3URQRPHVUHODWLYRVLQYDULiYHLV quem, que, onde TXDQGR HPTXH Bons eram os tempos quando po-
díamos jogar videogame.
Note que:
2SURQRPH´TXHµpRUHODWLYRGHPDLVODUJRHPSUHJR 2VSURQRPHVUHODWLYRVSHUPLWHPUHXQLUGXDVRUDo}HV
VHQGRSRULVVRFKDPDGRUHODWLYRXQLYHUVDO3RGHVHUVXEV- QXPDVyIUDVH
WLWXtGR SRU o qual, a qual, os quais, as quais, TXDQGR VHX O futebol é um esporte.
DQWHFHGHQWHIRUXPVXEVWDQWLYR O povo gosta muito deste esporte.
2WUDEDOKRTXHHXÀ]UHIHUHVHjFRUUXSomR RTXDO O futebol é um esporte de que o povo gosta muito.
A cantora que acabou de se apresentar é péssima D
1XPDVpULHGHRUDo}HVDGMHWLYDVFRRUGHQDGDVSRGH
TXDO
RFRUUHU D HOLSVH GR UHODWLYR ´TXHµ A sala estava cheia de
2V WUDEDOKRV TXH HX À] UHIHUHPVH j FRUUXSomR  RV
gente que conversava, (que) ria, (que) fumava.
TXDLV
As cantoras que se apresentaram eram péssimas DV
Pronomes Interrogativos
TXDLV
O qual, os quais, a qual H as quaisVmRH[FOXVLYDPHQWH
6mRXVDGRVQDIRUPXODomRGHSHUJXQWDVVHMDPHODVGL-
SURQRPHVUHODWLYRVSRULVVRVmRXWLOL]DGRVGLGDWLFDPHQWH
UHWDV RX LQGLUHWDV $VVLP FRPR RV SURQRPHV LQGHÀQLGRV
SDUDYHULÀFDUVHSDODYUDVFRPR´TXHµ´TXHPµ´RQGHµ TXH UHIHUHPVHjSHVVRDGRGLVFXUVRGHPRGR
SRGHP WHU YiULDV FODVVLÀFDo}HV  VmR SURQRPHV UHODWLYRV LPSUHFLVR 6mR SURQRPHV LQWHUURJDWLYRV TXH TXHP TXDO
7RGRV HOHV VmR XVDGRV FRP UHIHUrQFLD j SHVVRD RX FRLVD HYDULDo}HV TXDQWR HYDULDo}HV 
SRUPRWLYRGHFODUH]DRXGHSRLVGHGHWHUPLQDGDVSUHSRVL- Quem fez o almoço?/ Diga-me quem fez o almoço.
o}HVRegressando de São Paulo, visitei o sítio de minha tia, Qual das bonecas preferes? / Não sei qual das bonecas
o qual me deixou encantado 2XVRGH´TXHµQHVWHFDVR preferes.
JHUDULDDPELJXLGDGH Quantos passageiros desembarcaram? / Pergunte quan-
Essas são as conclusões sobre as quais pairam muitas tos passageiros desembarcaram.
dúvidas? 1mRVHSRGHULDXVDU´TXHµGHSRLVGHVREUH
2UHODWLYR´TXHµjVYH]HVHTXLYDOHDo que, coisa queH Sobre os pronomes
VHUHIHUHDXPDRUDomRNão chegou a ser padre, mas deixou
de ser poeta, que era a sua vocação natural. 2SURQRPHSHVVRDOpGRFDVRUHWRTXDQGRWHPIXQomR
GHVXMHLWRQDIUDVH2SURQRPHSHVVRDOpGRFDVRREOtTXR
2SURQRPH´FXMRµQmRFRQFRUGDFRPRVHXDQWHFH- TXDQGRGHVHPSHQKDIXQomRGHFRPSOHPHQWR9DPRVHQ-
GHQWHPDVFRPRFRQVHTXHQWH(TXLYDOHDdo qual, da qual, WHQGHUSULPHLUDPHQWHFRPRRSURQRPHSHVVRDOVXUJHQD
dos quais, das quais. IUDVHHTXHIXQomRH[HUFH2EVHUYHDVRUDo}HV
Este é o caderno cujas folhas estão rasgadas. 1. Eu não sei essa matéria, mas ele irá me ajudar.
  DQWHFHGHQWH  FRQVHTXHQWH  2. Maria foi embora para casa, pois não sabia se devia
lhe ajudar.
´4XDQWRµpSURQRPHUHODWLYRTXDQGRWHPSRUDQWHFH-
GHQWHXPSURQRPHLQGHÀQLGRWDQWR RXYDULDo}HV HWXGR 1DSULPHLUDRUDomRRVSURQRPHVSHVVRDLV´HXµH´HOHµ
Emprestei tantos quantos foram necessários. H[HUFHPIXQomRGHVXMHLWRORJRVmRSHUWHQFHQWHVDRFDVR
  DQWHFHGHQWH   UHWR-iQDVHJXQGDRUDomRREVHUYDPRVRSURQRPH´OKHµ
Ele fez tudo quanto havia falado H[HUFHQGRIXQomRGHFRPSOHPHQWRHFRQVHTXHQWHPHQWH
  DQWHFHGHQWH   pGRFDVRREOtTXR

48
LÍNGUA PORTUGUESA

2VSURQRPHVSHVVRDLVLQGLFDPDVSHVVRDVGRGLVFXUVR 6XEVWDQWLYR&RPXPpDTXHOHTXHGHVLJQDRVVHUHVGH
RSURQRPHREOtTXR´OKHµGDVHJXQGDRUDomRDSRQWDSDUD XPD PHVPD HVSpFLH GH IRUPD JHQpULFD cidade, menino,
DVHJXQGDSHVVRDGRVLQJXODU WXYRFr Maria não sabia se homem, mulher, país, cachorro.
devia ajudar...$MXGDUTXHP"9RFr OKH  Estamos voando para Barcelona.

Importante(PREVHUYDomRjVHJXQGDRUDomRRHP- 2VXEVWDQWLYR%DUFHORQDGHVLJQDDSHQDVXPVHUGDHV-
SUHJRGRSURQRPHREOtTXR´OKHµpMXVWLÀFDGRDQWHVGRYHU- SpFLHFLGDGH(VVHVXEVWDQWLYRpSUySULR6XEVWDQWLYR3Uy-
ER LQWUDQVLWLYR ´DMXGDUµ SRUTXH R SURQRPH REOtTXR SRGH SULRpDTXHOHTXHGHVLJQDRVVHUHVGHXPDPHVPDHVSpFLH
HVWDUDQWHVGHSRLVRXHQWUHORFXomRYHUEDOFDVRRYHUER GHIRUPDSDUWLFXODULondres, Paulinho, Pedro, Tietê, Brasil
SULQFLSDO QRFDVR´DMXGDUµ HVWHMDQRLQÀQLWLYRRXJHU~QGLR 
Eu desejo lhe perguntar algo. 2 - Substantivos Concretos e Abstratos
Eu estou perguntando-lhe algo.  
/Ç03$'$ 0$/$
2VSURQRPHVSHVVRDLVREOtTXRVSRGHPVHUiWRQRVRX
W{QLFRV RV SULPHLURV QmR VmR SUHFHGLGRV GH SUHSRVLomR
2VVXEVWDQWLYRVOkPSDGDHPDODGHVLJQDPVHUHVFRP
GLIHUHQWHPHQWHGRVVHJXQGRVTXHVmRVHPSUHSUHFHGLGRV
H[LVWrQFLDSUySULDTXHVmRLQGHSHQGHQWHVGHRXWURVVHUHV
GHSUHSRVLomR
6mRVXEVWDQWLYRVFRQFUHWRV
3URQRPHREOtTXRiWRQRJoana me perguntou o que
eu estava fazendo.
3URQRPHREOtTXRW{QLFRJoana perguntou para mim Substantivo ConcretopDTXHOHTXHGHVLJQDRVHUTXH
o que eu estava fazendo. H[LVWHLQGHSHQGHQWHPHQWHGHRXWURVVHUHV

Substantivo Obs RV VXEVWDQWLYRV FRQFUHWRV GHVLJQDP VHUHV GR


PXQGRUHDOHGRPXQGRLPDJLQiULR
7XGRRTXHH[LVWHpVHUHFDGDVHUWHPXPQRPHSubs- 6HUHV GR PXQGR UHDO homem, mulher, cadeira, cobra,
tantivo pDFODVVHJUDPDWLFDOGHSDODYUDVYDULiYHLVDVTXDLV Brasília, etc.
GHQRPLQDPRVVHUHV$OpPGHREMHWRVSHVVRDVHIHQ{PH- 6HUHVGRPXQGRLPDJLQiULRsaci, mãe-d’água, fantas-
QRVRVVXEVWDQWLYRVWDPEpPQRPHLDP ma, etc
OXJDUHVAlemanha, Porto Alegre 
VHQWLPHQWRVraiva, amor. 2EVHUYHDJRUD
HVWDGRValegria, tristeza Beleza exposta
TXDOLGDGHVhonestidade, sinceridade Jovens atrizes veteranas destacam-se pelo visual
Do}HVcorrida, pescaria...
2VXEVWDQWLYREHOH]DGHVLJQDXPDTXDOLGDGH
Morfossintaxe do substantivo
Substantivo AbstratopDTXHOHTXHGHVLJQDVHUHVTXH
1DV RUDo}HV GH OtQJXD SRUWXJXHVD R VXEVWDQWLYR HP GHSHQGHPGHRXWURVSDUDVHPDQLIHVWDURXH[LVWLU
JHUDOH[HUFHIXQo}HVGLUHWDPHQWHUHODFLRQDGDVFRPRYHU- 3HQVHEHPDEHOH]DQmRH[LVWHSRUVLVyQmRSRGHVHU
ERDWXDFRPRQ~FOHRGRVXMHLWRGRVFRPSOHPHQWRVYHU- REVHUYDGD 6y SRGHPRV REVHUYDU D EHOH]D QXPD SHVVRD
EDLV REMHWR GLUHWR RX LQGLUHWR  H GR DJHQWH GD SDVVLYD RXFRLVDTXHVHMDEHOD$EHOH]DGHSHQGHGHRXWURVHUSDUD
3RGH DLQGD IXQFLRQDU FRPR Q~FOHR GR FRPSOHPHQWR QR- VHPDQLIHVWDU3RUWDQWRDSDODYUDEHOH]DpXPVXEVWDQWLYR
PLQDORXGRDSRVWRFRPRQ~FOHRGRSUHGLFDWLYRGRVXMHLWR DEVWUDWR
GRREMHWRRXFRPRQ~FOHRGRYRFDWLYR7DPEpPHQFRQWUD-
2VVXEVWDQWLYRVDEVWUDWRVGHVLJQDPHVWDGRVTXDOLGD-
PRVVXEVWDQWLYRVFRPRQ~FOHRVGHDGMXQWRVDGQRPLQDLVH
GHVDo}HVHVHQWLPHQWRVGRVVHUHVGRVTXDLVSRGHPVHU
GHDGMXQWRVDGYHUELDLVTXDQGRHVVDVIXQo}HVVmRGHVHP-
DEVWUDtGRVHVHPRVTXDLVQmRSRGHPH[LVWLUvida (estado),
SHQKDGDVSRUJUXSRVGHSDODYUDV
rapidez (qualidade), viagem (ação), saudade (sentimento).
&ODVVLÀFDomRGRV6XEVWDQWLYRV
3 - Substantivos Coletivos
 Substantivos Comuns e Próprios
Ele vinha pela estrada e foi picado por uma abelha, ou-
2EVHUYH D GHÀQLomR s.f. 1: Povoação maior que vila, tra abelha, mais outra abelha.
com muitas casas e edifícios, dispostos em ruas e avenidas Ele vinha pela estrada e foi picado por várias abelhas.
(no Brasil, toda a sede de município é cidade). 2. O centro de Ele vinha pela estrada e foi picado por um enxame
uma cidade (em oposição aos bairros).
1RWHTXHQRSULPHLURFDVRSDUDLQGLFDUSOXUDOIRLQH-
4XDOTXHU´SRYRDomRPDLRUTXHYLODFRPPXLWDVFDVDV FHVViULR UHSHWLU R VXEVWDQWLYR XPD DEHOKD RXWUD DEHOKD
H HGLItFLRV GLVSRVWRV HP UXDV H DYHQLGDVµ VHUi FKDPDGD PDLVRXWUDDEHOKD
FLGDGH,VVRVLJQLÀFDTXHDSDODYUDFLGDGHpXPVXEVWDQWLYR 1RVHJXQGRFDVRXWLOL]DUDPVHGXDVSDODYUDVQRSOX-
FRPXP UDO

49
LÍNGUA PORTUGUESA

1RWHUFHLURFDVRHPSUHJRXVHXPVXEVWDQWLYRQRVLQJXODU HQ[DPH SDUDGHVLJQDUXPFRQMXQWRGHVHUHVGDPHVPD


HVSpFLH DEHOKDV 
2VXEVWDQWLYRHQ[DPHpXPVXEVWDQWLYRFROHWLYR
6XEVWDQWLYR&ROHWLYRpRVXEVWDQWLYRFRPXPTXHPHVPRHVWDQGRQRVLQJXODUGHVLJQDXPFRQMXQWRGHVHUHVGDPHV-
PDHVSpFLH

Substantivo coletivo Conjunto de


assembleia pessoas reunidas
alcateia lobos
acervo livros
antologia trechos literários selecionados
arquipélago ilhas
banda músicos
bando desordeiros ou malfeitores
banca examinadores
batalhão soldados
cardume peixes
caravana viajantes peregrinos
cacho frutas
FiÀOD   FDPHORV
cancioneiro canções, poesias líricas
colmeia abelhas
chusma gente, pessoas
concílio bispos
congresso parlamentares, cientistas.
HOHQFR   DWRUHVGHXPDSHoDRXÀOPH
esquadra navios de guerra
enxoval roupas
falange soldados, anjos
fauna animais de uma região
feixe lenha, capim
ÁRUD   YHJHWDLVGHXPDUHJLmR
frota navios mercantes, ônibus
girândola fogos de artifício
horda bandidos, invasores
junta médicos, bois, credores, examinadores
júri jurados
legião soldados, anjos, demônios
leva presos, recrutas
malta malfeitores ou desordeiros
manada búfalos, bois, elefantes,
matilha cães de raça
molho chaves, verduras
multidão pessoas em geral
ninhada pintos
nuvem insetos (gafanhotos, mosquitos, etc.)
penca bananas, chaves
pinacoteca pinturas, quadros
quadrilha ladrões, bandidos
UDPDOKHWH   ÁRUHV
rebanho ovelhas
récua bestas de carga, cavalgadura
repertório peças teatrais, obras musicais
réstia alhos ou cebolas
romanceiro poesias narrativas
revoada pássaros
sínodo párocos
talha lenha
tropa muares, soldados
turma estudantes, trabalhadores
vara porcos

50
LÍNGUA PORTUGUESA

Formação dos Substantivos PDVXPDSDUDRPDVFXOLQRHRXWUDSDUDRIHPLQLQR2EVHU-


YHgato – gata, homem – mulher, poeta – poetisa, prefeito
Substantivos Simples e Compostos - prefeita

&KXYDsubst. Fem. 1 - água caindo em gotas sobre a Substantivos Uniformes VmR DTXHOHV TXH DSUHVHQWDP
terra. XPD~QLFDIRUPDTXHVHUYHWDQWRSDUDRPDVFXOLQRTXDQWR
2VXEVWDQWLYRFKXYDpIRUPDGRSRUXP~QLFRHOHPHQWR
SDUDRIHPLQLQR&ODVVLÀFDPVHHP
RXUDGLFDOeXPVXEVWDQWLYRVLPSOHV

Substantivo SimplespDTXHOHIRUPDGRSRUXP~QLFR - Epicenos WrP XP Vy JrQHUR H QRPHLDP ELFKRV a


HOHPHQWR cobra macho e a cobra fêmea, o jacaré macho e o jacaré
2XWURVVXEVWDQWLYRVVLPSOHVtempo, sol, sofáHWF9HMD fêmea.
DJRUD2VXEVWDQWLYRJXDUGDFKXYDpIRUPDGRSRUGRLVHOH- - Sobrecomuns WrP XP Vy JrQHUR H QRPHLDP SHV-
PHQWRV JXDUGDFKXYD (VVHVXEVWDQWLYRpFRPSRVWR VRDVa criança, a testemunha, a vítima, o cônjuge, o gênio,
Substantivo CompostopDTXHOHIRUPDGRSRUGRLVRX o ídolo, o indivíduo.
PDLVHOHPHQWRV2XWURVH[HPSORVEHLMDÁRUSDVVDWHPSR. - Comuns de Dois GênerosLQGLFDPRVH[RGDVSHV-
 VRDVSRUPHLRGRDUWLJRo colega e a colega, o doente e a
Substantivos Primitivos e Derivados doente, o artista e a artista.

Meu limão meu limoeiro, Saiba que6XEVWDQWLYRVGHRULJHPJUHJDWHUPLQDGRV


meu pé de jacarandá... HP ema RX oma VmR PDVFXOLQRV o fonema, o poema, o
sistema, o sintoma, o teorema.
2VXEVWDQWLYROLPmRpSULPLWLYRSRLVQmRVHRULJLQRX
GHQHQKXPRXWURGHQWURGHOtQJXDSRUWXJXHVD  ([LVWHP FHUWRV VXEVWDQWLYRV TXH YDULDQGR GH JrQH-
Substantivo Primitivo p DTXHOH TXH QmR GHULYD GH UR YDULDP HP VHX VLJQLÀFDGR o rádio (aparelho receptor)
QHQKXPD RXWUD SDODYUD GD SUySULD OtQJXD SRUWXJXHVD 2 e a rádio (estação emissora) o capital (dinheiro) e a capital
VXEVWDQWLYR OLPRHLUR p GHULYDGR SRLV VH RULJLQRX D SDUWLU (cidade)
GDSDODYUDOLPmR
Substantivo DerivadopDTXHOHTXHVHRULJLQDGHRX- Formação do Feminino dos Substantivos Biformes
WUDSDODYUD
 5HJUD JHUDO WURFDVH D WHUPLQDomR R SRU ²D aluno
Flexão dos substantivos - aluna.
6XEVWDQWLYRVWHUPLQDGRVHPrVDFUHVFHQWDVHDDR
2VXEVWDQWLYRpXPDFODVVHYDULiYHO$SDODYUDpYDULi- PDVFXOLQRfreguês - freguesa
YHOTXDQGRVRIUHÁH[mR YDULDomR $SDODYUDPHQLQRSRU  6XEVWDQWLYRV WHUPLQDGRV HP mR ID]HP R IHPLQLQR
H[HPSORSRGHVRIUHUYDULDo}HVSDUDLQGLFDU
GHWUrVIRUPDV
3OXUDOmeninos )HPLQLQRmenina
$XPHQWDWLYRmeninão'LPLQXWLYRmenininho WURFDVHmRSRURD  patrão – patroa
WURFDVHmRSRUm campeão - campeã
Flexão de Gênero WURFDVHmRSRURQD solteirão - solteirona
Exceçõesbarão – baronesa ladrão- ladra sultão
*rQHURpDSURSULHGDGHTXHDVSDODYUDVWrPGHLQGLFDU - sultana
VH[R UHDO RX ÀFWtFLR GRV VHUHV 1D OtQJXD SRUWXJXHVD Ki
GRLVJrQHURVmasculino e feminino.3HUWHQFHPDRJrQHUR 6XEVWDQWLYRVWHUPLQDGRVHPRU
PDVFXOLQRRVVXEVWDQWLYRVTXHSRGHPYLUSUHFHGLGRVGRV DFUHVFHQWDVHDDRPDVFXOLQR doutor – doutora
DUWLJRVo, os, um, uns.9HMDHVWHVWtWXORVGHÀOPHV WURFDVHRUSRUWUL]  imperador - imperatriz
O velho e o mar
Um Natal inesquecível 6XEVWDQWLYRVFRPIHPLQLQRHPHVDHVVDLVDcôn-
Os reis da praia sul - consulesa / abade - abadessa / poeta - poetisa / duque
- duquesa / conde - condessa / profeta - profetisa
3HUWHQFHP DR JrQHUR IHPLQLQR RV VXEVWDQWLYRV TXH
SRGHPYLUSUHFHGLGRVGRVDUWLJRVa, as, uma, umas:
$KLVWyULDVHPÀP 6XEVWDQWLYRVTXHIRUPDPRIHPLQLQRWURFDQGRRH
Uma cidade sem passado ÀQDOSRUDelefante - elefanta
As tartarugas ninjas
6XEVWDQWLYRVTXHWrPUDGLFDLVGLIHUHQWHVQRPDVFXOL-
Substantivos Biformes e Substantivos Uniformes QRHQRIHPLQLQRbode – cabra / boi - vaca

Substantivos Biformes GXDVIRUPDV DRLQGLFDUQR- 6XEVWDQWLYRVTXHIRUPDPRIHPLQLQRGHPDQHLUDHV-


PHV GH VHUHV YLYRV JHUDOPHQWH R JrQHUR GD SDODYUD HVWi SHFLDOLVWRpQmRVHJXHPQHQKXPDGDVUHJUDVDQWHULRUHV
UHODFLRQDGR DR VH[R GR VHU KDYHQGR SRUWDQWR GXDV IRU- czar – czarina réu - ré

51
LÍNGUA PORTUGUESA

Formação do Feminino dos Substantivos Uniformes Femininos: a dinamite, a derme, a hélice, a omoplata, a
cataplasma, a pane, a mascote, a gênese, a entorse, a libido,
Epicenos a cal, a faringe, a cólera (doença), a ubá (canoa).
Novo jacaré escapa de policiais no rio Pinheiros.
6mRJHUDOPHQWHPDVFXOLQRVRVVXEVWDQWLYRVGHRUL-
1mRpSRVVtYHOVDEHURVH[RGRMDFDUpHPTXHVWmR,VVR JHPJUHJDWHUPLQDGRVHPPDo grama (peso), o quilo-
RFRUUHSRUTXHRVXEVWDQWLYRMDFDUpWHPDSHQDVXPDIRUPD grama, o plasma, o apostema, o diagrama, o epigrama, o
SDUDLQGLFDURPDVFXOLQRHRIHPLQLQR telefonema, o estratagema, o dilema, o teorema, o trema, o
$OJXQV QRPHV GH DQLPDLV DSUHVHQWDP XPD Vy IRUPD eczema, o edema, o magma, o estigma, o axioma, o traco-
SDUD GHVLJQDU RV GRLV VH[RV (VVHV VXEVWDQWLYRV VmR FKD- ma, o hematoma.
PDGRVGHHSLFHQRV1RFDVRGRVHSLFHQRVTXDQGRKRXYHU
D QHFHVVLGDGH GH HVSHFLÀFDU R VH[R XWLOL]DPVH SDODYUDV ([FHo}HVDFDWDSODVPDDFHOHXPDDÁHXPDHWF
PDFKRHIrPHD

A cobra macho picou o marinheiro.
Gênero dos Nomes de Cidades
A cobra fêmea escondeu-se na bananeira.
&RPUDUDVH[FHo}HVQRPHVGHFLGDGHVVmRIHPLQLQRV
Sobrecomuns:
Entregue as crianças à natureza A histórica Ouro Preto.
A dinâmica São Paulo.
$SDODYUDFULDQoDVUHIHUHVHWDQWRDVHUHVGRVH[RPDV- A acolhedora Porto Alegre.
FXOLQRTXDQWRDVHUHVGRVH[RIHPLQLQR1HVVHFDVRQHP Uma Londres imensa e triste.
RDUWLJRQHPXPSRVVtYHODGMHWLYRSHUPLWHPLGHQWLÀFDUR ([FHo}HVo Rio de Janeiro, o Cairo, o Porto, o Havre.
VH[RGRVVHUHVDTXHVHUHIHUHDSDODYUD9HMD
A criança chorona chamava-se João. *rQHURH6LJQLÀFDomR
A criança chorona chamava-se Maria.
0XLWRVVXEVWDQWLYRVWrPXPDVLJQLÀFDomRQRPDVFXOL-
2XWURVVXEVWDQWLYRVVREUHFRPXQV QRHRXWUDQRIHPLQLQR2EVHUYHo baliza (soldado que, que
DFULDWXUD João é uma boa criatura. Maria é uma boa à frente da tropa, indica os movimentos que se deve realizar
criatura em conjunto; o que vai à frente de um bloco carnavalesco,
RF{QMXJH O cônjuge de João faleceu. O cônjuge de manejando um bastão), a baliza (marco, estaca; sinal que
Marcela faleceu marca um limite ou proibição de trânsito), o cabeça (chefe),
a cabeça (parte do corpo), o cisma (separação religiosa, dissi-
Comuns de Dois Gêneros: GrQFLD DFLVPD DWRGHFLVPDUGHVFRQÀDQoD RFLQ]D DFRU
Motorista tem acidente idêntico 23 anos depois cinzenta), a cinza (resíduos de combustão), o capital (dinhei-
ro), a capital (cidade), o coma (perda dos sentidos), a coma
4XHPVRIUHXRDFLGHQWHXPKRPHPRXXPDPXOKHU" (cabeleira), o coral (pólipo, a cor vermelha, canto em coro),
eLPSRVVtYHOVDEHUDSHQDVSHORWtWXORGDQRWtFLDXPD a coral (cobra venenosa), o crisma (óleo sagrado, usado na
YH]TXHDSDODYUDPRWRULVWDpXPVXEVWDQWLYRXQLIRUPH administração da crisma e de outros sacramentos), a crisma
$GLVWLQomRGHJrQHURSRGHVHUIHLWDDWUDYpVGDDQiOLVH VDFUDPHQWRGDFRQÀUPDomR RFXUD SiURFR DFXUD DWRGH
GRDUWLJRRXDGMHWLYRTXDQGRDFRPSDQKDUHPRVXEVWDQWL- curar), o estepe (pneu sobressalente), a estepe (vasta planície
YRo colega - a colega; o imigrante - a imigrante; um jovem de vegetação), o guia (pessoa que guia outras), a guia (docu-
- uma jovem; artista famoso - artista famosa; repórter fran-
mento, pena grande das asas das aves), o grama (unidade de
cês - repórter francesa
peso), a grama (relva), o caixa (funcionário da caixa), a caixa
 $ SDODYUD SHUVRQDJHP p XVDGD LQGLVWLQWDPHQWH QRV
(recipiente, setor de pagamentos), o lente (professor), a lente
GRLVJrQHURV
D  (QWUH RV HVFULWRUHV PRGHUQRV QRWDVH DFHQWXDGD
(vidro de aumento), o moral (ânimo), a moral (honestidade,
SUHIHUrQFLDSHORPDVFXOLQRO menino descobriu nas nuvens bons costumes, ética), o nascente (lado onde nasce o Sol), a
os personagens dos contos de carochinha nascente (a fonte), o maria-fumaça (trem como locomotiva
E &RPUHIHUrQFLDDPXOKHUGHYHVHSUHIHULURIHPLQL- a vapor), maria-fumaça (locomotiva movida a vapor), o pala
QRO problema está nas mulheres de mais idade, que não (poncho), a pala (parte anterior do boné ou quepe, antepa-
aceitam a personagem. ro), o rádio (aparelho receptor), a rádio (estação emissora), o
'L]VHo (ou a) manequim Marcela, o (ou a) modelo voga (remador), a voga (moda, popularidade).
IRWRJUiÀFR$QD%HOPRQWH
2EVHUYHRJrQHURGRVVXEVWDQWLYRVVHJXLQWHV )OH[mRGH1~PHURGR6XEVWDQWLYR

Masculinos: o tapa, o eclipse, o lança-perfume, o dó (PSRUWXJXrVKiGRLVQ~PHURVJUDPDWLFDLVRVLQJXODU


(pena), o sanduíche, o clarinete, o champanha, o sósia, o TXHLQGLFDXPVHURXXPJUXSRGHVHUHVHRSOXUDOTXH
maracajá, o clã, o hosana, o herpes, o pijama, o suéter, o LQGLFDPDLVGHXPVHURXJUXSRGHVHUHV$FDUDFWHUtVWLFD
soprano, o proclama, o pernoite, o púbis. GRSOXUDOpR´VµÀQDO

52
LÍNGUA PORTUGUESA

Plural dos Substantivos Simples Flexiona-se somente o segundo elementoTXDQGR


IRUPDGRVGH
-2VVXEVWDQWLYRVWHUPLQDGRVHPYRJDOGLWRQJRRUDOH YHUERVXEVWDQWLYR guarda-roupa e guarda-roupas
´QµID]HPRSOXUDOSHORDFUpVFLPRGH´Vµ pai – pais; ímã – SDODYUD LQYDULiYHO  SDODYUD YDULiYHO  alto-falante e
ímãs; hífen - hifens (sem acento, no plural). ([FHomRcânon alto- -falantes
- cânones. SDODYUDVUHSHWLGDVRXLPLWDWLYDV reco-reco e reco-re-
 2V VXEVWDQWLYRV WHUPLQDGRV HP ´Pµ ID]HP R SOXUDO cos
HP´QVµhomem - homens.
Flexiona-se somente o primeiro elementoTXDQGR
2VVXEVWDQWLYRVWHUPLQDGRVHP´UµH´]µID]HPRSOX- IRUPDGRVGH
UDOSHORDFUpVFLPRGH´HVµrevólver – revólveres; raiz - raízes.
VXEVWDQWLYRSUHSRVLomRFODUDVXEVWDQWLYR água-
de-colônia e águas-de-colônia
Atenção2SOXUDOGHFDUiWHUpFDUDFWHUHV
2VVXEVWDQWLYRVWHUPLQDGRVHPDOHOROXOÁH[LRQDP VXEVWDQWLYRSUHSRVLomRRFXOWDVXEVWDQWLYR cava-
VHQRSOXUDOWURFDQGRR´OµSRU´LVµquintal - quintais; cara- lo-vapor e cavalos-vapor
col – caracóis; hotel - hotéis. ([FHo}HVmal e males, cônsul VXEVWDQWLYR  VXEVWDQWLYR TXH IXQFLRQD FRPR GHWHU-
e cônsules. PLQDQWHGRSULPHLURRXVHMDHVSHFLÀFDDIXQomRRXRWLSR
GRWHUPRDQWHULRUpalavra-chave - palavras-chave, bomba
2VVXEVWDQWLYRVWHUPLQDGRVHP´LOµID]HPRSOXUDOGH -relógio - bombas-relógio, notícia-bomba - notícias-bomba,
GXDVPDQHLUDV homem-rã - homens-rã, peixe-espada - peixes-espada.
4XDQGRR[tWRQRVHP´LVµcanil - canis
4XDQGRSDUR[tWRQRVHP´HLVµmíssil - mísseis Permanecem invariáveisTXDQGRIRUPDGRVGH
YHUERDGYpUELR o bota-fora e os bota-fora
ObsDSDODYUDUpSWLOSRGHIRUPDUVHXSOXUDOGHGXDV YHUERVXEVWDQWLYRQRSOXUDO o saca-rolhas e os sa-
PDQHLUDVrépteis ou reptis SRXFRXVDGD  ca-rolhas
2VVXEVWDQWLYRVWHUPLQDGRVHP´VµID]HPRSOXUDOGH
GXDVPDQHLUDV Casos Especiais
 4XDQGR PRQRVVLOiELFRV RX R[tWRQRV PHGLDQWH R o louva-a-deus e os louva-a-deus
DFUpVFLPRGH´HVµás – ases / retrós - retroses o bem-te-vi e os bem-te-vis
4XDQGRSDUR[tWRQRVRXSURSDUR[tWRQRVÀFDPLQYD-
o bem-me-quer e os bem-me-queres
ULiYHLVo lápis - os lápis / o ônibus - os ônibus.
o joão-ninguém e os joões-ninguém.
 2V VXEVWDQWLYRV WHUPLQDGRV HP ´DRµ ID]HP R SOXUDO
GHWUrVPDQHLUDV Plural das Palavras Substantivadas
VXEVWLWXLQGRRmRSRU}HVação - ações
VXEVWLWXLQGRRmRSRUmHVcão - cães $V SDODYUDV VXEVWDQWLYDGDV LVWR p SDODYUDV GH RXWUDV
VXEVWLWXLQGRRmRSRUmRVgrão - grãos FODVVHVJUDPDWLFDLVXVDGDVFRPRVXEVWDQWLYRDSUHVHQWDP
QRSOXUDODVÁH[}HVSUySULDVGRVVXEVWDQWLYRV
2VVXEVWDQWLYRVWHUPLQDGRVHP´[µÀFDPLQYDULiYHLV Pese bem os prós e os contras.
o látex - os látex. O aluno errou na prova dos noves.
Ouça com a mesma serenidade os sins e os nãos.
Plural dos Substantivos Compostos Obs QXPHUDLV VXEVWDQWLYDGRV WHUPLQDGRV HP ´Vµ RX
´]µQmRYDULDPQRSOXUDONas provas mensais consegui mui-
$IRUPDomRGRSOXUDOGRVVXEVWDQWLYRVFRPSRVWRVGH- tos seis e alguns dez.
SHQGH GD IRUPD FRPR VmR JUDIDGRV GR WLSR GH SDODYUDV
TXHIRUPDPRFRPSRVWRHGDUHODomRTXHHVWDEHOHFHPHQ- Plural dos Diminutivos
WUHVL$TXHOHVTXHVmRJUDIDGRVVHPKtIHQFRPSRUWDPVH
FRPRRVVXEVWDQWLYRVVLPSOHVDJXDUGHQWHDJXDUGHQWHV
)OH[LRQDVHRVXEVWDQWLYRQRSOXUDOUHWLUDVHR´VµÀQDO
JLUDVVROJLUDVVyLV SRQWDSpSRQWDSpV PDOPHTXHUPDOPH-
HDFUHVFHQWDVHRVXÀ[RGLPLQXWLYR
TXHUHV
2SOXUDOGRVVXEVWDQWLYRVFRPSRVWRVFXMRVHOHPHQWRV pãe(s) + zinhos = pãezinhos
VmROLJDGRVSRUKtIHQFRVWXPDSURYRFDUPXLWDVG~YLGDVH animai(s) + zinhos = animaizinhos
GLVFXVV}HV$OJXPDVRULHQWDo}HVVmRGDGDVDVHJXLU botõe(s) + zinhos = botõezinhos
chapéu(s) + zinhos = chapeuzinhos
Flexionam-se os dois elementosTXDQGRIRUPDGRV farói(s) + zinhos = faroizinhos
GH tren(s) + zinhos = trenzinhos
VXEVWDQWLYRVXEVWDQWLYR FRXYHÁRUHFRXYHVÁRUHV colhere(s) + zinhas = colherezinhas
VXEVWDQWLYR  DGMHWLYR  amor-perfeito e amores-per- ÁRUH V ]LQKDV ÁRUH]LQKDV
feitos mão(s) + zinhas = mãozinhas
DGMHWLYR  VXEVWDQWLYR  gentil-homem e gentis-ho- papéi(s) + zinhos = papeizinhos
mens nuven(s) + zinhas = nuvenzinhas
QXPHUDOVXEVWDQWLYR quinta-feira e quintas-feiras funi(s) + zinhos = funizinhos

53
LÍNGUA PORTUGUESA

túnei(s) + zinhos = tuneizinhos  2XWURV HQÀP WrP QR SOXUDO VHQWLGR GLIHUHQWH GR
pai(s) + zinhos = paizinhos VLQJXODUbem (virtude) e bens (riquezas), honra (probidade,
pé(s) + zinhos = pezinhos bom nome) e honras (homenagem, títulos).
pé(s) + zitos = pezitos  8VDPRV jV YH]HV RV VXEVWDQWLYRV QR VLQJXODU PDV
FRPVHQWLGRGHSOXUDO
Plural dos Nomes Próprios Personativos Aqui morreu muito negro.
Celebraram o sacrifício divino muitas vezes em capelas
'HYHPVH SOXUDOL]DU RV QRPHV SUySULRV GH SHVVRDV improvisadas.
VHPSUHTXHDWHUPLQDomRSUHVWHVHjÁH[mR
Os Napoleões também são derrotados. Flexão de Grau do Substantivo
As Raquéis e Esteres.
*UDXpDSURSULHGDGHTXHDVSDODYUDVWrPGHH[SULPLU
Plural dos Substantivos Estrangeiros DVYDULDo}HVGHWDPDQKRGRVVHUHV&ODVVLÀFDVHHP
Grau Normal,QGLFDXPVHUGHWDPDQKRFRQVLGHUD-
6XEVWDQWLYRVDLQGDQmRDSRUWXJXHVDGRVGHYHPVHUHV- GRQRUPDO3RUH[HPSORcasa
FULWRVFRPRQDOtQJXDRULJLQDODFUHVFHQWDQGRVH´Vµ H[FH- Grau Aumentativo ,QGLFDRDXPHQWRGRWDPDQKR
WRTXDQGRWHUPLQDPHP´VµRX´]µ os shows, os shorts, os GRVHU&ODVVLÀFDVHHP
jazz. Analítico RVXEVWDQWLYRpDFRPSDQKDGRGHXPDGMH-
WLYRTXHLQGLFDJUDQGH]D3RUH[HPSORcasa grande
6XEVWDQWLYRVMiDSRUWXJXHVDGRVÁH[LRQDPVHGHDFRU- Sintético pDFUHVFLGRDRVXEVWDQWLYRXPVXÀ[RLQGL-
GRFRPDVUHJUDVGHQRVVDOtQJXDos clubes, os chopes, os FDGRUGHDXPHQWR3RUH[HPSORcasarão
jipes, os esportes, as toaletes, os bibelôs, os garçons, Grau Diminutivo,QGLFDDGLPLQXLomRGRWDPDQKR
os réquiens. GRVHU3RGHVHU
2EVHUYHRH[HPSOR Analítico VXEVWDQWLYRDFRPSDQKDGRGHXPDGMHWLYR
Este jogador faz gols toda vez que joga. TXHLQGLFDSHTXHQH]3RUH[HPSORcasa pequena
2SOXUDOFRUUHWRVHULDJRLV { PDVQmRVHXVD Sintético pDFUHVFLGRDRVXEVWDQWLYRXPVXÀ[RLQGL-
FDGRUGHGLPLQXLomR3RUH[HPSORcasinha.
Plural com Mudança de Timbre
Verbo
&HUWRVVXEVWDQWLYRVIRUPDPRSOXUDOFRPPXGDQoDGH
WLPEUH GD YRJDO W{QLFD R IHFKDGR  R DEHUWR  e XP IDWR VerbopDFODVVHGHSDODYUDVTXHVHÁH[LRQDHPSHVVRD
IRQpWLFRFKDPDGRPHWDIRQLD plural metafônico  Q~PHUR WHPSR PRGR H YR] 3RGH LQGLFDU HQWUH RXWURV
Singular Plural SURFHVVRVDomR FRUUHU HVWDGR ÀFDU IHQ{PHQR FKRYHU 
corpo (ô) corpos (ó) RFRUUrQFLD QDVFHU GHVHMR TXHUHU 
esforço esforços 2 TXH FDUDFWHUL]D R YHUER VmR DV VXDV ÁH[}HV H QmR
fogo fogos RVVHXVSRVVtYHLVVLJQLÀFDGRV2EVHUYHTXHSDODYUDVFRPR
forno fornos corrida, chuva H nascimentoWrPFRQWH~GRPXLWRSUy[LPR
fosso fossos DRGHDOJXQVYHUERVPHQFLRQDGRVDFLPDQmRDSUHVHQWDP
imposto impostos SRUpPWRGDVDVSRVVLELOLGDGHVGHÁH[mRTXHHVVHVYHUERV
olho olhos SRVVXHP
osso (ô) ossos (ó)
ovo ovos Estrutura das Formas Verbais
poço poços
porto portos 'R SRQWR GH YLVWD HVWUXWXUDO XPD IRUPD YHUEDO SRGH
posto postos DSUHVHQWDURVVHJXLQWHVHOHPHQWRV
tijolo tijolos
RadicalpDSDUWHLQYDULiYHOTXHH[SUHVVDRVLJQLÀFD-
7rPDYRJDOW{QLFDIHFKDGD { adornos, almoços, bol- GRHVVHQFLDOGRYHUER3RUH[HPSORfal-ei; fal-ava; fal-am
sos, esposos, estojos, globos, gostos, polvos, rolos, sorosHWF UDGLFDOIDO
TemapRUDGLFDOVHJXLGRGDYRJDOWHPiWLFDTXHLQ-
ObsGLVWLQJDVHPROKR {  FDOGR PROKRGHFDUQH  GLFD D FRQMXJDomR D TXH SHUWHQFH R YHUER 3RU H[HPSOR
GHPROKR y  IHL[H PROKRGHOHQKD  fala-r
6mRWUrVDVFRQMXJDo}HV9RJDO7HPiWLFD$(fa-
3DUWLFXODULGDGHVVREUHR1~PHURGRV6XEVWDQWLYRV lar), 9RJDO7HPiWLFD((vender), 9RJDO7HPiWLFD
,(partir)
+iVXEVWDQWLYRVTXHVyVHXVDPQRVLQJXODUo sul, o Desinência modo-temporalpRHOHPHQWRTXHGH-
norte, o leste, o oeste, a fé,HWF VLJQDRWHPSRHRPRGRGRYHUER3RUH[HPSOR
2XWURVVyQRSOXUDOas núpcias, os víveres, os pêsames, falávamos LQGLFDRSUHWpULWRLPSHUIHLWRGRLQGLFDWLYR
as espadas/os paus (naipes de baralho), as fezes falasse LQGLFDRSUHWpULWRLPSHUIHLWRGRVXEMXQWLYR 

54
LÍNGUA PORTUGUESA

'HVLQrQFLDQ~PHURSHVVRDOpRHOHPHQWRTXHGH-  R YHUER SDVVDU VHJXLGR GH SUHSRVLomR  LQGLFDQGR


VLJQDDSHVVRDGRGLVFXUVR RX HRQ~PHUR VLQ- WHPSRJá passa das seis.
JXODURXSOXUDO  RVYHUERVEDVWDUHFKHJDUVHJXLGRVGDSUHSRVLomR
falamos LQGLFDDSHVVRDGRSOXUDO GH LQGLFDQGR VXÀFLrQFLD Basta de tolices. Chega de blas-
falavam LQGLFDDSHVVRDGRSOXUDO fêmias
 RV YHUERV HVWDU H ÀFDU HP RUDo}HV WDLV FRPR Está
ObservaçãoRYHUERpôrDVVLPFRPRVHXVGHULYDGRV EHP(VWiPXLWREHPDVVLP1mRÀFDEHP)LFDPDOVHPUH-
compor, repor, depor, HWF  SHUWHQFHP j  FRQMXJDomR IHUrQFLDDVXMHLWRH[SUHVVRDQWHULRUPHQWH3RGHPRVDLQGD
SRLV D IRUPD DUFDLFD GR YHUER S{U HUD poer $ YRJDO ´Hµ QHVVHFDVRFODVVLÀFDURVXMHLWRFRPRKLSRWpWLFRWRUQDQGR
DSHVDU GH KDYHU GHVDSDUHFLGR GR LQÀQLWLYR UHYHODVH HP VHWDLVYHUERVHQWmRSHVVRDLV
DOJXPDVIRUPDVGRYHUERpõe, pões, põem,HWF RYHUERGHXSDUDGDOtQJXDSRSXODUHTXLYDOHQWH
GH´VHUSRVVtYHOµ3RUH[HPSOR
Formas Rizotônicas e Arrizotônicas Não deu para chegar mais cedo.
Dá para me arrumar uns trocados?
$RFRPELQDUPRVRVFRQKHFLPHQWRVVREUHDHVWUXWXUD  8QLSHVVRDLV VmR DTXHOHV TXH WHQGR VXMHLWR FRQMX-
GRV YHUERV FRP R FRQFHLWR GH DFHQWXDomR W{QLFD SHUFH- JDPVH DSHQDV  QDV WHUFHLUDV SHVVRDV GR VLQJXODU H GR
EHPRVFRPIDFLOLGDGHTXHQDVIRUPDVUL]RW{QLFDVRDFHQWR SOXUDO
W{QLFRFDLQRUDGLFDOGRYHUERopino, aprendam, nutroSRU A fruta amadureceu.
H[HPSOR1DVIRUPDVDUUL]RW{QLFDVRDFHQWRW{QLFRQmRFDL As frutas amadureceram.
QRUDGLFDOPDVVLPQDWHUPLQDomRYHUEDOopinei, aprende-
rão, nutriríamos Obs RV YHUERV XQLSHVVRDLV SRGHP VHU XVDGRV FRPR
YHUERVSHVVRDLVQDOLQJXDJHPÀJXUDGDTeu irmão amadu-
&ODVVLÀFDomRGRV9HUERV receu bastante

&ODVVLÀFDPVHHP (QWUH RV XQLSHVVRDLV HVWmR RV YHUERV TXH VLJQLÀFDP


RegularesVmRDTXHOHVTXHSRVVXHPDVGHVLQrQFLDV YR]HVGHDQLPDLVHLVDOJXQVbramar: tigre, bramir: crocodi-
QRUPDLVGHVXDFRQMXJDomRHFXMDÁH[mRQmRSURYRFDDOWH- lo, cacarejar: galinha, coaxar: sapo, cricrilar: grilo
UDo}HVQRUDGLFDOcanto cantei cantarei cantava
cantasse. 2VSULQFLSDLVYHUERVXQLSHVVRDLVVmR
IrregularesVmRDTXHOHVFXMDÁH[mRSURYRFDDOWHUD-  cumprir, importar, convir, doer, aprazer, parecer, ser
o}HVQRUDGLFDORXQDVGHVLQrQFLDVIDoRÀ]IDUHLÀ- SUHFLVRQHFHVViULRHWF 
zesse. Cumpre trabalharmos bastante. (Sujeito: trabalharmos
DefectivosVmRDTXHOHVTXHQmRDSUHVHQWDPFRQMX- bastante.)
JDomRFRPSOHWD&ODVVLÀFDPVHHPLPSHVVRDLVXQLSHVVRDLV Parece que vai chover. (Sujeito: que vai chover.)
HSHVVRDLV É preciso que chova. (Sujeito: que chova.)
,PSHVVRDLVVmRRVYHUERVTXHQmRWrPVXMHLWR1RU-
PDOPHQWH VmR XVDGRV QD WHUFHLUD SHVVRD GR VLQJXODU 2V fazer e irHPRUDo}HVTXHGmRLGHLDGHWHPSRVHJXL-
SULQFLSDLVYHUERVLPSHVVRDLVVmR GRVGDFRQMXQomRque
haverTXDQGRVLQ{QLPRGHH[LVWLUDFRQWHFHUUHDOL- Faz dez anos que deixei de fumar. (Sujeito: que deixei de
]DUVHRXID]HU HPRUDo}HVWHPSRUDLV  fumar.)
Havia poucos ingressos à venda. (Havia = Existiam) Vai para (ou Vai em ou Vai por) dez anos que não vejo
Houve duas guerras mundiais. (Houve = Aconteceram) Cláudia. (Sujeito: que não vejo Cláudia)
Haverá reuniões aqui. (Haverá = Realizar-se-ão) ObsWRGRVRVVXMHLWRVDSRQWDGRVVmRRUDFLRQDLV
Deixei de fumar há muitos anos. (há = faz)
fazer, ser e estar TXDQGRLQGLFDPWHPSR 3HVVRDLVQmRDSUHVHQWDPDOJXPDVÁH[}HVSRUPRWL-
Faz invernos rigorosos no Sul do Brasil. YRVPRUIROyJLFRVRXHXI{QLFRV3RUH[HPSOR
Era primavera quando a conheci. YHUERIDOLU(VWHYHUERWHULDFRPRIRUPDVGRSUHVHQWH
Estava frio naquele dia. GRLQGLFDWLYRfalo, fales, faleLGrQWLFDVjVGRYHUERIDODUR
 7RGRV RV YHUERV TXH LQGLFDP IHQ{PHQRV GD QDWX- TXH SURYDYHOPHQWH FDXVDULD SUREOHPDV GH LQWHUSUHWDomR
UH]D VmR LPSHVVRDLV chover, ventar, nevar, gear, trovejar, HPFHUWRVFRQWH[WRV
amanhecer, escurecer, HWF 4XDQGR SRUpP VH FRQVWUyL  YHUER FRPSXWDU (VWH YHUER WHULD FRPR IRUPDV GR
´Amanheci mal- -humoradoµ XVDVH R YHUER ´DPD- SUHVHQWHGRLQGLFDWLYRcomputo, computas, computaIRU-
QKHFHUµ HP VHQWLGR ÀJXUDGR 4XDOTXHU YHUER LPSHVVRDO PDVGHVRQRULGDGHFRQVLGHUDGDRIHQVLYDSRUDOJXQVRXYL-
HPSUHJDGR HP VHQWLGR ÀJXUDGR GHL[D GH VHU LPSHVVRDO GRVJUDPDWLFDLV(VVDVUD]}HVPXLWDVYH]HVQmRLPSHGHPR
SDUDVHUSHVVRDO XVRHIHWLYRGHIRUPDVYHUEDLVUHSXGLDGDVSRUDOJXQVJUD-
Amanheci mal-humorado. (Sujeito desinencial: eu) PiWLFRVH[HPSORGLVVRpRSUySULRYHUERFRPSXWDUTXH
Choveram candidatos ao cargo. (Sujeito: candidatos) FRPRGHVHQYROYLPHQWRHDSRSXODUL]DomRGDLQIRUPiWLFD
Fiz quinze anos ontem. (Sujeito desinencial: eu) WHP VLGR FRQMXJDGR HP WRGRV RV WHPSRV PRGRV H SHV-
6mRLPSHVVRDLVDLQGD VRDV

55
LÍNGUA PORTUGUESA

AbundantesVmRDTXHOHVTXHSRVVXHPPDLVGHXPDIRUPDFRPRPHVPRYDORU*HUDOPHQWHHVVHIHQ{PHQRFRVWXPD
RFRUUHUQRSDUWLFtSLRHPTXHDOpPGDVIRUPDVUHJXODUHVWHUPLQDGDVHPDGRRXLGRVXUJHPDVFKDPDGDVIRUPDVFXUWDV
SDUWLFtSLRLUUHJXODU 2EVHUYH

INFINITIVO PARTICÍPIO REGULAR PARTICÍPIO IRREGULAR


Anexar Anexado Anexo
Dispersar Dispersado Disperso
Eleger Elegido Eleito
Envolver Envolvido Envolto
Imprimir Imprimido Impresso
Matar Matado Morto
Morrer Morrido Morto
Pegar Pegado Pego
Soltar Soltado Solto

AnômalosVmRDTXHOHVTXHLQFOXHPPDLVGHXPUDGLFDOHPVXDFRQMXJDomR3RUH[HPSORIr, Pôr, Ser, Saber (vou, vais,


ides, fui, foste, pus, pôs, punha, sou, és, fui, foste, seja).

Auxiliares: 6mRDTXHOHVTXHHQWUDPQDIRUPDomRGRVWHPSRVFRPSRVWRVHGDVORFXo}HVYHUEDLV2YHUERSULQFLSDO
TXDQGRDFRPSDQKDGRGHYHUERDX[LOLDUpH[SUHVVRQXPDGDVIRUPDVQRPLQDLVLQÀQLWLYRJHU~QGLRRXSDUWLFtSLR
 Vou espantar as moscas.
 YHUERDX[LOLDU  YHUERSULQFLSDOQRLQÀQLWLYR

 Está chegando a hora do debate


 YHUERDX[LOLDU  YHUERSULQFLSDOQRJHU~QGLR 

Os noivos foram cumprimentados por todos os presentes
 YHUERDX[LOLDU  YHUERSULQFLSDOQRSDUWLFtSLR

ObsRVYHUERVDX[LOLDUHVPDLVXVDGRVVmRser, estar, ter e haver.

Conjugação dos Verbos Auxiliares

SER - Modo Indicativo

Presente Pret.Perfeito Pretérito Imp. Pret.Mais-Que-Perf. Fut.do Pres. Fut. Do Pretérito


VRX  IXL  HUD  IRUD  VHUHL  VHULD
pV  IRVWH  HUDV  IRUDV   VHUiV  VHULDV
p  IRL  HUD  IRUD   VHUi  VHULD
VRPRV IRPRV  pUDPRV  I{UDPRV  VHUHPRV VHUtDPRV
VRLV IRVWHV  pUHLV  I{UHLV   VHUHLV  VHUtHLV
VmR  IRUDP  HUDP  IRUDP   VHUmR  VHULDP

SER - Modo Subjuntivo

Presente Pretérito Imperfeito Futuro


TXHHXVHMD   VHHXIRVVH   TXDQGRHXIRU
TXHWXVHMDV   VHWXIRVVHV   TXDQGRWXIRUHV
TXHHOHVHMD   VHHOHIRVVH   TXDQGRHOHIRU
TXHQyVVHMDPRV  VHQyVI{VVHPRV  TXDQGRQyVIRUPRV
TXHYyVVHMDLV  VHYyVI{VVHLV   TXDQGRYyVIRUGHV
TXHHOHVVHMDP  VHHOHVIRVVHP   TXDQGRHOHVIRUHP

SER - Modo Imperativo

$ÀUPDWLYR   1HJDWLYR
VrWX   QmRVHMDVWX
VHMDYRFr   QmRVHMDYRFr
VHMDPRVQyV  QmRVHMDPRVQyV
VHGHYyV   QmRVHMDLVYyV
VHMDPYRFrV   QmRVHMDPYRFrV

56
LÍNGUA PORTUGUESA

SER - Formas Nominais

,QÀQLWLYR,PSHVVRDO ,QÀQLWLYR3HVVRDO *HU~QGLR 3DUWLFtSLR


VHU    VHUHX   VHQGR  VLGR
    VHUHVWX 
    VHUHOH  
    VHUPRVQyV  
    VHUGHVYyV  
    VHUHPHOHV 

ESTAR - Modo Indicativo

Presente Pret. perf. Pret. Imperf. Pret.Mais-Que-Perf. Fut.doPres. Fut.do Preté


HVWRX HVWLYH  HVWDYD  HVWLYHUD   HVWDUHL  HVWDULD
HVWiV HVWLYHVWH HVWDYDV  HVWLYHUDV  HVWDUiV  HVWDULDV
HVWi HVWHYH  HVWDYD  HVWLYHUD   HVWDUi  HVWDULD
HVWDPRV HVWLYHPRV HVWiYDPRV HVWLYpUDPRV  HVWDUHPRV HVWDUtDPRV
HVWDLV HVWLYHVWHV HVWiYHLV HVWLYpUHLV  HVWDUHLV  HVWDUtHLV
HVWmR HVWLYHUDP HVWDYDP HVWLYHUDP  HVWDUmR  HVWDULDP

ESTAR - Modo Subjuntivo e Imperativo

3UHVHQWH 3UHWpULWR,PSHUIHLWR )XWXUR  $ÀUPDWLYR 1HJDWLYR


HVWHMD HVWLYHVVH  HVWLYHU  
HVWHMDV HVWLYHVVHV  HVWLYHUHV HVWi  HVWHMDV
HVWHMD HVWLYHVVH  HVWLYHU  HVWHMD  HVWHMD
HVWHMDPRV HVWLYpVVHPRV  HVWLYHUPRV HVWHMDPRV HVWHMDPRV
HVWHMDLV HVWLYpVVHLV  HVWLYHUGHV HVWDL  HVWHMDLV
HVWHMDP HVWLYHVVHP  HVWLYHUHP HVWHMDP HVWHMDP

ESTAR - Formas Nominais

,QÀQLWLYR,PSHVVRDO,QÀQLWLYR3HVVRDO *HU~QGLR 3DUWLFtSLR


HVWDU  HVWDU   HVWDQGR HVWDGR
   HVWDUHV  
   HVWDU  
   HVWDUPRV  
   HVWDUGHV 
   HVWDUHP

HAVER - Modo Indicativo

Presente Pret. Perf. Pret. Imper. Pret.Mais-Que-Perf. Fut. Do Pres. Fut. Do Preté.
KHL  KRXYH  KDYLD  KRXYHUD  KDYHUHL  KDYHULD
KiV  KRXYHVWH KDYLDV  KRXYHUDV  KDYHUiV  KDYHULDV
Ki  KRXYH  KDYLD  KRXYHUD  KDYHUi  KDYHULD
KDYHPRV KRXYHPRV KDYtDPRV KRXYpUDPRV  KDYHUHPRV KDYHUtDPRV
KDYHLV KRXYHVWHV KDYtHLV  KRXYpUHLV  KDYHUHLV KDYHUtHLV
KmR KRXYHUDP KDYLDP  KRXYHUDP  KDYHUmR KDYHULDP

HAVER - Modo Subjuntivo e Imperativo

3UHVHQWH  3UHWpULWR,PSHUIHLWR )XWXUR  $ÀUPDWLYR 1HJDWLYR


KDMD  KRXYHVVH  KRXYHU  
KDMDV  KRXYHVVHV  KRXYHUHV Ki  KDMDV
KDMD  KRXYHVVH  KRXYHU  KDMD  KDMD
KDMDPRV  KRXYpVVHPRV  KRXYHUPRV KDMDPRV KDMDPRV
KDMDLV  KRXYpVVHLV  KRXYHUGHV KDYHL  KDMDLV
KDMDP  KRXYHVVHP  KRXYHUHP KDMDP  KDMDP

57
LÍNGUA PORTUGUESA

HAVER - Formas Nominais

,QÀQLWLYR,PSHVVRDO,QÀQLWLYR3HVVRDO *HU~QGLR 3DUWLFtSLR


KDYHU  KDYHU   KDYHQGR  KDYLGR
   KDYHUHV  
   KDYHU  
   KDYHUPRV  
   KDYHUGHV  
   KDYHUHP  

TER - Modo Indicativo

Presente Pret. Perf. Pret. Imper. Preté.Mais-Que-Perf. Fut. Do Pres. Fut. Do Preté.
7HQKR WLYH  WLQKD  WLYHUD   WHUHL  WHULD
WHQV WLYHVWH  WLQKDV  WLYHUDV   WHUiV  WHULDV
WHP WHYH  WLQKD  WLYHUD   WHUi  WHULD
WHPRV WLYHPRV WtQKDPRV WLYpUDPRV  WHUHPRV WHUtDPRV
WHQGHV WLYHVWHV  WtQKHLV  WLYpUHLV   WHUHLV  WHUtHLV
WrP WLYHUDP  WLQKDP  WLYHUDP   WHUmR  WHULDP

TER - Modo Subjuntivo e Imperativo

3UHVHQWH 3UHWpULWR,PSHUIHLWR )XWXUR  $ÀUPDWLYR 1HJDWLYR


7HQKD WLYHVVH   WLYHU  
WHQKDV WLYHVVHV   WLYHUHV  WHP  WHQKDV
WHQKD WLYHVVH   WLYHU  WHQKD  WHQKD
WHQKDPRV WLYpVVHPRV  WLYHUPRV WHQKDPRV WHQKDPRV
WHQKDLV WLYpVVHLV  WLYHUGHV WHQGH  WHQKDLV
WHQKDP WLYHVVHP  WLYHUHP  WHQKDP  WHQKDP

Pronominais6mRDTXHOHVYHUERVTXHVHFRQMXJDPFRPRVSURQRPHVREOtTXRViWRQRVme, te, se, nos, vos, seQD


PHVPDSHVVRDGRVXMHLWRH[SUHVVDQGRUHÁH[LELOLGDGH SURQRPLQDLVDFLGHQWDLV RXDSHQDVUHIRUoDQGRDLGHLDMiLPSOtFLWDQR
SUySULRVHQWLGRGRYHUER UHÁH[LYRVHVVHQFLDLV 9HMD
(VVHQFLDLVVmRDTXHOHVTXHVHPSUHVHFRQMXJDPFRPRVSURQRPHVREOtTXRVme, te, se, nos, vos, se6mRSRXFRV
abster-se, ater-se, apiedar-se, atrever-se, dignar-se, arrepender-seHWF1RVYHUERVSURQRPLQDLVHVVHQFLDLVDUHÁH[LELOLGDGHMi
HVWiLPSOtFLWDQRUDGLFDOGRYHUER3RUH[HPSORArrependi-me de ter estado lá
$LGHLDpGHTXHDSHVVRDUHSUHVHQWDGDSHORVXMHLWR HX WHPXPVHQWLPHQWR DUUHSHQGLPHQWR TXHUHFDLVREUHHOD
PHVPDSRLVQmRUHFHEHDomRWUDQVLWLYDQHQKXPDYLQGDGRYHUERRSURQRPHREOtTXRiWRQRpDSHQDVXPDSDUWtFXODLQWH-
JUDQWHGRYHUERMiTXHSHORXVRVHPSUHpFRQMXJDGDFRPRYHUER'L]VHTXHRSURQRPHDSHQDVVHUYHGHUHIRUoRGDLGHLD
UHÁH[LYDH[SUHVVDSHORUDGLFDOGRSUySULRYHUER
9HMDXPDFRQMXJDomRSURQRPLQDOHVVHQFLDO YHUERHUHVSHFWLYRVSURQRPHV 
Eu me arrependo
Tu te arrependes
Ele se arrepende
Nós nos arrependemos
Vós vos arrependeis
Eles se arrependem

$FLGHQWDLVVmRDTXHOHVYHUERVWUDQVLWLYRVGLUHWRVHPTXHDDomRH[HUFLGDSHORVXMHLWRUHFDLVREUHRREMHWRUHSUH-
VHQWDGRSRUSURQRPHREOtTXRGDPHVPDSHVVRDGRVXMHLWRDVVLPRVXMHLWRID]XPDDomRTXHUHFDLVREUHHOHPHVPR(P
JHUDORVYHUERVWUDQVLWLYRVGLUHWRVRXWUDQVLWLYRVGLUHWRVHLQGLUHWRVSRGHPVHUFRQMXJDGRVFRPRVSURQRPHVPHQFLRQDGRV
IRUPDQGRRTXHVHFKDPDYR]UHÁH[LYD3RUH[HPSOR Maria se penteava.
$UHÁH[LELOLGDGHpDFLGHQWDOSRLVDDomRUHÁH[LYDSRGHVHUH[HUFLGDWDPEpPVREUHRXWUDSHVVRD3RUH[HPSOR
Maria penteou-me.

Observações
3RUID]HUHPSDUWHLQWHJUDQWHGRYHUERRVSURQRPHVREOtTXRViWRQRVGRVYHUERVSURQRPLQDLVQmRSRVVXHPIXQomR
VLQWiWLFD

58
LÍNGUA PORTUGUESA

+iYHUERVTXHWDPEpPVmRDFRPSDQKDGRVGHSUR-  Particípio TXDQGR QmR p HPSUHJDGR QD IRUPDomR


QRPHVREOtTXRViWRQRVPDVTXHQmRVmRHVVHQFLDOPHQWH GRV WHPSRV FRPSRVWRV R SDUWLFtSLR LQGLFD JHUDOPHQWH R
SURQRPLQDLV VmR RV YHUERV UHÁH[LYRV 1RV YHUERV UHÁH- UHVXOWDGRGHXPDDomRWHUPLQDGDÁH[LRQDQGRVHHPJr-
[LYRVRVSURQRPHVDSHVDUGHVHHQFRQWUDUHPQDSHVVRD QHURQ~PHURHJUDX3RUH[HPSOR
LGrQWLFDjGRVXMHLWRH[HUFHPIXQo}HVVLQWiWLFDV3RUH[HP- Terminados os exames, os candidatos saíram.
SOR
Eu me feri (X VXMHLWR SHVVRDGRVLQJXODUPH 4XDQGR R SDUWLFtSLR H[SULPH VRPHQWH HVWDGR VHP
REMHWRGLUHWR SHVVRDGRVLQJXODU QHQKXPD UHODomR WHPSRUDO DVVXPH YHUGDGHLUDPHQWH D
IXQomRGHDGMHWLYR DGMHWLYRYHUEDO 3RUH[HPSOREla foi a
Modos Verbais aluna escolhida para representar a escola.
'iVH R QRPH GH PRGR jV YiULDV IRUPDV DVVXPLGDV
Tempos Verbais
SHORYHUERQDH[SUHVVmRGHXPIDWR(P3RUWXJXrVH[LV-
WHPWUrVPRGRV
Indicativo  LQGLFD XPD FHUWH]D XPD UHDOLGDGH Eu 7RPDQGRVH FRPR UHIHUrQFLD R PRPHQWR HP TXH VH
sempre estudo. IDODDDomRH[SUHVVDSHORYHUERSRGHRFRUUHUHPGLYHUVRV
Subjuntivo  LQGLFD XPD G~YLGD XPD SRVVLELOLGDGH WHPSRV9HMD
Talvez eu estude amanhã.
Imperativo  LQGLFD XPD RUGHP XP SHGLGR Estuda 1. Tempos do Indicativo
agora, menino.
- Presente  ([SUHVVD XP IDWR DWXDO Eu estudo neste
Formas Nominais colégio.
- Pretérito Imperfeito  ([SUHVVD XP IDWR RFRUULGR
$OpPGHVVHVWUrVPRGRVRYHUERDSUHVHQWDDLQGDIRU- QXPPRPHQWRDQWHULRUDRDWXDOPDVTXHQmRIRLFRPSOH-
PDV TXH SRGHP H[HUFHU IXQo}HV GH QRPHV VXEVWDQWLYR WDPHQWHWHUPLQDGR Ele estudava as lições quando foi inter-
DGMHWLYR DGYpUELR  VHQGR SRU LVVR GHQRPLQDGDV IRUPDV rompido.
QRPLQDLV2EVHUYH - Pretérito Perfeito ([SUHVVDXPIDWRRFRUULGRQXP
,QÀQLWLYR,PSHVVRDOH[SULPHDVLJQLÀFDomRGRYHU- PRPHQWRDQWHULRUDRDWXDOHTXHIRLWRWDOPHQWHWHUPLQDGR
ERGHPRGRYDJRHLQGHÀQLGRSRGHQGRWHUYDORUHIXQomR Ele estudou as lições ontem à noite
GHVXEVWDQWLYR3RUH[HPSOR
Viver é lutar. (= vida é luta)
- Pretérito-Mais-Que-Perfeito  ([SUHVVD XP IDWR
É indispensável combater a corrupção. (= combate à)
RFRUULGRDQWHVGHRXWURIDWRMiWHUPLQDGREle já tinha es-
2LQÀQLWLYRLPSHVVRDOSRGHDSUHVHQWDUVHQRSUHVHQ- tudado as lições quando os amigos chegaram. (forma com-
WH IRUPD VLPSOHV  RX QR SDVVDGR IRUPD FRPSRVWD  3RU posta) Ele já estudara as lições quando os amigos chegaram.
H[HPSOR (forma simples).
É preciso ler este livro.
Era preciso ter lido este livro. - Futuro do Presente   (QXQFLD XP IDWR TXH GHYH
RFRUUHU QXP WHPSR YLQGRXUR FRP UHODomR DR PRPHQWR
 ,QÀQLWLYR 3HVVRDO p R LQÀQLWLYR UHODFLRQDGR jV WUrV DWXDOEle estudará as lições amanhã.
SHVVRDVGRGLVFXUVR1DHSHVVRDVGRVLQJXODUQmR
DSUHVHQWDGHVLQrQFLDVDVVXPLQGRDPHVPDIRUPDGRLP- - Futuro do Pretérito  (QXQFLD XP IDWR TXH SRGH
SHVVRDOQDVGHPDLVÁH[LRQDVHGDVHJXLQWHPDQHLUD RFRUUHU SRVWHULRUPHQWH D XP GHWHUPLQDGR IDWR SDVVDGR
SHVVRDGRVLQJXODU5DGLFDO(6([teres WX Se eu tivesse dinheiro, viajaria nas férias.
SHVVRDGRSOXUDO5DGLFDO026([termos QyV
SHVVRDGRSOXUDO5DGLFDO'(6([terdes YyV 2. Tempos do Subjuntivo
SHVVRDGRSOXUDO5DGLFDO(0([terem HOHV
3RU H[HPSOR Foste elogiado por teres alcançado uma - Presente(QXQFLDXPIDWRTXHSRGHRFRUUHUQRPR-
boa colocação.
PHQWRDWXDOÉ conveniente que estudes para o exame.
- Pretérito Imperfeito  ([SUHVVD XP IDWR SDVVDGR
GerúndioRJHU~QGLRSRGHIXQFLRQDUFRPRDGMHWLYR
RXDGYpUELR3RUH[HPSOR PDVSRVWHULRUDRXWURMiRFRUULGREu esperava que ele ven-
Saindo de casa, encontrei alguns amigos. (função de ad- cesse o jogo
vérbio)
Nas ruas, havia crianças vendendo doces. (função de ObsRSUHWpULWRLPSHUIHLWRpWDPEpPXVDGRQDVFRQV-
adjetivo) WUXo}HVHPTXHVHH[SUHVVDDLGHLDGHFRQGLomRRXGHVHMR
3RU H[HPSOR Se ele viesse ao clube, participaria do cam-
1DIRUPDVLPSOHVRJHU~QGLRH[SUHVVDXPDDomRHP peonato.
FXUVRQDIRUPDFRPSRVWDXPDDomRFRQFOXtGD3RUH[HP-
SOR  Futuro do Presente  (QXQFLD XP IDWR TXH SRGH
Trabalhando, aprenderás o valor do dinheiro. RFRUUHUQXPPRPHQWRIXWXURHPUHODomRDRDWXDOQuando
Tendo trabalhado, aprendeu o valor do dinheiro. ele vier à loja, levará as encomendas.

59
LÍNGUA PORTUGUESA

ObsRIXWXURGRSUHVHQWHpWDPEpPXVDGRHPIUDVHVTXHLQGLFDPSRVVLELOLGDGHRXGHVHMR3RUH[HPSORSe ele vier à


loja, levará as encomendas.
Presente do Indicativo

FRQMXJDomR FRQMXJDomR FRQMXJDomR 'HVLQrQFLDSHVVRDO


&$17$5  9(1'(5 3$57,5
FDQW2  YHQG2  SDUW2  2
FDQWD6  YHQGH6  SDUWH6  6
FDQWD  YHQGH  SDUWH  
FDQWD026  YHQGH026 SDUWL026 026
FDQWD,6  YHQGH,6 SDUW,6  ,6
FDQWD0  YHQGH0 SDUWH0  0

Pretérito Perfeito do Indicativo

FRQMXJDomR FRQMXJDomR FRQMXJDomR 'HVLQrQFLDSHVVRDO


&$17$5  9(1'(5 3$57,5
FDQWH,  YHQG,  SDUW,  ,
FDQWD67(  YHQGH67( SDUW,67( 67(
FDQWR8  YHQGH8  SDUWL8  8
FDQWD026  YHQGH026 SDUWL026 026
FDQWD67(6  YHQGH67(6 SDUW,67(6 67(6
FDQWD5$0  YHQGH5$0 SDUWL5$0 5$0

Pretérito mais-que-perfeito

FRQMXJDomR FRQMXJDomR FRQMXJDomR 'HVWHPSRUDO 'HVLQrQFLDSHVVRDO


       HFRQM
&$17$5  9(1'(5 3$57,5 
FDQWD5$  YHQGH5$ SDUWL5$  5$  ’
FDQWD5$6  YHQGH5$6 SDUWL5$6 5$  6
FDQWD5$  YHQGH5$ SDUWL5$  5$  ’
FDQWi5$026 YHQGr5$026 SDUWt5$026 5$  026
FDQWi5(,6  YHQGr5(,6 SDUWt5(,6 5(  ,6
FDQWD5$0  YHQGH5$0 SDUWL5$0 5$  0

Pretérito Imperfeito do Indicativo

FRQMXJDomR FRQMXJDomR  FRQMXJDomR


&$17$5  9(1'(5  3$57,5
FDQW$9$  YHQG,$   SDUW,$
FDQW$9$6  YHQG,$6  SDUW$6
&DQW$9$  YHQG,$   SDUW,$
FDQWÉ9$026 YHQGÌ$026  SDUWÌ$026
FDQWÉ9(,6  YHQGÌ(,6  SDUWÌ(,6
FDQW$9$0  YHQG,$0  SDUW,$0

Futuro do Presente do Indicativo

FRQMXJDomR FRQMXJDomR FRQMXJDomR


&$17$5  9(1'(5 3$57,5
FDQWDUHL  YHQGHUHL SDUWLUHL
FDQWDUiV  YHQGHUiV SDUWLUiV
FDQWDUi  YHQGHUi SDUWLUi
FDQWDUHPRV  YHQGHUHPRV SDUWLUHPRV
FDQWDUHLV  YHQGHUHLV SDUWLUHLV
FDQWDUmR  YHQGHUmR SDUWLUmR

60
LÍNGUA PORTUGUESA

Futuro do Pretérito do Indicativo

FRQMXJDomR FRQMXJDomR FRQMXJDomR


&$17$5  9(1'(5 3$57,5
FDQWDU,$  YHQGHU,$ SDUWLU,$
FDQWDU,$6  YHQGHU,$6 SDUWLU,$6
FDQWDU,$  YHQGHU,$ SDUWLU,$
FDQWDUÌ$026 YHQGHUÌ$026 SDUWLUÌ$026
FDQWDUÌ(,6  YHQGHUÌ(,6 SDUWLUÌ(,6
FDQWDU,$0  YHQGHU,$0 SDUWLU,$0

Presente do Subjuntivo

3DUDVHIRUPDURSUHVHQWHGRVXEMXQWLYRVXEVWLWXLVHDGHVLQrQFLDRGDSULPHLUDSHVVRDGRVLQJXODUGRSUHVHQWHGR
LQGLFDWLYRSHODGHVLQrQFLD( QRVYHUERVGHFRQMXJDomR RXSHODGHVLQrQFLD$ QRVYHUERVGHHFRQMXJDomR 

FRQMXJ FRQMXJ FRQMX 'HVWHPSRUDO 'HVWHPSRUDO 'HVLQrQSHVVRDO


      FRQM  FRQM
&$17$5 9(1'(5 3$57,5  
FDQW( YHQG$  SDUW$  (  $  ’
FDQW(6 YHQG$6  SDUW$6  (  $  6
FDQW( YHQG$  SDUW$  (  $  ’
FDQW(026 YHQG$026 SDUW$026 (  $  026
FDQW(,6 YHQG$,6 SDUW$,6  (  $  ,6
FDQW(0 YHQG$0 SDUW$0  (  $  0

Pretérito Imperfeito do Subjuntivo

3DUDIRUPDURLPSHUIHLWRGRVXEMXQWLYRHOLPLQDVHDGHVLQrQFLD67(GDSHVVRDGRVLQJXODUGRSUHWpULWRSHUIHLWRRE-
WHQGRVHDVVLPRWHPDGHVVHWHPSR$FUHVFHQWDVHDHVVHWHPDDGHVLQrQFLDWHPSRUDO66(PDLVDGHVLQrQFLDGHQ~PHUR
HSHVVRDFRUUHVSRQGHQWH

FRQMXJDomR FRQMXJDomR  FRQMXJDomR 'HVWHPSRUDO 'HVLQrQFLDSHVVRDO


        HFRQM
&$17$5  9(1'(5  3$57,5 
FDQWD66(  YHQGH66(  SDUWL66( 66(  ’
FDQWD66(6  YHQGH66(6  SDUWL66(6 66(  6
FDQWD66(  YHQGH66(  SDUWL66( 66(  ’
FDQWi66(026 YHQGr66(026  SDUWt66(026 66(  026
FDQWi66(,6  YHQGr66(,6  SDUWt66(,6 66(  ,6
FDQWD66(0  YHQGH66(0  SDUWL66(0 66(  0

Futuro do Subjuntivo

3DUDIRUPDURIXWXURGRVXEMXQWLYRHOLPLQDVHDGHVLQrQFLD67(GDSHVVRDGRVLQJXODUGRSUHWpULWRSHUIHLWRRE-
WHQGRVHDVVLPRWHPDGHVVHWHPSR$FUHVFHQWDVHDHVVHWHPDDGHVLQrQFLDWHPSRUDO5PDLVDGHVLQrQFLDGHQ~PHURH
SHVVRDFRUUHVSRQGHQWH

FRQMXJDomR FRQMXJDomR  FRQMXJDomR  'HVWHPSRUDO 'HVLQrQFLDSHVVRDO


         HFRQM
&$17$5  9(1'(5  3$57,5 
FDQWD5  YHQGH5   SDUWL5   ’
FDQWD5(6  YHQGH5(6  SDUWL5(6  5  (6
FDQWD5  YHQGH5   SDUWL5   5  ’
FDQWD5026  YHQGH5026  SDUWL5026  5  026
FDQWD5'(6  YHQGH5'(6  SDUWL5'(6  5  '(6
FDQWD5(0  YHQGH5(0  3DUWL5(0  5  (0

61
LÍNGUA PORTUGUESA

Modo Imperativo

,PSHUDWLYR$ÀUPDWLYR

3DUDVHIRUPDURLPSHUDWLYRDÀUPDWLYRWRPDVHGRSUHVHQWHGRLQGLFDWLYRDSHVVRDGRVLQJXODU WX HDVHJXQGD
SHVVRDGRSOXUDO YyV HOLPLQDQGRVHR´6µÀQDO$VGHPDLVSHVVRDVYrPVHPDOWHUDomRGRSUHVHQWHGRVXEMXQWLYR9HMD

3UHVHQWHGR,QGLFDWLYR ,PSHUDWLYR$ÀUPDWLYR 3UHVHQWHGR6XEMXQWLYR


(XFDQWR      4XHHXFDQWH
7XFDQWDV   &DQW$WX  4XHWXFDQWHV
(OHFDQWD   &DQWHYRFr  4XHHOHFDQWH
1yVFDQWDPRV  &DQWHPRVQyV  4XHQyVFDQWHPRV
9yVFDQWDLV   &DQW$,YyV  4XHYyVFDQWHLV
(OHVFDQWDP   &DQWHPYRFrV  4XHHOHVFDQWHP

Imperativo Negativo

3DUDVHIRUPDURLPSHUDWLYRQHJDWLYREDVWDDQWHFLSDUDQHJDomRjVIRUPDVGRSUHVHQWHGRVXEMXQWLYR

Presente do Subjuntivo Imperativo Negativo


4XHHXFDQWH  
4XHWXFDQWHV  1mRFDQWHVWX
4XHHOHFDQWH  1mRFDQWHYRFr
4XHQyVFDQWHPRV  1mRFDQWHPRVQyV
4XHYyVFDQWHLV  1mRFDQWHLVYyV
4XHHOHVFDQWHP  1mRFDQWHPHOHV

Observações:

1RPRGRLPSHUDWLYRQmRID]VHQWLGRXVDUQDSHVVRD VLQJXODUHSOXUDO DVIRUPDVHOHHOHVSRLVXPDRUGHPSHGLGR


RXFRQVHOKRVyVHDSOLFDPGLUHWDPHQWHjSHVVRDFRPTXHPVHIDOD3RUHVVDUD]mRXWLOL]DVHYRFrYRFrV
2YHUER6(5QRLPSHUDWLYRID]H[FHSFLRQDOPHQWHsê (tu), sede (vós).

,QÀQLWLYR3HVVRDO

FRQMXJDomR FRQMXJDomR  FRQMXJDomR


&$17$5  9(1'(5  3$57,5
FDQWDU  YHQGHU   SDUWLU
FDQWDU(6  YHQGHU(6  SDUWLU(6
FDQWDU  YHQGHU   SDUWLU
FDQWDU026  YHQGHU026  SDUWLU026
FDQWDU'(6  YHQGHU'(6  SDUWLU'(6
FDQWDU(0  YHQGHU(0  SDUWLU(0

Questões sobre Verbo

 $*(17(32/Ì&,$-981(63 &RQVLGHUHRWUHFKRDVHJXLU


É comum que objetos ___________ esquecidos em locais públicos. Mas muitos transtornos poderiam ser evitados se as pes-
soas _____________ a atenção voltada para seus pertences, conservando-os junto ao corpo.
$VVLQDOHDDOWHUQDWLYDTXHSUHHQFKHFRUUHWDHUHVSHFWLYDPHQWHDVODFXQDVGRWH[WR
$ VHMDP¬PDQWHVVH
% VHMDP¬PDQWLYHVVHP
& VHMDP¬PDQWpP
' VHMD¬PDQWLYHVVHP
( VHMD¬PDQWrP

 0*67e&1,&2&217É%,/²,%)&DGDSWDGD
(P´$VVLPPXLWRVFDVDLVtêmTXDWURVHLVGH]ÀOKRVµQRWDVHTXHRDFHQWRGRYHUERHPGHVWDTXHGHYHVHDXPD
H[LJrQFLDGHFRQFRUGkQFLD$VVLQDOHDDOWHUQDWLYDFRUUHWDHPUHODomRDRHPSUHJRGHVVHPHVPRYHUER

62
LÍNGUA PORTUGUESA

D 1R%UDVLODVRFLHGDGHWrPYiULDVTXHVW}HV  3$3,/26&23,67$32/,&,$/981(63DGDS 


E 2MRYHPWrPXPJUDQGHGHVDÀRSHODIUHQWH $VVLQDOHDDOWHUQDWLYDTXHVXEVWLWXLFRUUHWDPHQWHHVHPDO-
F $VSHVVRDVWHPPXLWRVSODQRV WHUDURVHQWLGRGDIUDVHDH[SUHVVmRGHVWDFDGDHP²Se a
G $PHQWLUDWHPSHUQDFXUWD criança se perder,TXHPHQFRQWUiODYHUiQDSXOVHLUDLQV-
WUXo}HVSDUDTXHHQYLHXPDPHQVDJHPHOHWU{QLFDDRJUX-
 (6&5(9(17( 7- 63 981(63 DGDS  Sem SRRXDFLRQHRFyGLJRQDLQWHUQHW
querer estereotipar, mas já estereotipando: trata-se de um $ &DVRDFULDQoDVHKDYLDSHUGLGR¬
ser cujas interações sociais terminam, 99% das vezes, diante % &DVRDFULDQoDSHUGHX¬
& &DVRDFULDQoDVHSHUFD¬
da pergunta “débito ou crédito?µ
1HVVHFRQWH[WRRYHUERHVWHUHRWLSDUWHPVHQWLGRGH
' &DVRDFULDQoDHVWLYHUDSHUGLGD¬
$ FRQVLGHUDUDRDFDVRVHPSUHPHGLWDomR
( &DVRDFULDQoDVHSHUGD¬
%  DFHLWDU XPD LGHLD PHVPR VHP HVWDU FRQYHQFLGR
GHOD
& DGRWDUFRPRUHIHUrQFLDGHTXDOLGDGH  $*(17( '( $32,2 23(5$&,21$/ ²981(63²
' MXOJDUGHDFRUGRFRPQRUPDVOHJDLV DGDS $VVLQDOHDDOWHUQDWLYDHPTXHRYHUERGHVWD-
( FODVVLÀFDUVHJXQGRLGHLDVSUHFRQFHELGDV FDGRHVWiQRWHPSRIXWXUR
$ 2VFRQVXPLGRUHVsãoDVVHGLDGRVSHORPDUNHWLQJ¬
 (6&5(9(17(7-63981(63 $VVLQDOHDDO- % ¬VRPHQWHHOHVSRGHPGHFLGLUVHirãoRXQmRFRP-
WHUQDWLYD FRQWHQGR D IUDVH GR WH[WR QD TXDO D H[SUHVVmR SUDU
YHUEDOGHVWDFDGDH[SULPHSRVVLELOLGDGH & eFRPRVHabrissem HPQyVXPD´FDL[DGHQHFHV-
$ RFLHQWLVWD7KHRGRU1HOVRQsonhavaFRPXPVLV- VLGDGHVµ¬
WHPDFDSD]GHGLVSRQLELOL]DUXPJUDQGHQ~PHURGHREUDV ' ¬GHRQGHvem RSURGXWR¬"
OLWHUiULDV ( 8PDSHVTXLVDmostrouTXHGDVSHVVRDV¬
% )XQFLRQDQGRFRPRXPLPHQVRVLVWHPDGHLQIRUPD-
omRHDUTXLYDPHQWRRKLSHUWH[WRdeveria VHUXPHQRUPH  $*(5%$  7e&1,&2 (0 5(*8/$d®2 ² ,%)&
DUTXLYRYLUWXDO DGDSWDGD
&  ,VVR DFDUUHWD XPD WH[WXDOLGDGH TXH funciona SRU $ ÁH[mR GH DOJXQV YHUERV VREUHWXGR RV LUUHJXODUHV
DVVRFLDomR H QmR PDLV SRU VHTXrQFLDV À[DV SUHYLDPHQWH SRGHFDXVDUFRQIXVmR2YHUER´TXLVµSUHVHQWHHP´Minha
HVWDEHOHFLGDV
mãe sempre quis viajarµpXPH[HPSORWtSLFR1HVVHVHQ-
'  'HVGH R VXUJLPHQWR GD LGHLD GH KLSHUWH[WR HVVH
WLGR DVVLQDOH D DOWHUQDWLYD HP TXH VH LQGLFD ,1&255(7$-
FRQFHLWR está ligado D XPD QRYD FRQFHSomR GH WH[WXDOL-
GDGH 0(17(DVXDÁH[mR
( CriouHQWmRR´;DQDGXµXPSURMHWRSDUDGLVSRQL- D TXHUHV²3UHVHQWHGR,QGLFDWLYR
ELOL]DUWRGDDOLWHUDWXUDGRPXQGR E TXHULD²)XWXURGR3UHWpULWRGR,QGLFDWLYR
F TXLVHUD²3UHWpULWRPDLVTXHSHUIHLWRGR,QGLFDWLYR
 32/Ì&,$0,/,7$5'2(67$'2'2$&5(²$/812 G TXHLUD²3UHVHQWHGR6XEMXQWLYR
62/'$'2 &20%$7(17( ² )81&$%  1R WUHFKR ´O H TXLVHVVH²3UHWpULWR,PSHUIHLWRGR6XEMXQWLYR
crescimento econômico, se associado à ampliação do empre-
go, PODE melhorar o quadro aqui sumariamente descrito.”,  $*(17( '( (6&2/7$ ( 9,*,/Ç1&,$ 3(1,7(1-
VHSDVVDUPRVRYHUERGHVWDFDGRSDUDRIXWXURGRSUHWpULWR &,É5,$²981(63²DGDS /HLDDVIUDVHVDVHJXLU
GRLQGLFDWLYRWHUHPRVDIRUPD I. Havia onze pessoas jogando pedras e pedaços de ma-
$ SXGHU deira no animal.
% SRGHULD II. Existiam muitos ferimentos no boi.
& S{GH III. Havia muita gente assustando o boi numa avenida
' SRGHUi movimentada.
( SXGHVVH
6XEVWLWXLQGRVHRYHUERHaverSHORYHUERExistirHHVWH
 (6&5(9(17(7-63981(63 $VVLQDOHDDO-
SHORYHUERHaver,QDVIUDVHVWrPVHUHVSHFWLYDPHQWH
WHUQDWLYD HP TXH WRGRV RV YHUERV HVWmR HPSUHJDGRV GH
$ ([LVWLD²+DYLDP²([LVWLDP
DFRUGRFRPDQRUPDSDGUmR
% ([LVWLDP²+DYLD²([LVWLDP
$ (QYLDUDPRWH[WRSDUDTXHRUHYtVVHPRVDQWHVGD
LPSUHVVmRGHÀQLWLYD & ([LVWLDP²+DYLDP²([LVWLDP
% 1mRKDYHUiSURYDGRFULPHVHRUpXVHPDQWHUHP ' ([LVWLDP²+DYLD²([LVWLD
VLOrQFLR ( ([LVWLD²+DYLD²([LVWLD
& 9mRSDJDUKRUDVH[WUDVDRVTXHVHGLVSRUHPDWUD-
EDOKDUQRIHULDGR GABARITO
' )LFDUmRVXUSUHVRVTXDQGRRYHUHPFRPDWRJD
( 6HYRFrTXHUDSURPRomRpQHFHVViULRTXHDUHTXH- 01. B 02. D 03. E 04. B 05. B
UDDVHXVXSHULRU 06. A 07. C 08. B09. B10. D

63
LÍNGUA PORTUGUESA

RESOLUÇÃO  
9DPRVDRVLWHQV
  D TXHUHV²3UHVHQWHGR,QGLFDWLYR HXTXHURWXTXH-
eFRPXPTXHREMHWRVVHMDPHVTXHFLGRVHPORFDLV UHVFRUUHWD
S~EOLFRV0DVPXLWRVWUDQVWRUQRVSRGHULDPVHUHYLWDGRVVH E TXHULD²)XWXURGR3UHWpULWRGR,QGLFDWLYR HXTXH-
DV SHVVRDV   PDQWLYHVVHP   D DWHQomR YROWDGD SDUD VHXV UHULDWXTXHUHULDVHOHTXHUHULDLQFRUUHWD
SHUWHQFHVFRQVHUYDQGRRVMXQWRDRFRUSR F TXLVHUD²3UHWpULWRPDLVTXHSHUIHLWRGR,QGLFDWLYR 
HXTXLVHUDHOHTXLVHUD²FRUUHWD
  G  TXHLUD ² 3UHVHQWH GR 6XEMXQWLYR  TXH HX TXHLUD
$QDOLVHPRV TXHWXTXHLUDVTXHHOHTXHLUDFRUUHWD
D 1R%UDVLODVRFLHGDGHWrPYiULDVTXHVW}HV DVR- H TXLVHVVH²3UHWpULWR,PSHUIHLWRGR6XEMXQWLYR VHHX
FLHGDGHWHP YHUERQRVLQJXODU TXLVHVVHVHWXTXLVHVVHVVHHOHTXLVHVVH²FRUUHWD
E  2 MRYHP WrP XP JUDQGH GHVDÀR SHOD IUHQWH  R 5(63267$%
MRYHPWHP YHUERQRVLQJXODU
F  $V SHVVRDV WHP PXLWRV SODQRV  DV SHVVRDV WrP  
YHUERQRSOXUDO , +DYLD RQ]H SHVVRDV MRJDQGR SHGUDV H SHGDoRV GH
G $PHQWLUDWHPSHUQDFXUWD FRUUHWD PDGHLUDQRDQLPDO
5(63267$' ,,([LVWLDPPXLWRVIHULPHQWRVQRERL
,,,+DYLDPXLWDJHQWHDVVXVWDQGRRERLQXPDDYHQLGD
  PRYLPHQWDGD
6HPTXHUHUHVWHUHRWLSDUPDVMiHVWHUHRWLSDQGRWUDWD Haver²VHQWLGRGHH[LVWLU LQYDULiYHOLPSHVVRDO
VH GH XP VHU FXMDV LQWHUDo}HV VRFLDLV WHUPLQDP  GDV existir YDULiYHO3RUWDQWRWHPRV
YH]HVGLDQWHGDSHUJXQWD´GpELWRRXFUpGLWR"µ ,²([LVWLDPRQ]HSHVVRDV
1HVVH FRQWH[WR R YHUER HVWHUHRWLSDU WHP VHQWLGR GH ,,²+DYLDPXLWRVIHULPHQWRV
FODVVLÀFDUVHJXQGRLGHLDVSUHFRQFHELGDV ,,,²([LVWLDPXLWDJHQWH

 Vozes do Verbo
% )XQFLRQDQGRFRPRXPLPHQVRVLVWHPDGHLQIRUPD-
omRHDUTXLYDPHQWRRKLSHUWH[WRGHYHULDVHUXPHQRUPH 'iVH R QRPH GH YR] j IRUPD DVVXPLGD SHOR YHUER
DUTXLYRYLUWXDO YHUERQRIXWXURGRSUHWpULWR SDUDLQGLFDUVHRVXMHLWRJUDPDWLFDOpDJHQWHRXSDFLHQWH
GDDomR6mRWUrVDVYR]HVYHUEDLV
 
&RQMXJDQGRRYHUER´SRGHUµQRIXWXURGRSUHWpULWRGR - Ativa: TXDQGR R VXMHLWR p DJHQWH LVWR p SUDWLFD D
,QGLFDWLYRHXSRGHULDWXSRGHULDVHOHSRGHULDQyVSRGH- DomRH[SUHVVDSHORYHUER3RUH[HPSOR
UtDPRVYyVSRGHUtHLVHOHVSRGHULDP2VXMHLWRGDRUDomR Ele fez o trabalho
pFUHVFLPHQWRHFRQ{PLFR VLQJXODU SRUWDQWRWHUFHLUDSHV- VXMHLWRDJHQWH DomR  REMHWR SDFLHQWH
VRDGRVLQJXODU HOH  SRGHULD
- Passiva TXDQGR R VXMHLWR p SDFLHQWH UHFHEHQGR D
  DomRH[SUHVVDSHORYHUER3RUH[HPSOR
% 1mRKDYHUiSURYDGRFULPHVHRUpXVHPDQWLYHUHP O trabalho foi feito por ele.
VLOrQFLR VXMHLWRSDFLHQWH DomR  DJHQWHGDSDVVLYD
&  9mR SDJDU KRUDVH[WUDV DRV TXH VH GLVSXVHUHP D
WUDEDOKDUQRIHULDGR - 5HÁH[LYDTXDQGRRVXMHLWRpDRPHVPRWHPSRDJHQ-
' )LFDUmRVXUSUHVRVTXDQGRRYLUHPFRPDWRJD WHHSDFLHQWHLVWRpSUDWLFDHUHFHEHDDomR3RUH[HPSOR
( 6HYRFrTXLVHUDSURPRomRpQHFHVViULRTXHDUH- O menino feriu-se
TXHLUDDVHXVXSHULRU
ObsQmRFRQIXQGLURHPSUHJRUHÁH[LYRGRYHUERFRP
  DQRomRGHUHFLSURFLGDGHOs lutadores feriram-se. XPDR
&DVRDFULDQoDVHSHUFD¬ perda VXEVWDQWLYR+RXYH RXWUR
XPDJUDQGHSHUGDVDODULDO
Formação da Voz Passiva
 
$ 2VFRQVXPLGRUHVVmRDVVHGLDGRVSHORPDUNHWLQJ  $ YR] SDVVLYD SRGH VHU IRUPDGD SRU GRLV SURFHVVRV
SUHVHQWH DQDOtWLFRHVLQWpWLFR
& eFRPRVHDEULVVHPHPQyVXPD´FDL[DGHQHFHVVL- 1- Voz Passiva Analítica
GDGHVµ¬ SUHWpULWRGR6XEMXQWLYR &RQVWUyLVHGDVHJXLQWHPDQHLUD9HUER6(5SDUWLFt-
' ¬GHRQGHYHPRSURGXWR¬" SUHVHQWH SLRGRYHUERSULQFLSDO3RUH[HPSOR
( 8PDSHVTXLVDPRVWURXTXHGDVSHVVRDV¬  A escola será pintada.
SUHWpULWRSHUIHLWR O trabalho é feito por ele.

64
LÍNGUA PORTUGUESA

ObsRDJHQWHGDSDVVLYDJHUDOPHQWHpDFRPSDQKDGR 2EVHUYHTXHRREMHWRGLUHWRVHUiRVXMHLWRGDSDVVLYD
GDSUHSRVLomRporPDVSRGHRFRUUHUDFRQVWUXomRFRPD RVXMHLWRGDDWLYDSDVVDUiDDJHQWHGDSDVVLYDHRYHUERDWL-
SUHSRVLomRde3RUH[HPSOR$FDVDÀFRXFHUFDGDGHVROGD- YRDVVXPLUiDIRUPDSDVVLYDFRQVHUYDQGRRPHVPRWHP-
dos SR2EVHUYHPDLVH[HPSORV
 3RGH DFRQWHFHU DLQGD TXH R DJHQWH GD SDVVLYD QmR - Os mestres têm constantemente aconselhado os alu-
HVWHMDH[SOtFLWRQDIUDVHA exposição será aberta amanhã. nos.
 $ YDULDomR WHPSRUDO p LQGLFDGD SHOR YHUER DX[LOLDU Os alunos têm sido constantemente aconselhados pelos
6(5 SRLVRSDUWLFtSLRpLQYDULiYHO2EVHUYHDWUDQVIRUPD- mestres.
omRGDVIUDVHVVHJXLQWHV
D Ele fez o trabalho SUHWpULWRSHUIHLWRGRLQGLFDWLYR - Eu o acompanharei.
O trabalho foi feito por ele SUHWpULWRSHUIHLWRGRLQGL- Ele será acompanhado por mim.
FDWLYR
ObsTXDQGRRVXMHLWRGDYR]DWLYDIRULQGHWHUPLQDGR
QmRKDYHUiFRPSOHPHQWRDJHQWHQDSDVVLYD3RUH[HPSOR
E Ele faz o trabalho SUHVHQWHGRLQGLFDWLYR
Prejudicaram-me. / Fui prejudicado.
O trabalho é feito por ele SUHVHQWHGRLQGLFDWLYR
Saiba que:
F Ele fará o trabalho. IXWXURGRSUHVHQWH $RVYHUERVTXHQmRVmRDWLYRVQHPSDVVLYRVRXUHÁH-
O trabalho será feito por ele IXWXURGRSUHVHQWH [LYRVVmRFKDPDGRVQHXWURV
O vinho é bom.
1DVIUDVHVFRPORFXo}HVYHUEDLVRYHUER6(5DVVXPH Aqui chove muito.
RPHVPRWHPSRHPRGRGRYHUERSULQFLSDOGDYR]DWLYD
2EVHUYHDWUDQVIRUPDomRGDIUDVHVHJXLQWH +iIRUPDVSDVVLYDVFRPVHQWLGRDWLYR
O vento ia levando as folhas JHU~QGLR É chegada a hora. (= Chegou a hora.)
As folhas iam sendo levadas pelo vento. JHU~QGLR Eu ainda não era nascido. (= Eu ainda não tinha nas-
cido.)
Obs p PHQRV IUHTXHQWH D FRQVWUXomR GD YR] SDVVL- És um homem lido e viajado. (= que leu e viajou)
YDDQDOtWLFDFRPRXWURVYHUERVTXHSRGHPHYHQWXDOPHQWH
IXQFLRQDUFRPRDX[LOLDUHV3RUH[HPSOR$PRoDÀFRXPDU-  ,QYHUVDPHQWH XVDPRV IRUPDV DWLYDV FRP VHQWLGR
cada pela doença. SDVVLYR
Há coisas difíceis de entender. (= serem entendidas)
2- Voz Passiva Sintética Mandou-o lançar na prisão. (= ser lançado)

$YR]SDVVLYDVLQWpWLFDRXSURQRPLQDOFRQVWUyLVHFRP 2VYHUERVchamar-se, batizar-se, operar-se QRVHQWLGR


RYHUERQDSHVVRDVHJXLGRGRSURQRPHDSDVVLYDGRU6( FLU~UJLFR  H vacinar-se VmR FRQVLGHUDGRV SDVVLYRV ORJR R
3RUH[HPSOR VXMHLWRpSDFLHQWH
Abriram-se as inscrições para o concurso. Chamo-me Luís.
Destruiu-se o velho prédio da escola. Batizei-me na Igreja do Carmo.
ObsRDJHQWHQmRFRVWXPDYLUH[SUHVVRQDYR]SDVVLYD Operou-se de hérnia.
VLQWpWLFD Vacinaram-se contra a gripe.
&XULRVLGDGH$SDODYUDpassivoSRVVXLDPHVPDUDL]OD-
)RQWH
WLQDGHSDL[mR ODWLPpassio, passionis HDPEDVVHUHODFLR-
KWWSZZZVRSRUWXJXHVFRPEUVHFRHVPRUIPRUI
QDPFRPRVLJQLÀFDGRVRIULPHQWRSDGHFLPHQWR'DtYHP
SKS
RVLJQLÀFDGRGHYR]SDVVLYDFRPRVHQGRDYR]TXHH[SUHV-
Questões sobre Vozes dos Verbos
VDDDomRVRIULGDSHORVXMHLWR1DYR]SDVVLYDWHPRVGRLV
HOHPHQWRVTXHQHPVHPSUHDSDUHFHP68-(,723$&,(17(  &2/e*,2 3('52 ,,5- ² $66,67(17( (0 $'0,-
H$*(17('$3$66,9$ 1,675$d®2²$2&3 (P´Os dados foram divulgados
ontem pelo Instituto Sou da Paz.”DH[SUHVVmRGHVWDFDGDp
Conversão da Voz Ativa na Voz Passiva $ DGMXQWRDGQRPLQDO
% VXMHLWRSDFLHQWH
3RGHVHPXGDUDYR]DWLYDQDSDVVLYDVHPDOWHUDUVXEV- & REMHWRLQGLUHWR
WDQFLDOPHQWHRVHQWLGRGDIUDVH ' FRPSOHPHQWRQRPLQDO
Gutenberg inventou a imprensa 9R]$WLYD ( DJHQWHGDSDVVLYD
6XMHLWRGD$WLYD REMHWR'LUHWR
  )&&&23(5*É6²$8;,/,$57e&1,&2$'0,1,6-
A imprensa foi inventada por Gutenberg  9R]3DV- 75$7,92 Um dia um tufão furibundo abateu-o pela
VLYD raiz7UDQVSRQGRVHDIUDVHDFLPDSDUDDYR]SDVVLYD
6XMHLWRGD3DVVLYD $JHQWHGD3DVVLYD DIRUPDYHUEDOUHVXOWDQWHVHUi

65
LÍNGUA PORTUGUESA

$ HUDDEDWLGR  *29(512 '2 (67$'2 '2 5,2 '( -$1(,52 ²


% IRUDDEDWLGR 352&21 ² $*(17( $'0,1,675$7,92 ² &(3(5- 
& DEDWHUDVH DGDSWDGD 8PH[HPSORGHFRQVWUXomRQDYR]SDVVLYDHVWi
' IRLDEDWLGR HP
( WLQKDDEDWLGR $ ´$*XOOLYHUUHFROKHUiPLOEULQTXHGRVµ
%  ´R FRQVXPLGRU SRGH VROLFLWDU D GHYROXomR GR GL-
 75($/²7e&1,&2-8',&,É5,2²)&& QKHLURµ
 valores e princípios que sejam percebidos pela socie- & ´HQYLDUREULQTXHGRSRUVHGH[µ
dade como tais '  ´$ HPSUHVD WDPEpP p REULJDGD SHOR &yGLJR GH
7UDQVSRQGRSDUDDYR]DWLYDDIUDVHDFLPDRYHUERSDV- 'HIHVDGR&RQVXPLGRUµ
VDUiDVHUFRUUHWDPHQWH ( ´$HPSUHVDIH]FDPSDQKDSDUDUHFROKHUµ
$ SHUFHED
% IRLSHUFHELGR  0(75Ñ63 ²6(&5(7É5,$ 3/(12 ² )&& 
& WHQKDPSHUFHELGR 7UDQVSRQGRVHSDUDDYR]SDVVLYDDFRQVWUXomRMais tarde
' GHYDPSHUFHEHU vim a entender a tradução completa,DIRUPDYHUEDOUHVXO-
( HVWDYDSHUFHEHQGR WDQWHVHUi
$ YHLRDVHUHQWHQGLGD
 7-5- ² 7e&1,&2 '( $7,9,'$'( -8',&,É5,$ 6(0 % WHULDHQWHQGLGR
(63(&,$/,'$'( ² )&&  As ruas estavam ocupadas & IRUDHQWHQGLGD
pela multidão... ' WHUiVLGRHQWHQGLGD
$IRUPDYHUEDOUHVXOWDQWHGDWUDQVSRVLomRGDIUDVHDFL- ( WrODLDHQWHQGLGR
PDSDUDDYR]DWLYDp
$ RFXSDYDVH  ,1)5$(52²&$'$67525(6(59$23(5$&,21$/
% RFXSDYDP 352),66,21$/ '( 75É)(*2 $e5(2 ² )&&  $'$3-
& RFXSRX 7$'$ 
' RFXSD  ele empreende, de maneira quase clandestina, a série
( RFXSDYD
Mulheres.
7UDQVSRQGRVHDIUDVHDFLPDSDUDDYR]SDVVLYDDIRU-
 75)5(*,®27e&1,&2-8',&,É5,2)&& 
PDYHUEDOUHVXOWDQWHVHUi
$ IUDVH TXH 1®2 DGPLWH WUDQVSRVLomR SDUD D YR] SDVVLYD
$ IRLHPSUHHQGLGD
HVWiHP
% VmRHPSUHHQGLGRV
$ 4XDQGR5RGROIRVXUJLX
& IRLHPSUHHQGLGR
% DGTXLULXDVLPSUHVVRUDV
' pHPSUHHQGLGD
& HVXVWHQWDUjVYH]HVIDPtOLDQXPHURVD
( VmRHPSUHHQGLGDV
' DFROKHXRFRPRSDWURQR
( TXHPRQWRX>@DSULPHLUDJUDQGHIROKHWDULDGR
5HFLIH GABARITO

 75)   5(*,®2 ² 7e&1,&2 -8',&,É5,2 ² 01. E 02. D 03. A 04. E 05. A
)&&  O engajamento moral e político não chegou a 06. B 07. C 08. D 09. A 10. D
constituir um deslocamento da atenção intelectual de Said ...
7UDQVSRQGRVHDIUDVHDFLPDSDUDDYR]SDVVLYDDIRU- RESOLUÇÃO
PDYHUEDOUHVXOWDQWHp
D VHFRQVWLWXLX  
E FKHJRXDVHUFRQVWLWXtGR 1R HQXQFLDGR WHPRV XPD RUDomR FRP D YR] SDVVLYD
F WHULDFKHJDGRDFRQVWLWXLU GRYHUER7UDQVIRUPDQGRDHPDWLYDWHUHPRV´2,QVWLWXWR
G FKHJDDVHFRQVWLWXLU 6RXGD3D]GLYXOJRXGDGRVµ1HVVD´,QVWLWXWR6RXGD3D]µ
H FKHJDULDDVHUFRQVWLWXtGR IXQFLRQD FRPR VXMHLWR GD RUDomR RX VHMD QD SDVVLYD VXD
IXQomRpDGHDJHQWHGDSDVVLYD2VXMHLWRSDFLHQWHp´RV
 0(75Ñ63²7e&1,&26,67(0$60(7529,É5,26 GDGRVµ
&,9,/²)&&$'$37$'$ .’sertanejo’ indicava indis-  
tintamente as músicas produzidas no interior do país.. 8P GLD XP WXImR IXULEXQGR DEDWHXR SHOD UDL]  (OH
7UDQVSRQGRVHDIUDVHDFLPDSDUDDYR]SDVVLYDDIRU- IRLDEDWLGR
PDYHUEDOUHVXOWDQWHVHUi
$ YLQKDPLQGLFDGDV 
% HUDLQGLFDGR YDORUHVHSULQFtSLRVTXHVHMDPSHUFHELGRVSHODVR-
& HUDPLQGLFDGDV FLHGDGHFRPRWDLV GRLVYHUERVQDYR]SDVVLYDHQWmRWH-
' WLQKDLQGLFDGR UHPRVXPQDDWLYDTXHDVRFLHGDGHSHUFHEDRVYDORUHVH
( IRLLQGLFDGD SULQFtSLRV

66
LÍNGUA PORTUGUESA

  ([HPSORGHFRQMXJDomRGRYHUER´GDUµQRSUHVHQWHGR
$VUXDVHVWDYDPRFXSDGDVSHODPXOWLGmR GRLVYHUERV LQGLFDWLYR
QDSDVVLYDXPYHUERQDDWLYD Eu dou
$PXOWLGmRRFXSDYDDVUXDV Tu dás
Ele dá
  Nós damos
% DVLPSUHVVRUDVIRUDPDGTXLULGDV Vós dais
& IDPtOLDQXPHURVDpVXVWHQWDGD Eles dão
'²IRLDFROKLGRFRPRSDWURQR
(²DSULPHLUDJUDQGHIROKHWDULDGR5HFLIHIRLPRQWDGD 3HUFHEHVH TXH Ki DOWHUDomR GR UDGLFDO DIDVWDQGRVH
GRRULJLQDO´GDUµGXUDQWHDFRQMXJDomRVHQGRFRQVLGHUDGR
  YHUERLUUHJXODU
2HQJDMDPHQWRPRUDOHSROtWLFRQmRFKHJRXDFRQVWL-
WXLUXPGHVORFDPHQWRGDDWHQomRLQWHOHFWXDOGH6DLG GRLV ([HPSOR&RQMXJDomRGRYHUERYDOHU
YHUERV QD YR] DWLYD PDV FRP SUHVHQoD GH SUHSRVLomR H
XPGHOHVQRLQÀQLWLYRHQWmRRYHUERDX[LOLDU´VHUµÀFDUiQR Modo Indicativo
LQÀQLWLYR QDYR]SDVVLYD HRYHUERSULQFLSDO FRQVWLWXLU À-
FDUiQRSDUWLFtSLR8PGHVORFDPHQWRGDDWHQomRLQWHOHFWXDO Presente
GH6DLGQmRFKHJRXDVHUFRQVWLWXtGRSHORHQJDMDPHQWR eu valho
tu vales
 ele vale
·VHUWDQHMR·LQGLFDYDLQGLVWLQWDPHQWHDVP~VLFDVSURGX- nós valemos
]LGDVQRLQWHULRUGRSDtV vós valeis
$V P~VLFDV SURGX]LGDV QR SDtV HUDP LQGLFDGDV SHOR eles valem
VHUWDQHMRLQGLVWLQWDPHQWH
Pretérito Perfeito do Indicativo
 
eu vali
$ ´$*XOOLYHUUHFROKHUiPLOEULQTXHGRVµ YR]DWLYD
tu valeste
%  ´R FRQVXPLGRU SRGH VROLFLWDU D GHYROXomR GR GL-
ele valeu
QKHLURµ YR]DWLYD
nós valemos
& ´HQYLDUREULQTXHGRSRUVHGH[µ YR]DWLYD
vós valestes
'  ´$ HPSUHVD WDPEpP p REULJDGD SHOR &yGLJR GH
eles valeram
'HIHVDGR&RQVXPLGRUµ YR]SDVVLYD
( ´$HPSUHVDIH]FDPSDQKDSDUDUHFROKHUµ YR]DWLYD
Pretérito Imperfeito do Indicativo
 eu valia
0DLVWDUGHYLPDHQWHQGHUDWUDGXomRFRPSOHWD tu valias
$WUDGXomRFRPSOHWDYHLRDVHUHQWHQGLGDSRUPLP ele valia
nós valíamos
  vós valíeis
HOHHPSUHHQGHGHPDQHLUDTXDVHFODQGHVWLQDDVpULH eles valiam
0XOKHUHV
$VpULHGHPXOKHUHVpHPSUHHQGLGDSRUHOHGHPDQHLUD Pretérito Mais-que-perfeito do Indicativo
TXDVHFODQGHVWLQD eu valera
tu valeras
ele valera
nós valêramos
vós valêreis
Verbos irregularesVmRYHUERVTXHVRIUHPDOWHUDo}HV eles valeram
HP VHX UDGLFDO RX HP VXDV GHVLQrQFLDV DIDVWDQGRVH GR
PRGHORDTXHSHUWHQFHP Futuro do Presente do Indicativo
1RSRUWXJXrVSDUDYHULÀFDUVHXPYHUERVRIUHDOWHUD- eu valerei
o}HVEDVWDFRQMXJiORQRSUHVHQWHHQRSUHWpULWRSHUIHLWR tu valerás
GRLQGLFDWLYR([IDoR²À]WUDJR²WURX[HSRVVRSXGH ele valerá
1mR p FRQVLGHUDGD LUUHJXODULGDGH D DOWHUDomR JUiÀFD nós valeremos
GRUDGLFDOGHFHUWRVYHUERVSDUDFRQVHUYDomRGDUHJXODUL- vós valereis
GDGHI{QLFD([embarcar ²HPEDUFRÀQJLU²ÀQMR eles valerão

67
LÍNGUA PORTUGUESA

Futuro do Pretérito do Indicativo ,QÀQLWLYR


eu valeria
tu valerias ,QÀQLWLYR3HVVRDO
ele valeria por valer eu
nós valeríamos por valeres tu
vós valeríeis por valer ele
eles valeriam por valermos nós
por valerdes vós
Mais-que-perfeito Composto do Indicativo por valerem eles
eu tinha valido
tu tinhas valido ,QÀQLWLYR,PSHVVRDO valer
ele tinha valido Particípio Valido
nós tínhamos valido
vós tínheis valido $FRPSDQKHDEDL[RXPDOLVWDFRPRVSULQFLSDLVYHUERV
eles tinham valido LUUHJXODUHV

GerúndioGRYHUERYDOHU valendo Dizer


Presente do indicativo: Digo, dizes, diz, dizemos, di-
Modo Subjuntivo zeis, dizem.
Presente
que eu valha Pretérito perfeito do indicativo: Disse, disseste, disse,
que tu valhas dissemos, dissestes, disseram.
que ele valha
que nós valhamos Futuro do presente do indicativo: Direi, dirás, dirá,
diremos, direis, dirão.
que vós valhais
Fazer
que eles valham
Presente do indicativo: Faço, fazes, faz, fazemos, fa-
zeis, fazem.
Pretérito Imperfeito do Subjuntivo
se eu valesse
Pretérito perfeito do indicativo: )L]À]HVWHIH]À]H-
se tu valesses
PRVÀ]HVWHVÀ]HUDP
se ele valesse
se nós valêssemos Futuro do presente do indicativo: Farei, farás, fará,
se vós valêsseis faremos, fareis, farão.
se eles valessem
Ir
Futuro do Subjuntivo Presente do indicativo: Vou, vais, vai, vamos, ides, vão.
quando eu valer
quando tu valeres Pretérito perfeito do indicativo: Fui, foste, foi, fomos,
quando ele valer fostes, foram.
quando nós valermos
quando vós valerdes Futuro do presente do indicativo: Irei, irás, irá, ire-
quando eles valerem mos, ireis, irão.

Imperativo Futuro do subjuntivo: For, fores, for, formos, fordes,


forem.
,PSHUDWLYR$ÀUPDWLYR
-- Querer
vale tu Presente do indicativo: Quero, queres, quer, queremos,
valha ele quereis, querem.
valhamos nós
valei vós Pretérito perfeito do indicativo: Quis, quiseste, quis,
valham eles quisemos, quisestes, quiseram.
Imperativo Negativo
-- Presente do subjuntivo: Queira, queiras, queira, quei-
não valhas tu ramos, queirais, queiram.
não valha ele
não valhamos nós Ver
não valhais vós Presente do indicativo: Vejo, vês, vê, vemos, vedes,
não valham eles veem.

68
LÍNGUA PORTUGUESA

Pretérito perfeito do indicativo: Vi, viste, viu, vimos, 2V IXQFLRQiULRV )25$0 &2192&$'26 SHOR GLUHWRU
vistes, viram. DX[6(5SULQF&2192&$5

Futuro do presente do indicativo:Verei, verás, verá, 2V HVWXGDQWHV (67®2 5(6321'(1'2 jV TXHVW}HV
veremos, vereis, verão. DX[(67$5SULQF5(6321'(5

Futuro do subjuntivo: Vir, vires, vir, virmos, virdes, vi- 2V WUDEDOKDGRUHV 7È0 (1)5(17$'2 PXLWRV SUREOH-
rem. PDV DX[7(5SULQF(1)5(17$5

Vir 2YHUHDGRU+$9,$'(181&,$'2VHXVFRPSDQKHLURV
Presente do indicativo: Venho, vens, vem, vimos, vin- DX[+$9(5SULQF'(181&,$5
des, vêm.
2V DOXQRV '(9(0 (678'$5 WRGRV RV GLDV DX[ '(-
Pretérito perfeito do indicativo: Vim, vieste, veio, vie- 9(5SULQF(678'$5
mos, viestes, vieram.
Sujeito
Futuro do presente do indicativo: Virei, virás, virá, vi-
remos, vireis, virão. 3DUDVHGHVFREULUTXDORVXMHLWRGRYHUER RXGDORFX-
omRYHUEDO GHYHVHSHUJXQWDUDHOH RXDHOD RVHJXLQWH
Futuro do subjuntivo: Vier, vieres, vier, viermos, vier- Que(m) é que ..."$UHVSRVWDVHUiRVXMHLWR3RUH[HPSOR
des, vierem. DQDOLVHPRVDSULPHLUDIUDVHGHQWUHDVDSUHVHQWDGDVDFLPD
Os funcionários foram convocados pelo diretor.
SINTAXE
2SULQFtSLRpRYHUER3URFXUDVHSRUWDQWRRYHUERp
O princípio é o verbo. DORFXomRYHUEDOforam convocados3HUJXQWDVHDHOD
Que(m) é que foi convocado?
(VVDpDSUHPLVVDIXQGDPHQWDOGDSintaxe,TXHpDSDU- 5HVSRVWDOs funcionários.
WHGDJUDPiWLFDTXHHVWXGDDVpalavras enquanto elementos  2 VXMHLWR GD RUDomR HQWmR p R VHJXLQWH os funcio-
de uma frase, as suas relações de concordância, de subor- nários
dinação e de ordem6LJQLÀFDTXHDRVHUHDOL]DUDDQiOLVH (QFRQWUDGRRVXMHLWRSDUWHVHSDUDDDQiOLVHGRYHUER
VLQWiWLFD GH XPD RUDomRVHPSUHVH LQLFLD SHOR YHUERe D 6HHOHLQGLFDUTXHRVXMHLWRSRVVXLXPDTXDOLGDGHXP
SDUWLUGHOHTXHVHGHVFREUHTXDORVXMHLWRGDRUDomRVHKiD HVWDGRRXXPPRGRGHVHUVHPSUDWLFDUDomRDOJXPDVHUi
LQGLFDomRGHTXDOLGDGHHVWDGRRXPRGRGHVHUGRVXMHLWR GHQRPLQDGRGH9(5%2'(/,*$d®22VYHUERVGHOLJDomR
VHHOHSUDWLFDXPDDomRRXVHDVRIUHVHKiFRPSOHPHQWR PDLVFRPXQVVmRRVVHJXLQWHVVHUHVWDUSDUHFHUÀFDUSHU-
YHUEDOVHKiFLUFXQVWkQFLD DGMXQWRDGYHUELDO HWF manecer e continuar 1mR VH HVTXHoD SRUpP GH TXH Vy
VHUiYHUERGHOLJDomRRTXHLQGLFDUTXDOLGDGHHVWDGRRX
1HP VHPSUH R YHUER VH DSUHVHQWD VR]LQKR HP XPD PRGRGHVHUGRVXMHLWRVHPSUDWLFDUDomRDOJXPD2EVHUYH
RUDomR(PPXLWRVFDVRVVXUJHPGRLVRXPDLVYHUERVMXQ- DVVHJXLQWHVIUDVHV
WRVSDUDLQGLFDUTXHVHSUDWLFDRXVHVRIUHXPDDomRRX O político continuou seu discurso mesmo com todas as
TXHRVXMHLWRSRVVXLXPDTXDOLGDGH$HVVDMXQomRGiVH vaias recebidas
RQRPHGHlocução verbal7RGDORFXomRYHUEDOpIRUPDGD ContinuarQHVWDIUDVHQmRpGHOLJDomRMiTXHQmRLQ-
SRUXPYHUERDX[LOLDU RXPDLVGHXP HXPYHUERSULQFLSDO GLFDTXDOLGDGHGRVXMHLWRHVLPDomR
VRPHQWHXP  A professora estava na sala de aula
Estar, QHVWD IUDVH QmR p GH OLJDomR Mi TXH QmR LQGLFD
2 YHUER DX[LOLDU p R TXH VH UHODFLRQD FRP R VXMHLWR TXDOLGDGHGRVXMHLWRHVLPIDWR
SRU LVVR FRQFRUGD FRP HVWH RX VHMD VH R VXMHLWR HVWLYHU
QRVLQJXODURYHUERDX[LOLDUWDPEpPÀFDUiQRVLQJXODUVH A garota estava muito alegre.
RVXMHLWRHVWLYHUQRSOXUDORYHUERDX[LOLDUWDPEpPÀFDUi Estar p YHUER GH OLJDomR SRUTXH LQGLFD TXDOLGDGH GR
QRSOXUDO1D/tQJXD3RUWXJXHVDRVYHUERVDX[LOLDUHVVmRRV VXMHLWR
VHJXLQWHVVer, estar, ter, haver, dever, poder, ir,GHQWUHRXWURV
6HRYHUERLQGLFDUTXHRVXMHLWRSUDWLFDXPDDomRRX
2 YHUER SULQFLSDO p R TXH LQGLFD VH R VXMHLWR SRVVXL TXHSDUWLFLSDDWLYDPHQWHGHXPIDWRVHUiGHQRPLQDGRGH
XPDTXDOLGDGHVHHOHSUDWLFDXPDDomRRXVHDVRIUHeR 9(5%2,175$16,7,92RX9(5%275$16,7,92GHDFRUGR
PDLVLPSRUWDQWHGDORFXomR1D/tQJXD3RUWXJXHVDRYHUER FRPRVHJXLQWH
SULQFLSDOVXUJHVHPSUHQRLQÀQLWLYR WHUPLQDGRHP²ar, -er
RX²ir QRJHU~QGLR WHUPLQDGRHP²ndo RXQRSDUWLFtSLR Quem .7RGRYHUERTXHVHHQFDL[DU
WHUPLQDGRHP²adoRX²idoGHQWUHRXWUDVWHUPLQDo}HV  QHVVDIUDVHVHUi,175$16,7,923RUH[HPSORRYHUERcor-
9HMDDOJXQVH[HPSORVGHORFXo}HVYHUEDLV rer4XHPFRUUHFRUUH

69
LÍNGUA PORTUGUESA

- Quem ............ , ................. algo/alguém 7RGR YHUER  $*(17('('()(1625,$3Ó%/,&$²)&&² 


TXHVHHQFDL[DUQHVVDIUDVHVHUi75$16,7,92',5(723RU Donos de uma capacidade de orientação nas brenhas selva-
H[HPSORRYHUERcomer:4XHPFRPHFRPHDOJRRXRYHU- gens [...], sabiam os paulistas como...
ERamar4XHPDPDDPDDOJXpP 2VHJPHQWRHPGHVWDTXHQDIUDVHDFLPDH[HUFHDPHV-
PDIXQomRVLQWiWLFDTXHRHOHPHQWRJULIDGRHP
Quem ............ , ................. + prep. + algo/alguém7RGR $ Nas expedições breves VHUYLDPGHEDOL]DVRXPRV-
YHUERTXHVHHQFDL[DUQHVVDIUDVHVHUi75$16,7,92,1',- WUDGRUHVSDUDDYROWD
5(723RUH[HPSORRYHUERgostar4XHPJRVWDJRVWDGH % ­VHVWUHLWDVYHUHGDVHDWDOKRV>@nada DFUHVFHQWD-
DOJR RX GH DOJXpP $V SUHSRVLo}HV PDLV FRPXQV VmR DV ULDPDTXHOHVGHFRQVLGHUiYHO
VHJXLQWHVa, de, em, por, para, semHcom. & 6yDXPROKDUPXLWRH[HUFLWDGRVHULDperceptível R
VLQDO
Quem ............ , ................. algo/alguém + prep. + algo/
' Uma sequência de tais galhos,HPTXDOTXHUÁRUHV-
alguém:7RGRYHUERTXHVHHQFDL[DUQHVVDIUDVHVHUi75$1-
6,7,92',5(72(,1',5(72WDPEpPGHQRPLQDGRGH%,- WDSRGLDVLJQLÀFDUXPDSLVWD
75$16,7,923RUH[HPSORRYHUERPRVWUDU4XHPPRVWUD ( $OJXQVPDSDVHWH[WRVGRVpFXOR;9,,DSUHVHQWDP
PRVWUDDOJRDDOJXpPRXRYHUERLQIRUPDU4XHPLQIRUPD QRVa vila de São Paulo FRPRFHQWUR
LQIRUPDDOJXpPGHDOJRRX4XHPLQIRUPDLQIRUPDDOJRD
DOJXpP +iFRPSOHPHQWRQRPLQDOHP
$ 9RFrGHYLDYLUFiIRUDUHFHEHUREHLMRGDPDGUXJDGD
e LPSRUWDQWH VDOLHQWDU TXH XP YHUER Vy VHUi 75$1- %  HPERUD IRVVH TXDVH FHUWD D VXD SRVVLELOLGDGH GH
6,7,92 VH KRXYHU FRPSOHPHQWR REMHWR GLUHWR RX REMHWR JDQKDUDYLGD
LQGLUHWR  $ DQiOLVH GH XP YHUER GHSHQGH SRUWDQWR GR & (ODHVWDYDQDMDQHODGRHGLItFLR
DPELHQWHVLQWiWLFRHPTXHHOHVHHQFRQWUD8PYHUERTXH ' VHPVDEHUDRFHUWRVHJRVWiYDPRVGHOH
DSDUHQWHPHQWHVHMDWUDQVLWLYRGLUHWRSRGHVHUQDUHDOLGD- ( 3RXFR GHSRLV FRPHoDUDP D EULQFDU GH EDQGLGR H
GHLQWUDQVLWLYRFDVRQmRKDMDFRPSOHPHQWR3RUH[HPSOR PRFLQKRGHFLQHPD
REVHUYHDVHJXLQWHIUDVH
O pior cego é aquele que não quer ver.  (63063 (P´esta lhe deu cem mil contos”RWHU-
2YHUER´YHUµpDSDUHQWHPHQWHWUDQVLWLYRGLUHWRXPD PRGHVWDFDGRp
YH]TXHVHHQFDL[DQDIUDVHQuem vê, vê algo2FRUUHSR- $ SURQRPHSRVVHVVLYR
UpPTXHQmRKiR´DOJRµ2SLRUFHJRpDTXHOHTXHQmR
% FRPSOHPHQWRQRPLQDO
TXHUYHURTXr"1mRDSDUHFHQDRUDomRQmRKiSRUWDQWR
RREMHWRGLUHWR&RPRQmRRKiRYHUERQmRSRGHVHUWUDQ- & REMHWRLQGLUHWR
VLWLYRGLUHWRHVLPLQWUDQVLWLYR ' DGMXQWRDGQRPLQDO
2EVHUYH DJRUD HVWD IUDVH Quem dá aos pobres, em- ( REMHWRGLUHWR
presta a Deus.
2V YHUERV ´GDUµ H ´HPSUHVWDUµ VmR DSDUHQWHPHQWH $VVLQDOHDDOWHUQDWLYDFRUUHWDHLGHQWLÀTXHRVXMHLWR
WUDQVLWLYRVGLUHWRVHLQGLUHWRVXPDYH]TXHVHHQFDL[DPQDV GDVVHJXLQWHVRUDo}HVHPUHODomRDRVYHUERVGHVWDFDGRV
IUDVHV4XHPGiGiDOJRDDOJXpPH4XHPHPSUHVWDHP- - Amanhã teremos uma palestra sobre qualidade de
SUHVWDDOJRDDOJXpP2FRUUHSRUpPTXHQmRKiR´DOJRµ vida.
4XHPGiRTXHDRVSREUHVHPSUHVWDRTXHD'HXV"1mR - Neste ano, quero prestar serviço voluntário.
DSDUHFHQDRUDomRQmRKiSRUWDQWRRREMHWRGLUHWR&RPR
QmR R Ki RV YHUERV QmR SRGHP VHU WUDQVLWLYRV GLUHWRV H $ 7X²YyV
LQGLUHWRVHVLPVRPHQWHWUDQVLWLYRVLQGLUHWRV % 1yV²HX
& 9yV²QyV
)217( ' (OHWX
KWWSZZZJUDPDWLFDRQOLQHFRPEUWH[WR
&ODVVLÀTXHRVXMHLWRGDVRUDo}HVGHVWDFDGDVQRWH[-
WRVHJXLQWHHDVHJXLUDVVLQDOHDVHTXrQFLDFRUUHWD
Questões sobre Análise Sintática

 $*(17( '( $32,2 $'0,1,675$7,92 ² )&& ²


É notável, nos textos épicos, a participação do sobrena-
 Os trabalhadores passaram mais tempo na escola... tural. É frequente a mistura de assuntos relativos ao nacio-
2VHJPHQWRJULIDGRDFLPDSRVVXLDPHVPDIXQomRVLQ- nalismo com o caráter maravilhoso. Nas epopeias, os deu-
WiWLFDTXHRGHVWDFDGRHP ses tomam partido e interferem nas aventuras dos heróis,
$ RTXHUHGX]a média de ganho GDFDWHJRULD ajudando-os ou atrapalhando- -os.
% KRXYHmais ofertas de trabalhadores GHVVDFODV- $ VLPSOHVFRPSRVWR
VH % LQGHWHUPLQDGRFRPSRVWR
& O crescimento da escolaridade WDPEpPIRLLPSXO- & VLPSOHVVLPSOHV
VLRQDGR ' RFXOWRLQGHWHUPLQDGR
' HOHYDQGRa fatia dos brasileiros FRPHQVLQRPp-
GLR  (63063  ´Surgiram fotógrafos e repórteresµ
( LPSXOVLRQDGRSHORDXPHQWRGRQ~PHURGHXQL- ,GHQWLÀTXHDDOWHUQDWLYDTXHFODVVLÀFDFRUUHWDPHQWHDIXQ-
versidades... omRVLQWiWLFDHDFODVVHPRUIROyJLFDGRVWHUPRVGHVWDFDGRV

70
LÍNGUA PORTUGUESA

$ REMHWRLQGLUHWR²VXEVWDQWLYR  
% REMHWRGLUHWRVXEVWDQWLYR eQRWiYHOQRVWH[WRVpSLFRVDSDUWLFLSDomRGRVREUHQD-
& VXMHLWR²DGMHWLYR WXUDOeIUHTXHQWHDPLVWXUDGHDVVXQWRVUHODWLYRVDRQDFLR-
' REMHWRGLUHWR²DGMHWLYR QDOLVPRFRPRFDUiWHUPDUDYLOKRVR1DVHSRSHLDVRVGHX-
( VXMHLWRVXEVWDQWLYR VHVWRPDPSDUWLGRHLQWHUIHUHPQDVDYHQWXUDVGRVKHUyLV
DMXGDQGRRVRXDWUDSDOKDQGRRV
$PERVRVWHUPRVDSUHVHQWDPVXMHLWRVLPSOHV
GABARITO
 
01. C 02. D 03. B 04. C 05. B 06. C 07. E 6XUJLUDPIRWyJUDIRVHUHSyUWHUHV
2VXMHLWRHVWiGHVORFDGRFRORFDGRQDRUGHPLQGLUHWD
RESOLUÇÃO ÀQDO GD RUDomR  3RUWDQWR IXQomR VLQWiWLFD VXMHLWR FRP-
SRVWR  FODVVH PRUIROyJLFD FODVVH GH SDODYUDV  VXEVWDQWL-
  YRV
2VWUDEDOKDGRUHVSDVVDUDPPDLVWHPSRQDHVFROD
68-(,72 Frase pWRGRHQXQFLDGRGHVHQWLGRFRPSOHWRSRGHQGR
$ RTXHUHGX]DPpGLDGHJDQKRGDFDWHJRULD RE- VHUIRUPDGDSRUXPDVySDODYUDRXSRUYiULDVWHUYHUERVRX
MHWRGLUHWR QmR$IUDVHH[SULPHDWUDYpVGDIDODRXGDHVFULWDLGHLDV
% KRXYHPDLVRIHUWDVGHWUDEDOKDGRUHVGHVVDFODVVH HPRo}HVRUGHQVDSHORV'HÀQHVHSHORVHXSURSyVLWRFR-
REMHWRGLUHWR PXQLFDWLYRRXVHMDSHODVXDFDSDFLGDGHGHQXPLQWHUFkP-
&  2 FUHVFLPHQWR GD HVFRODULGDGH WDPEpP IRL LPSXO- ELROLQJXtVWLFRWUDQVPLWLUXPFRQWH~GRVDWLVIDWyULRSDUDD
VLWXDomRHPTXHpXWLOL]DGD([HPSORV
VLRQDGR VXMHLWRSDFLHQWH
O Brasil possui um grande potencial turístico.
'  HOHYDQGR D IDWLD GRV EUDVLOHLURV FRP HQVLQR Pp- Espantoso!
GLR REMHWRGLUHWR Não vá embora.
( LPSXOVLRQDGRSHORDXPHQWRGRQ~PHURGHXQLYHU- Silêncio!
VLGDGHV DJHQWHGDSDVVLYD O telefone está tocando.

  2EVHUYDomRDIUDVHTXHQmRSRVVXLYHUERGHQRPLQD
'RQRVGHXPDFDSDFLGDGHGHRULHQWDomRQDVEUHQKDV VHFrase Nominal.
VHOYDJHQV>@VDELDPRVSDXOLVWDVFRPR 68-(,72 1D OtQJXD IDODGD D IUDVH p FDUDFWHUL]DGD SHOD HQWRD-
$ 1DVH[SHGLo}HVEUHYHV $'-8172$'9(5%,$/ omRTXHLQGLFDQLWLGDPHQWHVHXLQtFLRHVHXÀP$HQWRDomR
% QDGDDFUHVFHQWDULDPDTXHOHVGHFRQVLGHUiYHO DG- SRGHYLUDFRPSDQKDGDSRUJHVWRVH[SUHVV}HVGRURVWRGR
MXQWRDGYHUELDO ROKDUDOpPGHVHUFRPSOHPHQWDGDSHODVLWXDomRHPTXHR
& VHULDSHUFHSWtYHORVLQDO SUHGLFDWLYR IDODQWHVHHQFRQWUD(VVHVIDWRVFRQWULEXHPSDUDTXHIUH-
TXHQWHPHQWH VXUMDP IUDVHV PXLWR VLPSOHV IRUPDGDV SRU
' 8PDVHTXrQFLDGHWDLVJDOKRV VXMHLWR
DSHQDVXPDSDODYUD2EVHUYH
( DSUHVHQWDPQRVDYLODGH6mR3DXORFRPR REMHWR Rua!
GLUHWR Ai!

  (VVDVSDODYUDVGRWDGDVGHHQWRDomRSUySULDHDFRP-
$ REHLMRGDPDGUXJDGD DGMXQWRDGQRPLQDO SDQKDGDVGHJHVWRVSHFXOLDUHVVmRVXÀFLHQWHVSDUDVDWLVID-
% DVXDSRVVLELOLGDGHGHJDQKDUDYLGD FRPSOHPHQWR ]HUVXDVQHFHVVLGDGHVH[SUHVVLYDV
QRPLQDO SRVVLELOLGDGHGHTXr" 1DOtQJXDHVFULWDDHQWRDomRpUHSUHVHQWDGDSHORVVL-
& QDMDQHODGRHGLItFLR DGMXQWRDGQRPLQDO QDLV GH SRQWXDomR RV TXDLV SURFXUDP VXJHULU D PHORGLD
' VHPVDEHUDRFHUWRVHJRVWiYDPRVGHOH REMHWR IUDVDO'HVDSDUHFHQGRDVLWXDomRYLYDRFRQWH[WRpIRUQH-
LQGLUHWR FLGRSHORSUySULRWH[WRRTXHDFDEDWRUQDQGRQHFHVViULR
( DEULQFDUGHEDQGLGRHPRFLQKRGHFLQHPD REMHWR TXHDVIUDVHVHVFULWDVVHMDPOLQJXLVWLFDPHQWHPDLVFRPSOH-
LQGLUHWR WDV(VVDPDLRUFRPSOH[LGDGHOLQJXtVWLFDOHYDDIUDVHDREH-
GHFHU jV UHJUDV JHUDLV GD OtQJXD 3RUWDQWR D RUJDQL]DomR
 
HDRUGHQDomRGRVHOHPHQWRVIRUPDGRUHVGDIUDVHGHYHP
HVWDOKHGHXFHPPLOFRQWRV RYHUER'$5pELWUDQVLWL-
VHJXLU RV SDGU}HV GD OtQJXD 3RU LVVR p TXH As meninas
YRRXVHMDWUDQVLWLYRGLUHWRHLQGLUHWRSRUWDQWRSUHFLVDGH estavam alegres. = FRQVWLWXLXPDIUDVHHQTXDQWRAlegres
GRLVFRPSOHPHQWRV²GRLVREMHWRVGLUHWRHLQGLUHWR meninas estavam as. = QmRpFRQVLGHUDGDXPDIUDVHGDOtQ-
'HXRTXr" FHPPLOFRQWRV GLUHWR  JXDSRUWXJXHVD
'HXDTXHP"OKH DHOHDHOD  LQGLUHWR
Tipos de Frases
 
$PDQKm QyV WHUHPRVXPDSDOHVWUDVREUHTXDOLGD- 0XLWDVYH]HVDVIUDVHVDVVXPHPVHQWLGRVTXHVySR-
GHGHYLGD GHPVHULQWHJUDOPHQWHFDSWDGRVVHDWHQWDUPRVSDUDRFRQ-
1HVWHDQR HX TXHURSUHVWDUVHUYLoRYROXQWiULR WH[WRHPTXHVmRHPSUHJDGDVeRFDVRSRUH[HPSORGDV

71
LÍNGUA PORTUGUESA

VLWXDo}HVHPTXHVHH[SORUDDLURQLD3HQVHSRUH[HPSOR Estrutura da Frase


QDIUDVH´Que educaçãoµXVDGDTXDQGRVHYrDOJXpPLQ-
YDGLQGRFRPVHXFDUURDIDL[DGHSHGHVWUHV1HVVHFDVR $VIUDVHVTXHSRVVXHPYHUERVmRJHUDOPHQWHHVWUXWX-
HODH[SUHVVDH[DWDPHQWHRFRQWUiULRGRTXHDSDUHQWHPHQ- UDGDV D SDUWLU GH GRLV HOHPHQWRV HVVHQFLDLV sujeito e pre-
WHGL] dicado ,VVR QmR VLJQLÀFD QR HQWDQWR TXH WDLV IUDVHV GH-
$HQWRDomRpXPHOHPHQWRPXLWRLPSRUWDQWHGDIUDVH YDPVHUIRUPDGDVQRPtQLPRSRUGRLVYRFiEXORV1DIUDVH
IDODGDSRLVQRVGiXPDDPSODSRVVLELOLGDGHGHH[SUHVVmR ´SaímosµSRUH[HPSORKiXPVXMHLWRLPSOtFLWRQDWHUPLQD-
'HSHQGHQGRGHFRPRpGLWDXPDIUDVHVLPSOHVFRPR´É omRGRYHUERQyV
elDµ SRGH LQGLFDU FRQVWDWDomR G~YLGD VXUSUHVD LQGLJQD- 2VXMHLWRpRWHUPRGDIUDVHTXHFRQFRUGDFRPRYHUER
omRGHFHSomRHWF1DOtQJXDHVFULWDRVVLQDLVGHSRQWXD- HP Q~PHUR H SHVVRD e QRUPDOPHQWH R ´VHU GH TXHP VH
omRSRGHPDJLUFRPRGHÀQLGRUHVGRVHQWLGRGDVIUDVHV GHFODUDDOJRµ´RWHPDGRTXHVHYDLFRPXQLFDUµ
([LVWHPDOJXQVWLSRVGHIUDVHVFXMDHQWRDomRpPDLVRX 2 SUHGLFDGR p D SDUWH GD IUDVH TXH FRQWpP ´D LQIRU-
PHQRV SUHYLVtYHO GH DFRUGR FRP R VHQWLGR TXH WUDQVPL- PDomR QRYD SDUD R RXYLQWHµ 1RUPDOPHQWH HOH VH UHIHUH
WHP6mRHODV DRVXMHLWRFRQVWLWXLQGRDGHFODUDomRGRTXHVHDWULEXLDR
 Frases Interrogativas: RFRUUHP TXDQGR XPD SHU- VXMHLWR e VHPSUH PXLWR LPSRUWDQWH DQDOLVDU TXDO p R Q~-
JXQWDpIHLWDSHORHPLVVRUGDPHQVDJHP6mRHPSUHJDGDV FOHRVLJQLÀFDWLYRGDGHFODUDomRVHRQ~FOHRGDGHFODUDomR
TXDQGRVHGHVHMDREWHUDOJXPDLQIRUPDomR$LQWHUURJDomR HVWLYHUQRYHUERWHUHPRVXPSUHGLFDGRYHUEDO RFRUUHQDV
SRGHVHUGLUHWDRXLQGLUHWD IUDVHVYHUEDLV VHRQ~FOHRGDGHFODUDomRHVWLYHUHPDOJXP
Você aceita um copo de suco? ,QWHUURJDomRGLUHWD QRPH WHUHPRV XP SUHGLFDGR QRPLQDO RFRUUH QDV IUDVHV
Desejo saber se você aceita um copo de suco. ,QWHUUR- QRPLQDLVTXHSRVVXHPYHUERGHOLJDomR 2EVHUYHO amor
JDomRLQGLUHWD é eterno.
2WHPDRVHUGHTXHPVHGHFODUDDOJRRVXMHLWRp´2
- Frases Imperativas RFRUUHP TXDQGR R HPLVVRU GD DPRUµ$GHFODUDomRUHIHUHQWHD´RDPRUµRXVHMDRSUHGL-
PHQVDJHPGiXPDRUGHPXPFRQVHOKRRXID]XPSHGLGR FDGRpªpHWHUQR«eXPSUHGLFDGRQRPLQDOSRLVVHXQ~-
XWLOL]DQGRRYHUERQRPRGRLPSHUDWLYR3RGHPVHUDÀUPD- FOHRVLJQLÀFDWLYRpRQRPHªHWHUQR«-iQDIUDVHOs rapazes
WLYDVRXQHJDWLYDV jogam futebol2VXMHLWRp´2VUDSD]HVµTXHLGHQWLÀFDPRV
Faça-o entrar no carro! $ÀUPDWLYD SRUVHURWHUPRTXHFRQFRUGDHPQ~PHURHSHVVRDFRPR
Não faça isso 1HJDWLYD YHUER´MRJDPµ2SUHGLFDGRp´MRJDPIXWHEROµFXMRQ~FOHR
Dê-me uma ajudinha com isso! $ÀUPDWLYD VLJQLÀFDWLYRpRYHUER´MRJDPµ7HPRVDVVLPXPSUHGLFD-
GRYHUEDO
- Frases Exclamativas QHVVH WLSR GH IUDVH R HPLVVRU
H[WHULRUL]DXPHVWDGRDIHWLYR$SUHVHQWDPHQWRDomROLJHL- Oração
UDPHQWHSURORQJDGD3RU([HPSOR
Que prova difícil! 8PDIUDVHYHUEDOSRGHVHUWDPEpPXPDRUDomR3DUD
É uma delícia esse bolo! LVVRpQHFHVViULR
TXHRHQXQFLDGRWHQKDVHQWLGRFRPSOHWR
   Frases Declarativas RFRUUHP TXDQGR R HPLVVRU TXHRHQXQFLDGRWHQKDYHUER RXORFXomRYHUEDO 
FRQVWDWDXPIDWR(VVHWLSRGHIUDVHLQIRUPDRXGHFODUDDO- 3RU([HPSORCamila terminou a leitura do livro.
JXPDFRLVD3RGHPVHUDÀUPDWLYDVRXQHJDWLYDV
Obrigaram o rapaz a sair $ÀUPDWLYD 2EV1DRUDomRDVSDODYUDVHVWmRUHODFLRQDGDVHQWUHVL
Ela não está em casa. 1HJDWLYD FRPRSDUWHVGHXPFRQMXQWRKDUP{QLFRHODVVmRRVWHU-
PRVRXDVXQLGDGHVVLQWiWLFDVGDRUDomR$VVLPFDGDWHU-
Frases Optativas:VmRXVDGDVSDUDH[SULPLUXPGHVH- PRGDRUDomRGHVHPSHQKDXPDIXQomRVLQWiWLFD
MR3RU([HPSOR
Deus te acompanhe! Atenção: 1HPWRGDIUDVHpRUDomR3RU([HPSORQue
Bons ventos o levem! dia lindo!
(VVH HQXQFLDGR p IUDVH SRLV WHP VHQWLGR (VVH HQXQ-
'H DFRUGR FRP D FRQVWUXomR DV IUDVHV FODVVLÀFDPVH FLDGRQmRpRUDomRSRLVQmRSRVVXLYHUER$VVLPQmRSRV-
HP VXHPHVWUXWXUDVLQWiWLFDSRUWDQWRQmRVmRRUDo}HVIUDVHV
Frase Nominal:pDIUDVHFRQVWUXtGDVHPYHUERV([HP- FRPR
SORV Socorro! - Com Licença! - Que rapaz ignorante!
Fogo! $IUDVHSRGHFRQWHUXPDRXPDLVRUDo}HV9HMD
Cuidado! Brinquei no parque XPDRUDomR
Belo serviço o seu! Entrei na casa e sentei-me. GXDVRUDo}HV 
Trabalho digno desse feirante. Cheguei, vi, venci. WUrVRUDo}HV

Frase Verbal: p D IUDVH FRQVWUXtGD FRP YHUER 3RU Período


([HPSOR
O sol ilumina a cidade e aquece os dias. 3HUtRGRpDIUDVHFRQVWLWXtGDGHXPDRXPDLVRUDo}HV
Os casais saíram para jantar. IRUPDQGR XP WRGR FRP VHQWLGR FRPSOHWR 2 SHUtRGR
A bola rolou escada abaixo. SRGHVHUVLPSOHVRXFRPSRVWR

72
LÍNGUA PORTUGUESA

Período SimplespDTXHOHFRQVWLWXtGRSRUDSHQDVXPD Coordenadas Assindéticas


RUDomRTXHUHFHEHRQRPHGHRUDomRDEVROXWD([HPSORV
O amor é eterno. 6mRRUDo}HVFRRUGHQDGDVHQWUHVLHTXHQmRVmROLJD-
As plantas necessitam de cuidados especiais. GDVDWUDYpVGHQHQKXPFRQHFWLYR(VWmRDSHQDVMXVWDSRV-
Quero aquelas rosas. WDV
O tempo é o melhor remédio. Coordenadas Sindéticas

Período CompostopDTXHOHFRQVWLWXtGRSRUGXDVRX $RFRQWUiULRGDDQWHULRUVmRRUDo}HVFRRUGHQDGDVHQ-


PDLVRUDo}HV([HPSORV WUHVLPDVTXHVmROLJDGDVDWUDYpVGHXPDFRQMXQomRFRRU-
4XDQGRYRFrSDUWLXPLQKDYLGDÀFRXVHPDOHJULDV GHQDWLYD (VVH FDUiWHU YDL WUD]HU SDUD HVVH WLSR GH RUDomR
4XHURDTXHODVÁRUHVSDUDSUHVHQWHDUPLQKDPmH XPDFODVVLÀFDomR$VRUDo}HVFRRUGHQDGDVVLQGpWLFDVVmR
Vou gritar para todos ouvirem que estou sabendo o que FODVVLÀFDGDVHPFLQFRWLSRVDGLWLYDVDGYHUVDWLYDVDOWHUQD-
acontece ao anoitecer. WLYDVFRQFOXVLYDVHH[SOLFDWLYDV
Cheguei, jantei e fui dormir.
Orações Coordenadas Sindéticas AditivasVXDVSULQ-
6DLEDTXH&RPRWRGDRUDomRHVWiFHQWUDGDQXPYHUER FLSDLVFRQMXQo}HVVmRe, nem, não só... mas também, não
RXQXPDORFXomRYHUEDODPDQHLUDSUiWLFDGHVDEHUTXDQ- só... como, assim... como.
WDV RUDo}HV H[LVWHP QXP SHUtRGR p FRQWDU RV YHUERV RX - Não só cantei como também dancei.
ORFXo}HVYHUEDLV - Nem comprei o protetor solar, nem fui à praia.
- Comprei o protetor solar e fui à praia.
Período Composto
Orações Coordenadas Sindéticas AdversativasVXDV
2 período composto FDUDFWHUL]DVH SRU SRVVXLU PDLV SULQFLSDLVFRQMXQo}HVVmRmas, contudo, todavia, entretan-
GHXPDRUDomRHPVXDFRPSRVLomR6HQGR$VVLP
to, porém, no entanto, ainda, assim, senão.
- Fiquei muito cansada, contudo me diverti bastante.
- Ainda que a noite acabasse, nós continuaríamos dan-
 Eu irei à praia 3HUtRGR 6LPSOHV  XP YHUER XPD
çando.
RUDomR
- Não comprei o protetor solar, mas mesmo assim fui à
Estou comprando um protetor solar, depois irei à praia
praia.
3HUtRGR&RPSRVWR ORFXomRYHUEDOYHUERGXDVRUDo}HV
Já me decidi: só irei à praia, se antes eu comprar um
Orações Coordenadas Sindéticas Alternativas VXDV
protetor solar. 3HUtRGR&RPSRVWR WUrVYHUERVWUrVRUD-
SULQFLSDLV FRQMXQo}HV VmR ou... ou; ora...ora; quer...quer;
o}HV 
seja...seja.
- Ou uso o protetor solar, ou uso o óleo bronzeador.
&DGD YHUER RX ORFXomR YHUEDO VXEOLQKDGD DFLPD FRU- - Ora sei que carreira seguir, ora penso em várias carrei-
UHVSRQGHDXPDRUDomR,VVRLPSOLFDTXHRSULPHLURH[HP- ras diferentes.
SORpXPSHUtRGRVLPSOHVSRLVWHPDSHQDVXPDRUDomRRV  4XHU HX GXUPD TXHU HX ÀTXH DFRUGDGR ÀFDUHL QR
GRLV RXWURV H[HPSORV VmR SHUtRGRV FRPSRVWRV SRLV WrP quarto.
PDLVGHXPDRUDomR
+i GRLV WLSRV GH UHODo}HV TXH SRGHP VH HVWDEHOHFHU Orações Coordenadas Sindéticas Conclusivas VXDV
HQWUHDVRUDo}HVGHXPSHUtRGRFRPSRVWRXPDUHODomRGH SULQFLSDLVFRQMXQo}HVVmRORJRSRUWDQWRSRUÀPSRUFRQ-
FRRUGHQDomRRXXPDUHODomRGHVXERUGLQDomR seguinte, consequentemente, pois (posposto ao verbo)
'XDV RUDo}HV VmR FRRUGHQDGDV TXDQGR HVWmR MXQWDV - Passei no vestibular, portanto irei comemorar.
HPXPPHVPRSHUtRGR RXVHMDHPXPPHVPREORFRGH - Conclui o meu projeto, logo posso descansar.
LQIRUPDo}HVPDUFDGRSHODSRQWXDomRÀQDO PDVWrPDP- 7RPRXPXLWRVROFRQVHTXHQWHPHQWHÀFRXDGRHQWDGD
EDVHVWUXWXUDVLQGLYLGXDLVFRPRpRH[HPSORGH - A situação é delicada; devemos, pois, agir
Estou comprando um protetor solar, depois irei à praia Orações Coordenadas Sindéticas Explicativas VXDV
3HUtRGR&RPSRVWR SULQFLSDLVFRQMXQo}HVVmRisto é, ou seja, a saber, na verda-
de, pois (anteposto ao verbo).
3RGHPRVGL]HU - Só passei na prova porque me esforcei por muito tem-
1. Estou comprando um protetor solar. po.
2. Irei à praia. 6yÀTXHLWULVWHSRUYRFrQmRWHUYLDMDGRFRPLJR
6HSDUDQGRDVGXDVYHPRVTXHHODVVmRLQGHSHQGHQWHV - Não fui à praia, pois queria descansar durante o Do-
eHVVHWLSRGHSHUtRGRTXHYHUHPRVR3HUtRGR&RP- mingo.
SRVWRSRU&RRUGHQDomR
4XDQWR j FODVVLÀFDomR GDV RUDo}HV FRRUGHQDGDV WH- )RQWH
PRVGRLVWLSRV&RRUGHQDGDV$VVLQGpWLFDVH&RRUGHQDGDV KWWSZZZLQIRHVFRODFRPSRUWXJXHVRUDFRHVFRRU-
6LQGpWLFDV GHQDGDVDVVLQGHWLFDVHVLQGHWLFDV

73
LÍNGUA PORTUGUESA

Questões sobre Orações Coordenadas GABARITO

$RUDomR´1mRVHYHULÀFRXWRGDYLDXPDWUDQVSODQ- 01. B 02. E 03. D 04. E 05. D


tação integral de gosto e de estiloµWHPYDORU
$ FRQFOXVLYR RESOLUÇÃO
% DGYHUVDWLYR
& FRQFHVVLYR  
' H[SOLFDWLYR
´1mRVHYHULÀFRXWRGDYLDXPDWUDQVSODQWDomRLQWHJUDO
( DOWHUQDWLYR
GH JRVWR H GH HVWLORµ  FRQMXQomR DGYHUVDWLYD SRUWDQWR
“EstudamosORJRGHYHUHPRVSDVVDUQRVH[DPHVµ RUDomRFRRUGHQDGDVLQGpWLFDDGYHUVDWLYD
$RUDomRHPGHVWDTXHp
D FRRUGHQDGDH[SOLFDWLYD  
E FRRUGHQDGDDGYHUVDWLYD EstudamoV ORJR GHYHUHPRV SDVVDU QRV H[DPHV  D
F FRRUGHQDGDDGLWLYD RUDomRHPGHVWDTXHQmRpLQWURGX]LGDSRUFRQMXQomRHQ-
G FRRUGHQDGDFRQFOXVLYD WmRFRRUGHQDGDDVVLQGpWLFD
H FRRUGHQDGDDVVLQGpWLFD
 
 $*(17(('8&$&,21$/²981(63²DGDS  -R\FHH0R]DUWVmRyWLPRVPDVHOHV FRQMXQomR H
5HOHLDRVHJXLQWHWUHFKR LGHLD DGYHUVDWLYD
Joyce e Mozart são ótimos, mas eles, como quase toda a $  -R\FH H 0R]DUW VmR yWLPRV SRUWDQWR HOHV FRPR
cultura humanística, têm pouca relevância para nossa vida TXDVH WRGD D FXOWXUD KXPDQtVWLFD WrP SRXFD UHOHYkQFLD
prática.
SDUDQRVVDYLGDSUiWLFD FRQFOXVLYD
6HPTXHKDMDDOWHUDomRGHVHQWLGRHGHDFRUGRFRPD
QRUPDSDGUmRGDOtQJXDSRUWXJXHVDDRVHVXEVWLWXLUR %  -R\FH H 0R]DUW VmR yWLPRV FRQIRUPH HOHV FRPR
WHUPRHPGHVWDTXHRWUHFKRHVWDUiFRUUHWDPHQWHUHHVFULWR TXDVH WRGD D FXOWXUD KXPDQtVWLFD WrP SRXFD UHOHYkQFLD
HP SDUDQRVVDYLGDSUiWLFD FRQIRUPDWLYD
$  -R\FH H 0R]DUW VmR yWLPRV SRUWDQWR HOHV FRPR & -R\FHH0R]DUWVmRyWLPRVDVVLPHOHVFRPRTXDVH
TXDVH WRGD D FXOWXUD KXPDQtVWLFD WrP SRXFD UHOHYkQFLD WRGDDFXOWXUDKXPDQtVWLFDWrPSRXFDUHOHYkQFLDSDUDQRV-
SDUDQRVVDYLGDSUiWLFD VDYLGDSUiWLFD FRQFOXVLYD
%  -R\FH H 0R]DUW VmR yWLPRV FRQIRUPH HOHV FRPR (  -R\FH H 0R]DUW VmR yWLPRV SRLV HOHV FRPR TXDVH
TXDVH WRGD D FXOWXUD KXPDQtVWLFD WrP SRXFD UHOHYkQFLD WRGDDFXOWXUDKXPDQtVWLFDWrPSRXFDUHOHYkQFLDSDUDQRV-
SDUDQRVVDYLGDSUiWLFD VDYLGDSUiWLFD H[SOLFDWLYD
& -R\FHH0R]DUWVmRyWLPRVDVVLPHOHVFRPRTXDVH Dica FRQMXQomR pois FRPR H[SOLFDWLYD  Gi SDUD HX
WRGDDFXOWXUDKXPDQtVWLFDWrPSRXFDUHOHYkQFLDSDUDQRV- VXEVWLWXLUSRUporqueFRPRFRQFOXVLYDVXEVWLWXRSRUpor-
VDYLGDSUiWLFD tanto
' -R\FHH0R]DUWVmRyWLPRVWRGDYLDHOHVFRPRTXD-
VH WRGD D FXOWXUD KXPDQtVWLFD WrP SRXFD UHOHYkQFLD SDUD
QRVVDYLGDSUiWLFD  
(  -R\FH H 0R]DUW VmR yWLPRV SRLV HOHV FRPR TXDVH IUXWR QmR Vy GR QRYR DFHVVR GD SRSXODomR DR DXWR-
WRGDDFXOWXUDKXPDQtVWLFDWrPSRXFDUHOHYkQFLDSDUDQRV- PyYHOPDVWDPEpPGDQHFHVVLGDGHGHPDLRUQ~PHURGH
VDYLGDSUiWLFD YLDJHQVHVWDEHOHFHPUHODomRGHDGLomRGHLGHLDVGHIDWRV

 $1$/,67$ $'0,1,675$7,92²981(63²  


DGDS (P²IUXWRnão sóGRQRYRDFHVVRGDSRSXODomR 1mRVHGHVHVSHUHTXHHVWDUHPRVDVHXODGRVHPSUH
DRDXWRPyYHOmas tambémGDQHFHVVLGDGHGHPDLRUQ~- FRQMXQomRH[SOLFDWLYD SRUTXH FRRUGHQDGDVLQ-
PHURGHYLDJHQV²RVWHUPRVHPGHVWDTXHHVWDEHOHFHP GpWLFDH[SOLFDWLYD
UHODomRGH
$ H[SOLFDomR Subordinação
% RSRVLomR
& DOWHUQkQFLD
2EVHUYHRH[HPSORDEDL[RGH9LQtFLXVGH0RUDHV
' FRQFOXVmR
( DGLomR
“Eu sinto que em meu gesto existe o teu
$QDOLVHDRUDomRGHVWDFDGD1mRVHGHVHVSHUHque gestoµ
estaremos a seu lado sempre. 2UDomR3ULQFLSDO 2UDomR6XERUGLQDGD
0DUTXHDRSomRFRUUHWDTXDQWRjVXDFODVVLÀFDomR
$ &RRUGHQDGDVLQGpWLFDDGLWLYD 2EVHUYH TXH QD RUDomR VXERUGLQDGD WHPRV R YHUER
% &RRUGHQDGDVLQGpWLFDDOWHUQDWLYD ´H[LVWHµTXHHVWiFRQMXJDGRQDWHUFHLUDSHVVRDGRVLQJXODU
& &RRUGHQDGDVLQGpWLFDFRQFOXVLYD GR SUHVHQWH GR LQGLFDWLYR $V RUDo}HV VXERUGLQDGDV TXH
' &RRUGHQDGDVLQGpWLFDH[SOLFDWLYD DSUHVHQWDP YHUER HP TXDOTXHU GRV WHPSRV ÀQLWRV WHP-

74
LÍNGUA PORTUGUESA

SRVGRPRGRGRLQGLFDWLYRVXEMXQWLYRHLPSHUDWLYR VmR Atenção: 2EVHUYHTXHDRUDomRVXERUGLQDGDVXEVWDQ-


FKDPDGDVGHorações desenvolvidasRXH[SOtFLWDV3RGH- WLYDSRGHVHUVXEVWLWXtGDSHORSURQRPH´LVVRµ$VVLPWH-
PRVPRGLÀFDURSHUtRGRDFLPD9HMD PRVXPSHUtRGRVLPSOHV
É fundamental isso. ou Isso é fundamental.
Eu sinto existir em meu gesto o teu gesto.
2UDomR3ULQFLSDO 2UDomR6XERUGLQDGD 'HVVDIRUPDDRUDomRFRUUHVSRQGHQWHD´LVVRµH[HUFH-
UiDIXQomRGHVXMHLWR
$ DQiOLVH GDV RUDo}HV FRQWLQXD VHQGR D PHVPD ´(X 9HMDDOJXPDVHVWUXWXUDVWtSLFDVTXHRFRUUHPQDRUDomR
VLQWRµ p D RUDomR SULQFLSDO FXMR REMHWR GLUHWR p D RUDomR SULQFLSDO
VXERUGLQDGD´H[LVWLUHPPHXJHVWRRWHXJHVWRµ1RWHTXH 1- Verbos de ligação + predicativo,HPFRQVWUXo}HV
DRUDomRVXERUGLQDGDDSUHVHQWDDJRUDYHUERQRLQÀQLWLYR GRWLSRÉ bom - É útil - É conveniente - É certo - Parece certo
$OpPGLVVRDFRQMXQomR´TXHµFRQHFWLYRTXHXQLDDVGXDV - É claro - Está evidente - Está comprovado
RUDo}HVGHVDSDUHFHX$VRUDo}HVVXERUGLQDGDVFXMRYHUER É bom que você compareça à minha festa.
VXUJHQXPDGDVIRUPDVQRPLQDLV LQÀQLWLYRÁH[LRQDGRRX
QmRJHU~QGLRRXSDUWLFtSLR FKDPDPRVorações reduzi- 2- Expressões na voz passivaFRPRSabe-se - Soube-
dasRXLPSOtFLWDV se - Conta-se - Diz-se - Comenta-se - É sabido - Foi anun-
2EV DV RUDo}HV UHGX]LGDV QmR VmR LQWURGX]LGDV SRU ciado - Ficou provado
FRQMXQo}HVQHPSURQRPHVUHODWLYRV3RGHPVHUHYHQWXDO- Sabe-se que Aline não gosta de Pedro.
PHQWHLQWURGX]LGDVSRUSUHSRVLomR
9HUERVFRPRconvir - cumprir - constar - admirar -
1) ORAÇÕES SUBORDINADAS SUBSTANTIVAS importar - ocorrer - acontecer
Convém que não se atrase na entrevista.
$RUDomRVXERUGLQDGDVXEVWDQWLYDWHPYDORUGHVXEV- Obs.TXDQGRDRUDomRVXERUGLQDGDVXEVWDQWLYDpVXE-
WDQWLYRHYHPLQWURGX]LGDJHUDOPHQWHSRUFRQMXQomRLQWH- MHWLYDRYHUERGDRUDomRSULQFLSDOHVWiVHPSUHQDSHV-
JUDQWH que, se  VRDGRVLQJXODU
b) Objetiva Direta
Suponho que você foi à biblioteca hoje.
  2UDomR6XERUGLQDGD6XEVWDQWLYD $RUDomRVXERUGLQDGDVXEVWDQWLYDREMHWLYDGLUHWDH[HU-
FHIXQomRGHREMHWRGLUHWRGRYHUERGDRUDomRSULQFLSDO
Você sabe se o presidente já chegou?
2UDomR6XERUGLQDGD6XEVWDQWLYD Todos querem sua aprovação no concurso.
   2EMHWR'LUHWR
2VSURQRPHVLQWHUURJDWLYRV TXHTXHPTXDO WDPEpP
LQWURGX]HP DV RUDo}HV VXERUGLQDGDV VXEVWDQWLYDV EHP Todos querem que você seja aprovado. 7RGRV
FRPRRVDGYpUELRVLQWHUURJDWLYRV SRUTXHTXDQGRRQGH TXHUHPLVVR
FRPR 9HMDRVH[HPSORV 2UDomR3ULQFLSDO RUDomR6XERUGLQDGD6XEVWDQWLYD
   2EMHWLYD'LUHWD
O garoto perguntou qual era o telefone da moça.
   2UDomR6XERUGLQDGD6XEVWDQWLYD $VRUDo}HVVXERUGLQDGDVVXEVWDQWLYDVREMHWLYDVGLUHWDV
GHVHQYROYLGDVVmRLQLFLDGDVSRU
Não sabemos por que a vizinha se mudou.
   2UDomR6XERUGLQDGD6XEVWDQWLYD  Conjunções integrantes ´TXHµ jV YH]HV HOtSWLFD  H
´VHµ
&ODVVLÀFDomRGDV2UDo}HV6XERUGLQDGDV $SURIHVVRUDYHULÀFRXVHWRGRVDOXQRVHVWDYDPSUHVHQ-
Substantivas tes.
3URQRPHVLQGHÀQLGRVTXHTXHPTXDOTXDQWR jV
'HDFRUGRFRPDIXQomRTXHH[HUFHQRSHUtRGRDRUD- YH]HVUHJLGRVGHSUHSRVLomR QDVLQWHUURJDo}HVLQGLUHWDV
omRVXERUGLQDGDVXEVWDQWLYDSRGHVHU O pessoal queria saber quem era o dono do carro im-
portado
a) Subjetiva
 Advérbios FRPR TXDQGR RQGH SRU TXH TXmR jV
eVXEMHWLYDTXDQGRH[HUFHDIXQomRVLQWiWLFDGHVXMHLWR YH]HVUHJLGRVGHSUHSRVLomR QDVLQWHUURJDo}HVLQGLUHWDV
GRYHUERGDRUDomRSULQFLSDO2EVHUYH Eu não sei por que ela fez isso.
É fundamental o seu comparecimento à reunião
   6XMHLWR c) Objetiva Indireta

É fundamental que você compareça à reunião. $ RUDomR VXERUGLQDGD VXEVWDQWLYD REMHWLYD LQGLUHWD
2UDomR3ULQFLSDO 2UDomR6XERUGLQDGD6XEVWDQWLYD DWXD FRPR REMHWR LQGLUHWR GR YHUER GD RUDomR SULQFLSDO
6XEMHWLYD 9HPSUHFHGLGDGHSUHSRVLomR

75
LÍNGUA PORTUGUESA

Meu pai insiste em meu estudo Fernanda tinha um grande sonhoa chegada do dia de
   2EMHWR,QGLUHWR seu casamento.
     $SRVWR
Meu pai insiste em que eu estude 0HXSDLLQ- )HUQDQGDWLQKDXPJUDQGHVRQKRisso.
VLVWHQLVVR
   2UDomR6XERUGLQDGD6XEVWDQWLYD Fernanda tinha um grande sonhoque o dia do seu ca-
   2EMHWLYD,QGLUHWD samento chegasse.
    2UDomR6XERUGLQDGD
2EVHPDOJXQVFDVRVDSUHSRVLomRSRGHHVWDUHOtSWLFD     6XEVWDQWLYD$SRVLWLYD
QDRUDomR
2) ORAÇÕES SUBORDINADAS ADJETIVAS
Marta não gosta (de) que a chamem de senhora.
   2UDomR6XERUGLQDGD6XEVWDQWLYD
8PDRUDomRVXERUGLQDGDDGMHWLYDpDTXHODTXHSRVVXL
   2EMHWLYD,QGLUHWD
YDORUHIXQomRGHDGMHWLYRRXVHMDTXHDHOHHTXLYDOH$V
RUDo}HVYrPLQWURGX]LGDVSRUSURQRPHUHODWLYRHH[HUFHP
d) Completiva Nominal
D IXQomR GH DGMXQWR DGQRPLQDO GR DQWHFHGHQWH 2EVHUYH
$RUDomRVXERUGLQDGDVXEVWDQWLYDFRPSOHWLYDQRPLQDO RH[HPSOR
FRPSOHWDXPQRPHTXHSHUWHQFHjRUDomRSULQFLSDOHWDP-
EpPYHPPDUFDGDSRUSUHSRVLomR Esta foi uma redação bem-sucedida.
6XEVWDQWLYR  $GMHWLYR $GMXQWR$GQRPLQDO
Sentimos orgulho de seu comportamento.
   &RPSOHPHQWR1RPLQDO 1RWHTXHRVXEVWDQWLYRUHGDomRIRLFDUDFWHUL]DGRSHOR
DGMHWLYREHPVXFHGLGD1HVVHFDVRpSRVVtYHOIRUPDUPRV
Sentimos orgulho de que você se comportou  RXWUDFRQVWUXomRDTXDOH[HUFHH[DWDPHQWHRPHVPRSD-
6HQWLPRVRUJXOKRGLVVR SHO9HMD
   2UDomR6XERUGLQDGD6XEVWDQWLYD
   &RPSOHWLYD1RPLQDO Esta foi uma redação que fez sucesso
2UDomR3ULQFLSDO 2UDomR6XERUGLQDGD$GMHWLYD
Lembre-seDVRUDo}HVVXERUGLQDGDVVXEVWDQWLYDVRE-
MHWLYDVLQGLUHWDVLQWHJUDPRVHQWLGRGHXPYHUERHQTXDQWR 3HUFHEDTXHDFRQH[mRHQWUHDRUDomRVXERUGLQDGDDG-
TXHRUDo}HVVXERUGLQDGDVVXEVWDQWLYDVFRPSOHWLYDVQRPL- MHWLYDHRWHUPRGDRUDomRSULQFLSDOTXHHODPRGLÀFDpIHLWD
QDLVLQWHJUDPRVHQWLGRGHXPQRPH3DUDGLVWLQJXLUXPD SHORSURQRPHUHODWLYR´TXHµ$OpPGHFRQHFWDU RXUHODFLR-
GDRXWUDpQHFHVViULROHYDUHPFRQWDRWHUPRFRPSOHPHQ- QDU  GXDV RUDo}HV R SURQRPH UHODWLYR GHVHPSHQKD XPD
WDGR(VVDpDOLiVDGLIHUHQoDHQWUHRREMHWRLQGLUHWRHR IXQomRVLQWiWLFDQDRUDomRVXERUGLQDGDRFXSDRSDSHOTXH
FRPSOHPHQWRQRPLQDORSULPHLURFRPSOHPHQWDXPYHUER VHULDH[HUFLGRSHORWHUPRTXHRDQWHFHGH
RVHJXQGRXPQRPH 2EV SDUD TXH GRLV SHUtRGRV VH XQDP QXP SHUtRGR
FRPSRVWRDOWHUDVHRPRGRYHUEDOGDVHJXQGDRUDomR
e) Predicativa
Atenção: 9DOH OHPEUDU XP UHFXUVR GLGiWLFR SDUD UH-
$ RUDomR VXERUGLQDGD VXEVWDQWLYD SUHGLFDWLYD H[HUFH FRQKHFHU R SURQRPH UHODWLYR ´TXHµ HOH VHPSUH SRGH VHU
SDSHOGHSUHGLFDWLYRGRVXMHLWRGRYHUERGDRUDomRSULQFL-
VXEVWLWXtGRSRUo qual - a qual - os quais - as quais
SDOHYHPVHPSUHGHSRLVGRYHUERVHU
5HÀURPHDRDOXQRTXHpHVWXGLRVR
Nosso desejo era sua desistência.
(VVDRUDomRpHTXLYDOHQWHD
   3UHGLFDWLYRGR6XMHLWR
5HÀURPHDRDOXQRRTXDOHVWXGD
Nosso desejo era que ele desistisse 1RVVRGHVH-
MRHUDLVVR Forma das Orações Subordinadas Adjetivas
   2UDomR6XERUGLQDGD6XEVWDQWLYD
   3UHGLFDWLYD 4XDQGR VmR LQWURGX]LGDV SRU XP SURQRPH UHODWLYR H
DSUHVHQWDP YHUER QR PRGR LQGLFDWLYR RX VXEMXQWLYR DV
2EV HP FHUWRV FDVRV XVDVH D SUHSRVLomR H[SOHWLYD RUDo}HVVXERUGLQDGDVDGMHWLYDVVmRFKDPDGDVGHVHQYROYL-
´GHµSDUDUHDOFH9HMDRH[HPSORA impressão é de que não GDV$OpPGHODVH[LVWHPDVRUDo}HVVXERUGLQDGDVDGMHWLYDV
fui bem na prova UHGX]LGDVTXHQmRVmRLQWURGX]LGDVSRUSURQRPHUHODWLYR
SRGHP VHU LQWURGX]LGDV SRU SUHSRVLomR  H DSUHVHQWDP R
f) Apositiva YHUER QXPD GDV IRUPDV QRPLQDLV LQÀQLWLYR JHU~QGLR RX
SDUWLFtSLR 
$ RUDomR VXERUGLQDGD VXEVWDQWLYD DSRVLWLYD H[HUFH Ele foi o primeiro aluno que se apresentou.
IXQomRGHDSRVWRGHDOJXPWHUPRGDRUDomRSULQFLSDO Ele foi o primeiro aluno a se apresentar.

76
LÍNGUA PORTUGUESA

1RSULPHLURSHUtRGRKiXPDRUDomRVXERUGLQDGDDG- Durante a madrugada, eu olhei você dormindo


MHWLYD GHVHQYROYLGD Mi TXH p LQWURGX]LGD SHOR SURQRPH OrDomR6XERUGLQDGD$GYHUELDO
UHODWLYR ´TXHµ H DSUHVHQWD YHUER FRQMXJDGR QR SUHWpULWR 2EVHUYH TXH D RUDomR HP GHVWDTXH DJUHJD XPD FLU-
SHUIHLWRGRLQGLFDWLYR1RVHJXQGRKiXPDRUDomRVXERU- FXQVWkQFLDGHWHPSReSRUWDQWRFKDPDGDGHRUDomRVX-
GLQDGDDGMHWLYDUHGX]LGDGHLQÀQLWLYRQmRKiSURQRPHUH- ERUGLQDGDDGYHUELDOWHPSRUDO2VDGMXQWRVDGYHUELDLVVmR
ODWLYRHVHXYHUERHVWiQRLQÀQLWLYR WHUPRV DFHVVyULRV TXH LQGLFDP XPD FLUFXQVWkQFLD UHIH-
UHQWHYLDGHUHJUDDXPYHUER$FODVVLÀFDomRGRDGMXQWR
&ODVVLÀFDomRGDV2UDo}HV6XERUGLQDGDV$GMHWLYDV DGYHUELDOGHSHQGHGDH[DWDFRPSUHHQVmRGDFLUFXQVWkQFLD
TXHH[SULPH2EVHUYHRVH[HPSORVDEDL[R
1DUHODomRTXHHVWDEHOHFHPFRPRWHUPRTXHFDUDFWH- Naquele momento, senti uma das maiores emoções de
UL]DPDVRUDo}HVVXERUGLQDGDVDGMHWLYDVSRGHPDWXDUGH minha vida.
Quando vi a estátua, senti uma das maiores emoções de
GXDV PDQHLUDV GLIHUHQWHV +i DTXHODV TXH UHVWULQJHP RX
minha vida.
HVSHFLÀFDP R VHQWLGR GR WHUPR D TXH VH UHIHUHP LQGLYL-
GXDOL]DQGRR1HVVDVRUDo}HVQmRKiPDUFDomRGHSDXVD 1R SULPHLUR SHUtRGR ´QDTXHOH PRPHQWRµ p XP DG-
VHQGRFKDPDGDVVXERUGLQDGDVDGMHWLYDVUHVWULWLYDV([LVWHP MXQWR DGYHUELDO GH WHPSR TXH PRGLÀFD D IRUPD YHUEDO
WDPEpP RUDo}HV TXH UHDOoDP XP GHWDOKH RX DPSOLÀFDP ´VHQWLµ 1R VHJXQGR SHUtRGR HVVH SDSHO p H[HUFLGR SHOD
dados sobre o antecedente TXH Mi VH HQFRQWUD VXÀFLHQWH- RUDomR´4XDQGRYLDHVWiWXDµTXHpSRUWDQWRXPDRUDomR
PHQWHGHÀQLGRDVTXDLVGHQRPLQDPVHsubordinadas ad- VXERUGLQDGD DGYHUELDO WHPSRUDO (VVD RUDomR p GHVHQYRO-
jetivas explicativas. YLGDSRLVpLQWURGX]LGDSRUXPDFRQMXQomRVXERUGLQDWLYD
([HPSOR TXDQGR HDSUHVHQWDXPDIRUPDYHUEDOGRPRGRLQGLFDWL-
-DPDLVWHULDFKHJDGRDTXLQmRIRVVHDJHQWLOH]DGHXP YR ´YLµGRSUHWpULWRSHUIHLWRGRLQGLFDWLYR 6HULDSRVVtYHO
KRPHPque passava naquele momento UHGX]LODREWHQGRVH
2UDomR6XERUGLQDGD$GMHWLYD
5HVWULWLYD Ao ver a estátua, senti uma das maiores emoções de
minha vida.
1HVVHSHUtRGRREVHUYHTXHDRUDomRHPGHVWDTXHUHV-
WULQJHHSDUWLFXODUL]DRVHQWLGRGDSDODYUD´KRPHPµWUDWD $RUDomRHPGHVWDTXHpUHGX]LGDSRLVDSUHVHQWDXPD
VHGHXPKRPHPHVSHFtÀFR~QLFR$RUDomROLPLWDRXQL- GDVIRUPDVQRPLQDLVGRYHUER ´YHUµQRLQÀQLWLYR HQmRp
YHUVRGHKRPHQVLVWRpQmRVHUHIHUHDWRGRVRVKRPHQV LQWURGX]LGDSRUFRQMXQomRVXERUGLQDWLYDPDVVLPSRUXPD
SUHSRVLomR ´DµFRPELQDGDFRPRDUWLJR´Rµ 
PDVVLPjTXHOHTXHHVWDYDSDVVDQGRQDTXHOHPRPHQWR
([HPSOR
2EVDFODVVLÀFDomRGDVRUDo}HVVXERUGLQDGDVDGYHU-
2 KRPHP que se considera racional PXLWDV YH]HV ELDLVpIHLWDGRPHVPRPRGRTXHDFODVVLÀFDomRGRVDG-
DJHDQLPDOHVFDPHQWH MXQWRVDGYHUELDLV%DVHLDVHQDFLUFXQVWkQFLDH[SUHVVDSHOD
2UDomR6XERUGLQDGD$GMHWLYD([SOLFDWLYD RUDomR

1HVVHSHUtRGRDRUDomRHPGHVWDTXHQmRWHPVHQWLGR Circunstâncias Expressas


UHVWULWLYRHPUHODomRjSDODYUD´KRPHPµQDYHUGDGHHVVD pelas Orações Subordinadas Adverbiais
RUDomR DSHQDV H[SOLFLWD XPD LGHLD TXH Mi VDEHPRV HVWDU
FRQWLGDQRFRQFHLWRGH´KRPHPµ a) Causa
6DLEDTXH
$ RUDomR VXERUGLQDGD DGMHWLYD H[SOLFDWLYD p VHSDUDGD $ LGHLD GH FDXVD HVWi GLUHWDPHQWH OLJDGD jTXLOR TXH
GDRUDomRSULQFLSDOSRUXPDSDXVDTXHQDHVFULWDpUHSUH- SURYRFDXPGHWHUPLQDGRIDWRDRPRWLYRGRTXHVHGHFODUD
VHQWDGDSHODYtUJXODeFRPXPSRULVVRTXHDSRQWXDomR QDRUDomRSULQFLSDO´eDTXLORRXDTXHOHTXHGHWHUPLQDXP
VHMDLQGLFDGDFRPRIRUPDGHGLIHUHQFLDUDVRUDo}HVH[SOL- DFRQWHFLPHQWRµ
FDWLYDVGDVUHVWULWLYDVGHIDWRas explicativas vêm sempre 3ULQFLSDOFRQMXQomRVXERUGLQDWLYDFDXVDO32548(
isoladas por vírgulas; as restritivas, não. 2XWUDV FRQMXQo}HV H ORFXo}HV FDXVDLV como (sempre
introduzido na oração anteposta à oração principal), pois,
pois que, já que, uma vez que, visto que.
3) ORAÇÕES SUBORDINADAS ADVERBIAIS
$VUXDVÀFDUDPDODJDGDVSRUTXHDFKXYDIRLPXLWRIRUWH
Como ninguém se interessou pelo projeto, não houve al-
8PDRUDomRVXERUGLQDGDDGYHUELDOpDTXHODTXHH[HU- ternativa a não ser cancelá-lo.
FHDIXQomRGHDGMXQWRDGYHUELDOGRYHUERGDRUDomRSULQ- Já que você não vai, eu também não vou.
FLSDO'HVVDIRUPDSRGHH[SULPLUFLUFXQVWkQFLDGHWHPSR
PRGRÀPFDXVDFRQGLomRKLSyWHVHHWF4XDQGRGHVHQ- b) Consequência
YROYLGD YHP LQWURGX]LGD SRU XPD GDV FRQMXQo}HV VXERU-
GLQDWLYDV FRP H[FOXVmR GDV LQWHJUDQWHV  &ODVVLÀFDVH GH $V RUDo}HV VXERUGLQDGDV DGYHUELDLV FRQVHFXWLYDV H[-
DFRUGRFRPDFRQMXQomRRXORFXomRFRQMXQWLYDTXHDLQ- SULPHPXPIDWRTXHpFRQVHTXrQFLDTXHpHIHLWRGRTXH
WURGX] VHGHFODUDQDRUDomRSULQFLSDO6mRLQWURGX]LGDVSHODVFRQ-

77
LÍNGUA PORTUGUESA

MXQo}HVHORFXo}HVque, de forma que, de sorte que, tanto e) Comparação


queHWFHSHODVHVWUXWXUDVtão...que, tanto...que, tamanho...
que. $V RUDo}HV VXERUGLQDGDV DGYHUELDLV FRPSDUDWLYDV HV-
3ULQFLSDO FRQMXQomR VXERUGLQDWLYD FRQVHFXWLYD 48( WDEHOHFHPXPDFRPSDUDomRFRPDDomRLQGLFDGDSHORYHU-
SUHFHGLGRGHWDOWDQWRWmRWDPDQKR ERGDRUDomRSULQFLSDO
É feio que dói eWmRIHLRTXHHPFRQVHTXrQFLDFDXVD 3ULQFLSDOFRQMXQomRVXERUGLQDWLYDFRPSDUDWLYD&202
GRU Ele dorme como um urso.
Nunca abandonou seus ideais, de sorte que acabou con-
cretizando-os. 6DLEDTXHeFRPXPDRPLVVmRGRYHUERQDVRUDo}HV
Não consigo ver televisão sem bocejar. 2UDomR5HGX]L- VXERUGLQDGDVDGYHUELDLVFRPSDUDWLYDV3RUH[HPSOR
GDGH,QÀQLWLYR Agem como crianças. DJHP 
2UDomR6XERUGLQDGD$GYHUELDO&RPSDUDWLYD
c) Condição 1R HQWDQWR TXDQGR VH FRPSDUDP Do}HV GLIHUHQWHV
LVVR QmR RFRUUH 3RU H[HPSOR Ela fala mais do que faz
&RQGLomRpDTXLORTXHVHLPS}HFRPRQHFHVViULRSDUD FRPSDUDomRGRYHUERIDODUHGRYHUERID]HU 
DUHDOL]DomRRXQmRGHXPIDWR$VRUDo}HVVXERUGLQDGDV
DGYHUELDLVFRQGLFLRQDLVH[SULPHPRTXHGHYHRXQmRRFRU-
f) Conformidade
UHUSDUDTXHVHUHDOL]HRXGHL[HGHVHUHDOL]DURIDWRH[SUHV-
VRQDRUDomRSULQFLSDO
$VRUDo}HVVXERUGLQDGDVDGYHUELDLVFRQIRUPDWLYDVLQ-
3ULQFLSDOFRQMXQomRVXERUGLQDWLYDFRQGLFLRQDO6(
GLFDPLGHLDGHFRQIRUPLGDGHRXVHMDH[SULPHPXPDUH-
2XWUDV FRQMXQo}HV FRQGLFLRQDLV caso, contanto que,
JUDXPPRGHORDGRWDGRSDUDDH[HFXomRGRTXHVHGHFOD-
desde que, salvo se, exceto se, a não ser que, a menos que,
sem que, uma vez que (seguida de verbo no subjuntivo). UDQDRUDomRSULQFLSDO
Se o regulamento do campeonato for bem elaborado, 3ULQFLSDOFRQMXQomRVXERUGLQDWLYDFRQIRUPDWLYD&21-
certamente o melhor time será campeão. )250(
Uma vez que todos aceitem a proposta, assinaremos o 2XWUDV FRQMXQo}HV FRQIRUPDWLYDV como, consoante e
contrato. segundo WRGDVFRPRPHVPRYDORUGHFRQIRUPH 
Caso você se case, convide-me para a festa. Fiz o bolo conforme ensina a receita.
Consoante reza a Constituição, todos os cidadãos têm
d) Concessão direitos iguaiV

$V RUDo}HV VXERUGLQDGDV DGYHUELDLV FRQFHVVLYDV LQ- g) Finalidade


GLFDP FRQFHVVmR jV Do}HV GR YHUER GD RUDomR SULQFLSDO
LVWRpDGPLWHPXPDFRQWUDGLomRRXXPIDWRLQHVSHUDGR$ $V RUDo}HV VXERUGLQDGDV DGYHUELDLV ÀQDLV LQGLFDP D
LGHLDGHFRQFHVVmRHVWiGLUHWDPHQWHOLJDGDDRFRQWUDVWHj LQWHQomR D ÀQDOLGDGH GDTXLOR TXH VH GHFODUD QD RUDomR
TXHEUDGHH[SHFWDWLYD SULQFLSDO
3ULQFLSDOFRQMXQomRVXERUGLQDWLYDFRQFHVVLYD(0%25$ 3ULQFLSDOFRQMXQomRVXERUGLQDWLYDÀQDO$),0'(48(
8WLOL]DVH WDPEpP D FRQMXQomR conquanto H DV ORFX- 2XWUDVFRQMXQo}HVÀQDLVque, porque (= para que) HD
o}HVainda que, ainda quando, mesmo que, se bem que, pos- ORFXomRFRQMXQWLYDpara que.
to que, apesar de que. $SUR[LPHLPHGHODDÀPGHTXHÀFiVVHPRVDPLJRV
Só irei se ele for. Felipe abriu a porta do carro para que sua namorada
entrasse.
$RUDomRDFLPDH[SUHVVDXPDFRQGLomRRIDWRGH´HXµ
LUVyVHUHDOL]DUiFDVRHVVDFRQGLomRVHMDVDWLVIHLWD&RP- h) Proporção
SDUHDJRUDFRP
$VRUDo}HVVXERUGLQDGDVDGYHUELDLVSURSRUFLRQDLVH[-
Irei mesmo que ele não vá.
SULPHPLGHLDGHSURSRUomRRXVHMDXPIDWRVLPXOWkQHRDR
$ GLVWLQomR ÀFD QtWLGD WHPRV DJRUD XPD FRQFHVVmR
H[SUHVVRQDRUDomRSULQFLSDO
LUHLGHTXDOTXHUPDQHLUDLQGHSHQGHQWHPHQWHGHVXDLGD$
3ULQFLSDO ORFXomR FRQMXQWLYD VXERUGLQDWLYD SURSRUFLR-
RUDomRGHVWDFDGDpSRUWDQWRVXERUGLQDGDDGYHUELDOFRQ-
QDO­352325d®248(
FHVVLYD2EVHUYHRXWURVH[HPSORV
(PERUDÀ]HVVHFDORUOHYHLDJDVDOKR
Conquanto a economia tenha crescido, pelo menos me- 2XWUDVORFXo}HVFRQMXQWLYDVSURSRUFLRQDLV à medida
tade da população continua à margem do mercado de con- que, ao passo que. Há ainda as estruturas: quanto maior...
sumo. (maior), quanto maior...(menor), quanto menor...(maior),
Foi aprovado sem estudar VHPTXHHVWXGDVVHHP- quanto menor...(menor), quanto mais...(mais), quanto mais...
ERUDQmRHVWXGDVVH  UHGX]LGDGHLQÀQLWLYR (menos), quanto menos...(mais), quanto menos...(menos).

78
LÍNGUA PORTUGUESA

À proporção que estudávamos, acertávamos mais ques- metrópole. Mas não é o caso. Temos, hoje, um esvaziamento
tões. gradual do centro, com deslocamento das atividades para
Visito meus amigos à medida que eles me convidam. diversas regiões da cidade.
Quanto maior for a altura, maior será o tombo A visão de adensamento com uso abundante de trans-
porte coletivo precisa ser recuperada. Desse modo, será pos-
i) Tempo sível reverter esse processo de uso cada vez mais intenso do
transporte individual, fruto não só do novo acesso da popu-
$V RUDo}HV VXERUGLQDGDV DGYHUELDLV WHPSRUDLV DFUHV- lação ao automóvel, mas também da necessidade de maior
FHQWDP XPD LGHLD GH WHPSR DR IDWR H[SUHVVR QD RUDomR número de viagens em função da distância cada vez maior
SULQFLSDOSRGHQGRH[SULPLUQRo}HVGHVLPXOWDQHLGDGHDQ- entre os destinos da população.
WHULRULGDGHRXSRVWHULRULGDGH +HQULTXH0HLUHOOHV)ROKDGH63DXOR
$GDSWDGR
3ULQFLSDOFRQMXQomRVXERUGLQDWLYDWHPSRUDO48$1'2
2XWUDVFRQMXQo}HVVXERUGLQDWLYDVWHPSRUDLVenquan- $V H[SUHVV}HV mais denso e menos trânsito QR WtWXOR
to, mal e locuções conjuntivas: assim que, logo que, todas as HVWDEHOHFHPHQWUHVLXPDUHODomRGH
vezes que, antes que, depois que, sempre que, desde que, HWF $ FRPSDUDomRHDGLomR
% FDXVDHFRQVHTXrQFLD
Quando você foi embora, chegaram outros convidados. & FRQIRUPLGDGHHQHJDomR
Sempre que ele vem, ocorrem problemas. ' KLSyWHVHHFRQFHVVmR
Mal você saiu, ela chegou. ( DOWHUQkQFLDHH[SOLFDomR
Terminada a festa, todos se retiraram 4XDQGRWHUPL-
QRXDIHVWD  2UDomR5HGX]LGDGH3DUWLFtSLR  $*(17( '( (6&2/7$ ( 9,*,/Ç1&,$ 3(1,7(1-
&,É5,$ ² 981(63 ²   1R WUHFKR ² 7HP VXUWLGR XP
)RQWH HIHLWRSRVLWLYRSRUHOHVVHWRUQDUHPXPDUHIHUrQFLDSRVLWL-
KWWSZZZVRSRUWXJXHVFRPEUVHFRHVVLQWVLQW YDGHQWURGDXQLGDGH, já queFXPSUHPPHOKRUDVUHJUDV
SKS UHVSHLWDPRSUy[LPRHSHQVDPPHOKRUQDVVXDVDo}HVUH-
ÁHWHPDQWHVGHWRPDUXPDDWLWXGH²RWHUPRHPGHVWDTXH
HVWDEHOHFHHQWUHDVRUDo}HVXPDUHODomRGH
Questões sobre Orações Subordinadas
$ FRQGLomR
% FDXVD
01. 3$3,/26&23,67$32/,&,$/²981(6S 
& FRPSDUDomR
' WHPSR
( FRQFHVVmR
Mais denso, menos trânsito

 8)90*  $V RUDo}HV VXERUGLQDGDV VXEVWDQWLYDV


As grandes cidades brasileiras estão congestionadas e
em processo de deterioração agudizado pelo crescimento TXH DSDUHFHP QRV SHUtRGRV DEDL[R VmR WRGDV VXEMHWLYDV
HFRQ{PLFRGD~OWLPDGpFDGD([LVWHPGHÀFLrQFLDVHYLGHQWHV H[FHWR
em infraestrutura, mas é importante também considerar o $ 'HFLGLXVHTXHRSHWUyOHRVXELULDGHSUHoR
planejamento urbano. %  e PXLWR ERP TXH R KRPHP YH] SRU RXWUD UHÁLWD
Muitas grandes cidades adotaram uma abordagem de VREUHVXDYLGD
desconcentração, incentivando a criação de diversos centros & ,JQRUDVTXDQWRFXVWRXPHXUHOyJLR"
urbanos, na visão de que isso levaria a uma maior facilidade '  3HUJXQWRXVH DR GLUHWRU TXDQGR VHUtDPRV UHFHEL-
de deslocamento. GRV
Mas o efeito tem sido o inverso. A criação de diversos ( &RQYLQKDQRVTXHYRFrHVWLYHVVHSUHVHQWHjUHXQLmR
centros e o aumento das distâncias multiplicam o número de
YLDJHQVGLÀFXOWDQGRRLQYHVWLPHQWRHPWUDQVSRUWHFROHWLYRH
aumentando a necessidade do transporte individual.
Se olharmos Los Angeles como a região que levou a
GHVFRQFHQWUDomRDRH[WUHPRÀFDPFODUDVDVFRQVHTXrQFLDV
Numa região rica como a Califórnia, com enorme investi-
mento viário, temos engarrafamentos gigantescos que vira-
ram característica da cidade.
Os modelos urbanos bem-sucedidos são aqueles com
elevado adensamento e predominância do transporte coleti-
vo, como mostram Manhattan e Tóquio.
O centro histórico de São Paulo é a região da cidade
mais bem servida de transporte coletivo, com infraestrutura
de telecomunicação, água, eletricidade etc. Como em outras
grandes cidades, essa deveria ser a região mais adensada da

79
LÍNGUA PORTUGUESA

 $*(17('(9,*,/Ç1&,$(5(&(3d®2²981(63 ' 9LVWRTXHFRPDGHVFRQFHQWUDomRHRDXPHQWRGD


² &RQVLGHUHDWLULQKDHPTXHVHYr+RQLFRQYHUVDQ- H[WHQVmRXUEDQDYHULÀFDGRVQR%UDVLOpLPSRUWDQWHGHVHQ-
GRFRPVHX1DPRUDGR/XWH YROYHUHDGHQVDUDLQGDPDLVRVGLYHUVRVFHQWURVMiH[LVWHQ-
WHV
( 'HPDQHLUDTXHFRPDGHVFRQFHQWUDomRHRDXPHQ-
WRGDH[WHQVmRXUEDQDYHULÀFDGRVQR%UDVLOpLPSRUWDQWH
GHVHQYROYHU H DGHQVDU DLQGD PDLV RV GLYHUVRV FHQWURV Mi
H[LVWHQWHV

 $1$/,67$$'0,1,675$7,92²981(63² 
(P²eIXQGDPHQWDOTXHHVVDYLVmRGHDGHQVDPHQWRFRP
XVRDEXQGDQWHGHWUDQVSRUWHFROHWLYRVHMDUHFXSHUDGD para
queSRVVDPRVUHYHUWHUHVVHSURFHVVRGHXVR¬²DH[SUHV-
VmRHPGHVWDTXHHVWDEHOHFHHQWUHDVRUDo}HVUHODomRGH
$ FRQVHTXrQFLD
% FRQGLomR
& ÀQDOLGDGH
' FDXVD
( FRQFHVVmR

 $1$/,67$ '( 6,67(0$6 ² 981(63 ²  ²


DGDS  &RQVLGHUH R WUHFKR ´Como as músicas eram de
protesto, naquele mesmo ano foi enquadrado na lei de se-
gurança nacional pela ditadura militar e exilado.µ2WHUPR
Como, HP GHVWDTXH QD SULPHLUD SDUWH GR HQXQFLDGR H[-
SUHVVDLGHLDGH
'LN%URZQH)ROKDGH63DXOR $ FRQWUDVWHHWHPVHQWLGRHTXLYDOHQWHDSRUpP
% FRQFHVVmRHWHPVHQWLGRHTXLYDOHQWHDPHVPRTXH
& FRQIRUPLGDGHHWHPVHQWLGRHTXLYDOHQWHDFRQIRU-
eFRUUHWRDÀUPDUTXHDH[SUHVVmRcontanto queHVWD-
PH
EHOHFHHQWUHDVRUDo}HVUHODomRGH
' FDXVDHWHPVHQWLGRHTXLYDOHQWHDYLVWRTXH
$ FDXVDSRLV+RQLTXHUWHUÀOKRVHQmRGHVHMDWUDED-
( ÀQDOLGDGHHWHPVHQWLGRHTXLYDOHQWHDSDUDTXH
OKDUGHSRLVGHFDVDGD
%  FRPSDUDomR SRLV R QDPRUDGR HVSHUD WHU VXFHVVR  $1$/,67$(03/$1(-$0(17225d$0(172(
FRPRFDQWRUURPkQWLFR ),1$1d$6 3Ó%/,&$6 ² 981(63 ² DGDS   1R WUH-
& WHPSRSRLVDPERVDLQGDVmRDGROHVFHQWHVPDVMi FKR² “Fio, disjuntor, tomada, tudo!”, insiste o motorista, com
SHQVDPHPFDVDPHQWR tanto orgulho que chega a contaminar-me. –DFRQVWUXomR
' FRQGLomRSRLV/XWHVDEHTXHH[HUFHQGRDSURÀVVmR tanto ... que HVWDEHOHFHHQWUHDVFRQVWUXo}HV>FRPWDQWRRU-
GHP~VLFRSURYDYHOPHQWHJDQKDUiSRXFR JXOKR@H>TXHFKHJDDFRQWDPLQDUPH@XPDUHODomRGH
( ÀQDOLGDGHSRLV+RQLHVSHUDTXHVHXIXWXURPDULGR $ FRQGLomRHÀQDOLGDGH
WRUQHVHXPDUWLVWDIDPRVR % FRQIRUPLGDGHHSURSRUomR
& ÀQDOLGDGHHFRQFHVVmR
 $1$/,67$$'0,1,675$7,92²981(63²  ' SURSRUomRHFRPSDUDomR
(P²Apesar da desconcentração e do aumento da ex- ( FDXVDHFRQVHTXrQFLD
WHQVmRXUEDQDYHULÀFDGRVQR%UDVLO,pLPSRUWDQWHGHVHQ-
YROYHUHDGHQVDUDLQGDPDLVRVGLYHUVRVFHQWURVMiH[LVWHQ- GABARITO
WHV²VHPTXHWHQKDVHXVHQWLGRDOWHUDGRRWUHFKRHP
GHVWDTXHHVWiFRUUHWDPHQWHUHHVFULWRHP
01. B 02. B 03. C 04. D 05. A
06. C 07. D 08. E
$ 0HVPRFRPDGHVFRQFHQWUDomRHRDXPHQWRGD([-
WHQVmRXUEDQDYHULÀFDGRVQR%UDVLOpLPSRUWDQWHGHVHQYRO-
RESOLUÇÃO
YHUHDGHQVDUDLQGDPDLVRVGLYHUVRVFHQWURVMiH[LVWHQWHV
% 8PDYH]TXHVHYHULÀFDDGHVFRQFHQWUDomRHRDX-  
PHQWRGDH[WHQVmRXUEDQDQR%UDVLOpLPSRUWDQWHGHVHQ- PDLV GHQVR H PHQRV WUkQVLWR  PDLV GHQVR FRQVH-
YROYHUHDGHQVDUDLQGDPDLVRVGLYHUVRVFHQWURVMiH[LVWHQ- TXHQWHPHQWHPHQRVWUkQVLWRHQWmRFDXVDHFRQVHTXrQFLD
WHV
& $VVLPFRPRVmRYHULÀFDGRVDGHVFRQFHQWUDomRHR  
DXPHQWR GD H[WHQVmR XUEDQD QR %UDVLO p LPSRUWDQWH GH- MiTXHFXPSUHPPHOKRUDVUHJUDV HVWDEHOHFHHQWUH
VHQYROYHUHDGHQVDUDLQGDPDLVRVGLYHUVRVFHQWURVMiH[LV- DVRUDo}HVXPDUHODomRGHFDXVDFRPDFRQVHTXrQFLDGH
WHQWHV ´WHPXPHIHLWRSRVLWLYRµ

80
LÍNGUA PORTUGUESA

  Observação:
,JQRUDVTXDQWRFXVWRXPHXUHOyJLR" RUDomRVXERU-
GLQDGDVXEVWDQWLYDREMHWLYDGLUHWD 1RFDVRGHRFROHWLYRDSDUHFHUVHJXLGRGHDGMXQWR
$RUDomRQmRDWHQGHDRVUHTXLVLWRVGHWDLVRUDo}HVRX DGQRPLQDOQRSOXUDORYHUERSHUPDQHFHUiQRVLQJXODURX
VHMDQmRVHLQLFLDFRPYHUERGHOLJDomRWDPSRXFRSHORV SRGHUiLUSDUDRSOXUDO
YHUERV´FRQYLUµ´SDUHFHUµ´LPSRUWDUµ´FRQVWDUµHWFHWDP- Uma multidão de pessoas saiu aos gritos.
EpPQmRLQLFLDFRPDVFRQMXQo}HVLQWHJUDQWHV´TXHµH´VHµ Uma multidão de pessoas saíram aos gritos.

    4XDQGR R VXMHLWR p UHSUHVHQWDGR SRU H[SUHVV}HV


D H[SUHVVmR contanto que HVWDEHOHFH XPD UHODomR GH SDUWLWLYDVUHSUHVHQWDGDVSRU´D maioria de, a maior parte
FRQGLomR FRQGLFLRQDO de, a metade de, uma porção de” HQWUHRXWUDVRYHUERWDQWR
SRGH FRQFRUGDU FRP R Q~FOHR GHVVDV H[SUHVV}HV TXDQWR
 
FRPRVXEVWDQWLYRTXHDVHJXHA maioria dos alunos resol-
$SHVDUGDGHVFRQFHQWUDomRHGRDXPHQWRGDH[WHQVmR
XUEDQDYHULÀFDGRVQR%UDVLO FRQMXQomRFRQFHVVLYD YHXÀFDU$PDLRULDGRVDOXQRVUHVROYHUDPÀFDU
% 8PDYH]TXHVHYHULÀFDDGHVFRQFHQWUDomRHRDX-
PHQWRGDH[WHQVmRXUEDQDQR%UDVLO FDXVDO  1RFDVRGHRVXMHLWRVHUUHSUHVHQWDGRSRUH[SUHV-
& $VVLPFRPRVmRYHULÀFDGRVDGHVFRQFHQWUDomRHR V}HVDSUR[LPDWLYDVUHSUHVHQWDGDVSRU´cerca de, perto deµ
DXPHQWRGDH[WHQVmRXUEDQDQR%UDVLO FRPSDUDWLYD RYHUERFRQFRUGDFRPRVXEVWDQWLYRGHWHUPLQDGRSRUHODV
' 9LVWRTXHFRPDGHVFRQFHQWUDomRHRDXPHQWRGD Cerca de mil candidatos se inscreveram no concurso.
H[WHQVmRXUEDQDYHULÀFDGRVQR%UDVLO FDXVDO
( 'HPDQHLUDTXHFRPDGHVFRQFHQWUDomRHRDXPHQ-  (PFDVRVHPTXHRVXMHLWRpUHSUHVHQWDGRSHODH[-
WRGDH[WHQVmRXUEDQDYHULÀFDGRVQR%UDVLO FRQVHFXWLYDV SUHVVmR´mais de umµRYHUERSHUPDQHFHQRVLQJXODUMais
de um candidato se inscreveu no concurso de piadas.
  2EVHUYDomR
SDUDTXHSRVVDPRV FRQMXQomRÀQDO ÀQDOLGDGH 1RFDVRGDUHIHULGDH[SUHVVmRDSDUHFHUUHSHWLGDRX
DVVRFLDGDDXPYHUERTXHH[SULPHUHFLSURFLGDGHRYHUER
  QHFHVVDULDPHQWHGHYHUiSHUPDQHFHUQRSOXUDO
´&RPRDVP~VLFDVHUDPGHSURWHVWR H[SUHVVDLGHLD Mais de um aluno, mais de um professor contribuíram
GH FDXVD GD FRQVHTXrQFLD ´IRL  HQTXDGUDGRµ    FDXVD H na campanha de doação de alimentos.
WHPVHQWLGRHTXLYDOHQWHDvisto que.
Mais de um formando se abraçaram durante as soleni-
dades de formatura.
 
FRP WDQWR RUJXOKR TXH FKHJD D FRQWDPLQDUPH ² D
FRQVWUXomRHVWDEHOHFHXPDUHODomRGHFDXVDHFRQVHTXrQ-   4XDQGR R VXMHLWR IRU FRPSRVWR GD H[SUHVVmR ´um
FLD DFDXVDGD´FRQWDPLQDomRµ²FRQVHTXrQFLD dos queµRYHUERSHUPDQHFHUiQRSOXUDOEsse jogador foi
um dos que atuaram na Copa América.
CONCORDÂNCIA
  (P FDVRV UHODWLYRV j FRQFRUGkQFLD FRP ORFXo}HV
$R IDODUPRV VREUH D concordância verbal, HVWDPRV SURQRPLQDLVUHSUHVHQWDGDVSRU´algum de nós, qual de vós,
QRVUHIHULQGRjUHODomRGHGHSHQGrQFLDHVWDEHOHFLGDHQWUH quais de vós, alguns de nósµHQWUHRXWUDVID]VHQHFHVViULR
XPWHUPRHRXWURPHGLDQWHXPFRQWH[WRRUDFLRQDO'HVWD QRVDWHUPRVDGXDVTXHVW}HVEiVLFDV
IHLWDRVDJHQWHVSULQFLSDLVGHVVHSURFHVVRVmRUHSUHVHQWD-  1R FDVR GH R SULPHLUR SURQRPH HVWDU H[SUHVVR QR
GRVSHORVXMHLWRTXHQRFDVRIXQFLRQDFRPRVXERUGLQDQWH SOXUDO R YHUER SRGHUi FRP HOH FRQFRUGDU FRPR SRGHUi
HRYHUERRTXDOGHVHPSHQKDDIXQomRGHVXERUGLQDGR WDPEpPFRQFRUGDUFRPRSURQRPHSHVVRDOAlguns de nós
'HVVDIRUPDWHPRVTXHDFRQFRUGkQFLDYHUEDOFDUDF- o receberemos. / Alguns de nós o receberão.
WHUL]DVHSHODDGDSWDomRGRYHUERWHQGRHPYLVWDRVTXH- 4XDQGRRSULPHLURSURQRPHGDORFXomRHVWLYHUH[-
VLWRV´Q~PHURHSHVVRDµHPUHODomRDRVXMHLWR([HPSOLÀ- SUHVVRQRVLQJXODURYHUERSHUPDQHFHUiWDPEpPQRVLQ-
FDQGRWHPRVO aluno chegou atrasado. 7HPRVTXHRYHUER JXODUAlgum de nós o receberá.
DSUHVHQWDVHQDWHUFHLUDSHVVRDGRVLQJXODUSRLVID]UHIH-
UrQFLD D XP VXMHLWR DVVLP WDPEpP H[SUHVVR HOH  &RPR
  1R FDVR GH R VXMHLWR DSDUHFHU UHSUHVHQWDGR SHOR
SRGHUtDPRVWDPEpPGL]HUos alunos chegaram atrasados.
SURQRPH´quemµRYHUERSHUPDQHFHUiQDWHUFHLUDSHVVRD
Casos referentes a sujeito simples GRVLQJXODURXSRGHUiFRQFRUGDUFRPRDQWHFHGHQWHGHVVH
SURQRPHFomos nós quem contou toda a verdade para
 (PFDVRGHVXMHLWRVLPSOHVRYHUERFRQFRUGDFRP ela. / Fomos nós quem contamos toda a verdade para ela.
RQ~FOHRHPQ~PHURHSHVVRDO aluno chegou atrasado
 (PFDVRVQRVTXDLVRVXMHLWRDSDUHFHUHDOoDGRSHOD
  1RV FDVRV UHIHUHQWHV D VXMHLWR UHSUHVHQWDGR SRU SDODYUD´queµRYHUERGHYHUiFRQFRUGDUFRPRWHUPRTXH
VXEVWDQWLYRFROHWLYRRYHUERSHUPDQHFHQDWHUFHLUDSHV- DQWHFHGHHVVDSDODYUDNesta empresa somos nós que toma-
VRDGRVLQJXODU A multidão, apavorada, saiu aos gritos. mos as decisões. / Em casa sou eu que decido tudo.

81
LÍNGUA PORTUGUESA

 1RFDVRGHRVXMHLWRDSDUHFHUUHSUHVHQWDGRSRUH[- 5 &DVRVUHODWLYRVDVXMHLWRFRPSRVWRGHSDODYUDVVLQ{-
SUHVV}HV TXH LQGLFDP SRUFHQWDJHQV R YHUER FRQFRUGDUi QLPDVRXRUGHQDGRSRUHOHPHQWRVHPJUDGDomRRYHUER
FRPRQXPHUDORXFRPRVXEVWDQWLYRDTXHVHUHIHUHHVVD SRGHUiSHUPDQHFHUQRVLQJXODURXLUSDUDRSOXUDOMinha
SRUFHQWDJHP50% dos funcionários aprovaram a decisão vitória, minha conquista, minha premiação são frutos de
da diretoria. / 50% do eleitorado apoiou a decisão. meu esforço. / Minha vitória, minha conquista, minha pre-
miação é fruto de meu esforço.
Observações:
&DVRRYHUERDSDUHoDDQWHSRVWRjH[SUHVVmRGHSRU- Concordância nominal p R DMXVWH TXH ID]HPRV DRV
FHQWDJHPHVVHGHYHUiFRQFRUGDUFRPRQXPHUDOAprova- GHPDLVWHUPRVGDRUDomRSDUDTXHFRQFRUGHPHPJrQHUR
ram a decisão da diretoria 50% dos funcionários. HQ~PHURFRPRVXEVWDQWLYR7HUHPRVTXHDOWHUDUSRUWDQ-
(PFDVRVUHODWLYRVDRYHUERSHUPDQHFHUiQRVLQ- WRRDUWLJRRDGMHWLYRRQXPHUDOHRSURQRPH$OpPGLVVR
JXODU1% dos funcionários não aprovou a decisão da dire- WHPRVWDPEpPRYHUERTXHVHÁH[LRQDUijVXDPDQHLUD
toria Regra geral2DUWLJRRDGMHWLYRRQXPHUDOHRSURQR-
(PFDVRVHPTXHRQXPHUDOHVWLYHUDFRPSDQKDGRGH PHFRQFRUGDPHPJrQHURHQ~PHURFRPRVXEVWDQWLYR
GHWHUPLQDQWHV QR SOXUDO R YHUER SHUPDQHFHUi QR SOXUDO - A pequena criança é uma gracinha.
Os 50% dos funcionários apoiaram a decisão da diretoria. - O garoto que encontrei era muito gentil e simpático.
  1RV FDVRV HP TXH R VXMHLWR HVWLYHU UHSUHVHQWDGR Casos especiais 9HUHPRV DOJXQV FDVRV TXH IRJHP j
SRUSURQRPHVGHWUDWDPHQWRRYHUERGHYHUiVHUHPSUH- UHJUDJHUDOPRVWUDGDDFLPD
JDGRQDWHUFHLUDSHVVRDGRVLQJXODURXGRSOXUDOVossas D Um adjetivo após vários substantivos
Majestades gostaram das homenagens. Vossa Majestade  6XEVWDQWLYRV GH PHVPR JrQHUR DGMHWLYR YDL SDUD R
agradeceu o convite. SOXUDORXFRQFRUGDFRPRVXEVWDQWLYRPDLVSUy[LPR
- Irmão e primo recém-chegado estiveram aqui.
 &DVRVUHODWLYRVDVXMHLWRUHSUHVHQWDGRSRUVXEVWDQ- - Irmão e primo recém-chegados estiveram aqui.
WLYRSUySULRQRSOXUDOVHHQFRQWUDPUHODFLRQDGRVDDOJXQV
DVSHFWRVTXHRVGHWHUPLQDP 6XEVWDQWLYRVGHJrQHURVGLIHUHQWHVYDLSDUDRSOXUDO
'LDQWHGHQRPHVGHREUDVQRSOXUDOVHJXLGRVGRYHU-
PDVFXOLQRRXFRQFRUGDFRPRVXEVWDQWLYRPDLVSUy[LPR
ERVHUHVWHSHUPDQHFHQRVLQJXODUFRQWDQWRTXHRSUHGL-
- Ela tem pai e mãe louros.
FDWLYRWDPEpPHVWHMDQRVLQJXODUMemórias póstumas de
- Ela tem pai e mãe loura.
Brás Cubas é uma criação de Machado de Assis.
1RVFDVRVGHDUWLJRH[SUHVVRQRSOXUDORYHUERWDP-
$GMHWLYRIXQFLRQDFRPRSUHGLFDWLYRYDLREULJDWRULD-
EpPSHUPDQHFHQRSOXUDOOs Estados Unidos são uma po-
PHQWHSDUDRSOXUDO
tência mundial.
&DVRVHPTXHRDUWLJRÀJXUDQRVLQJXODURXHPTXH O homem e o menino estavam perdidos.
HOHQHPDSDUHFHRYHUERSHUPDQHFHQRVLQJXODUEstados - O homem e sua esposa estiveram hospedados aqui.
Unidos é uma potência mundial.
E Um adjetivo anteposto a vários substantivos
Casos referentes a sujeito composto  $GMHWLYR DQWHSRVWR QRUPDOPHQWH FRQFRUGD FRP R
PDLVSUy[LPR
 1RVFDVRVUHODWLYRVDVXMHLWRFRPSRVWRGHSHVVRDV Comi delicioso almoço e sobremesa.
JUDPDWLFDLVGLIHUHQWHVRYHUERGHYHUiLUSDUDRSOXUDOHV- Provei deliciosa fruta e suco.
WDQGRUHODFLRQDGRDGRLVSUHVVXSRVWRVEiVLFRV
4XDQGRKRXYHUDSHVVRDHVWDSUHYDOHFHUiVREUHDV  $GMHWLYR DQWHSRVWR IXQFLRQDQGR FRPR SUHGLFDWLYR
GHPDLVEu, tu e ele faremos um lindo passeio. FRQFRUGDFRPRPDLVSUy[LPRRXYDLSDUDRSOXUDO
4XDQGRKRXYHUDSHVVRDRYHUERSRGHUiÁH[LR- (VWDYDPIHULGRVRSDLHRVÀOKRV
QDUQDRXQDSHVVRDTu e ele sois primos. Tu e ele são (VWDYDIHULGRRSDLHRVÀOKRV
primos.
F Um substantivo e mais de um adjetivo
 1RVFDVRVHPTXHRVXMHLWRFRPSRVWRDSDUHFHUDQ- DQWHFHGHWRGRVRVDGMHWLYRVFRPXPDUWLJR
WHSRVWRDRYHUERHVWHSHUPDQHFHUiQRSOXUDOO pai e seus )DODYDÁXHQWHPHQWHDOtQJXDLQJOHVDHDHVSDQKROD
GRLVÀOKRVFRPSDUHFHUDPDRHYHQWR
FRORFDRVXEVWDQWLYRQRSOXUDO
 1RFDVRHPTXHRVXMHLWRDSDUHFHUSRVSRVWRDRYHU- )DODYDÁXHQWHPHQWHDVOtQJXDVLQJOHVDHHVSDQKROD
ERHVWHSRGHUiFRQFRUGDUFRPRQ~FOHRPDLVSUy[LPRRX
SHUPDQHFHUQRSOXUDOCompareceram ao evento o pai e seus G Pronomes de tratamento
GRLVÀOKRV&RPSDUHFHXDRHYHQWRRSDLHVHXVGRLVÀOKRV VHPSUHFRQFRUGDPFRPDSHVVRD
Vossa Santidade esteve no Brasil.
  1RV FDVRV UHODFLRQDGRV D VXMHLWR VLPSOHV SRUpP
FRP PDLV GH XP Q~FOHR R YHUER GHYHUi SHUPDQHFHU QR H Anexo, incluso, próprio, obrigado
VLQJXODUMeu esposo e grande companheiro merece toda a &RQFRUGDPFRPRVXEVWDQWLYRDTXHVHUHIHUHP
felicidade do mundo. As cartas estão anexas.

82
LÍNGUA PORTUGUESA

A bebida está inclusa. &RPRQXPHUDOVHJXHDUHJUDJHUDO


Precisamos de nomes próprios. Comi meia (metade) laranja pela manhã.
Obrigado, disse o rapaz.
Q Só
I Um(a) e outro(a), num(a) e noutro(a) DSHQDVVRPHQWH DGYpUELR LQYDULiYHO
$SyVHVVDVH[SUHVV}HVRVXEVWDQWLYRÀFDVHPSUHQR Só consegui comprar uma passagem.
VLQJXODUHRDGMHWLYRQRSOXUDO
Renato advogou um e outro caso fáceis. VR]LQKR DGMHWLYR YDULiYHO
Pusemos numa e noutra bandeja rasas o peixe. Estiveram sós durante horas.
J É bom, é necessário, é proibido )RQWH
(VVDVH[SUHVV}HVQmRYDULDPVHRVXMHLWRQmRYLHUSUH- KWWSZZZEUDVLOHVFRODFRPJUDPDWLFDFRQFRUGDQFLD
FHGLGRGHDUWLJRRXRXWURGHWHUPLQDQWH
YHUEDOKWP
Canja é bom. / A canja é boa.
É necessário sua presença. / É necessária a sua presença.
Questões sobre Concordância Nominal e Verbal
É proibido entrada de pessoas não autorizadas. / A en-
trada é proibida.
K Muito, pouco, caro  75($/²7e&1,&2-8',&,É5,2²)&& $FRQ-
&RPRDGMHWLYRVVHJXHPDUHJUDJHUDO FRUGkQFLD YHUEDO H QRPLQDO HVWi LQWHLUDPHQWH FRUUHWD QD
Comi muitas frutas durante a viagem. IUDVH
3RXFRDUUR]pVXÀFLHQWHSDUDPLP  $  $ VRFLHGDGH GHYH UHFRQKHFHU RV SULQFtSLRV H YD-
Os sapatos estavam caros. ORUHV TXH GHWHUPLQDP DV HVFROKDV GRV JRYHUQDQWHV SDUD
FRQIHULUOHJLWLPLGDGHDVXDVGHFLV}HV
&RPRDGYpUELRVVmRLQYDULiYHLV  % $FRQÀDQoDGRVFLGDGmRVHPVHXVGLULJHQWHVGH-
Comi muito durante a viagem. YHPVHUHPEDVDGRVQDSHUFHSomRGRVYDORUHVHSULQFtSLRV
Pouco lutei, por isso perdi a batalha. TXHUHJHPDSUiWLFDSROtWLFD
Comprei caro os sapatos.  & (OHLo}HVOLYUHVHGLUHWDVpJDUDQWLDGHXPYHUGDGHL-
URUHJLPHGHPRFUiWLFRHPTXHVHUHVSHLWDWDQWRDVOLEHU-
L Mesmo, bastante GDGHVLQGLYLGXDLVTXDQWRDVFROHWLYDV
&RPRDGYpUELRVLQYDULiYHLV  ' $VLQVWLWXLo}HVIXQGDPHQWDLVGHXPUHJLPHGHPR-
Preciso mesmo da sua ajuda. FUiWLFRQmRSRGHHVWDUVXERUGLQDGRjVRUGHQVLQGLVFULPL-
Fiquei bastante contente com a proposta de emprego. QDGDVGHXP~QLFRSRGHUFHQWUDO
 (  2 LQWHUHVVH GH WRGRV RV FLGDGmRV HVWmR YROWDGRV
&RPRSURQRPHVVHJXHPDUHJUDJHUDO SDUDRPRPHQWRHOHLWRUDOTXHH[S}HPDVGLIHUHQWHVRSL-
Seus argumentos foram bastantes para me convencer. QL}HVH[LVWHQWHVQDVRFLHGDGH
Os mesmos argumentos que eu usei, você copiou.
M Menos, alerta  $JHQWH7pFQLFR²)&&² $VQRUPDVGHFRQ-
(PWRGDVDVRFDVL}HVVmRLQYDULiYHLV FRUGkQFLDYHUEDOHQRPLQDOHVWmRLQWHLUDPHQWHUHVSHLWDGDV
Preciso de menos comida para perder peso. HP
Estamos alerta para com suas chamadas. $  $OJXQV GRV DVSHFWRV PDLV GHVHMiYHLV GH XPD ERD
OHLWXUDTXHVDWLVIDoDDRVOHLWRUHVHVHMDYHtFXORGHDSULPR-
N Tal Qual
UDPHQWRLQWHOHFWXDOHVWmRQDFDSDFLGDGHGHFULDomRGRDX-
 ´7DOµ FRQFRUGD FRP R DQWHFHGHQWH ´TXDOµ FRQFRUGD
WRUPHGLDQWHSDODYUDVVXDPDWpULDSULPD
FRPRFRQVHTXHQWH
% 2EUDVTXHVHFRQVLGHUDFOiVVLFDVQDOLWHUDWXUDVHP-
As garotas são vaidosas tais qual a tia.
2VSDLVYLHUDPIDQWDVLDGRVWDLVTXDLVRVÀOKRV SUH GHOLQHLD QRYRV FDPLQKRV SRLV p FDSD] GH HQFDQWDU R
OHLWRUDRXOWUDSDVVDURVOLPLWHVGDpSRFDHPTXHYLYHPVHXV
O Possível DXWRUHVJrQLRVQRGRPtQLRGDVSDODYUDVVXDPDWpULDSUL-
4XDQGRYHPDFRPSDQKDGRGH´PDLVµ´PHQRVµ´PH- PD
OKRUµ RX ´SLRUµ DFRPSDQKD R DUWLJR TXH SUHFHGH DV H[- &  $ SDODYUD PDWpULDSULPD GH SRHWDV H URPDQFLVWDV
SUHVV}HV OKHSHUPLWHPFULDUWRGRXPPXQGRGHÀFomRHPTXHSHU-
A mais possível das alternativas é a que você expôs. VRQDJHQVVHWUDQVIRUPDPHPVHUHVYLYRVDDFRPSDQKDURV
Os melhores cargos possíveis estão neste setor da em- OHLWRUHVQXPDYHUGDGHLUDLQWHUDomRFRPDUHDOLGDGH
presa. ' $VSRVVLELOLGDGHVGHFRPXQLFDomRHQWUHDXWRUHOHL-
As piores situações possíveis são encontradas nas fave- WRUVRPHQWHVHUHDOL]DSOHQDPHQWHFDVRKDMDDÀQLGDGHGH
las da cidade. LGHLDV HQWUH DPERV R TXH SHUPLWH DR PHVPR WHPSR R
FUHVFLPHQWRLQWHOHFWXDOGHVWH~OWLPRHRSUD]HUGDOHLWXUD
P Meio (  &RQVWD QD OLWHUDWXUD PXQGLDO REUDVSULPDV TXH
&RPRDGYpUELRLQYDULiYHO FRQVWLWXLOHLWXUDREULJDWyULDHVHWRUQDPUHIHUrQFLDVSRUVHX
Estou meio (um pouco) insegura. FRQWH~GRTXHXOWUDSDVVDRVOLPLWHVGHWHPSRHGHpSRFD

83
LÍNGUA PORTUGUESA

 (VFUHYHQWH7-63²9XQHVS /HLDRWH[WRSDUD % 9HPPXLWDJHQWHSUHVWLJLDUDVQRVVDVIHVWDVMXQLQDV


UHVSRQGHUjTXHVWmR 9rPSHVVRDVGHPXLWRORQJHSDUDEULQFDUGHTXDGULOKD
BBBBBBBBBdúvidas sobre o crescimento verde. Primeiro, & 3RXFDJHQWHTXLVYROWDUPDLVFHGRSDUDFDVD4XDVH
não está claro até onde pode realmente chegar uma políti- WRGRVTXLVHUDPÀFDUDWpRQDVFHUGRVROQDSUDLD
FDEDVHDGDHPPHOKRUDUDHÀFLrQFLDVHPSUHoRVDGHTXDGRV ' ([LVWHPSHVVRDVEHPLQWHQFLRQDGDVSRUDTXLPDV
para o carbono, a água e (na maioria dos países pobres) a WDPEpPH[LVWHPXPDVTXHQmRPHUHFHPQRVVDDWHQomR
terra. É verdade que mesmo que a ameaça dos preços do ( $TXHOHVTXHQmRDWUDSDOKDPPXLWRDMXGDP
carbono e da água em si ___________diferença, as compa-
nhias não podem suportar ter de pagar, de repente, digamos,  75)5(*,®27e&1,&2-8',&,É5,2)&& 
40 dólares por tonelada de carbono, sem qualquer prepara- Os folheteiros vivem em feiras, mercados, praças e locais de
ção. Portanto, elas começam a usar preços- -sombra. peregrinação.
Ainda assim, ninguém encontrou até agora uma maneira 2YHUERGDIUDVHDFLPD1®2SRGHVHUPDQWLGRQRSOX-
GH TXDQWLÀFDU DGHTXDGDPHQWH RV LQVXPRV EiVLFRV ( VHP UDOFDVRRVHJPHQWRJULIDGRVHMDVXEVWLWXtGRSRU
$ +iIROKHWHLURVTXH
eles a maioria das políticas de crescimento verde sempre
% $PDLRUSDUWHGRVIROKHWHLURV
BBBBBBBBBBBa segunda opção.
& 2IROKHWHLURHVXDIDPtOLD
 &DUWD&DSLWDO
' 2JURVVRGRVIROKHWHLURV
$GDSWDGR ( &DGDXPGRVIROKHWHLURV
'HDFRUGRFRPDQRUPDSDGUmRGDOtQJXDSRUWXJXHVD
DVODFXQDVGRWH[WRGHYHPVHUSUHHQFKLGDVFRUUHWDHUHV-  75)5(*,®27e&1,&2-8',&,É5,2)&& 
SHFWLYDPHQWHFRP 7RGDV DV IRUPDV YHUEDLV HVWmR FRUUHWDPHQWH ÁH[LRQDGDV
$ 5HVWDP¬IDoD¬VHUi HP
% 5HVWD¬ID]¬VHUi $  (QTXDQWR QmR VH GLVSRUHP D FRQVLGHUDU R FRUGHO
& 5HVWDP¬ID]VHUmR VHP SUHFRQFHLWRV DV SHVVRDV QmR VHUmR FDSD]HV GH IUXLU
' 5HVWDP¬IDoDP¬VHUmR GHVVDVFULDo}HVSRpWLFDVWmRRULJLQDLV
( 5HVWD¬ID]HP¬VHUi %  $LQGD TXH QHP VHPSUH GHWHQKD R PHVPR VWDWXV
DWULEXtGRjDUWHHUXGLWDRFRUGHOYHPVHQGRHVWXGDGRKRMH
 (VFUHYHQWH7-63²9XQHVS $VVLQDOHDDOWHUQD- QDVPHOKRUHVXQLYHUVLGDGHVGRSDtV
WLYDHPTXHRWUHFKR & 5RGROIR&RHOKR&DYDOFDQWHGHYHWHUSHUFHELGRTXH
²Ainda assim, ninguém encontrou até agora uma ma- DVLWXDomRGRVFRUGHOLVWDVQmRPXGDULDDQmRVHUTXHHOHV
QHLUD GH TXDQWLÀFDU DGHTXDGDPHQWH RV LQVXPRV EiVLFRV² PHVPRVUHTXL]HVVHPRUHVSHLWRTXHID]LDPSRUPHUHFHU
HVWi FRUUHWDPHQWH UHHVFULWR GH DFRUGR FRP D QRUPDSD- ' 6HQmRSURYHHPGRSUHFRQFHLWRDGHVYDORUL]DomRH
GUmRGDOtQJXDSRUWXJXHVD DSRXFDYLVLELOLGDGHGHVVDDUWHSRSXODUWmRULFDVySRGHVHU
$  $LQGD DVVLP WHPRV FHUWH]D TXH QLQJXpP HQFRQ- UHVXOWDGRGRSXURHVLPSOHVGHVFRQKHFLPHQWR
WURXDWpDJRUDXPDPDQHLUDDGHTXDGDGHVHTXDQWLÀFDURV ( 5RGROIR&RHOKR&DYDOFDQWHHQWUHYHXTXHRVSUREOH-
LQVXPRVEiVLFRV PDVGRVFRUGHOLVWDVHVWDYDPGLUHWDPHQWHOLJDGRVjIDOWDGH
% $LQGDDVVLPWHPRVFHUWH]DGHTXHQLQJXpPHQFRQ- UHSUHVHQWDWLYLGDGH
WURXDWpDJRUDXPDPDQHLUDDGHTXDGDGHRVLQVXPRVEiVL-
FRVVHUTXDQWLÀFDGRV  75)   5(*,®2 ² 7e&1,&2 -8',&,É5,2 ²
& $LQGDDVVLPWHPRVFHUWH]DTXHQLQJXpPHQFRQWURX )&&  2EVHUYDPVH FRUUHWDPHQWH DV UHJUDV GH FRQ-
DWpDJRUDXPDPDQHLUDDGHTXDGDSDUDTXHRVLQVXPRVEi- FRUGkQFLDYHUEDOHQRPLQDOHP
D 2GHVHQUDL]DPHQWRQmRVyHQWUHLQWHOHFWXDLVFRPR
VLFRVVHMDPTXDQWLÀFDGR
HQWUHRVPDLVGLYHUVRVWLSRVGHSHVVRDVGDVPDLVVRÀVWLFD-
' $LQGDDVVLPWHPRVFHUWH]DGHTXHQLQJXpPHQFRQ-
GDVjVPDLVKXPLOGHVVmRFDGDYH]PDLVFRPXQVQRVGLDV
WURXDWpDJRUDXPDPDQHLUDDGHTXDGDSDUDTXHRVLQVX-
GHKRMH
PRVEiVLFRVVHMDTXDQWLÀFDGR E $ LPSRUWkQFLD GH LQWHOHFWXDLV FRPR (GZDUG6DLG H
( $LQGDDVVLPWHPRVFHUWH]DGHTXHQLQJXpPHQFRQ- 7RQ\-XGWTXHQmRVHIXUWDUDPDRGHEDWHVREUHTXHVW}HV
WURXDWpDJRUDXPDPDQHLUDDGHTXDGDGHVHTXDQWLÀFDUHP SROrPLFDVGHVHXWHPSRQmRHVWmRDSHQDVQRVOLYURVTXH
RVLQVXPRVEiVLFRV HVFUHYHUDP
 )81'$d®2&$6$63$*(17($'0,1,675$7,92 F 1DGDLQGLFDTXHRFRQÁLWRQR2ULHQWH0pGLRHQWUH
981(63$'$37$'$ 2EVHUYHDVIUDVHVGRWH[WR iUDEHVHMXGHXVUHVSRQViYHOSRUWDQWDVPRUWHVHWDQWRVR-
I. Cerca de 75 por cento dos países obtêm nota nega- IULPHQWR HVWHMDP SUy[LPRV GH VHUHP UHVROYLGRV RX SHOR
tiva... PHQRVGHWHUHPDOJXPDWUpJXD
II. ... à Venezuela, de Chávez, que obtém a pior classi- G  ,QWHOHFWXDLV TXH WrP FRPSURPLVVR DSHQDV FRP D
ÀFDomRGRFRQWLQHQWHDPHULFDQR   YHUGDGH DLQGD TXH FRQVFLHQWHV GH TXH HVWD p DWp FHUWR
$VVLPFRPRRFRUUHFRPRYHUER´REWHUµQDVIUDVHV,H SRQWRUHODWLYDFRVWXPDPHQFRQWUDUPXLWRPDLVGHWUDWRUHV
,,DFRQFRUGkQFLDVHJXHDVPHVPDVUHJUDVQDRUGHPGRV TXHDGPLUDGRUHV
H[HPSORVHP H 1RÀQDOGRVpFXOR;;MiQmRVHYLDPXLWRVLQWHOHF-
$  7RGDV DV SHVVRDV WrP ERDV SHUVSHFWLYDV SDUD R WXDLVHHVFULWRUHVFRPR(GZDUG6DLGTXHQmRDSHQDVHUD
SUy[LPR DQR 6HUi TXH DOJXpP WHP RSLQLmR GLIHUHQWH GD QRWtFLD SHORV OLYURV TXH SXEOLFDYDP FRPR SHODV SRVLo}HV
PDLRULD" TXHFRUDMRVDPHQWHDVVXPLDP

84
LÍNGUA PORTUGUESA

 75)5(*,®27e&1,&2-8',&,É5,2)&&  % 2EUDVTXHVHFRQVLGHUDPFOiVVLFDVQDOLWHUDWXUDVHP-


2YHUERTXHGDGDVDVDOWHUDo}HVHQWUHSDUrQWHVHVSURSRV- SUHGHOLQHLDPQRYRVFDPLQKRVSRLVVmRFDSD]HVGHHQFDQ-
WDVSDUDRVHJPHQWRJULIDGRGHYHUiVHUFRORFDGRQRSOXUDO WDU R OHLWRU DR XOWUDSDVVDUHP RV OLPLWHV GD pSRFD HP TXH
HVWiHP YLYHP VHXV DXWRUHV JrQLRV QR GRPtQLR GDV SDODYUDV VXD
$ 1mRKiG~YLGDGHTXHRHVWLORGHYLGD G~YLGDV PDWpULDSULPD
% O que não seVDEH QLQJXpPQDVUHJL}HVGRSOD- &  $ SDODYUD PDWpULDSULPD GH SRHWDV H URPDQFLVWDV
QHWD OKHVSHUPLWHFULDUWRGRXPPXQGRGHÀFomRHPTXHSHU-
&  O consumo mundial QmR Gi VLQDO GH WUpJXD 2 VRQDJHQVVHWUDQVIRUPDPHPVHUHVYLYRVDDFRPSDQKDURV
FRQVXPRPXQGLDOGHEDUULVGHSHWUyOHR OHLWRUHVQXPDYHUGDGHLUDLQWHUDomRFRPDUHDOLGDGH
' Um aumentoHOHYDGRQRSUHoRGRyOHRUHÁHWHVH ' $VSRVVLELOLGDGHVGHFRPXQLFDomRHQWUHDXWRUHOHL-
QRFXVWRGDPDWpULDSULPD &RQVWDQWHVDXPHQWRV WRU VRPHQWH VH UHDOL]DP SOHQDPHQWH FDVR KDMD DÀQLGDGH
(  R WHPD GDV PXGDQoDV FOLPiWLFDV SUHVVLRQD RV HV- GHLGHLDVHQWUHDPERVRTXHSHUPLWHDRPHVPRWHPSRR
IRUoRVPXQGLDLV DSUHRFXSDomRHPWRUQRGDVPXGDQoDV FUHVFLPHQWRLQWHOHFWXDOGHVWH~OWLPRHRSUD]HUGDOHLWXUD
FOLPiWLFDV (  &RQVWDP QD OLWHUDWXUD PXQGLDO REUDVSULPDV TXH
FRQVWLWXHPOHLWXUDREULJDWyULDHVHWRUQDPUHIHUrQFLDVSRU
 &(7(6%63²(6&5,785É5,2981(63 $VVL- VHXFRQWH~GRTXHXOWUDSDVVDRVOLPLWHVGHWHPSRHGHpSR-
QDOHDDOWHUQDWLYDHPTXHDFRQFRUGkQFLDGDVIRUPDVYHU- FD
EDLV GHVWDFDGDV HVWi GH DFRUGR FRP D QRUPDSDGUmR GD  B5HVWDPBBBG~YLGDV
OtQJXD PHVPR TXH D DPHDoD GRV SUHoRV GR FDUERQR H GD
$ FazemGH]DQRVTXHGHL[HLGHWUDEDOKDUHPKLJLH- iJXDHPVLBBIDoDBBGLIHUHQoD
QL]DomRVXEWHUUkQHD D PDLRULD GDV SROtWLFDV GH FUHVFLPHQWR YHUGH VHPSUH
%  $LQGD existe PXLWDV SHVVRDV TXH GLVFULPLQDP RV BBBBVHUiBBBBBDVHJXQGDRSomR
WUDEDOKDGRUHVGDiUHDGHOLPSH]D (P´DPDLRULDGHµDFRQFRUGkQFLDSRGHVHUGXSODWDQ-
&  1R WUDEDOKR HP PHLR D WDQWD VXMHLUD havia DOWRV WR QR SOXUDO TXDQWR QR VLQJXODU 1DV DOWHUQDWLYDV QmR Ki
ULVFRVGHVHFRQWUDLUDOJXPDGRHQoD ´UHVWDPIDoDVHUmRµSRUWDQWRD$pTXHDSUHVHQWDDVRS-
'  (X SDVVDYD D PDQKm QR VXEWHUUkQHR TXDQGR era o}HVDGHTXDGDV
VHWHGDPDQKmHXMiHVWDYDID]HQGRPHXVHUYLoR
(  $V FRPSDQKLDV GH OLPSH]D DSHQDV UHFHQWHPHQWH
 
começouDDGRWDUPHGLGDVPDLVULJRURVDVSDUDDSURWHomR
$ $LQGDDVVLPWHPRVFHUWH]DGHTXHQLQJXpPHQFRQ-
GHVHXVIXQFLRQiULRV
WURXDWpDJRUDXPDPDQHLUDDGHTXDGDGHVHTXDQWLÀFDURV
LQVXPRVEiVLFRV
GABARITO
% $LQGDDVVLPWHPRVFHUWH]DGHTXHQLQJXpPHQFRQ-
WURXDWpDJRUDXPDPDQHLUDDGHTXDGDGHRVLQVXPRVEiVL-
01. A 02. A 03. A 04. E 05. A
06. E 07. |B 08. D 09. D10. C FRVVHUHPTXDQWLÀFDGRV
& $LQGDDVVLPWHPRVFHUWH]DGHTXHQLQJXpPHQFRQ-
RESOLUÇÃO WURXDWpDJRUDXPDPDQHLUDDGHTXDGDSDUDTXHRVLQVX-
PRVEiVLFRVVHMDPTXDQWLÀFDGRV
 )L]RVDFHUWRVHQWUHSDUrQWHVHV ' $LQGDDVVLPWHPRVFHUWH]DGHTXHQLQJXpPHQFRQ-
$  $ VRFLHGDGH GHYH UHFRQKHFHU RV SULQFtSLRV H YD- WURXDWpDJRUDXPDPDQHLUDDGHTXDGDSDUDTXHRVLQVX-
ORUHV TXH GHWHUPLQDP DV HVFROKDV GRV JRYHUQDQWHV SDUD PRVEiVLFRVVHMDPTXDQWLÀFDGRV
FRQIHULUOHJLWLPLGDGHDVXDVGHFLV}HV ( $LQGDDVVLPWHPRVFHUWH]DGHTXHQLQJXpPHQFRQ-
 % $FRQÀDQoDGRVFLGDGmRVHPVHXVGLULJHQWHVGH- WURXDWpDJRUDXPDPDQHLUDDGHTXDGDGHVHTXDQWLÀFDUHP
YHP GHYH VHUHPEDVDGRV HPEDVDGD QDSHUFHSomRGRV RVLQVXPRVEiVLFRV FRUUHWD
YDORUHVHSULQFtSLRVTXHUHJHPDSUiWLFDSROtWLFD
 & (OHLo}HVOLYUHVHGLUHWDVp VmR JDUDQWLDGHXPYHU-  (P,REWrPHVWiQRSOXUDOHP,,QRVLQJXODU9DPRV
GDGHLUR UHJLPH GHPRFUiWLFR HP TXH VH UHVSHLWD UHVSHL- DRVLWHQV
WDP WDQWRDVOLEHUGDGHVLQGLYLGXDLVTXDQWRDVFROHWLYDV $  7RGDV DV SHVVRDV WrP SOXUDO   6HUi TXH DOJXpP
 ' $VLQVWLWXLo}HVIXQGDPHQWDLVGHXPUHJLPHGHPR- WHP VLQJXODU 
FUiWLFR QmR SRGH SRGHP  HVWDU VXERUGLQDGR VXERUGLQD- % 9HP VLQJXODU PXLWDJHQWH9rPSHVVRDV SOXUDO 
GDV jVRUGHQVLQGLVFULPLQDGDVGHXP~QLFRSRGHUFHQWUDO &  3RXFD JHQWH TXLV VLQJXODU   4XDVH WRGRV TXLVH-
 ( 2LQWHUHVVHGHWRGRVRVFLGDGmRVHVWmR HVWi YRO- UDP SOXUDO
WDGRV YROWDGR SDUDRPRPHQWRHOHLWRUDOTXHH[S}HP H[- '  ([LVWHP SOXUDO  SHVVRDV  PDV WDPEpP H[LVWHP
S}H DVGLIHUHQWHVRSLQL}HVH[LVWHQWHVQDVRFLHGDGH XPDV SOXUDO 
( $TXHOHVTXHQmRDWUDSDOKDPPXLWRDMXGDP DPEDV
  DVIRUPDVHVWmRQRSOXUDO
$  $OJXQV GRV DVSHFWRV PDLV GHVHMiYHLV GH XPD ERD
OHLWXUDTXHVDWLVIDoDDRVOHLWRUHVHVHMDYHtFXORGHDSULPR- 
UDPHQWRLQWHOHFWXDOHVWmRQDFDSDFLGDGHGHFULDomRGRDX- $+iIROKHWHLURVTXHYLYHP FRQFRUGDFRPRREMHWR
WRUPHGLDQWHSDODYUDVVXDPDWpULDSULPD FRUUHWD ´IROKHWHULRVµ

85
LÍNGUA PORTUGUESA

%²$PDLRUSDUWHGRVIROKHWHLURVYLYHPYLYH RSFLRQDO (  R WHPD GDV PXGDQoDV FOLPiWLFDV SUHVVLRQD RV HV-


&²2IROKHWHLURHVXDIDPtOLDYLYHP VXMHLWRFRPSRVWR IRUoRVPXQGLDLV DSUHRFXSDomRHPWRUQRGDVPXGDQoDV
'²2JURVVRGRVIROKHWHLURVYLYHYLYHP RSFLRQDO FOLPiWLFDV  ´SUHVVLRQDµSHUPDQHFHULDQRVLQJXODU
(²&DGDXPGRVIROKHWHLURVYLYH VRPHQWHQRVLQJXODU
 )L]DVFRUUHo}HV
 &RORTXHLHQWUHSDUrQWHVHVDIRUPDYHUEDOFRUUHWD $ )D]HPGH]DQRV ID] VHQWLGRGHWHPSR VLQJXODU
$ (QTXDQWRQmRVHGLVSRUHP GLVSXVHUHP DFRQVLGH- % $LQGDH[LVWHPXLWDVSHVVRDV H[LVWHP
UDURFRUGHOVHPSUHFRQFHLWRVDVSHVVRDVQmRVHUmRFDSD- &  1R WUDEDOKR HP PHLR D WDQWD VXMHLUD KDYLD DOWRV
]HVGHIUXLUGHVVDVFULDo}HVSRpWLFDVWmRRULJLQDLV ULVFRV
%  $LQGD TXH QHP VHPSUH GHWHQKD R PHVPR VWDWXV '  (X SDVVDYD D PDQKm QR VXEWHUUkQHR TXDQGR HUD
DWULEXtGRjDUWHHUXGLWDRFRUGHOYHPVHQGRHVWXGDGRKRMH VHWHGDPDQKm HUDP
QDVPHOKRUHVXQLYHUVLGDGHVGRSDtV (  $V FRPSDQKLDV GH OLPSH]D DSHQDV UHFHQWHPHQWH
& 5RGROIR&RHOKR&DYDOFDQWHGHYHWHUSHUFHELGRTXH FRPHoRX FRPHoDUDP
DVLWXDomRGRVFRUGHOLVWDVQmRPXGDULDDQmRVHUTXHHOHV
PHVPRVUHTXL]HVVHP UHTXHUHVVHP RUHVSHLWRTXHID]LDP REGÊNCIA
SRUPHUHFHU
' 6HQmRSURYHHP SURYrP GRSUHFRQFHLWRDGHVYD- 'iVHRQRPHGHregência jUHODomRGHVXERUGLQDomR
ORUL]DomRHDSRXFDYLVLELOLGDGHGHVVDDUWHSRSXODUWmRULFD TXHRFRUUHHQWUHXPYHUER RXXPQRPH HVHXVFRPSOH-
VySRGH SRGHP VHUUHVXOWDGRGRSXURHVLPSOHVGHVFR- PHQWRV2FXSDVHHPHVWDEHOHFHUUHODo}HVHQWUHDVSDOD-
QKHFLPHQWR YUDVFULDQGRIUDVHVQmRDPEtJXDVTXHH[SUHVVHPHIHWLYD-
( 5RGROIR&RHOKR&DYDOFDQWHHQWUHYHX HQWUHYLX TXH PHQWHRVHQWLGRGHVHMDGRTXHVHMDPFRUUHWDVHFODUDV
RVSUREOHPDVGRVFRUGHOLVWDVHVWDYDPGLUHWDPHQWHOLJDGRV
jIDOWDGHUHSUHVHQWDWLYLGDGH Regência Verbal

 )L]DVFRUUHo}HVHQWUHSDUrQWHVHV 7HUPR5HJHQWH9(5%2
D 2GHVHQUDL]DPHQWRQmRVyHQWUHLQWHOHFWXDLVFRPR
HQWUH RV PDLV GLYHUVRV WLSRV GH SHVVRDV GDV PDLV VRÀV- $ UHJrQFLD YHUEDO HVWXGD D UHODomR TXH VH HVWDEHOHFH
WLFDGDV jV PDLV KXPLOGHV VmR p  FDGD YH] PDLV FRPXQV HQWUHRVYHUERVHRVWHUPRVTXHRVFRPSOHPHQWDP REMH-
FRPXP QRVGLDVGHKRMH WRVGLUHWRVHREMHWRVLQGLUHWRV RXFDUDFWHUL]DP DGMXQWRV
E $ LPSRUWkQFLD GH LQWHOHFWXDLV FRPR (GZDUG6DLG H DGYHUELDLV 
7RQ\-XGWTXHQmRVHIXUWDUDPDRGHEDWHVREUHTXHVW}HV 2HVWXGRGDUHJrQFLDYHUEDOSHUPLWHQRVDPSOLDUQRV-
SROrPLFDVGHVHXWHPSRQmRHVWmR HVWi DSHQDVQRVOLYURV VD FDSDFLGDGH H[SUHVVLYD SRLV RIHUHFH RSRUWXQLGDGH GH
TXHHVFUHYHUDP FRQKHFHUPRVDVGLYHUVDVVLJQLÀFDo}HVTXHXPYHUERSRGH
F  1DGD LQGLFD TXH R FRQÁLWR QR 2ULHQWH 0pGLR HQ- DVVXPLUFRPDVLPSOHVPXGDQoDRXUHWLUDGDGHXPDSUH-
WUHiUDEHVHMXGHXVUHVSRQViYHOSRUWDQWDVPRUWHVHWDQWR SRVLomR2EVHUYH
VRIULPHQWRHVWHMDP HVWHMD SUy[LPRV SUy[LPR GHVHUHP $ PmH DJUDGD R ÀOKR ! DJUDGDU VLJQLÀFD DFDULFLDU
VHU  UHVROYLGRV UHVROYLGR  RX SHOR PHQRV GH WHUHP WHU  FRQWHQWDU
DOJXPDWUpJXD $ PmH DJUDGD DR ÀOKR ! DJUDGDU VLJQLÀFD ´FDXVDU
G  ,QWHOHFWXDLV TXH WrP FRPSURPLVVR DSHQDV FRP D DJUDGRRXSUD]HUµVDWLVID]HU
YHUGDGH DLQGD TXH FRQVFLHQWHV GH TXH HVWD p DWp FHUWR /RJRFRQFOXLVHTXH´DJUDGDUDOJXpPµpGLIHUHQWHGH
SRQWRUHODWLYDFRVWXPDPHQFRQWUDUPXLWRPDLVGHWUDWRUHV ´DJUDGDUDDOJXpPµ
TXHDGPLUDGRUHV
H  1R ÀQDO GR VpFXOR ;; Mi QmR VH YLD YLDP  PXLWRV Saiba que:
LQWHOHFWXDLVHHVFULWRUHVFRPR(GZDUG6DLGTXHQmRDSHQDV 2FRQKHFLPHQWRGRXVRDGHTXDGRGDVSUHSRVLo}HVp
HUD HUDP QRWtFLDSHORVOLYURVTXHSXEOLFDYDPFRPRSHODV XPGRVDVSHFWRVIXQGDPHQWDLVGRHVWXGRGDUHJrQFLDYHU-
SRVLo}HVTXHFRUDMRVDPHQWHDVVXPLDP EDO H WDPEpP QRPLQDO  $V SUHSRVLo}HV VmR FDSD]HV GH
PRGLÀFDUFRPSOHWDPHQWHRVHQWLGRGRTXHVHHVWiVHQGR
  GLWR9HMDRVH[HPSORV
$ 1mRKiG~YLGDGHTXHRHVWLORGHYLGD G~YLGDV   Cheguei ao metrô.
´KiµSHUPDQHFHULDQRVLQJXODU Cheguei no metrô.
% 2TXHQmRVHVDEH QLQJXpPQDVUHJL}HVGRSOD-
QHWD  ´VDEHµSHUPDQHFHULDQRVLQJXODU 1RSULPHLURFDVRRPHWU{pROXJDUDTXHYRXQRVH-
&  2 FRQVXPR PXQGLDO QmR Gi VLQDO GH WUpJXD  2 JXQGRFDVRpRPHLRGHWUDQVSRUWHSRUPLPXWLOL]DGR$
FRQVXPRPXQGLDOGHEDUULVGHSHWUyOHR  ´GiµSHUPDQH- RUDomR´&KHJXHLQRPHWU{µSRSXODUPHQWHXVDGDDÀPGH
FHULDQRVLQJXODU LQGLFDUROXJDUDTXHVHYDLSRVVXLQRSDGUmRFXOWRGDOtQ-
' 8PDXPHQWRHOHYDGRQRSUHoRGRyOHRUHÁHWHVH JXDVHQWLGRGLIHUHQWH$OLiVpPXLWRFRPXPH[LVWLUHPGL-
QRFXVWRGDPDWpULDSULPD&RQVWDQWHVDXPHQWRV  ´UH- YHUJrQFLDVHQWUHDUHJrQFLDFRORTXLDOFRWLGLDQDGHDOJXQV
ÁHWHµSDVVDULDSDUD´UHÁHWHPVHµ YHUERVHDUHJrQFLDFXOWD

86
LÍNGUA PORTUGUESA

3DUDHVWXGDUDUHJrQFLDYHUEDODJUXSDUHPRVRVYHUERV Verbos Transitivos Indiretos


GHDFRUGRFRPVXDWUDQVLWLYLGDGH$WUDQVLWLYLGDGHSRUpP
QmRpXPIDWRDEVROXWRXPPHVPRYHUERSRGHDWXDUGH 2V YHUERV WUDQVLWLYRV LQGLUHWRV VmR FRPSOHPHQWDGRV
GLIHUHQWHVIRUPDVHPIUDVHVGLVWLQWDV SRU REMHWRV LQGLUHWRV ,VVR VLJQLÀFD TXH HVVHV YHUERV H[L-
JHPXPDSUHSRVLomRSDUDRHVWDEHOHFLPHQWRGDUHODomRGH
Verbos Intransitivos UHJrQFLD 2V SURQRPHV SHVVRDLV GR FDVR REOtTXR GH WHU-
FHLUDSHVVRDTXHSRGHPDWXDUFRPRREMHWRVLQGLUHWRVVmR
2VYHUERVLQWUDQVLWLYRVQmRSRVVXHPFRPSOHPHQWRe R ´OKHµ R ´OKHVµ SDUD VXEVWLWXLU SHVVRDV 1mR VH XWLOL]DP
LPSRUWDQWHQRHQWDQWRGHVWDFDUDOJXQVGHWDOKHVUHODWLYRV RV SURQRPHV o, os, a, as FRPR FRPSOHPHQWRV GH YHUERV
DRVDGMXQWRVDGYHUELDLVTXHFRVWXPDPDFRPSDQKiORV WUDQVLWLYRVLQGLUHWRV&RPRVREMHWRVLQGLUHWRVTXHQmRUH-
SUHVHQWDP SHVVRDV XVDPVH SURQRPHV REOtTXRV W{QLFRV
&KHJDU,U GHWHUFHLUDSHVVRD HOHHOD HPOXJDUGRVSURQRPHViWRQRV
1RUPDOPHQWHYrPDFRPSDQKDGRVGHDGMXQWRVDGYHU- OKHOKHV
ELDLVGHOXJDU1DOtQJXDFXOWDDVSUHSRVLo}HVXVDGDVSDUD 2VYHUERVWUDQVLWLYRVLQGLUHWRVVmRRVVHJXLQWHV
LQGLFDUGHVWLQRRXGLUHomRVmRa, para  &RQVLVWLU  7HP FRPSOHPHQWR LQWURGX]LGR SHOD SUH-
Fui ao teatro SRVLomR´HPµA modernidade verdadeira consiste em direi-
$GMXQWR$GYHUELDOGH/XJDU tos iguais para todos.

Ricardo foi para a Espanha  2EHGHFHU H 'HVREHGHFHU  3RVVXHP VHXV FRPSOH-


$GMXQWR$GYHUELDOGH/XJDU PHQWRVLQWURGX]LGRVSHODSUHSRVLomR´Dµ
Devemos obedecer aos nossos princípios e ideais.
&RPSDUHFHU Eles desobedeceram às leis do trânsito.
2DGMXQWRDGYHUELDOGHOXJDUSRGHVHULQWURGX]LGRSRU
emRXa 5HVSRQGHU7HPFRPSOHPHQWRLQWURGX]LGRSHODSUH-
Comparecemos ao estádio (ou no estádio) para ver o SRVLomR´Dµ(VVHYHUERSHGHREMHWRLQGLUHWRSDUDLQGLFDU´D
último jogo TXHPµRX´DRTXHµVHUHVSRQGH
Respondi ao meu patrão.
Verbos Transitivos Diretos
Respondemos às perguntas.
Respondeu-lhe à altura.
2VYHUERVWUDQVLWLYRVGLUHWRVVmRFRPSOHPHQWDGRVSRU
REMHWRVGLUHWRV,VVRVLJQLÀFDTXHQmRH[LJHPSUHSRVLomR
ObsRYHUERUHVSRQGHUDSHVDUGHWUDQVLWLYRLQGLUHWR
SDUD R HVWDEHOHFLPHQWR GD UHODomR GH UHJrQFLD $R HP-
TXDQGRH[SULPHDTXLORDTXHVHUHVSRQGHDGPLWHYR]SDV-
SUHJDU HVVHV YHUERV GHYHPRV OHPEUDU TXH RV SURQRPHV
VLYDDQDOtWLFD9HMD
REOtTXRVo, a, os, asDWXDPFRPRREMHWRVGLUHWRV(VVHVSUR-
QRPHVSRGHPDVVXPLUDVIRUPDVlo, los, la, las DSyVIRUPDV
O questionário foi respondido corretamente.
YHUEDLVWHUPLQDGDVHPUVRX] RXno, na, nos, nas DSyV Todas as perguntas foram respondidas satisfatoriamen-
IRUPDVYHUEDLVWHUPLQDGDVHPVRQVQDVDLV HQTXDQWRlhe H te.
lhesVmRTXDQGRFRPSOHPHQWRVYHUEDLVREMHWRVLQGLUHWRV
6mRYHUERVWUDQVLWLYRVGLUHWRVGHQWUHRXWURVabando- 6LPSDWL]DUH$QWLSDWL]DU3RVVXHPVHXVFRPSOHPHQ-
nar, abençoar, aborrecer, abraçar, acompanhar, acusar, ad- WRVLQWURGX]LGRVSHODSUHSRVLomR´FRPµ
mirar, adorar, alegrar, ameaçar, amolar, amparar, auxiliar, Antipatizo com aquela apresentadora.
castigar, condenar, conhecer, conservar,convidar, defender, Simpatizo com os que condenam os políticos que gover-
eleger, estimar, humilhar, namorar, ouvir, prejudicar, prezar, nam para uma minoria privilegiada.
proteger, respeitar, socorrer, suportar, ver, visitar.
1D OtQJXD FXOWD HVVHV YHUERV IXQFLRQDP H[DWDPHQWH Verbos Transitivos Diretos e Indiretos
FRPRRYHUERDPDU
Amo aquele rapaz. / Amo-o. 2VYHUERVWUDQVLWLYRVGLUHWRVHLQGLUHWRVVmRDFRPSD-
Amo aquela moça. / Amo-a. QKDGRVGHXPREMHWRGLUHWRHXPLQGLUHWR0HUHFHPGHVWD-
Amam aquele rapaz. / Amam-no. TXHQHVVHJUXSRAgradecer, Perdoar e Pagar. 6mRYHUERV
Ele deve amar aquela mulher. / Ele deve amá-la. TXHDSUHVHQWDPREMHWRGLUHWRUHODFLRQDGRDFRLVDVHREMH-
WRLQGLUHWRUHODFLRQDGRDSHVVRDV9HMDRVH[HPSORV
ObsRVSURQRPHVOKHOKHVVyDFRPSDQKDPHVVHVYHU- Agradeço aos ouvintes a audiência.
ERVSDUDLQGLFDUSRVVH FDVRHPTXHDWXDPFRPRDGMXQWRV 2EMHWR,QGLUHWR2EMHWR'LUHWR
DGQRPLQDLV 
Quero beijar-lhe o rosto EHLMDUVHXURVWR Paguei o débito ao cobrador.
Prejudicaram-lhe a carreira  SUHMXGLFDUDP VXD FDU- 2EMHWR'LUHWR2EMHWR,QGLUHWR
UHLUD
Conheço-lhe o mau humor!  FRQKHoR VHX PDX KX- 2XVRGRVSURQRPHVREOtTXRViWRQRVGHYHVHUIHLWR
PRU FRPSDUWLFXODUFXLGDGR2EVHUYH

87
LÍNGUA PORTUGUESA

Agradeci o presente. / Agradeci-o. ObsQDOtQJXDFXOWDRYHUER´SUHIHULUµGHYHVHUXVDGR


Agradeço a você. / Agradeço-lhe. VHP WHUPRV LQWHQVLÀFDGRUHV WDLV FRPR muito, antes, mil
Perdoei a ofensa. / Perdoei-a. vezes, um milhão de vezes, mais $ rQIDVH Mi p GDGD SHOR
Perdoei ao agressor. / Perdoei-lhe. SUHÀ[RH[LVWHQWHQRSUySULRYHUER SUH 
Paguei minhas contas. / Paguei-as.
Paguei aos meus credores. / Paguei-lhes. 0XGDQoD GH 7UDQVLWLYLGDGH ; 0XGDQoD GH 6LJQLÀ-
cado
Informar +iYHUERVTXHGHDFRUGRFRPDPXGDQoDGHWUDQVLWLYL-
$SUHVHQWDREMHWRGLUHWRDRVHUHIHULUDFRLVDVHREMHWR GDGHDSUHVHQWDPPXGDQoDGHVLJQLÀFDGR2FRQKHFLPHQ-
LQGLUHWRDRVHUHIHULUDSHVVRDVRXYLFHYHUVD WRGDVGLIHUHQWHVUHJrQFLDVGHVVHVYHUERVpXPUHFXUVROLQ-
Informe os novos preços aos clientes. JXtVWLFRPXLWRLPSRUWDQWHSRLVDOpPGHSHUPLWLUDFRUUHWD
Informe os clientes dos novos preços. RXVREUHRVQRYRV LQWHUSUHWDomRGHSDVVDJHQVHVFULWDVRIHUHFHSRVVLELOLGDGHV
SUHoRV H[SUHVVLYDV D TXHP IDOD RX HVFUHYH 'HQWUH RV SULQFLSDLV
1DXWLOL]DomRGHSURQRPHVFRPRFRPSOHPHQWRVYHMD HVWmR
DVFRQVWUXo}HV
Informei-os aos clientes. / Informei-lhes os novos preços. AGRADAR
Informe-os dos novos preços. / Informe-os deles. RXVR- $JUDGDUpWUDQVLWLYRGLUHWRQRVHQWLGRGHID]HUFDUL-
EUHHOHV QKRVDFDULFLDU
6HPSUHDJUDGDRÀOKRTXDQGRRUHYr6HPSUHRDJUDGD
Obs. D PHVPD UHJrQFLD GR YHUER  LQIRUPDU p XVDGD quando o revê.
SDUDRVVHJXLQWHVDYLVDUFHUWLÀFDUQRWLÀFDUFLHQWLÀFDUSUH- Cláudia não perde oportunidade de agradar o gato. /
venir Cláudia não perde oportunidade de agradá-lo.
Comparar  $JUDGDU p WUDQVLWLYR LQGLUHWR QR VHQWLGR GH FDXVDU
4XDQGRVHJXLGRGHGRLVREMHWRVHVVHYHUERDGPLWHDV DJUDGRD VDWLVID]HU VHU DJUDGiYHO D  5HJH FRPSOHPHQWR
SUHSRVLo}HV´DµRX´FRPµSDUDLQWURGX]LURFRPSOHPHQWR
LQWURGX]LGRSHODSUHSRVLomR´Dµ
LQGLUHWR
O cantor não agradou aos presentes.
Comparei seu comportamento ao (ou com o) de uma
O cantor não lhes agradou.
criança
ASPIRAR
Pedir
$VSLUDUpWUDQVLWLYRGLUHWRQRVHQWLGRGHVRUYHULQVSL-
(VVHYHUERSHGHREMHWRGLUHWRGHFRLVD JHUDOPHQWHQD
UDU RDU LQDODUAspirava o suave aroma. (Aspirava-o)
IRUPD GH RUDomR VXERUGLQDGD VXEVWDQWLYD  H LQGLUHWR GH
SHVVRD
$VSLUDUpWUDQVLWLYRLQGLUHWRQRVHQWLGRGHGHVHMDUWHU
Pedi-lhe favores. FRPRDPELomRAspirávamos a melhores condições de vida.
2EMHWR,QGLUHWR2EMHWR'LUHWR (Aspirávamos a elas)

Pedi-lhe que se mantivesse em silêncio. Obs FRPR R REMHWR GLUHWR GR YHUER ´DVSLUDUµ QmR p
2EMHWR,QGLUHWR2UDomR6XERUGLQDGD6XEVWDQWLYD SHVVRDPDVFRLVDQmRVHXVDPDVIRUPDVSURQRPLQDLViWR-
2EMHWLYD'LUHWD QDV´OKHµH´OKHVµHVLPDVIRUPDVW{QLFDV´DHOH V µ´DHOD
V µ9HMDRH[HPSORAspiravam a uma existência melhor. (=
Saiba que: Aspiravam a ela)
$FRQVWUXomR´SHGLUSDUDµPXLWRFRPXPQDOLQJXD-
JHPFRWLGLDQDGHYHWHUHPSUHJRPXLWROLPLWDGRQDOtQJXD ASSISTIR
FXOWD1RHQWDQWRpFRQVLGHUDGDFRUUHWDTXDQGRDSDODYUD $VVLVWLUpWUDQVLWLYRGLUHWRQRVHQWLGRGHDMXGDUSUHV-
OLFHQoDHVWLYHUVXEHQWHQGLGD WDUDVVLVWrQFLDDDX[LOLDU3RUH[HPSOR
Peço (licença) para ir entregar-lhe os catálogos em casa As empresas de saúde negam-se a assistir os idosos.
2EVHUYHTXHQHVVHFDVRDSUHSRVLomR´SDUDµLQWURGX] As empresas de saúde negam-se a assisti-los.
XPDRUDomRVXERUGLQDGDDGYHUELDOÀQDOUHGX]LGDGHLQÀQL-
WLYR SDUDLUHQWUHJDUOKHRVFDWiORJRVHPFDVD  $VVLVWLUpWUDQVLWLYRLQGLUHWRQRVHQWLGRGHYHUSUHVHQ-
FLDUHVWDUSUHVHQWHFDEHUSHUWHQFHU([HPSORV
$FRQVWUXomR´GL]HUSDUDµWDPEpPPXLWRXVDGDSR- Assistimos ao documentário.
SXODUPHQWHpLJXDOPHQWHFRQVLGHUDGDLQFRUUHWD Não assisti às últimas sessões.
Essa lei assiste ao inquilino.
Preferir
1DOtQJXDFXOWDHVVHYHUERGHYHDSUHVHQWDUREMHWRLQ- ObsQRVHQWLGRGHPRUDUUHVLGLURYHUER´DVVLVWLUµp
GLUHWRLQWURGX]LGRSHODSUHSRVLomR´Dµ3RU([HPSOR LQWUDQVLWLYRVHQGRDFRPSDQKDGRGHDGMXQWRDGYHUELDOGH
3UHÀURTXDOTXHUFRLVDDDEULUPmRGHPHXVLGHDLV OXJDU LQWURGX]LGR SHOD SUHSRVLomR ´HPµ Assistimos numa
3UHÀURWUHPD{QLEXV conturbada cidade.

88
LÍNGUA PORTUGUESA

CHAMAR $V DÀUPDo}HV GD WHVWHPXQKD SURFHGLDP QmR KDYLD


 &KDPDU p WUDQVLWLYR GLUHWR QR VHQWLGR GH FRQYRFDU como refutá-las.
VROLFLWDUDDWHQomRRXDSUHVHQoDGH Você procede muito mal.
Por gentileza, vá chamar sua prima. / Por favor, vá cha-
má-la. 1RVVHQWLGRVGHWHURULJHPGHULYDUVH UHJHDSUHSR-
Chamei você várias vezes. / Chamei-o várias vezes. VLomRµGHµ HID]HUH[HFXWDU UHJHFRPSOHPHQWRLQWURGX]L-
GRSHODSUHSRVLomR´Dµ pWUDQVLWLYRLQGLUHWR
 &KDPDU QR VHQWLGR GH GHQRPLQDU DSHOLGDU SRGH O avião procede de Maceió.
DSUHVHQWDUREMHWRGLUHWRHLQGLUHWRDRTXDOVHUHIHUHSUHGL- Procedeu-se aos exames.
FDWLYRSUHSRVLFLRQDGRRXQmR O delegado procederá ao inquérito.
A torcida chamou o jogador mercenário.
A torcida chamou ao jogador mercenário. QUERER
A torcida chamou o jogador de mercenário. 4XHUHUpWUDQVLWLYRGLUHWRQRVHQWLGRGHGHVHMDUWHU
A torcida chamou ao jogador de mercenário.
YRQWDGHGHFRELoDU
Querem melhor atendimento.
CUSTAR
Queremos um país melhor.
 &XVWDU p LQWUDQVLWLYR QR VHQWLGR GH WHUGHWHUPLQDGR
YDORURXSUHoRVHQGRDFRPSDQKDGRGHDGMXQWRDGYHUELDO
Frutas e verduras não deveriam custar muito. 4XHUHUpWUDQVLWLYRLQGLUHWRQRVHQWLGRGHWHUDIHLomR
HVWLPDUDPDU
1RVHQWLGRGHVHUGLItFLOSHQRVRSRGHVHULQWUDQVLWLYR Quero muito aos meus amigos.
RXWUDQVLWLYRLQGLUHWR Ele quer bem à linda menina.
Muito custa viver tão longe da família 'HVSHGHVHRÀOKRTXHPXLWROKHTXHU
9HUER2UDomR6XERUGLQDGD6XEVWDQWLYD
6XEMHWLYD VISAR
,QWUDQVLWLYR5HGX]LGDGH,QÀQLWLYR &RPRWUDQVLWLYRGLUHWRDSUHVHQWDRVVHQWLGRVGHPL-
UDUID]HUSRQWDULDHGHS{UYLVWRUXEULFDU
Custa-me (a mim) crer que tomou realmente aquela O homem visou o alvo.
atitude O gerente não quis visar o cheque.
2EMHWR2UDomR6XERUGLQDGD6XEVWDQWLYD
6XEMHWLYD 1RVHQWLGRGHWHUHPYLVWDWHUFRPRPHWDWHUFRPR
,QGLUHWR5HGX]LGDGH,QÀQLWLYR REMHWLYRpWUDQVLWLYRLQGLUHWRHUHJHDSUHSRVLomR´Dµ
O ensino deve sempre visar ao progresso social.
ObsD*UDPiWLFD1RUPDWLYDFRQGHQDDVFRQVWUXo}HV Prometeram tomar medidas que visassem ao bem-estar
TXH DWULEXHP DR YHUER ´FXVWDUµ XP VXMHLWR UHSUHVHQWDGR público.
SRUSHVVRD2EVHUYH
Custei para entender o problema ESQUECER – LEMBRAR
)RUPDFRUUHWDCustou-me entender o problema. /HPEUDUDOJR²HVTXHFHUDOJR
 /HPEUDUVH GH DOJR ² HVTXHFHUVH GH DOJR SURQR-
IMPLICAR PLQDO
&RPRWUDQVLWLYRGLUHWRHVVHYHUERWHPGRLVVHQWLGRV
D GDUDHQWHQGHUID]HUVXSRUSUHVVXSRUSuas atitudes
1RžFDVRRVYHUERVVmRWUDQVLWLYRVGLUHWRVRXVHMD
LPSOLFDYDPXPÀUPHSURSyVLWR
H[LJHPFRPSOHPHQWRVHPSUHSRVLomREle esqueceu o livro.
E 7HUFRPRFRQVHTXrQFLDWUD]HUFRPRFRQVHTXrQFLD
1RžFDVRRVYHUERVVmRSURQRPLQDLV VHPHHWF H
DFDUUHWDUSURYRFDULiberdade de escolha implica amadure-
cimento político de um povo. H[LJHPFRPSOHPHQWRFRPDSUHSRVLomR´GHµ6mRSRUWDQ-
WRWUDQVLWLYRVLQGLUHWRV
 &RPR WUDQVLWLYR GLUHWR H LQGLUHWR VLJQLÀFD FRPSUR- - Ele se esqueceu do caderno.
PHWHUHQYROYHUImplicaram aquele jornalista em questões - Eu me esqueci da chave.
econômicas - Eles se esqueceram da prova.
- Nós nos lembramos de tudo o que aconteceu.
ObsQRVHQWLGRGHDQWLSDWL]DUWHULPSOLFkQFLDpWUDQ-
VLWLYRLQGLUHWRHUHJHFRPSUHSRVLomR´FRPµImplicava com +iXPDFRQVWUXomRHPTXHDFRLVDHVTXHFLGDRXOHP-
quem não trabalhasse arduamente. EUDGDSDVVDDIXQFLRQDUFRPRVXMHLWRHRYHUERVRIUHOHYH
DOWHUDomRGHVHQWLGReXPDFRQVWUXomRPXLWRUDUDQDOtQ-
PROCEDER JXDFRQWHPSRUkQHDSRUpPpIiFLOHQFRQWUiODHPWH[WRV
3URFHGHUpLQWUDQVLWLYRQRVHQWLGRGHVHUGHFLVLYRWHU FOiVVLFRVWDQWREUDVLOHLURVFRPRSRUWXJXHVHV0DFKDGRGH
FDELPHQWR WHU IXQGDPHQWR RX SRUWDUVH FRPSRUWDUVH $VVLVSRUH[HPSORIH]XVRGHVVDFRQVWUXomRYiULDVYH]HV
DJLU1HVVDVHJXQGDDFHSomRYHPVHPSUHDFRPSDQKDGR - Esqueceu-me a tragédia. (cair no esquecimento)
GHDGMXQWRDGYHUELDOGHPRGR - Lembrou-me a festa. (vir à lembrança)

89
LÍNGUA PORTUGUESA

2YHUEROHPEUDUWDPEpPSRGHVHUWUDQVLWLYRGLUHWRHLQGLUHWR OHPEUDUDOJXPDFRLVDDDOJXpPRXDOJXpPGHDOJXPD
FRLVD 

SIMPATIZAR
7UDQVLWLYRLQGLUHWRHH[LJHDSUHSRVLomR´FRPµNão simpatizei com os jurados

NAMORAR
eWUDQVLWLYRGLUHWRRXVHMDQmRDGPLWHSUHSRVLomRMaria namora João

Obs1mRpFRUUHWRGL]HU“Maria namora com João”.

OBEDECER
eWUDQVLWLYRLQGLUHWRRXVHMDH[LJHFRPSOHPHQWRFRPDSUHSRVLomR´Dµ REHGHFHUD Devemos obedecer aos pais

ObsHPERUDVHMDWUDQVLWLYRLQGLUHWRHVVHYHUERSRGHVHUXVDGRQDYR]SDVVLYD$ÀODQmRIRLREHGHFLGD

VER
eWUDQVLWLYRGLUHWRRXVHMDQmRH[LJHSUHSRVLomR(OHYLXRÀOPH

Regência Nominal

eRQRPHGDUHODomRH[LVWHQWHHQWUHXPQRPH VXEVWDQWLYRDGMHWLYRRXDGYpUELR HRVWHUPRVUHJLGRVSRUHVVHQRPH


(VVDUHODomRpVHPSUHLQWHUPHGLDGDSRUXPDSUHSRVLomR1RHVWXGRGDUHJrQFLDQRPLQDOpSUHFLVROHYDUHPFRQWDTXHYi-
ULRVQRPHVDSUHVHQWDPH[DWDPHQWHRPHVPRUHJLPHGRVYHUERVGHTXHGHULYDP&RQKHFHURUHJLPHGHXPYHUERVLJQLÀFD
QHVVHVFDVRVFRQKHFHURUHJLPHGRVQRPHVFRJQDWRV2EVHUYHRH[HPSOR9HUERREHGHFHUHRVQRPHVFRUUHVSRQGHQWHV
WRGRVUHJHPFRPSOHPHQWRVLQWURGX]LGRVSHODSUHSRVLomRa. 9HMD
Obedecer a algo/ a alguém.
Obediente a algo/ a alguém.

$SUHVHQWDPRVDVHJXLUYiULRVQRPHVDFRPSDQKDGRVGDSUHSRVLomRRXSUHSRVLo}HVTXHRVUHJHP2EVHUYHRVDWHQWD-
PHQWHHSURFXUHVHPSUHTXHSRVVtYHODVVRFLDUHVVHVQRPHVHQWUHVLRXDDOJXPYHUERFXMDUHJrQFLDYRFrFRQKHFH

Substantivos
Admiração a, por Devoção a, para, com, por Medo a, de
Aversão a, para, por Doutor em Obediência a
Atentado a, contra Dúvida acerca de, em, sobre Ojeriza a, por
Bacharel em Horror a Proeminência sobre
Capacidade de, para Impaciência com Respeito a, com, para com, por

Adjetivos
Acessível a Diferente de Necessário a
Acostumado a, com Entendido em Nocivo a
Afável com, para com Equivalente a Paralelo a
Agradável a Escasso de Parco em, de
Alheio a, de Essencial a, para Passível de
Análogo a Fácil de Preferível a
Ansioso de, para, por Fanático por Prejudicial a
Apto a, para Favorável a Prestes a
Ávido de Generoso com Propício a
%HQpÀFRD   *UDWRDSRU   3Uy[LPRD
Capaz de, para Hábil em Relacionado com
Compatível com Habituado a Relativo a
Contemporâneo a, de Idêntico a Satisfeito com, de, em, por
Contíguo a Impróprio para Semelhante a
Contrário a Indeciso em Sensível a
Curioso de, por Insensível a Sito em
Descontente com Liberal com Suspeito de
Desejoso de Natural de Vazio de

Advérbios
Longe de Perto de

90
LÍNGUA PORTUGUESA

2EV RV DGYpUELRV WHUPLQDGRV HP PHQWH WHQGHP D & RGHTXHR'LUHLWR>@HVWHMDSHUPHDGRHUHJXODGR


VHJXLURUHJLPHGRVDGMHWLYRVGHTXHVmRIRUPDGRVSDUD- SHODMXVWLoD
OHODDSDUDOHODPHQWHDUHODWLYDDUHODWLYDPHQWHD ' (VVDSUREOHPDWLFLGDGHQmRDIDVWDDIRUoDGDVDVSL-
UDo}HVGDMXVWLoD
)RQWH KWWSZZZVRSRUWXJXHVFRPEUVHFRHVVLQW (  1D GLQkPLFD GHVVD WHQVmR WHP SDSHO UHOHYDQWH R
VLQWSKS VHQWLPHQWRGHMXVWLoD

Questões sobre Regência Nominal e Verbal  (VFUHYHQWH7-63²9XQHVS $VVLQDOHDDOWHU-


QDWLYD HP TXH R SHUtRGR DGDSWDGR GD UHYLVWD 3HVTXLVD
 $GPLQLVWUDGRU²)&&²DGDS  )DSHVSGHMXQKRGHHVWiFRUUHWRTXDQWRjUHJrQFLD
DTXHSRQWRDDVWURQRPLDfacilitouDREUDGDVRXWUDV QRPLQDOHjSRQWXDomR
FLrQFLDV $  1mR Ki G~YLGD TXH DV PXOKHUHV DPSOLDP UDSLGD-
2YHUERTXHH[LJHRPHVPRWLSRGHFRPSOHPHQWRTXH PHQWHVHXHVSDoRQDFDUUHLUDFLHQWtÀFDDLQGDTXHRDYDQoR
RJULIDGRDFLPDHVWiHPSUHJDGRHP VHMDPDLVQRWiYHOHPDOJXQVSDtVHVR%UDVLOpXPH[HPSOR
$ DVWURVTXHÀFDPWmRGLVWDQWHV GRTXHHPRXWURV
% TXHDDVWURQRPLDpXPDGDVFLrQFLDV %  1mR Ki G~YLGD GH TXH DV PXOKHUHV DPSOLDP UD-
& TXHQRVSURSRUFLRQRXXPHVStULWR SLGDPHQWH VHX HVSDoR QD FDUUHLUD FLHQWtÀFD DLQGD TXH R
' FXMDLPSRUWkQFLDQLQJXpPLJQRUD DYDQoRVHMDPDLVQRWiYHOHPDOJXQVSDtVHVR%UDVLOpXP
( RQGHVHXFRUSRQmRSDVVDGHXPSRQWRREVFXUR H[HPSORGRTXHHPRXWURV
&  1mR Ki G~YLGD GH TXH DV PXOKHUHV DPSOLDP UD-
 $JHQWH GH $SRLR $GPLQLVWUDWLYR ² )&& ²  SLGDPHQWH VHX HVSDoR QD FDUUHLUD FLHQWtÀFD DLQGD TXH R
DGDS  DYDQoRVHMDPDLVQRWiYHOHPDOJXQVSDtVHVR%UDVLOpXP
 pediu DRGHOHJDGRGREDLUURTXHGHVVHXPMHLWRQRV H[HPSORGRTXHHPRXWURV
ÀOKRVGRVXHFR ' 1mRKiG~YLGDGHTXHDVPXOKHUHVDPSOLDPUDSLGD-
PHQWHVHXHVSDoRQDFDUUHLUDFLHQWtÀFDDLQGDTXHRDYDQoR
2YHUERTXHH[LJHQRFRQWH[WRRPHVPRWLSRGHFRP-
VHMDPDLVQRWiYHOHPDOJXQVSDtVHV²R%UDVLOpXPH[HPSOR
SOHPHQWRVTXHRJULIDGRDFLPDHVWiHPSUHJDGRHP
²GRTXHHPRXWURV
$ TXHH[LVWHXPDFRLVDFKDPDGDH[pUFLWR
(  1mR Ki G~YLGD TXH DV PXOKHUHV DPSOLDP UDSLGD-
% FRPRVHLVVRDTXLIRVVHFDVDGDVRJUD"
PHQWHVHXHVSDoRQDFDUUHLUDFLHQWtÀFDDLQGDTXHRDYDQ-
&  FRPSDUHFHX HP FRPSDQKLD GD PXOKHU j GHOHJD-
oRVHMDPDLVQRWiYHOHPDOJXQVSDtVHV R%UDVLOpXPH[HP-
FLD
SOR GRTXHHPRXWURV
' (XHQVLQRRVHQKRUDFXPSULUDOHLDOLQRGXUR
( 2GHOHJDGRDSHQDVROKRXDHVSDQWDGRFRPRDWUH-
 3DSLORVFRSLVWD3ROLFLDO²981(63² $VVLQD-
YLPHQWR OHDDOWHUQDWLYDFRUUHWDTXDQWRjUHJrQFLDGRVWHUPRVHP
GHVWDTXH
 $JHQWHGH'HIHQVRULD3~EOLFD²)&&²DGDS  $  (OH WHQWDYD FRQYHQFHU GXDV VHQKRUDV D DVVXPLU D
constavaVLPSOHVPHQWHGHXPDYDUHWDTXHEUDGDHP responsabilidadeSHORSUREOHPD
SDUWHVGHVLJXDLV % $PHQLQDWLQKDRreceio DOHYDUXPDEURQFDSRUWHU
2YHUERTXHH[LJHRPHVPRWLSRGHFRPSOHPHQWRTXH VHSHUGLGR
RJULIDGRDFLPDHVWiHPSUHJDGRHP & $JDURWDWLQKDDSHQDVDlembrançaSHORGHVHQKR
$ (PFDPSRVH[WHQVRVFKHJDYDPHPDOJXQVFDVRVD GHXPtQGLRQDSRUWDGRSUpGLR
H[WUHPRVGHVXWLOH]D ' $PHQLQDQmRWLQKDorgulho VRERIDWRGHWHUVH
% HUDPFRPXPHQWHDVVLQDODGRVDJROSHVGHPDFKD- SHUGLGRGHVXDIDPtOLD
GRQRVWURQFRVPDLVUREXVWRV ( $IDPtOLDWRGDVHRUJDQL]RXSDUDUHDOL]DUDprocura
& 2VWRVFRVGHVHQKRVHRVQRPHVHVWURSLDGRVGHVR- jJDURWLQKD
ULHQWDPQmRUDURTXHP
' .RFK*UQEHUJYLXXPDGHVVDVPDUFDVGHFDPLQKR  $QDOLVWD GH 6LVWHPDV ² 981(63 ²   $VVLQDOH
QDVHUUDGH7XQXt D DOWHUQDWLYD TXH FRPSOHWD FRUUHWD H UHVSHFWLYDPHQWH DV
( HPTXHWmREHPVHUHYHODPVXDVDÀQLGDGHVFRPR ODFXQDVGRWH[WRGHDFRUGRFRPDVUHJUDVGHUHJrQFLD
JHQWLRPHVWUHHFRODERUDGRU Os estudos _______ quais a pesquisadora se reportou já
assinalavam uma relação entre os distúrbios da imagem
 $JHQWH7pFQLFR²)&&²DGDS  corporal e a exposição a imagens idealizadas pela mídia.
SDUDlidar FRPDVP~OWLSODVYHUWHQWHVGDMXVWLoD $SHVTXLVDID]XPDOHUWDBBBBBBLQÁXrQFLDQHJDWLYDTXH
2YHUERTXHH[LJHRPHVPRWLSRGHFRPSOHPHQWRTXH a mídia pode exercer sobre os jovens.
RGDIUDVHDFLPDVHHQFRQWUDHP $ GRV¬QD
$ $SDODYUDGLUHLWRHPSRUWXJXrVYHPGHGLUHFWXP % QRV¬HQWUHD
GRYHUERODWLQRGLULJHUH & DRV¬SDUDD
% R'LUHLWRWHPXPDFRPSOH[DIXQomRGHJHVWmRGDV ' VREUHRV¬SHOD
VRFLHGDGHV ( SHORV¬VRED

91
LÍNGUA PORTUGUESA

 $QDOLVWDHP3ODQHMDPHQWR2UoDPHQWRH)LQDQoDV &RQVWDU YHUERLQWUDQVLWLYR


3~EOLFDV²981(63² &RQVLGHUDQGRDQRUPDSDGUmR % HUDPFRPXPHQWHDVVLQDODGRVDJROSHVGHPDFKD-
GDOtQJXDDVVLQDOHDDOWHUQDWLYDHPTXHRVWUHFKRVGHVWD- GRQRVWURQFRVPDLVUREXVWRV OLJDomR
FDGRVHVWmRFRUUHWRVTXDQWRjUHJrQFLDYHUEDORXQRPLQDO & 2VWRVFRVGHVHQKRVHRVQRPHVHVWURSLDGRVGHVR-
$ 2SUpGLRTXHRWD[LVWDPRVWURXdispunha de PDLV ULHQWDPQmRUDURTXHP WUDQVLWLYRGLUHWR
GHGH]PLOWRPDGDV ' .RFK*UQEHUJYLXXPDGHVVDVPDUFDVGHFDPLQKR
% 2DXWRUIH]conjecturas sob DSRVVLELOLGDGHGHKDYHU QDVHUUDGH7XQXt WUDQVLWLYRGLUHWR
XPKRPHPTXHHVWDULDRXYLQGRDVQRWDVGHXPRERp ( HPTXHWmREHPVHUHYHODPVXDVDÀQLGDGHVFRPR
&  &HQWHQDV GH WUDEDOKDGRUHV HVWmR empenhados de JHQWLRPHVWUHHFRODERUDGRU WUDQVLWLYRGLUHWR
FULDUORJRWLSRVHQHJRFLDU
'  2 WD[LVWD OHYRX R DXWRU D indagar no Q~PHUR GH  SDUDOLGDUFRPDVP~OWLSODVYHUWHQWHVGDMXVWLoD
WRPDGDVGRHGLItFLR /LGDU WUDQVLWLYRLQGLUHWR
( $FRUULGDFRPRWD[LVWDSRVVLELOLWRXTXHRDXWRUre- % R'LUHLWRWHPXPDFRPSOH[DIXQomRGHJHVWmRGDV
parasse aXPSUpGLRQDPDUJLQDO VRFLHGDGHV WUDQVLWLYRGLUHWR
& RGHTXHR'LUHLWR>@HVWHMDSHUPHDGRHUHJXODGR
SHODMXVWLoD OLJDomR
 $VVLVWHQWHGH,QIRUPiWLFD,,²981(63² $V-
' (VVDSUREOHPDWLFLGDGHQmRDIDVWDDIRUoDGDVDVSLUD-
VLQDOHDDOWHUQDWLYDTXHVXEVWLWXLDH[SUHVVmRGHVWDFDGDQD
o}HVGDMXVWLoD WUDQVLWLYRGLUHWRHLQGLUHWR
IUDVHFRQIRUPHDVUHJUDVGHUHJrQFLDGDQRUPDSDGUmRGD (  1D GLQkPLFD GHVVD WHQVmR WHP SDSHO UHOHYDQWH R
OtQJXDHVHPDOWHUDomRGHVHQWLGR VHQWLPHQWRGHMXVWLoD WUDQVLWLYRGLUHWR
0XLWDVRUJDQL]Do}HVOXWDUDPa favor daLJXDOGDGHGH
GLUHLWRVGRVWUDEDOKDGRUHVGRPpVWLFRV  A correção do item deve respeitar as regras de pon-
$ GD tuação também. Assinalei apenas os desvios quanto à re-
% QD JrQFLD SRQWXDomRHQFRQWUDVHHPWySLFRHVSHFtÀFR
& SHOD $ 1mRKiG~YLGDGHTXHDVPXOKHUHVDPSOLDP
' VRED % 1mRKiG~YLGDGHTXH HUURVTXDQWRjSRQ-
( VREUHD WXDomR
& 1mRKiG~YLGDGHTXHDVPXOKHUHV HUURVTXDQWR
GABARITO jSRQWXDomR
( 1mRKiG~YLGDGHTXHDVPXOKHUHVDPSOLDPUDSL-
01. D 02. D 03. A 04. A 05. D GDPHQWH VHX HVSDoR QD FDUUHLUD FLHQWtÀFD DLQGD TXH R
06. A 07. C 08. A09. C DYDQoRVHMDPDLVQRWiYHOHPDOJXQVSDtVHV R%UDVLOpXP
H[HPSOR GRTXHHPRXWURV
RESOLUÇÃO  
% $PHQLQDWLQKDRUHFHLRGHOHYDUXPDEURQFDSRU
   D TXH SRQWR D DVWURQRPLD IDFLOLWRX D REUD GDV WHUVHSHUGLGR
RXWUDVFLrQFLDV & $JDURWDWLQKDDSHQDVDOHPEUDQoDGRGHVHQKRGH
)DFLOLWDU²YHUERWUDQVLWLYRGLUHWR XPtQGLRQDSRUWDGRSUpGLR
$ DVWURVTXHÀFDPWmRGLVWDQWHV YHUERGHOL- ' $PHQLQDQmRWLQKDRUJXOKRGRIDWRGHWHUVHSHU-
JDomR GLGRGHVXDIDPtOLD
% TXHDDVWURQRPLDéXPDGDVFLrQFLDV YHUER ( $IDPtOLDWRGDVHRUJDQL]RXSDUDUHDOL]DUDSURFXUD
GHOLJDomR SHODJDURWLQKD
& TXHQRVproporcionouXPHVStULWR YHUERWUDQ-
  2V HVWXGRV       DRV  TXDLV D SHVTXLVDGRUD VH UH-
VLWLYRGLUHWRHLQGLUHWR
SRUWRXMiDVVLQDODYDPXPDUHODomRHQWUHRVGLVW~UELRVGD
( RQGHVHXFRUSRQmRpassaGHXPSRQWRREVFXUR  LPDJHPFRUSRUDOHDH[SRVLomRDLPDJHQVLGHDOL]DGDVSHOD
YHUERWUDQVLWLYRLQGLUHWR PtGLD
$SHVTXLVDID]XPDOHUWDSDUDDLQÁXrQFLDQHJDWLYD
 SHGLXDRGHOHJDGRGREDLUURTXHGHVVHXPMHLWR TXHDPtGLDSRGHH[HUFHUVREUHRVMRYHQV
QRVÀOKRVGRVXHFR
3HGLU YHUERWUDQVLWLYRGLUHWRHLQGLUHWR  
$ TXHexisteXPDFRLVDFKDPDGD(;e5&,72 WUDQ- % 2DXWRUIH]FRQMHFWXUDVVREUHDSRVVLELOLGDGHGHKD-
VLWLYRGLUHWR YHUXPKRPHPTXHHVWDULDRXYLQGRDVQRWDVGHXPRERp
% FRPRVHLVVRDTXLfosseFDVDGDVRJUD" YHUERGH &  &HQWHQDV GH WUDEDOKDGRUHV HVWmR HPSHQKDGRV HP
OLJDomR FULDUORJRWLSRVHQHJRFLDU
&  compareceu HP FRPSDQKLD GD PXOKHU j GHOHJD- ' 2WD[LVWDOHYRXRDXWRUDLQGDJDUVREUHRQ~PHURGH
FLD YHUERLQWUDQVLWLYR WRPDGDVGRHGLItFLR
( 2GHOHJDGRDSHQDVolhouDHVSDQWDGRFRPRDWUHYL- ( $FRUULGDFRPRWD[LVWDSRVVLELOLWRXTXHRDXWRUUH-
PHQWR WUDQVLWLYRGLUHWR SDUDVVHHPXPSUpGLRQDPDUJLQDO

 FRQVWDYDVLPSOHVPHQWHGHXPDYDUHWDTXHEUDGD  0XLWDVRUJDQL]Do}HVOXWDUDPSHODLJXDOGDGHGH
HPSDUWHVGHVLJXDLV GLUHLWRVGRVWUDEDOKDGRUHVGRPpVWLFRV

92
LÍNGUA PORTUGUESA

DISCURSO DIRETO, INDIRETO E LIVRE


ANÁLISE, COMPREENSÃO E INTERPRETAÇÃO
DE TEXTO: TIPOS DE COMUNICAÇÃO:
DiscursopDSUiWLFDKXPDQDGHFRQVWUXLUWH[WRVVHMDP DESCRIÇÃO; NARRAÇÃO; DISSERTAÇÃO;
HOHV HVFULWRV RX RUDLV 6HQGR DVVLP WRGR GLVFXUVR p XPD TIPOS DE DISCURSO; COESÃO TEXTUAL.
SUiWLFD VRFLDO $ DQiOLVH GH XP GLVFXUVR GHYH SRUWDQWR
FRQVLGHUDURFRQWH[WRHPTXHVHHQFRQWUDDVVLPFRPRDV
SHUVRQDJHQVHDVFRQGLo}HVGHSURGXomRGRWH[WR
(PXPWH[WRQDUUDWLYRRDXWRUSRGHRSWDUSRUWUrVWL- ePXLWRFRPXPHQWUHRVFDQGLGDWRVDXPFDUJRS~EOL-
SRV GH GLVFXUVR o discurso direto, o discurso indireto e o FRDSUHRFXSDomRFRPDLQWHUSUHWDomRGHWH[WRV3RULVVR
discurso indireto livre.1mRQHFHVVDULDPHQWHHVWHVWUrVGLV- YmRDTXLDOJXQVGHWDOKHVTXHSRGHUmRDMXGDUQRPRPHQWR
FXUVRV HVWmR VHSDUDGRV HOHV SRGHP DSDUHFHU MXQWRV HP GHUHVSRQGHUjVTXHVW}HVUHODFLRQDGDVDWH[WRV
XPWH[WR'HSHQGHUiGHTXHPRSURGX]LX 
9HMDPRVFDGDXPGHOHV Texto ²pXPFRQMXQWRGHLGHLDVRUJDQL]DGDVHUHODFLR-
Discurso Direto 1HVWH WLSR GH GLVFXUVR DV SHUVRQD- QDGDV HQWUH VL IRUPDQGR XP WRGR VLJQLÀFDWLYR FDSD] GH
JHQV JDQKDP YR] e R TXH RFRUUH QRUPDOPHQWH HP GLi- SURGX]LU LQWHUDomR FRPXQLFDWLYD FDSDFLGDGH GH FRGLÀFDU
ORJRV,VVRSHUPLWHTXHWUDoRVGDIDODHGDSHUVRQDOLGDGH HGHFRGLÀFDU 
GDVSHUVRQDJHQVVHMDPGHVWDFDGRVHH[SRVWRVQRWH[WRO 
GLVFXUVRGLUHWRUHSURGX]ÀHOPHQWHDVIDODVGDVSHUVRQDJHQV Contexto ²XPWH[WRpFRQVWLWXtGRSRUGLYHUVDVIUDVHV
9HUERV FRPR dizer, falar, perguntar HQWUH RXWURV VHUYHP (P FDGD XPD GHODV Ki XPD FHUWD LQIRUPDomR TXH D ID]
OLJDUVHFRPDDQWHULRUHRXFRPDSRVWHULRUFULDQGRFRQ-
SDUD TXH DV IDODV GDV SHUVRQDJHQV VHMDP LQWURGX]LGDV H
GLo}HVSDUDDHVWUXWXUDomRGRFRQWH~GRDVHUWUDQVPLWLGR
HODVJDQKHPYLGDFRPRHPXPDSHoDWHDWUDO
$HVVDLQWHUOLJDomRGiVHRQRPHGHFRQWH[WR1RWDVHTXH
7UDYHVV}HVGRLVSRQWRVDVSDVHH[FODPDo}HVVmRPXL-
RUHODFLRQDPHQWRHQWUHDVIUDVHVpWmRJUDQGHTXHVHXPD
WRFRPXQVGXUDQWHDUHSURGXomRGDVIDODV([ IUDVHIRUUHWLUDGDGHVHXFRQWH[WRRULJLQDOHDQDOLVDGDVH-
“O Guaxinim está inquieto, mexe dum lado pra outro. Eis SDUDGDPHQWHSRGHUiWHUXPVLJQLÀFDGRGLIHUHQWHGDTXHOH
que suspira lá na língua dele - Chente! que vida dura esta de LQLFLDO
guaxinim do banhado!...” 
“- Mano Poeta, se enganche na minha garupa!” Intertexto  FRPXPHQWH RV WH[WRV DSUHVHQWDP UHIH-
Discurso Indireto2QDUUDGRUFRQWDDKLVWyULDHUHSUR- UrQFLDVGLUHWDVRXLQGLUHWDVDRXWURVDXWRUHVDWUDYpVGHFL-
GX]IDODHUHDo}HVGDVSHUVRQDJHQVeHVFULWRQRUPDOPHQ- WDo}HV(VVHWLSRGHUHFXUVRGHQRPLQDVHLQWHUWH[WR
WHHPWHUFHLUDSHVVRD1HVVHFDVRRQDUUDGRUXWLOL]DVHGH 
SDODYUDVVXDVSDUDUHSURGX]LUDTXLORTXHIRLGLWRSHODSHU- Interpretação de textoRSULPHLURREMHWLYRGHXPD
VRQDJHP([ LQWHUSUHWDomR GH XP WH[WR p D LGHQWLÀFDomR GH VXD LGHLD
“Elisiário confessou que estava com sono.” 0DFKDGRGH SULQFLSDO $ SDUWLU GDt ORFDOL]DPVH DV LGHLDV VHFXQGiULDV
$VVLV RX IXQGDPHQWDo}HV DV DUJXPHQWDo}HV RX H[SOLFDo}HV
“Fora preso pela manhã, logo ao erguer-se da cama, e, TXH OHYHP DR HVFODUHFLPHQWR GDV TXHVW}HV DSUHVHQWDGDV
pelo cálculo aproximado do tempo, pois estava sem relógio QDSURYD
e mesmo se o tivesse não poderia consultá-lo à fraca luz da 1RUPDOPHQWHQXPDSURYDRFDQGLGDWRpFRQYLGDGRD
masmorra, imaginava podiam ser onze horas.” /LPD%DUUH- 
WR ,GHQWLÀFDU²pUHFRQKHFHURVHOHPHQWRVIXQGDPHQ-
Discurso Indireto Livre2WH[WRpHVFULWRHPWHUFHLUD WDLVGHXPDDUJXPHQWDomRGHXPSURFHVVRGHXPDpSRFD
SHVVRDHRQDUUDGRUFRQWDDKLVWyULDPDVDVSHUVRQDJHQV QHVWHFDVRSURFXUDPVHRVYHUERVHRVDGYpUELRVRVTXDLV
WrPYR]SUySULDGHDFRUGRFRPDQHFHVVLGDGHGRDXWRUGH GHÀQHPRWHPSR 
ID]rOR6HQGRDVVLPpXPDPLVWXUDGRVRXWURVGRLVWLSRV  Comparar ² p GHVFREULU DV UHODo}HV GH VHPHOKDQoD
GHGLVFXUVRHDVGXDVYR]HVVHIXQGHP([ RXGHGLIHUHQoDVHQWUHDVVLWXDo}HVGRWH[WR
“Que vontade de voar lhe veio agora! Correu outra vez  Comentar  p UHODFLRQDU  R FRQWH~GR DSUHVHQWDGR
com a respiração presa. Já nem podia mais. Estava desani- FRPXPDUHDOLGDGHRSLQDQGRDUHVSHLWR
Resumir²pFRQFHQWUDUDVLGHLDVFHQWUDLVHRXVHFXQ-
mado. Que pena! Houve um momento em que esteve qua-
GiULDVHPXPVySDUiJUDIR
se... quase!”
Parafrasear²pUHHVFUHYHURWH[WRFRPRXWUDVSDOD-
“Retirou as asas e estraçalhou-a. Só tinham beleza. En-
tretanto, qualquer urubu... que raiva...µ $QD0DULD0DFKD- YUDV
GR
“D. Aurora sacudiu a cabeça e afastou o juízo temerário. Condições básicas para interpretar
Para que estar catando defeitos no próximo? Eram todos ir- 
mãos. Irmãos.” *UDFLOLDQR5DPRV )D]HPVHQHFHVViULRV
 &RQKHFLPHQWR KLVWyULFR²OLWHUiULR HVFRODV H JrQHURV
)217( OLWHUiULRVHVWUXWXUDGRWH[WR OHLWXUDHSUiWLFD
KWWSZZZLQIRHVFRODFRPUHGDFDRWLSRVGHGLVFXU-  &RQKHFLPHQWR JUDPDWLFDO HVWLOtVWLFR TXDOLGDGHV GR
VR WH[WR HVHPkQWLFR

93
LÍNGUA PORTUGUESA

Observação²QDVHPkQWLFD VLJQLÀFDGRGDVSDODYUDV  2V SURQRPHV UHODWLYRV VmR PXLWR LPSRUWDQWHV QD LQ-
LQFOXHPVHKRP{QLPRVHSDU{QLPRVGHQRWDomRHFRQR- WHUSUHWDomRGHWH[WRSRLVVHXXVRLQFRUUHWRWUD]HUURVGH
WDomRVLQRQtPLDHDQWRQtPLDSROLVVHPLDÀJXUDVGHOLQJXD- FRHVmR$VVLPVHQGRGHYHVHOHYDUHPFRQVLGHUDomRTXH
JHPHQWUHRXWURV H[LVWHXPSURQRPHUHODWLYRDGHTXDGRDFDGDFLUFXQVWkQFLD
&DSDFLGDGHGHREVHUYDomRHGHVtQWHVHH DVDEHU
&DSDFLGDGHGHUDFLRFtQLR 
que (neutro)UHODFLRQDVHFRPTXDOTXHUDQWHFHGHQ-
Interpretar X compreender WHPDVGHSHQGHGDVFRQGLo}HVGDIUDVH
qual (neutro)LGHPDRDQWHULRU
,QWHUSUHWDUVLJQLÀFD quem (pessoa)
- Explicar, comentar, julgar, tirar conclusões, deduzir. cujo (posse)DQWHVGHOHDSDUHFHRSRVVXLGRUHGHSRLV
- Através do texto, infere-se que... RREMHWRSRVVXtGR
- É possível deduzir que... como (modo)
- O autor permite concluir que... onde (lugar)
4XDOpDLQWHQomRGRDXWRUDRDÀUPDUTXH quando (tempo)
quanto (montante)
&RPSUHHQGHUVLJQLÀFD
- intelecção, entendimento, atenção ao que realmente ([HPSOR
está escrito. Falou tudo QUANTO queria (correto)
- o texto diz que... Falou tudo QUE queria (errado - antes do QUE, deveria
- é sugerido pelo autor que... aparecer o demonstrativo O ).
GHDFRUGRFRPRWH[WRpFRUUHWDRXHUUDGDDDÀUPD- 
ção... Dicas para melhorar a interpretação de textos
RQDUUDGRUDÀUPD
/HUWRGRRWH[WRSURFXUDQGRWHUXPDYLVmRJHUDOGR
Erros de interpretação DVVXQWR
 6HHQFRQWUDUSDODYUDVGHVFRQKHFLGDVQmRLQWHUURPSD
ePXLWRFRPXPPDLVGRTXHVHLPDJLQDDRFRUUrQFLD DOHLWXUD
GHHUURVGHLQWHUSUHWDomR2VPDLVIUHTXHQWHVVmR
/HUOHUEHPOHUSURIXQGDPHQWHRXVHMDOHURWH[WR
([WUDSRODomR YLDJHP 2FRUUHTXDQGRVHVDLGRFRQ-
SHORPHQRVGXDVYH]HV
WH[WRDFUHVFHQWDGRLGHLDVTXHQmRHVWmRQRWH[WRTXHUSRU
,QIHULU
FRQKHFLPHQWRSUpYLRGRWHPDTXHUSHODLPDJLQDomR
9ROWDUDRWH[WRTXDQWDVYH]HVSUHFLVDU

1mRSHUPLWLUTXHSUHYDOHoDPVXDVLGHLDVVREUHDVGR
5HGXomReRRSRVWRGDH[WUDSRODomR'iVHDWHQomR
DXWRU
DSHQDVDXPDVSHFWRHVTXHFHQGRTXHXPWH[WRpXPFRQ-
)UDJPHQWDURWH[WR SDUiJUDIRVSDUWHV SDUDPHOKRU
MXQWRGHLGHLDVRTXHSRGHVHULQVXÀFLHQWHSDUDRWRWDOGR
HQWHQGLPHQWRGRWHPDGHVHQYROYLGR FRPSUHHQVmR
  9HULÀFDU FRP DWHQomR H FXLGDGR R HQXQFLDGR GH
&RQWUDGLomR1mRUDURRWH[WRDSUHVHQWDLGHLDVFRQ- FDGDTXHVWmR
WUiULDVjVGRFDQGLGDWRID]HQGRRWLUDUFRQFOXV}HVHTXLYR- 2DXWRUGHIHQGHLGHLDVHYRFrGHYHSHUFHErODV
FDGDVHFRQVHTXHQWHPHQWHHUUDQGRDTXHVWmR
Observação0XLWRVSHQVDPTXHKiDyWLFDGRHV- )RQWH
FULWRUHDyWLFDGROHLWRU3RGHVHUTXHH[LVWDPPDVQXPD KWWSZZZWXGRVREUHFRQFXUVRVFRPPDWHULDLVSRUWX-
SURYDGHFRQFXUVRRTXHGHYHVHUOHYDGRHPFRQVLGHUDomR JXHVFRPRLQWHUSUHWDUWH[WRV
pRTXHRDXWRUGL]HQDGDPDLV
 QUESTÕES
CoesãopRHPSUHJRGHPHFDQLVPRGHVLQWD[HTXH
UHODFLRQDSDODYUDVRUDo}HVIUDVHVHRXSDUiJUDIRVHQWUHVL   6$%(6363 ² $7(1'(17( $ &/,(17(6  ²
(PRXWUDVSDODYUDVDFRHVmRGiVHTXDQGRDWUDYpVGHXP )&&  $'$37$'$  $WHQomR 3DUD UHVSRQGHU j TXHV-
SURQRPHUHODWLYRXPDFRQMXQomR 1(;26 RXXPSURQR- WmRFRQVLGHUHRWH[WRDEDL[R
PHREOtTXRiWRQRKiXPDUHODomRFRUUHWDHQWUHRTXHVH
YDLGL]HUHRTXHMiIRLGLWR A marca da solidão

2%6(59$d®2²6mRPXLWRVRVHUURVGHFRHVmRQRGLD Deitado de bruços, sobre as pedras quentes do chão de
DGLDHHQWUHHOHVHVWiRPDXXVRGRSURQRPHUHODWLYRH paralelepípedos, o menino espia. Tem os braços dobrados e a
GRSURQRPHREOtTXRiWRQR(VWHGHSHQGHGDUHJrQFLDGR testa pousada sobre eles, seu rosto formando uma tenda de
YHUERDTXHOHGRVHXDQWHFHGHQWH1mRVHSRGHHVTXHFHU penumbra na tarde quente.
WDPEpPGHTXHRVSURQRPHVUHODWLYRVWrPFDGDXPYDORU Observa as ranhuras entre uma pedra e outra. Há, den-
VHPkQWLFRSRULVVRDQHFHVVLGDGHGHDGHTXDomRDRDQWH- tro de cada uma delas, um diminuto caminho de terra, com
FHGHQWH pedrinhas e tufos minúsculos de musgos, formando peque-

94
LÍNGUA PORTUGUESA

QDVSODQWDVtQÀPRVERQVDLVVyYLVtYHLVDRVROKRVGHTXHPp — Quem te mandou essa carta?


capaz de parar de viver para, apenas, ver. Quando se tem a — Minha irmã.
marca da solidão na alma, o mundo cabe numa fresta. — Mas por que não está escrito nada?
6(,;$6+HORtVD&RQWRVPDLVTXHPtQLPRV5LRGH-D- — Ah, porque nós brigamos e não estamos nos falando!
QHLUR7LQWDQHJUDED]DUS ,QWHUQHW ZZZKXPRUWDGHODFRPEUSLDGD! FRP
1RWH[WRRVXEVWDQWLYRXVDGRSDUDUHVVDOWDURXQLYHUVR DGDSWDo}HV 
UHGX]LGRQRTXDORPHQLQRGHWpPVXDDWHQomRp 2 HIHLWR VXUSUHVD H GH KXPRU TXH VH H[WUDL GR WH[WR
$ IUHVWD DFLPDGHFRUUH
% PDUFD $ GDLGHQWLÀFDomRQXPpULFDDWULEXtGDDRORXFR
%  GD H[SUHVVmR XWLOL]DGD SHOR FDUWHLUR DR HQWUHJDU D
& DOPD
FDUWDQRKRVStFLR
' VROLGmR
&  GR IDWR GH RXWUR ORXFR TXHUHU VDEHU TXHP HQYLRX
( SHQXPEUD DFDUWD
' GDH[SOLFDomRGDGDSHORORXFRSDUDDFDUWDHPEUDQ-
  $1&,1( ² 7e&1,&2 $'0,1,675$7,92 ² &(6- FR
3(  ( GRIDWRGHDLUPmGRORXFRWHUEULJDGRFRPHOH
O riso é tão universal como a seriedade; ele abarca a
totalidade do universo, toda a sociedade, a história, a con-   '(75$151²9,6725,$'25(03/$&$'25²)*9
cepção de mundo. É uma verdade que se diz sobre o mundo, 352-(726 
que se estende a todas as coisas e à qual nada escapa. É,
de alguma maneira, o aspecto festivo do mundo inteiro, em Painel do leitor (Carta do leitor)
todos os seus níveis, uma espécie de segunda revelação do
mundo. Resgate no Chile
0LNKDLO%DNKWLQ$FXOWXUDSRSXODUQD,GDGH0pGLDHR
5HQDVFLPHQWRRFRQWH[WRGH)UDQoRLV5DEHODLV6mR3DXOR Assisti ao maior espetáculo da Terra numa operação de
+XFLWHFS FRPDGDSWDo}HV  salvamento de vidas, após 69 dias de permanência no fundo
de uma mina de cobre e ouro no Chile.
1DOLQKDRHOHPHQWR´HOHµWHPFRPRUHIHUHQWHWH[- Um a um os mineiros soterrados foram içados com
sucesso, mostrando muita calma, saúde, sorrindo e cum-
WXDO´2ULVRµ
primentando seus companheiros de trabalho. Não se pode
 &(572  (55$'2
esquecer a ajuda técnica e material que os Estados Unidos,
Canadá e China ofereceram à equipe chilena de salvamen-
  $1((/²7e&1,&2$'0,1,675$7,92²&(63(  to, num gesto humanitário que só enobrece esses países. E,
Só agora, quase cinco meses depois do apagão que atin- também, dos dois médicos e dois “socorristas” que, demons-
giu pelo menos 1.800 cidades em 18 estados do país, surge trando coragem e desprendimento, desceram na mina para
XPD H[SOLFDomR RÀFLDO VDWLVIDWyULD SDUD R FRUWH DEUXSWR H ajudar no salvamento.
JHQHUDOL]DGRGHHQHUJLDQRÀQDOGH  'RXJODV-RUJH6mR3DXOR63ZZZIROKDFRPEU²SDL-
Segundo relatório da Agência Nacional de Energia Elé- QHOGROHLWRU²
trica (ANEEL), a responsabilidade recai sobre a empresa es-
tatal Furnas, cujas linhas de transmissão cruzam os mais de &RQVLGHUDQGRRWLSRWH[WXDODSUHVHQWDGRDOJXPDVH[-
900 km que separam Itaipu de São Paulo. SUHVV}HVGHPRQVWUDPRSRVLFLRQDPHQWRSHVVRDOGROHLWRU
Equipamentos obsoletos, falta de manutenção e de in- GLDQWHGRIDWRSRUHOHQDUUDGR7DLVPDUFDVWH[WXDLVSRGHP
vestimentos e também erros operacionais conspiraram para VHUHQFRQWUDGDVQRVWUHFKRVDVHJXLU(;&(72
produzir a mais séria falha do sistema de geração e distri- $ ´$VVLVWLDRPDLRUHVSHWiFXORGD7HUUDµ
buição de energia do país desde o traumático racionamento % ´DSyVGLDVGHSHUPDQrQFLDQRIXQGRGHXPD
de 2001. PLQDGHFREUHHRXURQR&KLOHµ
& ´1mRVHSRGHHVTXHFHUDDMXGDWpFQLFDHPDWHULDOµ
)ROKD GH 63DXOR (GLWRULDO  FRP DGDSWD-
' ´JHVWRKXPDQLWiULRTXHVyHQREUHFHHVVHVSDtVHVµ
o}HV 
( ´GHPRQVWUDQGRFRUDJHPHGHVSUHQGLPHQWRGHV-
FHUDPQDPLQDµ
&RQVLGHUDQGR RV VHQWLGRV H DV HVWUXWXUDV OLQJXtVWLFDV '&7$ ² 7e&1,&2  ² 6(*85$1d$ '2 75$%$/+2 ²
GRWH[WRDFLPDDSUHVHQWDGRMXOJXHRVSUy[LPRVLWHQV 981(63$'$37$'$ /HLDRWH[WRSDUDUHVSRQGHUjV
$RUDomR´TXHDWLQJLXSHORPHQRVFLGDGHVHP TXHVW}HVGHQ~PHURVD
HVWDGRVGRSDtVµWHPQHVVHFRQWH[WRYDORUUHVWULWLYR
 &(572  (55$'2 Férias na Ilha do Nanja

  &255(,26²&$57(,52²&(63( Meus amigos estão fazendo as malas, arrumando as


Um carteiro chega ao portão do hospício e grita: malas nos seus carros, olhando o céu para verem que tempo
— Carta para o 9.326!!! faz, pensando nas suas estradas – barreiras, pedras soltas,
Um louco pega o envelope, abre-o e vê que a carta está ÀVVXUDV ²VHPIDODUHPEDQGLGRVPLOK}HVGHEDQGLGRVHQWUH
embranco, e um outro pergunta: DVÀVVXUDVDVSHGUDVVROWDVHDVEDUUHLUDV

95
LÍNGUA PORTUGUESA

Meus amigos partem para as suas férias, cansados de  6HSHJDUQREROVRGRFRQVXPLGRUHQWmRWRGRPXQ-


tanto trabalho; de tanta luta com os motoristas da contra- GRYDLWHUTXHSHQVDUEHPDQWHVGHFRPSUDUXPFDUUR
PmRHQÀPFDQVDGRVFDQVDGRVGHVHUHPREULJDGRVDYLYHU  $JHQWHMiSDJDJDUDJHPJDVROLQDVHJXURHVWDFLR-
numa grande cidade, isto que já está sendo a negação da QDPHQWRUHYLVmRHDJRUDPDLVRSHGiJLR"
própria vida.  1yVMiSDJDPRVLPSRVWRVDOWRVHRGLQKHLURQmRp
E eu vou para a Ilha do Nanja. LQYHVWLGRQRWUDQVSRUWHS~EOLFR
Eu vou para a Ilha do Nanja para sair daqui. Passarei as  4XHUDQGDUVR]LQKRGHQWURGRVHXFDUUR"(QWmRSD-
férias lá, onde, à beira das lagoas verdes e azuis, o silêncio JXHSHORSULYLOpJLR
cresce como um bosque. Nem preciso fechar os olhos: já es-   2 WUkQVLWR QDV FLGDGHV TXH LQVWLWXtUDP R SHGiJLR
tou vendo os pescadores com suas barcas de sardinha, e a XUEDQRPHOKRURX
moça à janela a namorar um moço na outra janela de outra
ilha. $RUGHPREWLGDp
&HFtOLD 0HLUHOHV 2 TXH VH GL] H R TXH VH HQWHQGH D  6  1  1  6  6  6  1
$GDSWDGR
E  6  1  6  1  1  6  6
F  1  6  6  1  6  1  6
ÀVVXUDVIHQGDVUDFKDGXUDV
G  6  6  1  6  1  6  1
  '&7$²7e&1,&2²6(*85$1d$'275$%$/+2 H  1  1  6  6  1  6  1
² 981(63  1R SULPHLUR SDUiJUDIR DR GHVFUHYHU D
PDQHLUDFRPRVHSUHSDUDPSDUDVXDVIpULDVDDXWRUDPRV-   75,%81$/'(-867,d$'2(67$'2'23$5$1ɲ
WUDTXHVHXVDPLJRVHVWmR $'0,1,675$'258)35 $VVLQDOHDDOWHUQDWLYDTXH
$ VHUHQRV DSUHVHQWDXPGLWRSRSXODUTXHSDUDIUDVHLDRFRQWH~GRH[-
% GHVFXLGDGRV SUHVVRQRH[FHUWR´Se você está em casa, não pode sair. Se
& DSUHHQVLYRV você está na rua, não pode entrarµ
' LQGLIHUHQWHV D ´6HFRUUHURELFKRSHJDVHÀFDURELFKRFRPHµ
( UHOD[DGRV E ´4XDQGRRJDWRVDLRVUDWRVID]HPDIHVWDµ
F ´8PGLDGDFDoDRRXWURGRFDoDGRUµ
  '&7$²7e&1,&2²6(*85$1d$'275$%$/+2 G ´0DQGDTXHPSRGHREHGHFHTXHPSUHFLVDµ
²981(63 'HDFRUGRFRPRWH[WRSRGHVHDÀUPDU
TXHDVVLPFRPRVHXVDPLJRVDDXWRUDYLDMDSDUD
$ YLVLWDUXPOXJDUWRWDOPHQWHGHVFRQKHFLGR 5HVROXomR
% HVFDSDUGROXJDUHPTXHHVWi
& UHHQFRQWUDUIDPLOLDUHVTXHULGRV  
' SUDWLFDUHVSRUWHVUDGLFDLV &RPSDODYUDVGRSUySULRWH[WRUHVSRQGHUHPRVRPXQ-
( GHGLFDUVHDRWUDEDOKR GRFDEHQXPDIUHVWD
5(63267$´$µ
  '&7$²7e&1,&2²6(*85$1d$'275$%$/+2
² 981(63  $R GHVFUHYHU D ,OKD GR 1DQMD FRPR XP  
OXJDU RQGH ´j EHLUD GDV ODJRDV YHUGHV H D]XLV R VLOrQFLR 9DPRV DR WH[WR 2 ULVR p WmR XQLYHUVDO FRPR D VHULH-
FUHVFHFRPRXPERVTXHµ ~OWLPRSDUiJUDIR DDXWRUDVX- GDGH HOH DEDUFD D WRWDOLGDGH GR XQLYHUVR   2V WHUPRV
JHUHTXHYLDMDUiSDUDXPOXJDU UHODFLRQDPVH2SURQRPH´HOHµUHWRPDRVXMHLWR´ULVRµ
$ UHSXOVLYRHSRSXORVR
5(63267$´&(572µ
% VRPEULRHGHVDELWDGR
& FRPHUFLDOHPRYLPHQWDGR
 
' EXFyOLFRHVRVVHJDGR
( RSUHVVLYRHDJLWDGR 9ROWHPRVDRWH[WR´GHSRLVGRDSDJmRTXHDWLQJLXSHOR
  '1,7²7e&1,&2$'0,1,675$7,92²(6$) PHQRV  FLGDGHVµ 2 ´TXHµ SRGH VHU VXEVWLWXtGR SRU
Grandes metrópoles em diversos países já aderiram. E ´RTXDOµSRUWDQWRWUDWDVHGHXPSURQRPHUHODWLYR RUD-
o Brasil já está falando sobre isso. O pedágio urbano divide omRVXERUGLQDGDDGMHWLYD 4XDQGRKiSUHVHQoDGHYtUJXOD
RSLQL}HVHJHUDGHEDWHVDFDORUDGRV0DVDÀQDORTXHpPDLV WHPRV XPD DGMHWLYD H[SOLFDWLYD JHQHUDOL]D D LQIRUPDomR
justo? O que fazer para desafogar a cidade de tantos carros? GD RUDomR SULQFLSDO $ FRQVWUXomR VHULD ´GR DSDJmR TXH
Prepare-se para o debate que está apenas começando. DWLQJLXSHORPHQRVFLGDGHVHPHVWDGRVGRSDtVµ 
$GDSWDGRGH6XSHULQWHUHVVDQWHGH]HPEURS  TXDQGR QmR Ki WHPRV XPD DGMHWLYD UHVWULWLYD UHVWULQJH
GHOLPLWDDLQIRUPDomR²FRPRQRFDVRGRH[HUFtFLR 
0DUTXH1 QmR SDUDRVDUJXPHQWRVFRQWUDRSHGiJLR 5(63267$´&(572·
XUEDQRPDUTXH6 VLP SDUDRVDUJXPHQWRVDIDYRUGRSH-
GiJLRXUEDQR  
 $UHFHLWDJHUDGDSHORSHGiJLRYDLPHOKRUDURWUDQV- *HUDOPHQWHRHIHLWRGHKXPRUGHVVHVJrQHURVWH[WXDLV
SRUWHS~EOLFRHHVWHQGHUDVFLFORYLDV DSDUHFHQRGHVIHFKRGDKLVWyULDDRÀQDOFRPRQHVVH´$K
 9DLVHULJXDODRURGt]LRGHYHtFXORVHPDOJXPDVFLGD- SRUTXHQyVEULJDPRVHQmRHVWDPRVQRVIDODQGRµ
GHVTXHQmRUHVROYHXRVSUREOHPDVGRWUkQVLWR 5(63267$´'µ

96
LÍNGUA PORTUGUESA

 
(PWRGDVDVDOWHUQDWLYDVKiH[SUHVV}HVTXHUHSUHVHQWDPDRSLQLmRGRDXWRU$VVLVWLDRPDLRUHVSHWiFXORGD7HUUD1mR
VHSRGHHVTXHFHUJHVWRKXPDQLWiULRTXHVyHQREUHFHGHPRQVWUDQGRFRUDJHPHGHVSUHQGLPHQWR
5(63267$´%µ

 
´SHQVDQGRQDVVXDVHVWUDGDV²EDUUHLUDVSHGUDVVROWDVÀVVXUDV²VHPIDODUHPEDQGLGRVPLOK}HVGHEDQGLGRVHQWUHDV
ÀVVXUDVDVSHGUDVVROWDVHDVEDUUHLUDVµ SHQVDUQHVVDVFRLVDVFHUWDPHQWHGHL[DRVDSUHHQVLYRV
5(63267$´&µ

 
(XYRXSDUDD,OKDGR1DQMDSDUDVDLUGDTXL UHVSRVWDGDSUySULDDXWRUD
5(63267$´%µ

 
3HODGHVFULomRUHDOL]DGDROXJDUQmRWHPQDGDGHUXLP
5(63267$´'µ

 
6 $UHFHLWDJHUDGDSHORSHGiJLRYDLPHOKRUDURWUDQVSRUWHS~EOLFRHHVWHQGHUDVFLFORYLDV
1 9DLVHULJXDODRURGt]LRGHYHtFXORVHPDOJXPDVFLGDGHVTXHQmRUHVROYHXRVSUREOHPDVGRWUkQVLWR
6 6HSHJDUQREROVRGRFRQVXPLGRUHQWmRWRGRPXQGRYDLWHUTXHSHQVDUEHPDQWHVGHFRPSUDUXPFDUUR
1 $JHQWHMiSDJDJDUDJHPJDVROLQDVHJXURHVWDFLRQDPHQWRUHYLVmRHDJRUDPDLVRSHGiJLR"
1 1yVMiSDJDPRVLPSRVWRVDOWRVHRGLQKHLURQmRpLQYHVWLGRQRWUDQVSRUWHS~EOLFR
6 4XHUDQGDUVR]LQKRGHQWURGRVHXFDUUR"(QWmRSDJXHSHORSULYLOpJLR
6 2WUkQVLWRQDVFLGDGHVTXHLQVWLWXtUDPRSHGiJLRXUEDQRPHOKRURX
6161166
5(63267$´%µ

 
'HQWUHDVDOWHUQDWLYDVDSUHVHQWDGDVDTXHUHDÀUPDDLGHLDGRH[FHUWR QmRKiPXLWDVDtGDQmRKiHVFROKDV p´6HYRFr
HVWiHPFDVDQmRSRGHVDLU6HYRFrHVWiQDUXDQmRSRGHHQWUDUµ
5(63267$´$µ

2cartumWHPDFDUDFWHUtVWLFDGHXPDDQHGRWDJUiÀFDHPTXHSRGHPRVYLVXDOL]DUDSUHVHQoDGDOLQJXDJHPYHUEDO
DVVRFLDGDjQmRYHUEDO6XDVDERUGDJHQVGL]HPUHVSHLWRDVLWXDo}HVUHODFLRQDGDVDRFRPSRUWDPHQWRKXPDQRPDVQmR
HVWmRVLWXDGDVQRWHPSRSRULVVRVmRGHQRPLQDGDVGHDWHPSRUDLVHXQLYHUVDLVRXVHMDQmRID]HPUHIHUrQFLDDXPDSHU-
VRQDOLGDGHHPHVSHFtÀFR9HMDPRVXPH[HPSOR

&DUWXPGH*ODVEHUJHQDPHULFDQRFDUWXQLVWDHLOXVWUDGRUKXPRUtVWLFR

&RQVWDWDPRVTXHRFDUWXPHPUHIHUrQFLDDSRQWDSDUDRIDWRGHDVSHVVRDVHVWDUHPWmRDFRVWXPDGDVjVUHGHVVRFLDLV
TXHDWpXPEHErTXHDLQGDQmRQDVFHXMiSRVVXLPDLVDPLJRVQR)DFHERRNTXHRVSUySULRVSDLVUHYHODQGRXPDFUtWLFDD
HVVHFRPSRUWDPHQWRWmRUHFRUUHQWH

97
LÍNGUA PORTUGUESA

$chargeXPWDQWRTXDQWRGLIHUHQWHGRFDUWXPVDWLUL]DVLWXDo}HVHVSHFtÀFDVVLWXDGDVQRWHPSRHQRHVSDoRUD]mR
SHODTXDOVHHQFRQWUDVHPSUHDSRQWDQGRSDUDXPSHUVRQDJHPGDYLGDS~EOLFDHPJHUDOjVYH]HVXPDUWLVWDRXWUDVYH]HV
XPSROtWLFRHQÀP(PVHWUDWDQGRGDOLQJXDJHPWDPEpPFRVWXPDDVVRFLDUOLQJXDJHPYHUEDOHQmRYHUEDO2XWURDVSHFWR
SDUDRTXDOGHYHPRVDWHQWDUGL]UHVSHLWRDRIDWRGHDFKDUJHH[SUHVVDQDOtQJXDIUDQFHVDSRVVXLUVLJQLÀFDGRGH´FDUJDµ
DGHULQGRSRUFRPSOHWRjLQWHQomRGRFKDUJLVWDRXVHMDDGHTXHHOHUHDOPHQWHDWXDGHIRUPDFUtWLFDQXPDVLWXDomRGH
RUGHPVRFLDOHSROtWLFD9HMDXPH[HPSOR

&KDUJHGH-~OLR&RVWD1HWR²MRUQDOLVWDHGHVHQKLVWD

$RQRVDWHUPRVjFKDUJHHPTXHVWmRÀFDPRVFRQYHQFLGRVGHTXHRDXWRUDSRQWDSDUDDWHQGrQFLDTXHDVSHVVRDV
WUD]HPFRQVLJRGHTXHXPGRVPHLRVGHJDQKDUGLQKHLURpHQWUDQGRQDSROtWLFDVREUHWXGRSHODGHVRQHVWLGDGHSHODFRU-
UXSomRTXHVHPDQLIHVWDQHVVHPHLRUD]mRSHODTXDORSHUVRQDJHPUHVSRQGHXjSURIHVVRUDGHVVDIRUPD

,QIRJUDÀDRXLQIRJUiÀFRVVmRJUiÀFRVFRPDOJXPDVLQIRUPDo}HV(PUHYLVWDVRVLQIRJUiÀFRVVmRFDUDFWHUL]DGRVSHOD
MXQomRGHWH[WRVEUHYHVFRPLOXVWUDo}HVH[SOLFDWLYDVSDUDROHLWRUHQWHQGHURFRQWH~GR(VVHVJUiÀFRVVmRXVDGRVTXDQGR
DLQIRUPDomRSUHFLVDVHUH[SOLFDGDGHIRUPDPDLVGLQkPLFDFRPRHPPDSDVMRUQDOLVPRHPDQXDLVWpFQLFRVHGXFDWLYRVRX
FLHQWtÀFRVeXPUHFXUVRPXLWDVYH]HVFRPSOH[RSRGHQGRVHXWLOL]DUGDFRPELQDomRGHIRWRJUDÀDGHVHQKRHWH[WR(OHV
IDFLOLWDPDFRPSUHHQVmRGHPDWpULDVHPTXHDSHQDVWH[WRGLÀFXOWDULDRHQWHQGLPHQWR
1RGHVLJQGHMRUQDLVSRUH[HPSORRLQIRJUiÀFRFRVWXPDVHUXVDGRSDUDGHVFUHYHUFRPRDFRQWHFHXGHWHUPLQDGRIDWR
TXDLVVXDVFRQVHTXrQFLDV$OpPGHH[SOLFDUSRUPHLRGHLOXVWUDo}HVGLDJUDPDVHWH[WRVIDWRVTXHRWH[WRRXDIRWRQmR
FRQVHJXHPGHWDOKDUFRPDPHVPDHÀFLrQFLD
7DPEpPVmR~WHLVSDUDFLHQWLVWDVFRPRIHUUDPHQWDVGHFRPXQLFDomRYLVXDOVHQGRDSOLFDGRVHPWRGRVRVDVSHFWRVGD
YLVXDOL]DomRFLHQWtÀFD

)RQWHKWWSSWZLNLSHGLDRUJZLNL,QIRJUDÀD

$Propaganda InstitucionalpXPDIRUPDGHSXEOLFLGDGHTXHQmRVHUHIHUHDRSURGXWRHPVLHVLPjHPSUHVDRXLQV-
WLWXLomRYLVDQGRjGLVVHPLQDomRGHLGHLDVQRLQWXLWRGHPROGDUHLQÁXHQFLDUDRSLQLmRS~EOLFDPRWLYDQGRFRPSRUWDPHQWRV
GHVHMDGRVSRUXPDLQVWLWXLomRRXSURYRFDQGRPXGDQoDVQDLPDJHPS~EOLFDGHVWDLQVWLWXLomR)DODVHGDVXDLPSRUWkQFLD
SDUDDVRFLHGDGHGRVHPSUHJRVTXHHODJHUDGDVXDFRQWULEXLomRSDUDRSURJUHVVRGRSDtVHQÀPGDVFRLVDVERDVTXHD
HPSUHVDID]$VVLPFULDVHXPDLPDJHPSRVLWLYDGDPDUFDeXWLOL]DGDSDUDFULDUQRS~EOLFRXPHVWDGRGHFRQÀDQoDQDV
LQVWLWXLo}HVRTXDOVHUHÁHWLUiQRIXWXURHPVXSRUWHHDSRLRGDSRSXODomRDHVWDVLQVWLWXLo}HV

98
LÍNGUA PORTUGUESA

$reportagempXPJrQHURGHWH[WRMRUQDOtVWLFRTXHWUDQVPLWHXPDLQIRUPDomRSRUPHLRGDWHOHYLVmRUiGLRUHYLVWD
2REMHWLYRGDUHSRUWDJHPpOHYDURVIDWRVDROHLWRURXWHOHVSHFWDGRUGHPDQHLUDDEUDQJHQWH,VVRLPSOLFDHPXPIDWRU
HVVHQFLDODXPMRUQDOLVWDIDODUEHPHHVFUHYHUEHP
6HWHOHYLVLRQDGDDUHSRUWDJHPGHYHVHUWUDQVPLWLGDSRUXPUHSyUWHUTXHSRVVXLGLFomRSDXVDGDFODUDHOLQJXDJHP
GLUHWDSUHFLVDHVHPLQFRHUrQFLDV$OpPGHVDEHUXWLOL]DUDHQWRQDomRTXHGiYLGDjVSDODYUDVXPDYH]TXHUHSUHVHQWDQD
IDODRVVLQDLVGHSRQWXDomR
6HLPSUHVVDDUHSRUWDJHPGHYHGHPRQVWUDUFDSDFLGDGHLQWHOHFWXDOFULDWLYLGDGHVHQVLELOLGDGHTXDQWRDRVIDWRVHXPD
HVFULWDFRHUHQWHTXHGLQDPL]DDOHLWXUDHDWRUQDÁXHQWH3RUHVVDVTXHVW}HVDVXEMHWLYLGDGHHVWiPDLVSUHVHQWHQHVVHWLSR
GHUHSRUWDJHPGRTXHQRRXWURDSRQWDGRDFLPD
$WXDOPHQWHFRPRGHVHQYROYLPHQWRGRVVRIWZDUHVRVUHSyUWHUHVWrPPDLVUHFXUVRVYLVXDLVHJUiÀFRVGLVSRQtYHLVR
TXHFKDPDDDWHQomRSDUDDQRWtFLD
(PPHLRDRVIDWRVSUHVHQFLDGRVHTXHGHYHUmRVHUWUDQVPLWLGRVFDGDUHSyUWHUWHPVHXHVWLORSUySULRGHFRQGX]LURX
GHQDUUDURVDFRQWHFLPHQWRV3RULVVRDUHSRUWDJHPSRGHVHUDPHVPDPDVDPDQHLUDFRPRpFRPXQLFDGDpGLIHUHQWHGH
XPSURÀVVLRQDOSDUDRXWUR
Qual a diferença entre notícia e reportagem?$SULPHLUDLQIRUPDIDWRVGHPDQHLUDPDLVREMHWLYDHDSRQWDDVUD]}HV
HHIHLWRV$VHJXQGDYDLPDLVDIXQGRID]LQYHVWLJDo}HVWHFHFRPHQWiULRVOHYDQWDTXHVW}HVGLVFXWHDUJXPHQWD
$UHSRUWDJHPHVFULWDpGLYLGLGDHPWUrVSDUWHVmanchete, lead e corpo.
MancheteFRPSUHHQGHRWtWXORGDUHSRUWDJHPTXHWHPFRPRREMHWLYRUHVXPLURTXHVHUiGLWR$OpPGLVVRGHYHGHV-
SHUWDURLQWHUHVVHGROHLWRU
LeadSHTXHQRUHVXPRTXHDSDUHFHGHSRLVGRWtWXORDÀPGHFKDPDUPDLVDLQGDDDWHQomRGROHLWRU
Corpo:GHVHQYROYLPHQWRGRDVVXQWRDERUGDGRFRPOLQJXDJHPGLUHFLRQDGDDRS~EOLFRDOYR
$tira de jornalRXtirinhaFRPRpPDLVFRQKHFLGDpXPJrQHURWH[WXDOTXHVXUJLXQRV(VWDGRV8QLGRVGHYLGRjIDOWD
GHHVSDoRQRVMRUQDLVSDUDDSXEOLFDomRSDVVDWHPSRV2QRPH´WLULQKDµUHPHWHDRIRUPDWRGRWH[WRTXHSDUHFHXP´UHFRU-
WHµGHMRUQDO8PGRVSLRQHLURVQDFULDomRGDWLUDIRLRDPHULFDQR%XG)LVKHUDXWRUGDWLUD0XWWH-Hර
1R%UDVLOXPGRVSLRQHLURVQDFULDomRHSXEOLFDomRGHWLUDVIRL0DXUtFLRGH6RXVDTXHFRPHoRXSXEOLFDQGRDWLUDGR
FmR]LQKR%LGXQRÀPGDGpFDGDGHQRMRUQDO)ROKDGH6mR3DXOR0DXUtFLRGH6RXVDFULRXXPDVpULHGHRXWURVSHUVR-
QDJHQVTXHÀFDUDPIDPRVtVVLPRVFRPRD0{QLFDR&DVFmRR&HEROLQKDGHQWUHRXWURVHTXHJDQKDUDPSRVWHULRUPHQWH
VXDVSUySULDVUHYLVWDVGHKLVWyULDVHPTXDGULQKRV

(VWHJrQHURWH[WXDODSUHVHQWDJHUDOPHQWHXPDWHPiWLFDKXPRUtVWLFDFRQWXGRQmRUDURHQFRQWUDPRVWLULQKDVVDWtULFDV
GHFXQKRVRFLDORXSROtWLFRPHWDItVLFDVRXDWpPHVPRHUyWLFDV
eFRPXPDVWLUDVFHQWUDUHPVHHPXPSHUVRQDJHPSULQFLSDOTXHHVWDEHOHFHUHODomRFRPRXWURVSHUVRQDJHQV´PHQR-
UHVµHTXHUHSUHVHQWDXPDpSRFDUHPRWDXPSDtVXPHVWHUHyWLSRGHDOJXPDFXOWXUDHWF

5(63267$´'µ
COESÃO E COERÊNCIA

3ULPHLUDPHQWHRTXHQRVID]SURGX]LUXPWH[WRpDFDSDFLGDGHTXHWHPRVGHSHQVDU3RUPHLRGRSHQVDPHQWRHOD-
ERUDPRVWRGDVDVLQIRUPDo}HVTXHUHFHEHPRVHRULHQWDPRVDVDo}HVTXHLQWHUIHUHPQDUHDOLGDGHHRUJDQL]DomRGHQRVVRV
HVFULWRV2TXHOHPRVpSURGXWRGHXPSHQVDPHQWRWUDQVIRUPDGRHPWH[WR
/RJRFRPRFDGDXPGHQyVWHPVHXPRGRGHSHQVDUTXDQGRHVFUHYHPRVVHPSUHSURFXUDPRVXPDPDQHLUDRUJD-
QL]DGDGROHLWRUFRPSUHHQGHUDVQRVVDVLGHLDV$ÀQDOLGDGHGDHVFULWDpGLUHFLRQDUWRWDOPHQWHRTXHYRFrTXHUGL]HUSRU
PHLRGDFRPXQLFDomR

99
LÍNGUA PORTUGUESA

3DUDLVVRRVHOHPHQWRVTXHFRPS}HPRWH[WRVHVXE- (P XPD HVWUXWXUD QRUPDO HOD QmR GHYH GHL[DU XPD
GLYLGHPHPLQWURGXomRGHVHQYROYLPHQWRHFRQFOXVmR7R- EUHFKD SDUD XPD SRVVtYHO FRQWLQXLGDGH GR DVVXQWR RX
GRVHOHVGHYHPVHURUJDQL]DGRVGHPDQHLUDHTXLOLEUDGD VHMDSRVVXLDWULEXWRVGHVtQWHVH$GLVFXVVmRQmRGHYHVHU
HQFHUUDGDFRPDUJXPHQWRVUHSHWLWLYRVVHQGRHYLWDGRVQD
Introdução PHGLGD GR SRVVtYHO $OJXQV H[HPSORV “Portanto, como já
dissemos antes...”, “Concluindo...”, “Em conclusão...”
&DUDFWHUL]DGD SHOD HQWUDGD QR DVVXQWR H D DUJXPHQ- 6XDSURSRUomRHPUHODomRjWRWDOLGDGHGRWH[WRGHYH
WDomRLQLFLDO$LGHLDFHQWUDOGRWH[WRpDSUHVHQWDGDQHVVD VHUHTXLYDOHQWHDRGDLQWURGXomRGH(VVDpXPDGDV
HWDSD(QWUHWDQWRHVVDDSUHVHQWDomRGHYHVHUGLUHWDVHP FDUDFWHUtVWLFDVGHWH[WRVEHPUHGLJLGRV
URGHLRV2VHXWDPDQKRUDUDPHQWHH[FHGHDGHWRGRR 2VVHJXLQWHVHUURVDSDUHFHPTXDQGRDVFRQFOXV}HVÀ-
WH[WR3RUpPHPWH[WRVPDLVFXUWRVHVVDSURSRUomRQmRp FDPPXLWRORQJDV
HTXLYDOHQWH1HOHVDLQWURGXomRSRGHVHURSUySULRWtWXOR
-i QRV WH[WRV PDLV ORQJRV HP TXH R DVVXQWR p H[SRVWR ମ 2 SUREOHPD DSDUHFH TXDQGR QmR RFRUUH XPD H[-
HPYiULDVSiJLQDVHODSRGHWHURWDPDQKRGHXPFDStWXOR SORUDomRGHYLGDGRGHVHQYROYLPHQWR/RJRDFRQWHFHXPD
RXGHXPDSDUWHSUHFHGLGDSRUVXEWtWXOR1HVVDVLWXDomR LQYDVmRGDVLGHLDVGHGHVHQYROYLPHQWRQDFRQFOXVmR
SRGHWHUYiULRVSDUiJUDIRV(PUHGDo}HVPDLVFRPXQVTXH ମ2XWURIDWRUFRQVHTXHQWHGDLQVXÀFLrQFLDGHIXQGD-
HPPpGLDWrPGHDOLQKDVDLQWURGXomRVHUiRSUL- PHQWDomRGRGHVHQYROYLPHQWRHVWiQDFRQFOXVmRSUHFLVDU
PHLURSDUiJUDIR GHPDLRUHVH[SOLFDo}HVÀFDQGREDVWDQWHYD]LD
ମ (QURODU H ´HQFKHU OLQJXLoDµ VmR PXLWR FRPXQV QR
Desenvolvimento WH[WRHPTXHRDXWRUÀFDJLUDQGRHPWRUQRGHLGHLDVUH-
GXQGDQWHVRXSDUDOHODV
$ PDLRU SDUWH GR WH[WR HVWi LQVHULGD QR GHVHQYROYL- ମ 8VR GH IUDVHV YD]LDV TXH SRU YH]HV VmR SHUIHLWD-
PHQWR(OHpUHVSRQViYHOSRUHVWDEHOHFHUXPDOLJDomRHQWUH
PHQWHGLVSHQViYHLV
DLQWURGXomRHDFRQFOXVmReQHVVDHWDSDTXHVmRHODER-
ମ 4XDQGR QmR WHP FODUH]D GH TXDO p D PHOKRU FRQ-
UDGDVDVLGHLDVRVGDGRVHRVDUJXPHQWRVTXHVXVWHQWDP
FOXVmRRDXWRUDFDEDVHSHUGHQGRQDDUJXPHQWDomRÀQDO
H GmR EDVH jV H[SOLFDo}HV H SRVLo}HV GR DXWRU e FDUDF-
(P UHODomR j DEHUWXUD SDUD QRYDV GLVFXVV}HV D FRQ-
WHUL]DGR SRU XPD ´SRQWHµ IRUPDGD SHOD RUJDQL]DomR GDV
FOXVmRQmRSRGHWHUHVVHIRUPDWRH[FHWRSHORVVHJXLQWHV
LGHLDVHPXPDVHTXrQFLDTXHSHUPLWHIRUPDUXPDUHODomR
IDWRUHV
HTXLOLEUDGDHQWUHRVGRLVODGRV
2DXWRUGRWH[WRUHYHODVXDFDSDFLGDGHGHGLVFXWLUXP
ମ3DUDQmRLQÁXHQFLDUDFRQFOXVmRGROHLWRUVREUHWH-
GHWHUPLQDGR WHPD QR GHVHQYROYLPHQWR 1HVVD SDUWH HOH
PDVSROrPLFRVRDXWRUGHL[DDFRQFOXVmRHPDEHUWR
VHWRUQDFDSD]GHGHIHQGHUVHXVSRQWRVGHYLVWDDOpPGH
GLULJLUDDWHQomRGROHLWRUSDUDDFRQFOXVmR$VFRQFOXV}HV ମ3DUDHVWLPXODUROHLWRUDOHUXPDSRVVtYHOFRQWLQXLGD-
VmRIXQGDPHQWDGDVDSDUWLUGDTXL GHGRWH[WRRXDXWRUQmRIHFKDDGLVFXVVmRGHSURSyVLWR
3DUD TXH R GHVHQYROYLPHQWR FXPSUD VHX REMHWLYR R ମ 3RU DSHQDV DSUHVHQWDU GDGRV H LQIRUPDo}HV VREUH
HVFULWRUMiGHYHWHUXPDLGHLDFODUDGHFRPRYDLVHUDFRQ- RWHPDDVHUGHVHQYROYLGRRDXWRUQmRGHVHMDFRQFOXLUR
FOXVmR3RULVVRDLPSRUWkQFLDGRSODQHMDPHQWRGHWH[WR DVVXQWR
(PPpGLDRFXSDGRWH[WRQRPtQLPR-iQRVWH[- ମ3DUDTXHROHLWRUWLUHVXDVSUySULDVFRQFOXV}HVRDX-
WRVPDLVORQJRVSRGHHVWDULQVHULGRHPFDStWXORVRXWUH- WRUHQXPHUDDOJXPDVSHUJXQWDVQRÀQDOGRWH[WR
FKRV GHVWDFDGRV SRU VXEWtWXORV 'HYHUi VH DSUHVHQWDU QR $PDLRULDGHVVDVIDOKDVSRGHVHUHYLWDGDVHDQWHVRDX-
IRUPDWRGHSDUiJUDIRVPHGLDQRVHFXUWRV WRU À]HU XP HVERoR GH WRGDV DV VXDV LGHLDV (VVD WpFQLFD
2VSULQFLSDLVHUURVFRPHWLGRVQRGHVHQYROYLPHQWRVmR p XP URWHLUR HP TXH HVWmR SUHVHQWHV RV SODQHMDPHQWRV
RGHVYLRHDGHVFRQH[mRGDDUJXPHQWDomR2SULPHLURHVWi 1HOHGHYHPHVWDULQGLFDGDVDVPHOKRUHVVHTXrQFLDVDVH-
UHODFLRQDGRDRDXWRUWRPDUXPDUJXPHQWRVHFXQGiULRTXH UHPXWLOL]DGDVQDUHGDomR2URWHLURGHYHVHURPDLVHQ[XWR
VH GLVWDQFLD GD GLVFXVVmR LQLFLDO RX TXDQGR VH FRQFHQWUD SRVVtYHO
HPDSHQDVXPDVSHFWRGRWHPDHHVTXHFHRVHXWRGR2 Fonte: http://producao-de-textos.info/mos/view/Carac-
VHJXQGRFDVRDFRQWHFHTXDQGRTXHPUHGLJHWHPPXLWDV ter%C3%ADsticas_e_Estruturas_do_Texto/
LGHLDV RX LQIRUPDo}HV VREUH R TXH HVWi VHQGR GLVFXWLGR
QmR FRQVHJXLQGR HVWUXWXUiODV 6XUJH WDPEpP D GLÀFXO- 1mREDVWDFRQKHFHURFRQWH~GRGDVSDUWHVGHXPWUD-
GDGH GH RUJDQL]DU VHXV SHQVDPHQWRV H GHÀQLU XPD OLQKD EDOKRLQWURGXomRGHVHQYROYLPHQWRHFRQFOXVmR$OpPGH
OyJLFDGHUDFLRFtQLR VDEHU R TXH VH GHYH H R TXH QmR VH GHYH  HVFUHYHU HP
FDGDSDUWHFRQVWLWXLQWHGRWH[WRpSUHFLVRVDEHUHVFUHYHU
Conclusão REHGHFHQGR jV QRUPDV GH FRHUrQFLD H FRHVmR $QWHV GH
PDLVQDGDpQHFHVViULRGHÀQLURVWHUPRVcoerênciaGL]UHV-
&RQVLGHUDGD FRPR D SDUWH PDLV LPSRUWDQWH GR WH[WR SHLWRjDUWLFXODomRGRWH[WRjFRPSDWLELOLGDGHGDVLGHLDV
pRSRQWRGHFKHJDGDGHWRGDVDVDUJXPHQWDo}HVHODER- jOyJLFDGRUDFLRFtQLRDVHXFRQWH~GRCoesãoUHIHUHVHj
UDGDV$VLGHLDVHRVGDGRVXWLOL]DGRVFRQYHUJHPSDUDHVVD H[SUHVVmROLQJXtVWLFDDRQtYHOJUDPDWLFDOjVHVWUXWXUDVIUD-
SDUWHHPTXHDH[SRVLomRRXGLVFXVVmRVHIHFKD VDLVHDRHPSUHJRGRYRFDEXOiULR

100
LÍNGUA PORTUGUESA

Coerência e coesão UHODFLRQDPVHFRPRSURFHVVRGH FRPXQVGHUHGDomRVHMDPGHYLGRVjLPSURSULHGDGHGRYR-


SURGXomRHFRPSUHHQVmRGRWH[WR$FRHVmRFRQWULEXLSDUD FDEXOiULRHDRPDXHPSUHJRGRVFRQHFWLYRV FRQMXQo}HV
DFRHUrQFLDPDVQHPVHPSUHXPWH[WRFRHUHQWHDSUHVHQWD TXHWrPSRUIXQomROLJDUXPDIUDVHRXSHUtRGRDRXWUR (LV
FRHVmR3RGHRFRUUHUTXHRWH[WRVHPFRHUrQFLDDSUHVHQWH DOJXQVH[HPSORVGHLPSURSULHGDGHGRYRFDEXOiULRFROKL-
FRHVmRRXTXHXPWH[WRWHQKDFRHVmRVHPFRHUrQFLD(P GRVHPUHGDo}HVVREUHFHQVXUDHRVPHLRVGHFRPXQLFD-
RXWUDVSDODYUDVXPWH[WRSRGHVHUJUDPDWLFDOPHQWHEHP omRHRXWUDV
FRQVWUXtGRFRPIUDVHVEHPHVWUXWXUDGDVYRFDEXOiULRFRU-
UHWRPDVDSUHVHQWDULGHLDVVHPQH[RVHPXPDVHTXrQFLD “Nosso direito é frisado na Constituição.”
OyJLFDKiFRHVmRPDVQmRFRHUrQFLD3RURXWURODGRXP Nosso direito é assegurado pela Constituição. = correta
WH[WRSRGHDSUHVHQWDULGHLDVFRHUHQWHVHEHPHQFDGHDGDV
VHPTXHQRSODQRGDH[SUHVVmRDVHVWUXWXUDVIUDVDLVVHMDP “Estabelecer os limites as quais a programação deveria
JUDPDWLFDOPHQWHDFHLWiYHLVKiFRHUrQFLDPDVQmRFRHVmR estar exposta.”
$ FRHUrQFLD WH[WXDO VXEMD] DR WH[WR H p UHVSRQViYHO Estabelecer os limites aos quais a programação deveria
SHOD KLHUDUTXL]DomR GRV HOHPHQWRV WH[WXDLV RX VHMD HOD estar sujeita. = correta
WHPRULJHPQDVHVWUXWXUDVSURIXQGDVQRFRQKHFLPHQWRGR
PXQGR GH FDGD SHVVRD DOLDGD j FRPSHWrQFLD OLQJXtVWLFD ´A censura deveria punir as notícias sensacionalistas.”
'HGX]VH TXH p GLItFLO HQVLQDU FRHUrQFLD WH[WXDO LQWLPD- A censura deveria proibir (ou coibir) as notícias sensa-
PHQWH OLJDGD j YLVmR GH PXQGR j RULJHP GDV LGHLDV QR cionalistas ou punir os meios de comunicação que veiculam
SHQVDPHQWR $ FRHVmR SRUpP UHIHUHVH j H[SUHVVmR OLQ- tais notícias. = correta
JXtVWLFDDRVSURFHVVRVVLQWiWLFRVHJUDPDWLFDLVGRWH[WR 
2VHJXLQWHUHVXPRFDUDFWHUL]DFRHUrQFLDHFRHVmR “Retomada das rédeas da programação.”
Retomada das rédeas dos meios de comunicação, no
CoerênciaUHGHGHVLQWRQLDHQWUHDVSDUWHVHRWRGRGH que diz respeito à programação.= correta
XPWH[WR&RQMXQWRGHXQLGDGHVVLVWHPDWL]DGDVQXPDDGH-
TXDGDUHODomRVHPkQWLFDTXHVHPDQLIHVWDQDFRPSDWLEL- 2HPSUHJRGHYRFDEXOiULRLQDGHTXDGRSUHMXGLFDPXL-
OLGDGHHQWUHDVLGHLDV 1DOLQJXDJHPSRSXODU´GL]HUFRLVD WDVYH]HVDFRPSUHHQVmRGDVLGHLDVeLPSRUWDQWHDRUHGL-
FRPFRLVDµRX´XPDFRLVDEDWHFRPRXWUDµ  JLUHPSUHJDUSDODYUDVFXMRVLJQLÀFDGRVHMDFRQKHFLGRSHOR
CoesãoFRQMXQWRGHHOHPHQWRVSRVLFLRQDGRVDRORQJR HQXQFLDGRU H FXMR HPSUHJR IDoD SDUWH GH VHXV FRQKHFL-
GRWH[WRQXPDOLQKDGHVHTXrQFLDHFRPRVTXDLVVHHV- PHQWRVOLQJXtVWLFRV0XLWDVYH]HVTXHPUHGLJHFRQKHFHR
WDEHOHFHXPYtQFXORRXFRQH[mRVHTXHQFLDO6HRYtQFXOR VLJQLÀFDGRGHGHWHUPLQDGDSDODYUDPDVQmRVDEHHPSUH-
FRHVLYRID]VHYLDJUDPiWLFDIDODVHHPFRHVmRJUDPDWLFDO JiODDGHTXDGDPHQWHLVVRRFRUUHIUHTXHQWHPHQWHFRPR
6HVHID]SRUPHLRGRYRFDEXOiULRWHPVHDFRHVmROH[LFDO HPSUHJRGRVFRQHFWLYRV SUHSRVLo}HVHFRQMXQo}HV 1mR
EDVWDVDEHUTXHDVSUHSRVLo}HVOLJDPQRPHVRXVLQWDJPDV
Coerência QRPLQDLVQRLQWHULRUGDVIUDVHVHTXHDVFRQMXQo}HVOLJDP
DVVHQWDVHQRSODQRFRJQLWLYRGDLQWHOLJLELOLGDGHGR IUDVHVGHQWURGRSHUtRGRpQHFHVViULRHPSUHJDUDGHTXD-
WH[WR GDPHQWHWDQWRXPDVFRPRRXWUDVeEHPYHUGDGHTXHQD
VLWXDVHQDVXEMDFrQFLDGRWH[WRHVWDEHOHFHFRQH[mR PDLRULDGDVYH]HVRHPSUHJRLQDGHTXDGRGRVFRQHFWLYRV
FRQFHLWXDO UHPHWHDRVSUREOHPDVGHUHJrQFLDYHUEDOHQRPLQDO
 UHODFLRQDVH FRP D PDFURHVWUXWXUD WUDEDOKD FRP R ([HPSORV
WRGRFRPRDVSHFWRJOREDOGRWH[WR
HVWDEHOHFHUHODo}HVGHFRQWH~GRHQWUHSDODYUDVHIUD- “Estar inteirada com os fatos” VLJQLÀFDSDUWLFLSDomRLQ-
VHV WHUDomR
Coesão “Estar inteirada dos fatos” VLJQLÀFD WHU FRQKHFLPHQWR
DVVHQWDVHQRSODQRJUDPDWLFDOHQRQtYHOIUDVDO GRVIDWRVHVWDULQIRUPDGD
 VLWXDVH QD VXSHUItFLH GR WH[WR HVWDEHOHFH FRQH[mR “Ir de encontro” VLJQLÀFDGLYHUJLUQmRFRQFRUGDU
VHTXHQFLDO “Ir ao encontro” TXHUGL]HUFRQFRUGDU
 UHODFLRQDVH FRP D PLFURHVWUXWXUD WUDEDOKD FRP DV
SDUWHVFRPSRQHQWHVGRWH[WR “Ameaça de liberdade de expressão e transmissão de
 (VWDEHOHFH UHODo}HV HQWUH RV YRFiEXORV QR LQWHULRU ideias” VLJQLÀFDDOLEHUGDGHQmRpDPHDoD
GDVIUDVHV “Ameaça à liberdade de expressão e transmissão de
ideias”, LVWRpDOLEHUGDGHÀFDDPHDoDGD
&RHUrQFLD H FRHVmR VmR UHVSRQViYHLV SHOD LQWHOLJLELOL-
GDGH RX FRPSUHHQVmR GR WH[WR 8P WH[WR EHP UHGLJLGR 4XDQWR j UHJrQFLD YHUEDO FRQYpP VHPSUH FRQVXO-
WHPSDUiJUDIRVEHPHVWUXWXUDGRVHDUWLFXODGRVSHORHQFD- WDU XP GLFLRQiULR GH YHUERV SRLV PXLWRV GHOHV DGPLWHP
GHDPHQWR GDV LGHLDV QHOHV FRQWLGDV $V HVWUXWXUDV IUDVDLV GXDV RX WUrV UHJrQFLDV GLIHUHQWHV FDGD XPD SRUpP WHP
GHYHP VHU FRHUHQWHV H JUDPDWLFDOPHQWH FRUUHWDV QR TXH XPVLJQLÀFDGRHVSHFtÀFR/HPEUHVHDSURSyVLWRGHTXH
GL]UHVSHLWRjVLQWD[H2YRFDEXOiULRSUHFLVDVHUDGHTXDGR DV G~YLGDV VREUH R HPSUHJR GD FUDVH GHFRUUHP GR IDWR
HHVVDDGHTXDomRVyVHFRQVHJXHSHORFRQKHFLPHQWRGRV GHFRQVLGHUDUVHFUDVHFRPRVLQDOGHDFHQWXDomRDSHQDV
VLJQLÀFDGRVSRVVtYHLVGHFDGDSDODYUD7DOYH]RVHUURVPDLV TXDQGRRSUREOHPDUHIHUHVHjUHJrQFLDQRPLQDOHYHUEDO

101
LÍNGUA PORTUGUESA

([HPSORV HFRQRPLD HVWDELOL]DUVH ´Teresa vai estudar bastante para


fazer boa provaµ +i RXWURV DUWLFXODGRUHV TXH H[SUHVVDP
2YHUERDVVLVWLUDGPLWHGXDVUHJrQFLDV ÀQDOLGDGH D ÀP GH FRP R SURSyVLWR GH QD ÀQDOLGDGH GH
DVVLVWLU RD WUDQVLWLYR GLUHWR  VLJQLÀFD GDU RX SUHVWDU FRPDLQWHQomRGHFRPRREMHWLYRGHFRPRÀWRGHFRPR
DVVLVWrQFLD O médico assiste o doente  intuito de.
$VVLVWLU DR WUDQVLWLYR LQGLUHWR  VHU HVSHFWDGRU Assisti $LGHLDGHFRQFOXVmRSRGHVHULQWURGX]LGDSRUPHLR
ao jogo da seleção  GRVDUWLFXODGRUHVassim, desse modo, então, logo, portanto,
pois, por isso, por conseguinte, de modo que, em vista disso
3HGLUR Q WUDQVLWLYRGLUHWR VLJQLÀFDVROLFLWDUSOHLWHDU 3DUDLQWURGX]LUPDLVXPDUJXPHQWRDIDYRUGHGHWHUPLQDGD
Pedi o jornal do dia  FRQFOXVmRHPSUHJD
3HGLU TXH  FRQWpP XPD RUGHP A professora pediu VH ainda 2V DUWLFXODGRUHV aliás, além do mais, além
TXHÀ]HVVHPVLOrQFLR  disso, além de tudo LQWURGX]HP XP DUJXPHQWR GHFLVLYR
3HGLUSDUD SHGLUSHUPLVVmR Pediu para sair da clas- FDEDODSUHVHQWDGRFRPRXPDFUpVFLPRSDUDMXVWLÀFDUGH
se VLJQLÀFDWDPEpPSHGLUHPIDYRUGHDOJXpP A Diretora IRUPDLQFRQWHVWiYHORDUJXPHQWRFRQWUiULR
pediu ajuda para os alunos carentes HPIDYRUGRVDOXQRV  3DUD LQWURGX]LU HVFODUHFLPHQWRV UHWLÀFDo}HV RX GH-
SHGLUDOJRDDOJXpP SDUDVL  Pediu ao colega para ajudá VHQYROYLPHQWR GR TXH IRL GLWR HPSUHJDPVH RV articu-
-lo  SRGH VLJQLÀFDU DLQGD H[LJLU UHFODPDU Os professores ladores isto é, quer dizer, ou seja, em outras palavras $
pedem aumento de salário  FRQMXQomRDGLWLYD´eµDQXQFLDQmRDUHSHWLomRPDVRGH-
VHQYROYLPHQWRGRGLVFXUVRSRLVDFUHVFHQWDXPDLQIRUPD-
2PDXHPSUHJRGRVSURQRPHVUHODWLYRVWDPEpPSRGH omRQRYDXPGDGRQRYRHVHQmRDFUHVFHQWDUQDGDpSXUD
OHYDU j IDOWD GH FRHVmR JUDPDWLFDO )UHTXHQWHPHQWH HP- UHSHWLomRHGHYHVHUHYLWDGD
SUHJDVHno qual RXao qualHPOXJDUGRqueFRPSUHMXt]R  $OJXQV DUWLFXODGRUHV VHUYHP SDUD HVWDEHOHFHU XPD
GDFODUH]DGRWH[WRRXWUDVYH]HVRHPSUHJRpGHVQHFHVVi- JUDGDomRHQWUHRVFRUUHVSRQGHQWHVGHGHWHUPLQDGDHVFDOD
ULRRXLQDGHTXDGR 1RDOWRGHVVDHVFDODDFKDPVHmesmo, até, até mesmoQR
´Pela manhã o carteiro chegou com um envelope para SODQRPDLVEDL[Rao menos, pelo menos, no mínimo.
mim no qual estava sem remetenteµ &KHJRXFRPXPHQ-
YHORSHTXH RTXDO HVWDYDVHPUHPHWHQWH 

´Encontrei apenas belas palavras o qual não duvido da


sensibilidadeµ
(QFRQWUHLEHODVSDODYUDVHQmRGXYLGRGDVHQVLELOLGDGH
GHODV SDODYUDVFKHLDVGHVHQVLELOLGDGH 

3DUDHYLWDUDIDOWDGHFRHUrQFLDHFRHVmRQDDUWLFXODomR
GDVIUDVHVDFRQVHOKDVHOHYDUHPFRQWDDVVHJXLQWHVVXJHV-
W}HVSDUDRHPSUHJRFRUUHWRGRVarticuladores sintáticos
(conjunções, preposições, locuções prepositivas e locuções
conjuntivas).
3DUDGDULGHLDGHRSRVLomRRXFRQWUDGLomRDDUWLFX-
ODomRVLQWiWLFDID]VHSRUPHLRGHFRQMXQo}HVDGYHUVDWLYDV
mas, porém, todavia, contudo, no entanto, entretanto. 3R-
GHP WDPEpP VHU HPSUHJDGDV DV FRQMXQo}HV FRQFHVVLYDV
HORFXo}HVSUHSRVLWLYDVSDUDLQWURGX]LUDLGHLDGHRSRVLomR
DOLDGD j FRQFHVVmR embora, ou muito embora, apesar de,
ainda que, conquanto, posto que, a despeito de, não obs-
tante.
 $ DUWLFXODomR VLQWiWLFD GH FDXVD SRGH VHU IHLWD SRU
PHLR GH FRQMXQo}HV H ORFXo}HV FRQMXQWLYDV pois, porque,
como, por isso que, visto que, uma vez que, já que7DPEpP
SRGHPVHUHPSUHJDGDVDVSUHSRVLo}HVHORFXo}HVSUHSRVL-
WLYDV por, por causa de, em vista de, em virtude de, devido a,
em consequência de, por motivo de, por razões de.
2SULQFLSDODUWLFXODGRUVLQWiWLFRGHFRQGLomRpR´seµ
Se o time ganhar esse jogo, será campeão3RGHVHWDPEpP
H[SUHVVDU FRQGLomR SHOR HPSUHJR GRV FRQHFWLYRV caso,
contanto que, desde que, a menos que, a não ser que.
 2 HPSUHJR GD SUHSRVLomR ´paraµ p D PDQHLUD PDLV
FRPXPGHH[SUHVVDUÀQDOLGDGH´É necessário baixar as ta-
xas de juros para que a economia se estabilizeµ RX SDUD D

102
LÍNGUA PORTUGUESA

EXERCÍCIOS COMPLEMENTARES &  8P OHYDQWDPHQWR PRVWURX TXH RV DGROHVFHQWHV


DPHULFDQRVFRQVRPHPHPPpGLDFDORULDVGLiULDVGHV-
1-) (FUNDAÇÃO UNIVERSIDADE FEDERAL DO ABC/ VDIRQWH
SP – ADMINISTRADOR - VUNESP/2013) Assinale a al- ' 8POHYDQWDPHQWR ; PRVWURXTXHRVDGROHVFHQWHV
ternativa correta quanto à concordância, de acordo DPHULFDQRV ; FRQVRPHP ; HPPpGLD ; FDORULDV
com a norma-padrão da língua portuguesa. GLiULDVGHVVDIRQWH
(A) A má distribuição de riquezas e a desigualdade (  8P OHYDQWDPHQWR PRVWURX TXH RV DGROHVFHQWHV
social está no centro dos debates atuais. DPHULFDQRV ; FRQVRPHP ; HPPpGLD ; FDORULDV
(B) Políticos, economistas e teóricos diverge em re- GLiULDV ; GHVVDIRQWH
lação aos efeitos da desigualdade social.
(C) A diferença entre a renda dos mais ricos e a dos 5(63267$´&µ
mais pobres é um fenômeno crescente.
(D) A má distribuição de riquezas tem sido muito 3-) (TRT/RO E AC – ANALISTA JUDICIÁRIO –
criticado por alguns teóricos. FCC/2011) Estão plenamente observadas as normas de
(E) Os debates relacionado à distribuição de rique- concordância verbal na frase:
zas não são de exclusividade dos economistas. a) Destinam-se aos homens-placa um lugar visível
nas ruas e nas praças, ao passo que lhes é suprimida a
5HDOL]HLDFRUUHomRQRVLWHQV visibilidade social.
$ $PiGLVWULEXLomRGHULTXH]DVHDGHVLJXDOGDGHVR- b) As duas tábuas em que se comprimem o famige-
FLDOHVWi HVWmR rado homem-placa carregam ditos que soam irônicos,
%  3ROtWLFRV HFRQRPLVWDV H WHyULFRV GLYHUJH  GLYHU- como “compro ouro”.
JHP c) Não se compara aos vexames dos homens-placa
&  $ GLIHUHQoD HQWUH D UHQGD GRV PDLV ULFRV H D GRV a exposição pública a que se submetem os guardadores
PDLVSREUHVpXPIHQ{PHQRFUHVFHQWH de carros.
' $PiGLVWULEXLomRGHULTXH]DVWHPVLGRPXLWRFULWL- d) Ao se revogarem o emprego de carros-placa na
FDGR FULWLFDGD propaganda imobiliária, poupou-se a todos uma de-
( 2VGHEDWHVUHODFLRQDGR UHODFLRQDGRV monstração de mau gosto.
e) Não sensibilizavam aos possíveis interessados
5(63267$´&µ em apartamentos de luxo a visão grotesca daqueles ve-
lhos carros-placa.
2-) (COREN/SP – ADVOGADO – VUNESP/2013) Se-
guindo a norma-padrão da língua portuguesa, a frase )L]DVFRUUHo}HVHQWUHSDUrQWHVHV
– Um levantamento mostrou que os adolescentes ame- D 'HVWLQDPVH GHVWLQDVH DRVKRPHQVSODFDXPOX-
ricanos consomem em média 357 calorias diárias dessa JDUYLVtYHOQDVUXDVHQDVSUDoDVDRSDVVRTXHOKHVpVXSUL-
fonte. – recebe o acréscimo correto das vírgulas em: PLGDDYLVLELOLGDGHVRFLDO
(A) Um levantamento mostrou, que os adolescentes E $VGXDVWiEXDVHPTXHVHFRPSULPHP FRPSULPH 
americanos consomem em média 357 calorias, diárias RIDPLJHUDGRKRPHPSODFDFDUUHJDPGLWRVTXHVRDPLU{-
dessa fonte. QLFRVFRPR´FRPSURRXURµ
(B) Um levantamento mostrou que, os adolescentes F 1mRVHFRPSDUDDRVYH[DPHVGRVKRPHQVSODFDD
americanos consomem, em média 357 calorias diárias H[SRVLomRS~EOLFDDTXHVHVXEPHWHPRVJXDUGDGRUHVGH
dessa fonte. FDUURV
(C) Um levantamento mostrou que os adolescentes  G  $R VH UHYRJDUHP UHYRJDU  R HPSUHJR GH FDUURV
americanos consomem, em média, 357 calorias diárias SODFDQDSURSDJDQGDLPRELOLiULDSRXSRXVHDWRGRVXPD
dessa fonte. GHPRQVWUDomRGHPDXJRVWR
(D) Um levantamento, mostrou que os adolescentes H 1mRVHQVLELOL]DYDP VHQVLELOL]DYD DRVSRVVtYHLVLQ-
americanos, consomem em média 357 calorias diárias WHUHVVDGRVHPDSDUWDPHQWRVGHOX[RDYLVmRJURWHVFDGD-
dessa fonte. TXHOHVYHOKRVFDUURVSODFD
(E) Um levantamento mostrou que os adolescentes
americanos, consomem em média 357 calorias diárias, 5(63267$´&µ
dessa fonte.
4-) (TRE/PA- ANALISTA JUDICIÁRIO – FGV/2011)
$VVLQDOHLFRPXP´;µRQGHKiSRQWXDomRLQDGHTXDGD Assinale a palavra que tenha sido acentuada seguindo a
RXIDOWDQWH mesma regra que distribuídos.
$ 8POHYDQWDPHQWRPRVWURX ; TXHRVDGROHVFHQWHV (A) sócio
DPHULFDQRVFRQVRPHP ; HPPpGLD ; FDORULDV ;  (B) sofrê-lo
GLiULDVGHVVDIRQWH (C) lúcidos
% 8POHYDQWDPHQWRPRVWURXTXH ; RVDGROHVFHQWHV (D) constituí
DPHULFDQRVFRQVRPHPHPPpGLD ; FDORULDVGLiULDV (E) órfãos
GHVVDIRQWH

103
LÍNGUA PORTUGUESA

'LVWULEXtPRV UHJUDGRKLDWR (...) O uso do pronome de tratamento Vossa Senhoria


$ VyFLR SDUR[tWRQDWHUPLQDGDHPGLWRQJR (abreviado V. Sa.) para vereadores está correto, sim. Numa
%  VRIUrOR  R[tWRQD QmR VH FRQVLGHUD R SURQRPH Câmara de Vereadores só se usa Vossa Excelência para o seu
REOtTXR1XQFD presidente, de acordo com o Manual de Redação da Presi-
& O~FLGRV SURSDUR[tWRQD dência da República (1991).
' FRQVWLWXt UHJUDGRKLDWR GLIHUHQWHGH´FRQVWLWXLµ (Fonte: http://www.linguabrasil.com.br/nao-tropece-de-
²R[tWRQDFRQVWLWXL tail.php?id=393)
( yUImRV SDUR[tWRQDWHUPLQDGDHP´mRµ
5(63267$´(µ
5(63267$´'µ
7-) (TRE/AL – TÉCNICO JUDICIÁRIO – FCC/2010)
5-) (TRT/PE – ANALISTA JUDICIÁRIO – FCC/2012) ... valores e princípios que sejam percebidos pela so-
A concordância verbal está plenamente observada na ciedade como tais.
frase:
Transpondo para a voz ativa a frase acima, o verbo
(A) Provocam muitas polêmicas, entre crentes e
passará a ser, corretamente,
materialistas, o posicionamento de alguns religiosos e
(A) perceba.
parlamentares acerca da educação religiosa nas escolas
(B) foi percebido.
públicas.
(B) Sempre deverão haver bons motivos, junto (C) tenham percebido.
àqueles que são contra a obrigatoriedade do ensino (D) devam perceber.
religioso, para se reservar essa prática a setores da ini- (E) estava percebendo.
ciativa privada.
(C) Um dos argumentos trazidos pelo autor do tex-  YDORUHV H SULQFtSLRV TXH VHMDP SHUFHELGRV SHOD VR-
to, contra os que votam a favor do ensino religioso na FLHGDGHFRPRWDLV GRLVYHUERVQDYR]SDVVLYDHQWmRWH-
escola pública, consistem nos altos custos econômicos UHPRVXPQDDWLYDTXHDVRFLHGDGHSHUFHEDRVYDORUHVH
que acarretarão tal medida. SULQFtSLRV
(D) O número de templos em atividade na cidade
de São Paulo vêm gradativamente aumentando, em 5(63267$´$µ
proporção maior do que ocorrem com o número de es-
colas públicas. 8-) (TRE/AL – TÉCNICO JUDICIÁRIO – FCC/2010)
(E) Tanto a Lei de Diretrizes e Bases da Educação A concordância verbal e nominal está inteiramente cor-
como a regulação natural do mercado sinalizam para reta na frase:
as inconveniências que adviriam da adoção do ensino (A) A sociedade deve reconhecer os princípios e
religioso nas escolas públicas. valores que determinam as escolhas dos governantes,
para conferir legitimidade a suas decisões.
$ 3URYRFDP SURYRFD RSRVLFLRQDPHQWR   %  $ FRQÀDQoD GRV FLGDGmRV HP VHXV GLULJHQWHV
% 6HPSUHGHYHUmRKDYHUERQVPRWLYRV GHYHUiKDYHU devem ser embasados na percepção dos valores e prin-
& 8PGRVDUJXPHQWRVWUD]LGRVSHORDXWRUGRWH[WR cípios que regem a prática política.
FRQWUDRVTXHYRWDPDIDYRUGRHQVLQRUHOLJLRVRQDHVFROD (C) Eleições livres e diretas é garantia de um verda-
S~EOLFDFRQVLVWHP FRQVLVWH deiro regime democrático, em que se respeita tanto as
' 2Q~PHURGHWHPSORVHPDWLYLGDGHQDFLGDGHGH liberdades individuais quanto as coletivas.
6mR 3DXOR YrP JUDGDWLYDPHQWH DXPHQWDQGR HP SURSRU- (D) As instituições fundamentais de um regime de-
omRPDLRUGRTXHRFRUUHP RFRUUH
mocrático não pode estar subordinado às ordens indis-
( 7DQWRD/HLGH'LUHWUL]HVH%DVHVGD(GXFDomRFRPR
criminadas de um único poder central.
DUHJXODomRQDWXUDOGRPHUFDGRVLQDOL]DPSDUDDVLQFRQYH-
(E) O interesse de todos os cidadãos estão voltados
QLrQFLDV TXH DGYLULDP GD DGRomR GR HQVLQR UHOLJLRVR QDV
HVFRODVS~EOLFDV
para o momento eleitoral, que expõem as diferentes
opiniões existentes na sociedade.
5(63267$´(µ
)L]RVDFHUWRVHQWUHSDUrQWHVHV
6-) (TRE/PA- ANALISTA JUDICIÁRIO – FGV/2011) $  $ VRFLHGDGH GHYH UHFRQKHFHU RV SULQFtSLRV H YD-
Segundo o Manual de Redação da Presidência da Repú- ORUHV TXH GHWHUPLQDP DV HVFROKDV GRV JRYHUQDQWHV SDUD
blica, NÃO se deve usar Vossa Excelência para FRQIHULUOHJLWLPLGDGHDVXDVGHFLV}HV
(A) embaixadores.  % $FRQÀDQoDGRVFLGDGmRVHPVHXVGLULJHQWHVGH-
(B) conselheiros dos Tribunais de Contas estaduais. YHP GHYH VHUHPEDVDGRV HPEDVDGD QDSHUFHSomRGRV
(C) prefeitos municipais. YDORUHVHSULQFtSLRVTXHUHJHPDSUiWLFDSROtWLFD
(D) presidentes das Câmaras de Vereadores.  & (OHLo}HVOLYUHVHGLUHWDVp VmR JDUDQWLDGHXPYHU-
(E) vereadores. GDGHLUR UHJLPH GHPRFUiWLFR HP TXH VH UHVSHLWD UHVSHL-
WDP WDQWRDVOLEHUGDGHVLQGLYLGXDLVTXDQWRDVFROHWLYDV

104
LÍNGUA PORTUGUESA

 ' $VLQVWLWXLo}HVIXQGDPHQWDLVGHXPUHJLPHGHPR- 11-) (TRE/AL – ANALISTA JUDICIÁRIO – FCC/2010)


FUiWLFR QmR SRGH SRGHP  HVWDU VXERUGLQDGR VXERUGLQD- A pontuação está inteiramente adequada na frase:
GDV jVRUGHQVLQGLVFULPLQDGDVGHXP~QLFRSRGHUFHQWUDO D 6HUiSUHFLVRWDOYH]UHGHÀQLUDLQIkQFLDMiTXHDV
 ( 2LQWHUHVVHGHWRGRVRVFLGDGmRVHVWmR HVWi YRO- crianças de hoje, ao que tudo indica nada mais têm a
WDGRV YROWDGR SDUDRPRPHQWRHOHLWRUDOTXHH[S}HP H[- ver com as de ontem.
S}H DVGLIHUHQWHVRSLQL}HVH[LVWHQWHVQDVRFLHGDGH E 6HUiSUHFLVRWDOYH]UHGHÀQLUDLQIkQFLDMiTXH
as crianças, de hoje, ao que tudo indica nada têm a ver,
5(63267$´$µ com as de ontem.
F 6HUiSUHFLVRWDOYH]UHGHÀQLUDLQIkQFLDMiTXH
9-) (TRE/AL – ANALISTA JUDICIÁRIO – FCC/2010) as crianças de hoje ao que tudo indica, nada têm a ver
A frase que admite transposição para a voz passiva é: com as de ontem.
(A) O cúmulo da ilusão é também o cúmulo do sa- G 6HUiSUHFLVRWDOYH]UHGHÀQLUDLQIkQFLD"MiTXH
grado. as crianças de hoje ao que tudo indica, nada têm a ver
% 2FRQFHLWRGHHVSHWiFXORXQLÀFDHH[SOLFDXPD com as de ontem.
grande diversidade de fenômenos. H 6HUiSUHFLVRWDOYH]UHGHÀQLUDLQIkQFLDMiTXH
(C) O espetáculo é ao mesmo tempo parte da so- as crianças de hoje, ao que tudo indica, nada têm a ver
ciedade, a própria sociedade e seu instrumento de uni- com as de ontem.
ÀFDomR
'  $V LPDJHQV ÁXHP GHVOLJDGDV GH FDGD DVSHFWR 'HYLGRjLJXDOGDGHWH[WXDOHQWUHRVLWHQVDDSUHVHQ-
da vida (...). WDomRGDDOWHUQDWLYDFRUUHWDLQGLFDTXDLVVmRDVLQDGHTXD-
(E) Por ser algo separado, ele é o foco do olhar ilu- o}HVQDVGHPDLV
dido e da falsa consciência.
5(63267$´(µ
$ 2F~PXORGDLOXVmRpWDPEpPRF~PXORGRVDJUD-
GR 12-) (POLÍCIA MILITAR DO ESTADO DO ACRE –
%  2 FRQFHLWR GH HVSHWiFXOR XQLÀFD H H[SOLFD XPD ALUNO SOLDADO COMBATENTE – FUNCAB/2012)
JUDQGHGLYHUVLGDGHGHIHQ{PHQRV No trecho: “2 FUHVFLPHQWR HFRQ{PLFR VH DVVRFLDGR j
8PDJUDQGHGLYHUVLGDGHGHIHQ{PHQRVpXQLÀFDGDH ampliação do emprego, PODE melhorar o quadro aqui
H[SOLFDGDSHORFRQFHLWR sumariamente descrito.”, se passarmos o verbo desta-
& 2HVSHWiFXORpDRPHVPRWHPSRSDUWHGDVRFLHGD- cado para o futuro do pretérito do indicativo, teremos
GHDSUySULDVRFLHGDGHHVHXLQVWUXPHQWRGHXQLÀFDomR
a forma:
'  $V LPDJHQV ÁXHP GHVOLJDGDV GH FDGD DVSHFWR GD
A) puder.
YLGD  
B) poderia.
( 3RUVHUDOJRVHSDUDGRHOHpRIRFRGRROKDULOXGLGR
C) pôde.
HGDIDOVDFRQVFLrQFLD
D) poderá.
E) pudesse.
5(63267$´%µ
&RQMXJDQGRRYHUER´SRGHUµQRIXWXURGRSUHWpULWRGR
10-) (MPE/AM - AGENTE DE APOIO ADMINISTRA-
TIVO - FCC/2013) “Quando a gente entra nas serrarias, ,QGLFDWLYRHXSRGHULDWXSRGHULDVHOHSRGHULDQyVSRGH-
vê dezenas de caminhões parados”, revelou o analista UtDPRVYyVSRGHUtHLVHOHVSRGHULDP2VXMHLWRGDRUDomRp
ambiental Geraldo Motta. FUHVFLPHQWRHFRQ{PLFR VLQJXODU SRUWDQWRWHUFHLUDSHV-
Substituindo-se Quando por Se, os verbos subli- VRDGRVLQJXODU HOH  SRGHULD
nhados devem sofrer as seguintes alterações:
$ HQWUDUîYLUD 5(63267$´%µ
% HQWUDYDîWLQKDYLVWR
& HQWUDVVHîYHULD 13-) (TRE/AP - TÉCNICO JUDICIÁRIO – FCC/2011)
' HQWUDULDîYHULD Entre as frases que seguem, a única correta é:
( HQWUDYDîWHULDYLVWR a) Ele se esqueceu de que?
b) Era tão ruím aquele texto, que não deu para
6HDJHQWHHQWUDVVH YHUERQRVLQJXODU QDVHUUDULDYH- distribui-lo entre os presentes.
ULD HQWUDVVHYHULD c) Embora devessemos, não fomos excessivos nas
críticas.
5(63267$´&µ d) O juíz nunca negou-se a atender às reivindica-
ções dos funcionários.
e) Não sei por que ele mereceria minha conside-
ração.

105
LÍNGUA PORTUGUESA

$ (OHVHHVTXHFHXGHTXH" TXr" (A) … soubemos respeitar os mais velhos! / E quan-


% (UDWmRUXtP UXLP DTXHOHWH[WRTXHQmRGHXSDUD do eles falaramQyVFDODPRVDERFD
GLVWULEXLOR GLVWULEXtOR HQWUHRVSUHVHQWHV (B) … saberíamos respeitar os mais velhos! / E
& (PERUDGHYrVVHPRV GHYrVVHPRV QmRIRPRVH[- quando eles falassemQyVFDODUtDPRVDERFD
FHVVLYRVQDVFUtWLFDV (C) … soubéssemos respeitar os mais velhos! / E
' 2MXt] MXL] QXQFD VH QHJRXDDWHQGHUjVUHLYLQ- quando eles falassemQyVFDODUtDPRVDERFD
GLFDo}HVGRVIXQFLRQiULRV (D) … saberemos respeitar os mais velhos! / E quan-
( 1mRVHLSRUTXHHOHPHUHFHULDPLQKDFRQVLGHUDomR do eles falaremQyVFDODUHPRVDERFD
(E) … sabemos respeitar os mais velhos! / E quando
5(63267$´(µ eles falamQyVFDODPRVDERFD

14-) (FUNDAÇÃO CASA/SP - AGENTE ADMINIS- 1RSUHVHQWHQyVVDEHPRVHOHVIDODP


TRATIVO - VUNESP/2011 - ADAPTADA) Observe as
frases do texto: 5(63267$´(µ
I, Cerca de 75 por cento dos países obtêm nota ne-
16-) (UNESP/SP - ASSISTENTE TÉCNICO ADMINIS-
gativa...
TRATIVO - VUNESP/2012) A correlação entre as formas
II,... à Venezuela, de Chávez, que obtém a pior clas-
verbais está correta em:
VLÀFDomRGRFRQWLQHQWHDPHULFDQR  
(A) Se o consumo desnecessário vier a crescer, o
Assim como ocorre com o verbo “obter” nas frases planeta não resistiu.
I e II, a concordância segue as mesmas regras, na or- (B) Se todas as partes do mundo estiverem com alto
dem dos exemplos, em: poder de consumo, o planeta em breve sofrerá um co-
(A) Todas as pessoas têm boas perspectivas para o lapso.
próximo ano. Será que alguém tem opinião diferente (C) Caso todo prazer, como o da comida, o da bebi-
da maioria? da, o do jogo, o do sexo e o do consumo não conheces-
(B) Vem muita gente prestigiar as nossas festas se distorções patológicas, não haverá vícios.
juninas. Vêm pessoas de muito longe para brincar de (D) Se os meios tecnológicos não tivessem se tor-
quadrilha. QDGR WmR HÀFLHQWHV WDOYH] DV FRLVDV QmR ÀFDUDP WmR
(C) Pouca gente quis voltar mais cedo para casa. baratas.
4XDVH WRGRV TXLVHUDP ÀFDU DWp R QDVFHU GR VRO QD (E) Se as pessoas não se propuserem a consumir cons-
praia. FLHQWHPHQWHDRIHUWDGHSURGXWRVVXSpUÁXRVFUHVFLD
(D) Existem pessoas bem intencionadas por aqui,
mas também existem umas que não merecem nossa )L]DVFRUUHo}HVQHFHVViULDV
atenção. $ 6HRFRQVXPRGHVQHFHVViULRYLHUDFUHVFHURSODQH-
(E) Aqueles que não atrapalham muito ajudam. WDQmRUHVLVWLX UHVLVWLUi
%  6H WRGDV DV SDUWHV GR PXQGR HVWLYHUHP FRP DOWR
(P,REWrPHVWiQRSOXUDOHP,,QRVLQJXODU9DPRV SRGHUGHFRQVXPRRSODQHWDHPEUHYHVRIUHUiXPFRODSVR
DRVLWHQV & &DVRWRGRSUD]HUFRPRRGDFRPLGDRGDEHELGD
$ 7RGDVDVSHVVRDVWrP SOXUDO 6HUiTXHDOJXpP RGRMRJRRGRVH[RHRGRFRQVXPRQmRFRQKHFHVVHGLV-
WHP VLQJXODU  WRUo}HVSDWROyJLFDVQmRKDYHUi KDYHULD
% 9HP VLQJXODU PXLWDJHQWH9rPSHVVRDV SOXUDO  ' 6HRVPHLRVWHFQROyJLFRVQmRWLYHVVHPVHWRUQDGR
& 3RXFDJHQWHTXLV VLQJXODU 4XDVHWRGRVTXLVH- WmRHÀFLHQWHVWDOYH]DVFRLVDVQmRÀFDUDP ÀFDULDP RX
UDP SOXUDO WHULDPÀFDGR
( 6HDVSHVVRDVQmRVHSURSXVHUHPDFRQVXPLUFRQV-
'  ([LVWHP SOXUDO  SHVVRDV  PDV WDPEpP H[LVWHP
FLHQWHPHQWH D RIHUWD GH SURGXWRV VXSpUÁXRV FUHVFLD 
XPDV SOXUDO 
FUHVFHUi
( $TXHOHVTXHQmRDWUDSDOKDPPXLWRDMXGDP DPEDV
DVIRUPDVHVWmRQRSOXUDO
5(63267$´%µ
5(63267$´$µ 17-) (TJ/SP – AGENTE DE FISCALIZAÇÃO JUDICIÁ-
RIA – VUNESP/2010) Assinale a alternativa que preen-
15-) (CETESB/SP - ANALISTA ADMINISTRATIVO - che adequadamente e de acordo com a norma culta a
RECURSOS HUMANOS - VUNESP/2013 - ADAPTADA) lacuna da frase: Quando um candidato trêmulo ______ eu
Considere as orações: … sabíamos respeitar os mais lhe faria a pergunta mais deliciosa de todas.
velhos! / E quando eles falavamQyVFDOiYDPRVDERFD! (A) entrasse
Alterando apenas o tempo dos verbos destacados (B) entraria
para o tempo presente, sem qualquer outro ajuste, (C) entrava
tem-se, de acordo com a norma-padrão da língua por- (D) entrar
tuguesa: (E) entrou

106
LÍNGUA PORTUGUESA

2YHUER´IDULDµHVWiQRIXWXURGRSUHWpULWRRXVHMDLQ- & yEYLR SDUR[tWRQDWHUPLQDGDHPGLWRQJRDSyV


GLFDTXHpXPDDomRTXHSDUDDFRQWHFHUGHSHQGHGHRX- R[tWRQDWHUPLQDGDHP´Rµ´VµSDtVHV UHJUDGRKLDWR
tra([HPSOR4XDQGRXPFDQGLGDWRHQWUDVVHHXIDULD6H '  LVOkPLFR  SURSDUR[tWRQD   FHQiULR  SDUR[tWRQD
HOHHQWUDUHXIDUHL&DVRHOHHQWUHHXIDoR WHUPLQDGD HP GLWRQJR  SURS{V  R[tWRQD WHUPLQDGD HP
´Rµ´Vµ
5(63267$´$µ ( UHS~EOLFD SURSDUR[tWRQDHPSUHViULD SDUR[tWR-
QDWHUPLQDGDHPGLWRQJRJUD~GD UHJUDGRKLDWR
18-) (TJ/SP – AGENTE DE FISCALIZAÇÃO JUDICIÁ-
RIA – VUNESP/2010 - ADAPTADA) 5(63267$´(µ
Assinale a alternativa de concordância que pode ser
considerada correta como variante da frase do texto – 20-) (POLÍCIA CIVIL/SP – AGENTE POLICIAL - VU-
A maioria considera aceitável que um convidado che- NESP/2013) De acordo com a norma- padrão da
gue mais de duas horas ... língua portuguesa, o acento indicativo de crase está
(A) A maioria dos cariocas consideram aceitável
corretamente empregado em:
que um convidado chegue mais de duas horas...
(A) A população, de um modo geral, está à espera
(B) A maioria dos cariocas considera aceitáveis que
de que, com o novo texto, a lei seca possa coibir os
um convidado chegue mais de duas horas...
acidentes.
(C) As maiorias dos cariocas considera aceitáveis
que um convidado chegue mais de duas horas... (B) A nova lei chega para obrigar os motoristas à
(D) As maiorias dos cariocas consideram aceitáveis repensarem a sua postura.
que um convidado chegue mais de duas horas... (C) A partir de agora os motoristas estarão sujeitos
(E) As maiorias dos cariocas consideram aceitável à punições muito mais severas.
que um convidado cheguem mais de duas horas... (D) À ninguém é dado o direito de colocar em risco
a vida dos demais motoristas e de pedestres.
)L]DVLQGLFDo}HV (E) Cabe à todos na sociedade zelar pelo cumpri-
$  $ PDLRULD GRV FDULRFDV FRQVLGHUDP RX FRQVLGHUD mento da nova lei para que ela possa funcionar.
WDQWR ID]  DFHLWiYHO TXH XP FRQYLGDGR FKHJXH PDLV GH
GXDVKRUDV $ $SRSXODomRGHXPPRGRJHUDOHVWijHVSHUD Gi
%  $ PDLRULD GRV FDULRFDV FRQVLGHUD RN  DFHLWiYHLV SDUDVXEVWLWXLUSRU´HVSHUDQGRµ GHTXH
DFHLWiYHO TXHXPFRQYLGDGRFKHJXHPDLVGHGXDVKRUDV % $QRYDOHLFKHJDSDUDREULJDURVPRWRULVWDVjUH-
& $V $ PDLRULDV PDLRULD GRVFDULRFDVFRQVLGHUD RN  SHQVDUHP DQWHVGHYHUER
DFHLWiYHLV DFHLWiYHO  TXH XP FRQYLGDGR FKHJXH PDLV GH & $SDUWLUGHDJRUDRVPRWRULVWDVHVWDUmRVXMHLWRVj
GXDVKRUDV SXQLo}HV JHQHUDOL]DQGRSDODYUDQRSOXUDO
' $V $ PDLRULDV PDLRULD GRVFDULRFDVFRQVLGHUDP ' ­QLQJXpP SURQRPHLQGHÀQLGR
RN DFHLWiYHLV DFHLWiYHO TXHXPFRQYLGDGRFKHJXHPDLV ( &DEHjWRGRV SURQRPHLQGHÀQLGR
GHGXDVKRUDV
(  $V $  PDLRULDV PDLRULD  GRV FDULRFDV FRQVLGHUDP 5(63267$´$µ
RN  DFHLWiYHO TXH XP FRQYLGDGR FKHJXHP FKHJXH  PDLV
GHGXDVKRUDV (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO PAULO
- ESCREVENTE TÉCNICO JUDICIÁRIO – VUNESP/2013 -
5(63267$´$µ ADAPTADO) Leia o texto, para responder às questões
de números 21 e 22.
19-) (TJ/SP – AGENTE DE FISCALIZAÇÃO JUDICIÁ-
Veja, aí estão eles, a bailar seu diabólico “pas de
RIA – VUNESP/2010) Assinale a alternativa em que as
deux” (*): sentado, ao fundo do restaurante, o clien-
SDODYUDV VmR DFHQWXDGDV JUDÀFDPHQWH SHORV PHVPRV
PRWLYRV TXH MXVWLÀFDP UHVSHFWLYDPHQWH DV DFHQWXD-
te paulista acena, assovia, agita os braços num agô-
ções de: década, relógios, suíços. nico polichinelo; encostado à parede, marmóreo e
$ ÁH[tYHLVFDUWyULRWrQLV impassível, o garçom carioca o ignora com redobrada
(B) inferência, provável, saída. atenção. O paulista estrebucha: “Amigô?!”, “Chefê?!”,
(C) óbvio, após, países. ´3DUFHLU{"µRJDUoRPERFHMDWLUDXPÀDSRGRRPEUR
(D) islâmico, cenário, propôs. olha pro lustre.
(E) república, empresária, graúda. Eu disse “cliente paulista”, percebo a redundância: o
paulista é sempre cliente. Sem querer estereotipar, mas
'pFDGD SURSDUR[tWRQDUHOyJLRV SDUR[tWRQDWHUPL- já estereotipando: trata-se de um ser cujas interações
QDGDHPGLWRQJRVXtoRV UHJUDGRKLDWR sociais terminam, 99% das vezes, diante da pergunta
$ ÁH[tYHLVHFDUWyULR SDUR[tWRQDVWHUPLQDGDVHPGL- “débito ou crédito?”.[...] Como pode ele entender que
WRQJRWrQLV SDUR[tWRQDWHUPLQDGDHP´Lµ VHJXLGDGH´Vµ  o fato de estar pagando não garantirá a atenção do
%  LQIHUrQFLD  SDUR[tWRQD WHUPLQDGD HP GLWRQJR  garçom carioca? Como pode o ignóbil paulista, nascido
SURYiYHO SDUR[tWRQDWHUPLQDGDHP´OµVDtGD UHJUDGR e criado na crua batalha entre burgueses e proletários,
KLDWR compreender o discreto charme da aristocracia?

107
LÍNGUA PORTUGUESA

Sim, meu caro paulista: o garçom carioca é antes (A) príncipes e princesas constitui uma referência
de tudo um nobre. Um antigo membro da corte que em sentido não literal.
esconde, por trás da carapinha entediada, do descaso (B) reis e rainhas constitui uma referência em sen-
e da gravata borboleta, saudades do imperador. [...] Se tido não literal.
deixou de bajular os príncipes e princesas do século 19, (C) príncipes, princesas, reis e rainhas constitui uma
passou a servir reis e rainhas do 20: levou gim tônicas referência em sentido não literal.
para Vinicius e caipirinhas para Sinatra, uísques para (D) príncipes, princesas, reis e rainhas constitui uma
Tom e leites para Nelson, recebeu gordas gorjetas de referência em sentido literal.
Orson Welles e autógrafos de Rockfeller; ainda hoje (E) reis e rainhas constitui uma referência em sen-
fala de futebol com Roberto Carlos e ouve conselhos tido literal.
de João Gilberto. Continua tão nobre quanto sempre
3HOD OHLWXUD GR WH[WR LQIHUHVH TXH RV ´UHLV H UDLQKDVµ
foi, seu orgulho permanece intacto.
GRVpFXORVmRDVSHUVRQDOLGDGHVGDPtGLDRV´IDPRVRVµ
Até que chega esse paulista, esse homem bidimen- H´IDPRVDVµ4XDQWRDSUtQFLSHVHSULQFHVDVGRVpFXOR
sional e sem poesia, de camisa polo, meia soquete e HVVHVHUDPGDFRUWHOLWHUDOPHQWH
sapatênis, achando que o jacarezinho de sua Lacoste é
um crachá universal, capaz de abrir todas as portas. Ah, 5(63267$´%µ
paulishhhhta otááário, nenhum emblema preencherá o
vazio que carregas no peito - pensa o garçom, antes de 23-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO
conduzi-lo à última mesa do restaurante, a caminho do PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU-
banheiro, e ali esquecê-lo para todo o sempre. NESP/2013) O sentido de marmóreo (adjetivo) equiva-
Veja, veja como ele se debate, como se debaterá le ao da expressão de mármore. Assinale a alternativa
amanhã, depois de amanhã e até a Quarta-Feira de contendo as expressões com sentidos equivalentes, res-
Cinzas, maldizendo a Guanabara, saudoso das várzeas pectivamente, aos das palavras tJQHR e pétreo.
do Tietê, onde a desigualdade é tão mais organizada: (A) De corda; de plástico.
“Ô, companheirô, faz meia hora que eu cheguei, dava (B) De fogo; de madeira.
pra ver um cardápio?!”. Acalme-se, conterrâneo. (C) De madeira; de pedra.
Acostume-se com sua existência plebeia. O garçom (D) De fogo; de pedra.
carioca não está aí para servi-lo, você é que foi ao res- (E) De plástico; de cinza.
taurante para homenageá-lo.
4XHVWmRTXHSRGHVHUUHVROYLGDXVDQGRDOyJLFDRXDV-
$QWRQLR3UDWD&OLHQWHSDXOLVWDJDUoRPFDULRFD)ROKD
VRFLDomRGHSDODYUDV9HMDDLJQLomRGRFDUUROHPEUDQRV
GH63DXOR IRJRFRPEXVWmR3HGUDSHWULÀFDGR(QFRQWURXDUHVSRV-
WD"
8PWLSRGHFRUHRJUDÀDGHGDQoD
5(63267$´'µ
21-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO
PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU- (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO PAULO
NESP/2013) Assinale a alternativa contendo passagem - ESCREVENTE TÉCNICO JUDICIÁRIO – VUNESP/2013 -
em que o autor simula dialogar com o leitor. ADAPTADO) Para responder às questões de números
(A) Acalme-se, conterrâneo. Acostume-se com sua 24 e 25, considere a seguinte passagem: Sem querer
existência plebeia. estereotipar, mas já estereotipando: trata-se de um ser
(B) Ô, companheiro, faz meia hora que eu cheguei... cujas interações sociais terminam, 99% das vezes, dian-
(C) Veja, aí estão eles, a bailar seu diabólico “pas te da pergunta “débito ou crédito?”.
de deux”.
(D) Sim, meu caro paulista... 24-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO
(E) Ah, paulishhhhta otááário... PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU-
NESP/2013)Nesse contexto, o verbo estereotipar tem
(P ´PHX FDUR SDXOLVWDµ R DXWRU HVWi GLULJLQGRVH D
sentido de
(A) considerar ao acaso, sem premeditação.
QyVOHLWRUHV
(B) aceitar uma ideia mesmo sem estar convencido
dela.
5(63267$´'µ (C) adotar como referência de qualidade.
(D) julgar de acordo com normas legais.
22-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO ( FODVVLÀFDUVHJXQGRLGHLDVSUHFRQFHELGDV
PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU-
NESP/2013) O contexto em que se encontra a passa- &ODVVLÀFDUFRQIRUPHUHJUDVFRQKHFLGDVPDVQmRFRQ-
gem – Se deixou de bajular os príncipes e princesas do ÀUPDGDVVHYHUGDGHLUDV
século 19, passou a servir reis e rainhas do 20 (2.º pará-
grafo) – leva a concluir, corretamente, que a menção a 5(63267$´(µ

108
LÍNGUA PORTUGUESA

25-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO A) portanto.


PAULO - ESCREVENTE Te&1,&2 -8',&,É5,2 ² 98- (B) como.
1(63  Nessa passagem, a palavra cujas tem sen- (C) no entanto.
tido de (D) porque.
(A) lugar, referindo-se ao ambiente em que ocorre a (E) ou.
pergunta mencionada.
(B) posse, referindo-se às interações sociais do pau- 2´PDVµpXPDFRQMXQomRDGYHUVDWLYDGDQGRDLGHLDGH
lista. RSRVLomRHQWUHDVLQIRUPDo}HVDSUHVHQWDGDVSHODVRUDo}HV
(C) dúvida, pois a decisão entre débito ou crédito RTXHDFRQWHFHQRHQXQFLDGRGDTXHVWmR(P´$µWHPRV
ainda não foi tomada. XPDFRQFOXVLYD´%µFRPSDUDWLYD´&µDGYHUVDWLYD´'µH[-
(D) tempo, referindo-se ao momento em que ter- SOLFDWLYD´(µDOWHUQDWLYD
minam as interações sociais.
( FRQGLomRHPTXHVHGHYHGDUDWUDQVDomRÀQDQ- 5(63267$´&µ
ceira mencionada.
28-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO
2 SURQRPH ´FXMRµ JHUDOPHQWH QRV Gi R VHQWLGR GH PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU-
SRVVH2OLYURVFXMDVIROKDV OrVHDVIROKDVGRVOLYURV  NESP/2013) Assinale a alternativa contendo palavra
IRUPDGDSRUSUHÀ[R
5(63267$´%µ (A) Máquina.
(B) Brilhantismo.
26-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO (C) Hipertexto.
PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU- (D) Textualidade.
NESP/2013) Assinale a alternativa em que a oração (E) Arquivamento.
GHVWDFDGDH[SUHVVDÀQDOLGDGHHPUHODomRjRXWUDTXH
compõe o período. $ ² 0iTXLQD  VHP DFUpVFLPR GH DÀ[RV SUHÀ[R RX
(A) Se deixou de bajular os príncipes e princesas do VXÀ[R
%%ULOKDQWLVPR DFUpVFLPRGHVXÀ[R LVPR
século 19, passou a servir reis e rainhas do 20...
&²+LSHUWH[WR DFUpVFLPRGHSUHÀ[R KLSHU 
(B) Pensa o garçom, DQWHV GH FRQGX]LOR j ~OWLPD
'²7H[WXDOLGDGH DFUpVFLPRGHVXÀ[R LGDGH
mesa do restaurante...
(²$UTXLYDPHQWR DFUpVFLPRGHVXÀ[R PHQWR
(C) Você é que foi ao restaurante para homenageá
-lo.
5(63267$´&µ
(D) ... nenhum emblema preencherá o vazio que
carregas no peito ...
(TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO PAULO
(E) O garçom boceja, WLUDXPÀDSRGRRPEUR..
- ESCREVENTE TÉCNICO JUDICIÁRIO – VUNESP/2013 -
ADAPTADA) Para responder a esta questão, considere
9DPRVjVDQiOLVHV as palavras destacadas nas seguintes passagens do tex-
$  6H GHL[RX GH EDMXODU RV SUtQFLSHV H SULQFHVDV GR to:
VpFXOR DFRQMXQomRLQLFLDOpFRQGLFLRQDO Desde o surgimento da ideia de hipertexto...
%DQWHVGHFRQGX]LORj~OWLPDPHVDGRUHVWDXUDQWH  ... informações ligadas especialmente j SHVTXLVD
FRQMXQomRWHPSRUDO GiQRVQRomRGHWHPSR acadêmica,
&SDUDKRPHQDJHiOR QHVVDRUDomRWHPRVDQRomR ... uma “máquina poética”, algo que funcionasse
GRPRWLYR TXDODÀQDOLGDGH GDDomRGH´WHULGRDRUHVWDX- por analogia e associação...
UDQWHµVHJXQGRRWH[WR Quando o cientista Vannevar Bush [...] concebeu a
'  TXH FDUUHJDV QR SHLWR ² R ´TXHµ IXQFLRQD FRPR ideia de hipertexto...
SURQRPHUHODWLYR SRGHPRVVXEVWLWXtORSRU´RTXDOµFDU- ... 20 anos depois de seu artigo fundador...
UHJDVQRSHLWR
(WLUDXPÀDSRGRRPEUR²WHPRVDTXLXPDRUDomR 29-) As palavras destacadas que expressam ideia de
DVVLQGpWLFD VHPFRQMXQomR´ÀQDOµ tempo são:
(A) algo, especialmente e Quando.
5(63267$´&µ (B) Desde, especialmente e algo.
(C) especialmente, Quando e depois.
27-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO (D) Desde, Quando e depois.
PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU- (E) Desde, algo e depois.
NESP/2011) Em – A falta de modos dos homens da Casa
de Windsor é proverbial, masR príncipe Edward dizen- $VSDODYUDVTXHQRVGmRDQRomRLGHLDGHWHPSRVmR
do bobagens para estranhos no Quirguistão incomo- GHVGHTXDQGRHGHSRLV
dou a embaixadora americana.
A conjunção destacada pode ser substituída por 5(63267$´'µ

109
LÍNGUA PORTUGUESA

30- (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO PAU- 32-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO
LO - ESCREVENTE TÉCNICO JUDICIÁRIO – VUNESP/2013) PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU-
Assinale a alternativa contendo frase com redação de NESP/2013) Na passagem – Nesse contexto, governos e
acordo com a norma-padrão de concordância. empresas estão fechando o cerco contra a corrupção e a
(A) Pensava na necessidade de ser substituído de fraude, valendo-se dos mais variados mecanismos... – a
imediato os métodos existentes. oração destacada expressa, em relação à anterior, sen-
(B) Substitui-se os métodos de recuperação de infor- tido que responde à pergunta:
mações que se ligava especialmente à pesquisa acadêmica. (A) “Quando?”
(C) No hipertexto, a textualidade funciona por se- (B) “Por quê?”
TXrQFLDVÀ[DVTXHVHHVWDEHOHFHUDPSUHYLDPHQWH (C) “Como?”
(D) O inventor pensava em textos que já deveria es- (D) “Para quê?”
tar disponíveis em rede. (E) “Onde?”
(E) Era procurado por ele máquinas com as quais
pudesse capturar o brilhantismo anárquico da imagi- 4XHVWmRTXHHQYROYHFRQKHFLPHQWRGHFRHVmRHFRH-
nação humana. UrQFLD 6H SHUJXQWiVVHPRV j SULPHLUD RUDomR ´&202 R
JRYHUQRHVWiIHFKDQGRRFHUFRFRQWUDDFRUUXSomR"µRE-
&RORTXHLHQWUHSDUrQWHVHVDFRUUHomR WHUtDPRVDUHVSRVWDDSUHVHQWDGDSHODRUDomRHPGHVWDTXH
$ 3HQVDYDQDQHFHVVLGDGHGHVHUVXEVWLWXtGR VHUHP
VXEVWLWXtGRV GHLPHGLDWRRVPpWRGRVH[LVWHQWHV 5(63267$´&µ
% 6XEVWLWXLVH VXEVWLWXHPVH RVPpWRGRVGHUHFXSH-
UDomRGHLQIRUPDo}HVTXHVHOLJDYD OLJDYDP HVSHFLDOPHQ- 33-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO
WHjSHVTXLVDDFDGrPLFD PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU-
& 1RKLSHUWH[WRDWH[WXDOLGDGHIXQFLRQDSRUVHTXrQ- NESP/2013) Assinale a alternativa em que todos os ver-
FLDVÀ[DVTXHVHHVWDEHOHFHUDPSUHYLDPHQWH bos estão empregados de acordo com a norma-padrão.
' 2LQYHQWRUSHQVDYDHPWH[WRVTXHMiGHYHULD GHYH- (A) Enviaram o texto, para que o revíssemos antes
ULDP HVWDUGLVSRQtYHLVHPUHGH GDLPSUHVVmRGHÀQLWLYD
( (UDSURFXUDGR HUDPSURFXUDGDV SRUHOHPiTXLQDV (B) Não haverá prova do crime se o réu se manter
FRPDVTXDLVSXGHVVHFDSWXUDUREULOKDQWLVPRDQiUTXLFRGD em silêncio.
LPDJLQDomRKXPDQD (C) Vão pagar horas-extras aos que se disporem a
trabalhar no feriado.
5(63267$´&µ (D) Ficarão surpresos quando o verem com a toga...
(E) Se você quer a promoção, é necessário que a re-
31-) (TRIBUNAL DE JUSTIÇA DO ESTADO DE SÃO quera a seu superior.
PAULO - ESCREVENTE TÉCNICO JUDICIÁRIO – VU- 5HDOL]HLDFRUUHomRHQWUHSDUrQWHVHV
NESP/2013) Assinale a alternativa com as palavras $ (QYLDUDPRWH[WRSDUDTXHRUHYtVVHPRVDQWHVGD
acentuadas segundo as regras de acentuação, respecti- LPSUHVVmRGHÀQLWLYD
vamente, de intercâmbio e antropológico. %  1mR KDYHUi SURYD GR FULPH VH R UpX VH PDQWHU
(A) Distúrbio e acórdão. PDQWLYHU HPVLOrQFLR
(B) Máquina e jiló. & 9mRSDJDUKRUDVH[WUDVDRVTXHVHGLVSRUHP GLVSX-
(C) Alvará e Vândalo. VHUHP DWUDEDOKDUQRIHULDGR
(D) Consciência e características. '  )LFDUmR VXUSUHVRV TXDQGR R YHUHP YLUHP  FRP D
(E) Órgão e órfãs. WRJD
( 6HYRFrTXHUDSURPRomRpQHFHVViULRTXHDUHTXH-
3DUDTXHVDLEDPRVTXDODOWHUQDWLYDDVVLQDODUSULPHLUR UD UHTXHLUD DVHXVXSHULRU
WHPRV TXH FODVVLÀFDU DV SDODYUDV GR HQXQFLDGR TXDQWR j
SRVLomRGHVXDVtODEDW{QLFD 5(63267$´$µ
,QWHUFkPELR SDUR[tWRQDWHUPLQDGDHPGLWRQJR$Q-
WURSROyJLFR SURSDUR[tWRQD WRGDVVmRDFHQWXDGDV $JR-
UDYDPRVjDQiOLVHGRVLWHQVDSUHVHQWDGRV
$  'LVW~UELR  SDUR[tWRQD WHUPLQDGD HP GLWRQJR
DFyUGmR SDUR[tWRQDWHUPLQDGDHP´mRµ
% 0iTXLQD SURSDUR[tWRQDMLOy R[tWRQDWHUPLQDGDHP´Rµ
& $OYDUi R[tWRQDWHUPLQDGDHP´Dµ9kQGDOR SUR-
SDUR[tWRQD
'  &RQVFLrQFLD  SDUR[tWRQD WHUPLQDGD HP GLWRQJR
FDUDFWHUtVWLFDV SURSDUR[tWRQD
(  ÐUJmR H yUImV  DPEDV SDUR[tWRQD WHUPLQDGD HP
´mRµH´mµUHVSHFWLYDPHQWH

5(63267$´'µ

110
MATEMÁTICA E RACIOCÍNIO LÓGICO

Números inteiros; Números Naturais; Numeração decimal; Operações fundamentais como: Adição, Subtração, Divisão e
-
.....................................................................................................................................01
-
mas usando as quatro operações. .............................................................................................................................................................................07
....................................12
............................................................................................................12
...........................................................................................................................................................................21
..........................................................................................................................................................................26
.................................................................................28
...28
...................................................................................................................................33
.....................................................................................................................................................................33
..........................................................................................................................................................................................................38
...............................................................................................................................................................................................43
...............................................................................................................................................................48
Sistemas de numeração; Operações no conjunto dos números naturais; Operações fundamentais com números racionais;
-
............................................................................................................50
.........................................................................................................................................................................................................51
Geometria Espacial; ..........................................................................................................................................................................................................56
-
ras ..............................................................................................................................................................................................................................................63
.............................................................................................................................................................................................70
........................................................................................................................................................73
...........................................................................................................................77
Sistemas Lineares; .............................................................................................................................................................................................................85
.......................................................................................................................................................................................................96
......................................................................................98
......................................................................................................................................................................................................98
.....................................................................................................................................................................................................................99
.......................................................................................................................................................................................................................... 101
......................................................................................................................................................................................................... 103
........................................................................................ 103
-

............................................................................................................................................................................................... 103

informações das relações fornecidas e avaliar as condições usadas para estabelecer a estrutura daquelas relações. .... 118
-
................................................................................................................................................................................. 133
MATEMÁTICA E RACIOCÍNIO LÓGICO

Subconjuntos de
NÚMEROS INTEIROS; NÚMEROS NATURAIS; Vale lembrar que um asterisco, colocado junto à letra
NUMERAÇÃO DECIMAL; OPERAÇÕES -
do de tal conjunto.
FUNDAMENTAIS COMO: ADIÇÃO,
SUBTRAÇÃO, DIVISÃO E MULTIPLICAÇÃO;
SIMPLIFICAÇÃO; MEDINDO O TEMPO:
HORAS, MINUTOS E SEGUNDOS;
PROBLEMAS MATEMÁTICOS; RADICIAÇÃO; Expressões Numéricas
POTENCIAÇÃO; MÁXIMO DIVISOR COMUM;
MÍNIMO DIVISOR COMUM; -

Números Naturais -
rações, devemos resolver a multiplicação ou a divisão pri-
- meiramente, na ordem em que elas aparecerem e somente

Começando por zero e acrescentando sempre uma uni-


dade, obtemos os elementos dos números naturais:

A construção dos Números Naturais

23
o zero.

27

Números Inteiros

- números naturais, o conjunto dos opostos dos números


naturais e o zero. Este conjunto pode ser representado por:

terceiro e assim sucessivamente.

Subconjuntos do conjunto :

de zero.

1
MATEMÁTICA E RACIOCÍNIO LÓGICO

Números Racionais

, onde a e b são inteiros quaisquer,

Assim, os números são dois

Representação Decimal das Frações

decimais

Exemplo 1

3
.
9
-
Exemplo 2
número racional
-
Subtraindo membro a membro, temos:
irracionais, que trataremos mais a frente.

Números Irracionais
,GHQWLÀFDomRGHQ~PHURVLUUDFLRQDLV

Representação Fracionária dos Números Decimais - A soma de um número racional com um número irra-

- A diferença de dois números irracionais, pode ser um


-
número racional.

forma
- Exemplo: -
-
- O quociente de dois números irracionais, pode ser um
quantas forem as casas decimais do número decimal dado: número racional.

Exemplo: :

- O produto de dois números irracionais, pode ser um


número racional.

2
MATEMÁTICA E RACIOCÍNIO LÓGICO

Exemplo: . Ѯ

a raiz quadrada de um núme-

Números Reais

INTERVALOS IIMITADOS

reais menores que b.

Representação na reta
Ѯ

INTERVALOS LIMITADOS Ѯ

maiores que a.

Ѯ
Ѯ
-
nores que b. Potenciação
-
-

3
MATEMÁTICA E RACIOCÍNIO LÓGICO

m
Casos : an m-n

1)

96 : 92 6-2 4

2)
número.
m n
-

2 3 2.3 6

3)
resulta em um número positivo.
Radiciação

4) -

Técnica de Cálculo
A determinação da raiz quadrada de um número torna-
5) -
números primos. Veja:
base.

6)

se” um e multiplica.
m
. an
1 1
3.5 2
1
Observe: 3.5 3 2 .5 2 3. 5
a  R , b  R , n  N * , então:
4 3 7
5 .5
n n
7
a.b a .n b
-

dos fatores do radicando.

4
MATEMÁTICA E RACIOCÍNIO LÓGICO

1 1
2 § 2·2 22 2
Observe: ¨ ¸
©3¹
1
3 2
3
3
a  R , b  R * , n  N * , então:
n
n
a a
n
b b

-
ce dos termos do radicando.
Racionalização de Denominadores
Raiz quadrada números decimais
Normalmente não se apresentam números irracionais
com radicais no denominador. Ao processo que leva à eli-
-
zação do denominador.

Operações

Operações

Multiplicação

2º Caso: Denominador composto por duas parcelas.

Divisão
-
rença de quadrados no denominador:

MMC

Adição e subtração Cálculo do m.m.c.

dois ou mais números:

12 e 30:

5
MATEMÁTICA E RACIOCÍNIO LÓGICO

-
não comuns: cia temos:
12 = 36 = 22 2

90 = 2
2

Escrevendo a fatoração dos números na forma de

12 = 22

= 22
1º) dividimos o número maior pelo número menor;
O mmc de dois ou mais números, quando fatorados,
-

sucessivamente;

3º)
OBS:
1.Dois ou mais números são primos entre si quando o

Problemas
Neste processo decompomos todos os números ao
-
ma. O produto dos fatores primos que obtemos nessa de- -
-
-
OBS: ção ao ser informado das medidas, deu a ordem para que o
- -
plo de todos os outros,
dados.

o produto desses números. -

MDC
-
Máximo divisor comum (mdc) -

É o maior divisor comum entre dois ou mais núme-


ros naturais. Usamos a abreviação MDC
Cálculo do m.d.c

-
dois ou mais números
-
-
res primos: mesmo dia.
- Decompomos os números em fatores primos;

-
5

6
MATEMÁTICA E RACIOCÍNIO LÓGICO

Resposta

dia 14 de dezembro.

SISTEMA DE MEDIDAS: MEDIDAS DE


COMPRIMENTO, SUPERFÍCIE, VOLUME,
CAPACIDADE, TEMPO, MASSA, M² E METRO
LINEAR; PROBLEMAS USANDO AS QUATRO
OPERAÇÕES.

Sistema de Medidas Decimais

Unidades de Comprimento
km hm dam m dm cm mm
quilômetro metro
1000m 100m 10m 1m 0,1m 0,01m 0,001m

popular de litro.
2 2

-
2

2
.

Unidades de Área
km2 hm2 dam2 m2 dm2 cm2 mm2
quilômetro metro
quadrado quadrado quadrado quadrado quadrado quadrado quadrado
1000000m2 10000m2 100m2 1m2 0,01m2 0,0001m2 0,000001m2

7
MATEMÁTICA E RACIOCÍNIO LÓGICO

3 3

103, o sistema continua sendo decimal.

Unidades de Volume
3 3
km hm dam3 m3 dm3 cm3 mm3
quilômetro metro
cúbico cúbico cúbico cúbico cúbico cúbico cúbico
3 3 3 3 3 3
1000000000m 1000000m 1000m 1m 0,001m 0,000001m 0,000000001m3

3
.

Unidades de Capacidade
kl hl dal l dl cl ml
quilolitro decalitro litro decilitro mililitro
1000l 100l 10l 1l 0,1l 0,01l 0,001l

Unidades de Massa
kg hg dag g dg cg mg

Não Decimais

-
-

10 10

8
MATEMÁTICA E RACIOCÍNIO LÓGICO

Exercícios

1. 5DTXHOVDLXGHFDVDjVKPLQFDPLQKDQGRDWpRFXUVRGHLQJOrVTXHÀFDDPLQXWRVGHVXDFDVDHFKH-
gou na hora da aula cuja duração é de uma hora e meia. A que horas terminará a aula de inglês?

6. Quantos centilitros equivalem a

para

8. Converta 2,5 metros em

Respostas

Solução: Basta somarmos todos os valores mencionados no enunciado do teste, ou seja:

Solução: Como 1 cm3 3


por mil, para obtermos o seu equivalente em cen-
3
.
3 3
e ml se equivalem.

por 10 duas vezes:

Solução: Sabemos que 1 m3


à esquerda.
Dividiremos então 1.000 por 10 apenas uma vez:

9
MATEMÁTICA E RACIOCÍNIO LÓGICO

Como 1 m3
direita. Multiplicaremos então 1 por 10 duas vezes:

3
, ou a ”.
-
mos então 14 por 1000 seis vezes:

3 14 mm3
, ou a .

Multiplicaremos então 15 por 10 quatro vezes:

10
MATEMÁTICA E RACIOCÍNIO LÓGICO

-
Solução:

7 5336
Solução: 45 min 4 4144
--------------------------------------------------
Unidade de tempo

números naturais, então, vamos retirar 1 min de 53 min,


abreviado por s. transformar esse 1 min em 60 s e acrescenta-los aos 36 s.
Assim:

Hora Minuto 7 52 96
min s 4 41 44
------------------------------------------------
3600 s 60 s 1s
3 11 52

que a unidade que a antecede.


X6
--------------------------------------
-
te superior, basta dividi-la por 60 e inferior basta multipli-
ca-la por 60.
-

Problemas

5 1237 -
8 2011
ria, nessa ordem.
--------------------------------------------
13 3248

8 19 58
224 39 -
-------------------------------------------
10 43 97

vamos decompor esse valor em:

acrescentar 1 min na classe dos minutos.

11
MATEMÁTICA E RACIOCÍNIO LÓGICO

Respostas Cálculo de uma Porcentagem:


p V, basta multiplicarmos a fração p
por V. 100
p
.V
100
Exemplo 1
23
100
Exemplo 2
-
mos 1 minuto dos 27

O mesmo acontece com os minutos. Vamos emprestar 1 67


.56000 37520
- 100
Resposta: 37 520 pessoas.

Porcentagem que o lucro representa em relação ao


preço de custo e em relação ao preço de venda

CONJUNTO DE NÚMEROS: NATURAIS,


INTEIROS, RACIONAIS, IRRACIONAIS, REAIS, compra e venda a diferença entre o preço de venda e o
OPERAÇÕES, EXPRESSÕES (CÁLCULO); preço de custo.

prejuízo.
“Caro Candidato, o Tópico acima foi abordado
em: Números inteiros; Números Naturais; Numeração
Assim, podemos escrever:
decimal; Operações fundamentais como: Adição,
6XEWUDomR 'LYLVmR H 0XOWLSOLFDomR 6LPSOLÀFDomR
Medindo o tempo: horas, minutos e segundos;
Problemas matemáticos; radiciação; potenciação;
máximo divisor comum; mínimo divisor comum; “
de duas formas:

MATEMÁTICA FINANCEIRA; PORCENTAGEM;


JUROS SIMPLES E COMPOSTO;

PORCENTAGEM Exemplo

É uma fração de denominador centesimal, ou seja,

- o lucro obtido na transação;


50
Deste modo, a fração
100

Resposta:
Forma Decimal: É comum representarmos uma
300
Lc
500
forma decimal seriam representados por 0,35.
300
75
Lv
800
100

12
MATEMÁTICA E RACIOCÍNIO LÓGICO

Aumento Sendo V2

Aumento Percentual: Consideremos um valor inicial p2


V2 1
V 100
A o valor do aumento e VA p1 p2
V2
p 100 100
.V
100
Sendo V
p sofrer um aumento de p1
VA .V de p2
100
p Sendo V1
VA V1
p1
100
100
p
100 Sendo V2
V2 p2
1
100
Desconto p1 p2
V2
100 100
Desconto Percentual: Consideremos um valor inicial
V Exemplo
D o valor do desconto e VD
p
.V
100

p n
VD .V
100
p
VD
100 n
p § p ·
Resolução: VA ¨1  ¸ .v
100 © 100 ¹
n
Exemplo VA § 15 ·
¨ 1. ¸ .1000
© 100 ¹
VA
VA
VA

Resolução: VA
QUESTÕES
3500
2500
1,4 1 - (PREF. AMPARO/SP – AGENTE ESCOLAR – CON-
RIO/2014) Se em um tanque de um carro for misturado 45
-
Aumentos e Descontos Sucessivos: Consideremos
um valor inicial V
dois aumentos sucessivos de p1 2
V1 o valor
p1
V1
100
Sendo V2 2 - (CEF / Escriturário)
V2 p2
1
100 -
p1 p2
V2
100 100
Sendo V
sofrer dois descontos sucessivos de p1 2

Sendo V1
p1
V1
100

13
MATEMÁTICA E RACIOCÍNIO LÓGICO

3 - (SABESP – APRENDIZ – FCC/2012) Observe a tabela que indica o consumo mensal de uma mesma torneira da pia

4 - (CÂMARA DE SÃO PAULO/SP – TÉCNICO ADMINISTRATIVO – FCC/2014)

5 - (CÂMARA DE SÃO PAULO/SP – TÉCNICO ADMINISTRATIVO – FCC/2014) O preço de venda de um produto, des-

6 - (DPE/SP – AGENTE DE DEFENSORIA PÚBLICA – FCC/2013)


-

7 - (DPE/SP – AGENTE DE DEFENSORIA PÚBLICA – FCC/2013)

8 - PREF. JUNDIAI/SP – ELETRICISTA – MAKIYAMA/2013) Das 80 crianças que responderam a uma enquete referente

14
MATEMÁTICA E RACIOCÍNIO LÓGICO

RESPOSTAS

1 - RESPOSTA: “B”.

9 - (PM/SE – SOLDADO 3ªCLASSE – FUNCAB/2014)

promoção: 2 - RESPOSTA “C”.

3 - RESPOSTA: “B”.

ele com a revenda das latas de cerveja das duas embala-


4 - RESPOSTA: “B”.

10 - (PM/SE – SOLDADO 3ªCLASSE – FUNCAB/2014)

7 de dezembro. 5 - RESPOSTA: “A”.

-
-
-
-
culos, sendo que 183 foram comercializados como sucatas
e 12 foram vendidos como aptos para circulação.

6 - RESPOSTA: “C”.

valor.

ߠ

15
MATEMÁTICA E RACIOCÍNIO LÓGICO

7 - RESPOSTA: “A”.
Ao todo tem 12 bolas, portanto a probabilidade de se unidade:

Consideremos, como exemplo


8 - RESPOSTA: “D”.
-

ߠ
Resolução:

9 - RESPOSTA: “A”. C
t
i

10 - RESPOSTA: “E”.

------------------------------------------------------------
t

J=C.i.t
JUROS SIMPLES
Observações:

i e o tempo t
unidade.
i
decimal.
- Os juros são representados pela letra j. montante M

C.
calcular o 4º valor.
representado pela letra t.
M=C+ j
um capital durante certo tempo. É representado pela letra i
e utilizada para calcular juros. Exemplo

16
MATEMÁTICA E RACIOCÍNIO LÓGICO

Fórmula para o cálculo de Juros compostos

C.i.t
1
100
20000..i.3
2
100 2

3
3
28.800 .................................................................................................
600
n

JUROS COMPOSTOS n

rende juros.

incorporados ao principal e passam, por sua vez, a render

Vamos ilustrar a diferença entre os crescimentos de um


Exemplos

Solução:
n
n

escrever:

log(S / P) log S  log P


n= =
log(1+ i) log(1+ i)

Deste exemplo, dá para perceber que o estudo dos


juros compostos é uma aplicação prática do estudo dos
logaritmos.

Solução: n
. Quando o capital
n
investidores particulares costumam reinvestir as quantias
n

1,02
econômicos.

17
MATEMÁTICA E RACIOCÍNIO LÓGICO

5.

equivale a 2 anos e 11 meses.


Resposta: 2 anos e 11 meses.

EXERCÍCIOS

1. -

quatro meses, em outro fundo, que rendia juros simples de


-

reais, aplicada por Renato no primeiro investimento foi de 6. -


154.000,00
156.000,00
158.000,00
160.000,00
162.000,00

2. -

- 7.

3. -
8.
aplicar em um fundo que rende juros compostos, um inves-
tidor fez uma simulação. Na simulação feita, se ele aplicar
-

de juros considerada nessa simulação foi de

4. -

9. -

-
-

18
MATEMÁTICA E RACIOCÍNIO LÓGICO

7.
4.
5.
6.
3.

10. -

A) 240,00
B) 330,00
C) 429,00
D) 489,00
E) 538,00

RESPOSTAS

1 - RESPOSTA: “B”.

ߠ ߠ

2 - RESPOSTA: “B”.

3 - RESPOSTA: “D”.

4 – RESPOSTA: “B”.

19
MATEMÁTICA E RACIOCÍNIO LÓGICO

5 - RESPOSTA: “C”.

6 - RESPOSTA: “D”.

Como ele quer saber os juros:


ߠ

7 - RESPOSTA: “C”.

8 - RESPOSTA: “D”.

C1º ano 2º ano

20
MATEMÁTICA E RACIOCÍNIO LÓGICO

9 - RESPOSTA: “B”.

1,013
1,014

10 - RESPOSTA: “E”.

REGRAS DE TRÊS SIMPLES E COMPOSTA;

REGRA DE TRÊS SIMPLES

regra de três simples.

Exemplo 1

Solução:

180 15

180 15

21
MATEMÁTICA E RACIOCÍNIO LÓGICO

Exemplo 3
distância
e litros de álcool são diretamente proporcionais. No es-
quema que estamos montando, indicamos esse fato colo-
mesmo sentido
Vamos representar pela letra x o tempo procurado.

Distância (km) Litros de álcool


180 15 x
210 x

mesmo sentido Tempo gasto para fazer o


Velocidade
percurso
105 18 s
180 6 15
210 7 x 6 x

Se duplicarmos a velocidade inicial do carro, o tempo

Exemplo 2
números 200 e 240 são inversamente proporcionais aos
números 18 e x.

3600
240
60 4

Conclui-se, então, que se o competidor tivesse andan-

percurso.

REGRA DE TRÊS COMPOSTA


60 4
O processo usado para resolver problemas que
Observe que, se duplicarmos a velocidade, o tempo
regra de três
velocidade e tempo são inversamente proporcionais.
composta.
sentido contrário ao
Exemplo 1

Velocidade (km/h) Tempo (h)


60 4 x.
80 x

sentidos contrários x

4 80 4 12 8 160 4
x 60 3 6 300 x
4

22
MATEMÁTICA E RACIOCÍNIO LÓGICO

peças e dias são diretamente

mesmo
sentido

Máquinas Peças Dias


8 160 4
6 300 x “pessoas” e “estrada” são diretamente
-
Mesmo sentido mesmo senti-
do
máquinas e dias são inversamente

Máquinas Peças Dias


8 160 4
6 300 x

Sentidos contrários

4 Reposta: Devem ser contratados 105 pessoas.


x , com o produto das outras razões,
x
§ 6 160 · : Questões
¨ . ¸
4 2
6 160 81 © 8 300 ¹
. 5
1 – (FUNDA O CASA – AGENTE DE APOIO OPE-
x 81 30015 RACIONAL – VUNESP/2013)
4 2 para fazer 1 500 metros em 5 minutos. Como ele pretende
4 2.5
manter um ritmo sempre constante, deve fazer cada 100
x 5 21 metros em

Resposta: Em 10 dias.

Exemplo 2

2 – (SAP/SP – AGENTE DE SEGURANÇA PENITEN-


CIÁRIA DE CLASSE I – VUNESP/2013) -
-
na, mantendo o mesmo funcionamento, para fabricar 3 375
Solução: Em de ano foi pavimentada de estrada.

3 - (PREF. IMARUÍ – AGENTE EDUCADOR – PREF.


IMARUÍ/2014) -

“pessoas” e “tempo” são inversamente


-

23
MATEMÁTICA E RACIOCÍNIO LÓGICO

4 - (DNOCS -2010) Das 96 pessoas que participaram


-
partamento Nacional de Obras Contra as Secas, sabe-se

9 - (TRF 3ª – TÉCNICO JUDICI RIO – FCC/2014) Sa-


-

5 - (SABESP – APRENDIZ – FCC/2012) Em uma ma-

10 – (PREF. JUNDIAI/SP – ELETRICISTA – MAKIYA-


- MA/2013)

-
6 - (C MARA DE S O PAULO/SP – TÉCNICO ADMI-
NISTRATIVO – FCC/2014)
-
-
-

Respostas

1-
-
7 – (PREF. CORBÉLIA/PR – CONTADOR – FAUEL/2014)

1500 ----- 300

-
tamente proporcionais temos:

8 – (PC/SP – OFICIAL ADMINISTRATIVO – VU-


NESP/2014) epartição traba-
ߠ ߠ

por tempo indeterminado e outro se aposentou, o total de

24
MATEMÁTICA E RACIOCÍNIO LÓGICO

2- 6.

6000--------------18-------------- 5

-
tamente proporcionais temos:
-

correspondente em minutos
Hora Minutos
1 ------ 60

3.

7
27000 ------ 90 20-----------------8-------------60-------4800
X ------- 100

4.

8
-

ߠ ߠ
10---------------8--------------27

-
5.
-
100cm
ߠ

0,02m ------------ 0,035m 8---------------9-------------- 27

ߠ ߠ ߠ
30 dias.

25
MATEMÁTICA E RACIOCÍNIO LÓGICO

9
SISTEMA MONETÁRIO NACIONAL (REAL);
-

Sistema Monetário Nacional

- -
-

acordo com a Lei nº 59, de 08 de outubro de 1833, entrou

 ߠ ߠ
252000 ߠ

-
ma do Decreto nº 5.108, de 18 de dezembro de 1926, no
10
O Decreto-Lei nº 1, de 13 de novembro de 1965, trans-
5--------------------3-----------2500----------10

-
ou diretamente proporcionais.
-

26
MATEMÁTICA E RACIOCÍNIO LÓGICO

Cruzeiro

-
tabeleceu a denominação Cruzeiro, a partir de 15 de maio
de 1970, mantendo o centavo.
Exemplo: -

- Cruzeiros

- -
-
-
-
visionava a atuação dos bancos comerciais, orientava a
Cruzado
internacionais.
O Decreto-Lei nº 2.283, de 27 de fevereiro de 1986
- -
pel-moeda.

Cruzeiro
restabelecendo o centavo. A mudança de padrão foi dis-
O Decreto-Lei nº 4.791, de 05 de outubro de 1942 ciplinada pela Resolução nº 1.100, de 28 de fevereiro de

Exemplo:

parte do cruzeiro.
Exemplo: -
Cruzado Novo

Cruzeiro
-
-
- tendo o centavo. A Resolução nº 1.565, de 16 de janeiro

implantação do novo padrão.


Exemplo:

Cruzeiro Novo

Cruzeiro

- -
- tabeleceu a denominação Cruzeiro para a moeda, corres-
cional, pela Resolução nº 47, de 08 de fevereiro de 1967,

novo padrão.
Exemplo: -
- Exemplo: -

27
MATEMÁTICA E RACIOCÍNIO LÓGICO

Cruzeiro Real
EQUAÇÃO DE 1º GRAU: RESOLUÇÃO;
PROBLEMAS DE 1º GRAU; INEQUAÇÕES DO
1º GRAU;
EQUAÇÃO DE 2º GRAU: RESOLUÇÃO DAS
em substituição ao Cruzeiro, equivalendo um cruzeiro real EQUAÇÕES COMPLETAS, INCOMPLETAS,
a um mil cruzeiros, com a manutenção do centavo. A Re- PROBLEMAS DO 2º GRAU; EQUAÇÕES
FRACIONÁRIAS;

Exemplo: Equação 1º grau


-

Real -

- -
-

mantido o centavo.

Exemplo:

Banco Central (BC ou Bacen) - -

Banco Interamericano de Desenvolvimento (BID) -


-
-
Quando passamos de um lado para o outro invertemos o sinal

Banco Mundial - -
-

- (PREF. DE NITERÓI/RJ – Fiscal de Posturas – FGV/2015)


volvimento.

Banco Nacional de Desenvolvimento Econômico e


Social (BNDES) - Empresa pública federal vinculada ao Mi-

desenvolvimento do Brasil.

28
MATEMÁTICA E RACIOCÍNIO LÓGICO

Resolução

2.

Lembrando que:

3.

Se

Se
Resposta: B.

Equação 2º grau Se

Onde a, b e c são números reais, 5HODo}HVHQWUH&RHÀFLHQWHVH5Dt]HV

Discussão das Raízes

1.

Se
números reais.

Se for positivo, a equação tem duas soluções:

29
MATEMÁTICA E RACIOCÍNIO LÓGICO

Composição de uma equação do 2ºgrau, conhecidas


as raízes -
tes em cada membro, realizando as operações indicadas.
No caso das inequações, ao realizarmos uma multiplicação

Solução
1 2
1 2

Quando se trata de inequações-produto, teremos uma


(IMA – Analista Administrativo Jr – SHDIAS/2015) A -

somamos os quadrados dessas idades, obtemos 1000. A


realizando a intersecção do conjunto resposta das funções.

Resolução

Dividindo por2:

-
rente de zero.
-
ção de uma inequação-produto, de modo que devemos
analisar o sinal das funções e realizar a intersecção do sinal
dessas funções.
Inequação

>: maior
<: menor
–PDLRURXLJXDO
•PHQRURXLJXDO

30
MATEMÁTICA E RACIOCÍNIO LÓGICO

Sistema de Inequação do 1º Grau Substituindo em A

duas ou mais inequações, cada uma delas tem apenas uma Resposta: B.
-
tras inequações envolvidas. Inequação 2º grau

([HPSOR
Vamos resolver a inequação 3x² + 10x + 7 < 0.

Resolvendo Inequações

3x² + 10x +7

temos:

31
MATEMÁTICA E RACIOCÍNIO LÓGICO

Sistemas de equações primeiro grau


Duas -

Método da substituição
-
-
ção, veja como:

Dado o sistema , enumeramos as equações.

Adicionando as duas equações:

Se resolver um sistema utilizando qualquer um dois

 03(63²2ÀFLDOGH3URPRWRULD,²981(63
basta substituir 12 na equação

ele produziu um total de 333 peças. O número de dias que

Método da adição tipo A. Nesses 30 dias, o número de peças do tipo C que


ele produziu foi

-
nitas seja zero.

Dado o sistema: Resposta: B.

-
duzidas.

32
MATEMÁTICA E RACIOCÍNIO LÓGICO

-
-

uma relação de A em B.

Domínio, contradomínio, imagem


Devemos multiplicar por 15, pois ele produz 15 peças O domínio -
por dia de C

RELAÇÃO E FUNÇÃO: DOMÍNIO, -


CONTRADOMÍNIO E IMAGEM;
FUNÇÃO DO 1º GRAU; contradomínio, CD.
FUNÇÃO CONSTANTE;
imagem

Diagrama de Flechas
Exemplo
Com os conjuntos A={1, 4, 7} e B={1, 4, 6, 7, 8, 9, 12}
criamos a função I$ମ% f(x) = x + 5 que tam-
y = x + 5. A representação,

*UiÀFR&DUWHVLDQR

D = {1, 4, 7}, o contra-


{1, 4, 6, 7, 8, 9, 12} Im
= {6, 9, 12}

&ODVVLÀFDomRGDVIXQo}HV

Injetora

Muitas vezes nos deparamos com situações que en-

velocidade no trajeto.

33
MATEMÁTICA E RACIOCÍNIO LÓGICO

Sobrejetora: Quando todos os elementos do contra-

Bijetora -
ção injetora e ao mesmo tempo, de sobrejetora, ou seja,
Raiz da função
-

Função 1 grau

-
-
-
Estudo dos Sinais

y = ax
+ b ou f(x) = ax + b Dependendo do caso, teremos que fazer um sistema
aos reais e diferem de zero. Esse modelo de função possui

34
MATEMÁTICA E RACIOCÍNIO LÓGICO

Raízes

Função Quadrática ou Função do 2º grau


- Vértices e Estudo do Sinal

V; quando a < 0, a pa-


1 2
- V.
Em qualquer caso, as coordenadas de V são

Considerações

Concavidade

1 2 1 2

Quando

Repare que, quando tivermos o discriminante , as

35
MATEMÁTICA E RACIOCÍNIO LÓGICO

Equação Exponencial
-
- Se -
tes de 1.

Resolva a equação no universo dos números reais.

Solução

A Constante de Euler

-
-
ros a estudar as propriedades desse número.
-

Função exponencial e = 2,7182818284

Se Propriedades dos expoentes

número racional, então:


- -a a
-a

-a

36
MATEMÁTICA E RACIOCÍNIO LÓGICO

Equação Modular

Solução
-

Solução

Inequação Modular
-

Resolva as inequações:
a)
b)

Solução
a)
Ѯ Considerando-se dois números N e a reais e positivos,

b)

Ѯ na base a

Função Modular

-
função modular.

37
MATEMÁTICA E RACIOCÍNIO LÓGICO

&RQVHTXrQFLDVGD'HÀQLomR
RAZÃO E PROPORÇÃO;

Razão

Sejam dois números reais a e b, com E


razão entre a e b

lida de modo diferente.

Exemplos
Propriedades
3
5
3
5
Os termos da razão recebem nomes especiais.
O número 3 é numerador

Mudança de Base 3
a) Na fração
5
O número 5 é denominador

O número 3 é antecedente

a) Na razão 3
5 O número 5 é consequente
Exemplo 1
20 2
=
Solução 50 5 . 50 5
a) ԫ =
20 2
b) Exemplo 2

c)

Função Logarítmica
18 3
dada por , em que =
- 24 4

18 3
= , o que equivale a dizer
42 7

Razão entre grandezas de mesma espécie

Exemplo
2

dessa sala mede 384 dm2. Vamos calcular a razão entre a

38
MATEMÁTICA E RACIOCÍNIO LÓGICO

consumo médio.
uma mesma unidade:
2 2
2

Exemplo 4
escrever a razão:
384dm 2 384 16
= =
1800dm 2 1800 75

comprimento i no i desenho 20cm 20cm 1


Razão entre grandezas de espécies diferentes Escala = = = = ou1: 40
comprimento i real 8m 800cm 40

Exemplo 1
-
- Escala.

Proporção

pro-
porção.
3 6
=
Na proporção 5 10
140km -
= 70km / h
2h
velocidade média. -
-
Observe que:
tal das proporções:
diferentes;
“Em toda proporção, o produto dos meios é igual
ao produto dos extremos”.
Exemplo 1
Exemplo 2 2 6
Na proporção
3 9
2
- e em 1 = 4
- 4 16

- Exemplo 2
2 2

6628000
 71,5hab. / km 2 criança.
927286 x
densidade de- 5gotas x
PRJUiÀFD. =  x = 30gotas
2
2kg 12kg

Exemplo 3

5gotas
- = 20gotas / p  p = 8kg
2kg
teremos o número de quilômetros que esse carro percorre
-
83, 76km
 10, 47km / l
8l

39
MATEMÁTICA E RACIOCÍNIO LÓGICO

Propriedades da Proporção Questões

1-
- concurso participaram 3000 pessoas e foram aprovadas
zões formam ou não uma proporção. 1800. A razão do número de candidatos aprovados para o

4 12
e
3 9 formam uma proporção, pois
 4.9 
 = 3.12
meios. 36 36

2–

5 10  5 + 2 10 + 4 7 14
=  =  = que essa razão permaneça a mesma, pode-se concluir que
2 4  5 10 5 10
ou

5 10  5 + 2 10 + 4 7 14
=  =  =
2 4  2 4 2 4

- 3- -

4 8 ­4  3 86 1 2
Ÿ® Ÿ
3 6 ¯ 4 8 4 8
ou A) 31
B) 34
4 8 ­4  3 86 1 2
Ÿ® Ÿ C) 36
3 6 ¯ 3 6 3 6 D) 38
- E) 43

consequente. 4 -
-
mentos de mesma medida.
12 3 12 + 3 12 15 12
=  =  =
8 2  8+2 8 10 8
ou
12 3 12 + 3 3 15 3
=  =  =
8 2  8 + 2 2 10 2

seu consequente.

3 1  31 3 2 3
=  =  = -
15 5 15  5 15 10 15
ou
3 1  31 1 2 1
=  =  =
15 5 15  5 5 10 5

40
MATEMÁTICA E RACIOCÍNIO LÓGICO

7-( -
biblioteca de uma faculdade, a relação entre a quantidade
de livros e de revistas era de 1 para 4. Com a compra de

-
mente a essa situação.

A)
Nº de revis-
Nº de livros
tas
-
Antes da compra 50 200
200 300 -

B)
Nº de Nº de revis- -
livros tas
Antes da compra 50 200
300 200 A) 2:3
B) 1:3
C) C) 1:6
Nº de li- Nº de revis- D) 3:4
vros tas E) 2:5
Antes da compra 200 50
9-
200 300

D)
Nº de revis-
Nº de livros
tas
Antes da compra 200 50
300 200

E) -
Nº de revis-
Nº de livros
tas
-
Antes da compra 200 200
50 300

atendidos foi
6 - ( A) 84
- B) 100
C) 217
- D) 280
E) 350

A) 2,75
B) 2,95
C) 3,15
D) 3,35
E) 3,55

41
MATEMÁTICA E RACIOCÍNIO LÓGICO

Respostas

1 – Resposta “B”

2 – Resposta “A”

; assim aplicando a propriedade da proporção teremos:

Î Î 180.2 = CP.5 Î CP = Î CP = 72

3 - RESPOSTA: “D”

4 - Resposta “B”

5 - RESPOSTA: “A”

50 livros: 200 revistas

Depois da compra
2 livros :3 revistas
200 livros: 300 revistas

42
MATEMÁTICA E RACIOCÍNIO LÓGICO

6 - RESPOSTA: “C”
GRANDEZAS PROPORCIONAIS;

NÚMEROS DIRETAMENTE PROPORCIONAIS

7 - RESPOSTA: “A”
-

Î 6x = 72 Î x = 12 3 ovos
1 lata de leite condensado

8- RESPOSTA: “C”

1 pacote de coco ralado

Veja que:
tiveram mais de 30 minutos de atraso

Sucessão do número de ovos: 6 9 12

9 – RESPOSTA: “C”
Nessas sucessões as razões entre os termos

mente - 6 3 9 3 12 3
= = =
4 2 6 2 8 2
Montando a proporção teremos:
6 9 12 3
Assim: = = =
4 6 8 2
Dizemos, então, que:

- os números da sucessão 6, 9, 12 são diretamente


proporcionais aos
3 da sucessão 4, 6, 8;
- o número 2 -
fator de proporcionalidade.
Duas sucessões de números não-nulos são diretamen-
10 - RESPOSTA: “E” te proporcionais quando as razões entre cada termo da

Exemplo 1: Vamos determinar x e y, de modo que as


sucessões sejam diretamente proporcionais:
Î 5I = 3I+420 Î2I = 420 ÎI = 210
2 8 y
3 x 21

43
MATEMÁTICA E RACIOCÍNIO LÓGICO

Como as sucessões são diretamente proporcionais, as Números Inversamente Proporcionais

2 8 y
= =
3 x 21
2 8 2 y
3 x 3 21

24 42
2 3 Sucessão do número de minutos: 120 60 30 20
Nessas sucessões as razões entre cada termo da
primeira sucessão e o inverso do termo correspondente da
x y
1 2 4 6
Exemplo 2 = = = = 120
1 1 1 1
120 60 30 20

repartido entre eles em partes diretamente proporcionais Dizemos, então, que:


à quantia investida. Calcular a parte que coube a cada um. - os números da sucessão 1, 2, 4, 6 são inversamente
proporcionais aos da sucessão 120, 60, 30, 20;
Solução:
primeira sucessão e o inverso do seu correspondente na
x y,
z, podemos escrever:
Observando que
­ x  y  z 32400 ½
° °
® x y z ¾ 1 4
°̄ 24000 27000 30000 °¿ 1 1

32400

x y z x+ y+z 20 30
= = =
24000 27000 30000 24000
 27000
+ + 30000

81000
2 6
Resolvendo as proporções: 1 1
x 32400 4 60 20
=
24000 8100010

não-nulos são inversamente proporcionais quando os


produtos de cada termo da primeira sucessão pelo termo
y 4
=
27000 10
Exemplo 1: Vamos determinar x e y, de modo que as
sucessões sejam inversamente proporcionais:
4 x 8
20 16 y

proporcionais, os produtos dos termos correspondentes


z 4
=
3000 10

44
MATEMÁTICA E RACIOCÍNIO LÓGICO

Exemplo 2: Vamos dividir o número 104 em partes


inversamente proporcionais aos números 2, 3 e 4. diretamente proporcionais quando a razão entre os valores
Representamos os números procurados por x, y e z. E
x, y, z
proporcionais, escrevemos:

104
 Com 1 tonelada de cana-de-açúcar, uma usina produz
x y z x y z x yz
1 1 1 1 1 1 1 1 1 De acordo com esses dados podemos supor que:
  - com o dobro do número de toneladas de cana, a usina
2 3 4 2 3 4 2 3 4
- com o triplo do número de toneladas de cana, a usina

Como, vem
diretamente
proporcionais.

Grandezas Inversamente Proporcionais

na tabela:

Velocidade Tempo

Grandezas Diretamente Proporcionais

Considere uma usina de açúcar cuja produção, nos Com base na tabela apresentada observamos que:

Dias Sacos de açúcar


1 5 000
reduzido à terça parte, e assim por diante.
2 10 000
3 15 000 velocidade e
tempo são inversamente proporcionais.
4 20 000
Observe que, duas a duas, as razões entre os números
5 25 000
que indicam o tempo:
Com base na tabela apresentada observamos que:
30 6
= inverso da razão 12
60 12 6
- duplicando o número de dias, duplicou a
produção de açúcar;
30 4
- triplicando o número de dias, triplicou a produção = inverso da razão 12
90 12 4
de açúcar, e assim por diante. 12
30 3 inverso da razão
=
120 12 3
tempo e
produção são diretamente proporcionais. 60 4
= inverso da razão 6
90 6 4

60 3
= inverso da razão 6
120 6 3

90 3 inverso da razão 4
=
120 6 3

45
MATEMÁTICA E RACIOCÍNIO LÓGICO

4 - (METRÔ/SP - AGENTE DE SEGURANÇA METRO-


são inversamente proporcionais quando a razão entre os VI RIA I - FCC/2013)
-

De acordo com esses dados, podemos supor que:

quantidade de
5 - (PC/SP – OFICIAL ADMINISTRATIVO – VU-
máquinas e tempo são inversamente proporcionais.
NESP/2014)
QUESTÕES
Assim, o valor absoluto da diferença entre as capacidades
1 - (PGE/BA – ASSISTENTE DE PROCURADORIA –
FCC/2013)

livros, sendo 60.000 no salão maior, 15.000 no menor e os


-
-
locar, em cada salão, uma quantidade de livros diretamente 6 – (C MARA DE S O PAULO/SP – TÉCNICO ADMI-
- NISTRATIVO – FCC/2014)
namento. Considerando a estimativa feita, a quantidade de -

A letra X representa o número


2 - (PREF. PAULISTANA/PI – PROFESSOR DE MATE-
M TICA – IMA/2014)

7 - (SAMU/SC – ASSISTENTE ADMINISTRATIVO –


SPDM/2012) -

3 - (C MARA DE S O PAULO/SP – TÉCNICO AD-


MINISTRATIVO – FCC/2014) -

- 8 - (TRT – FCC) ês técnicos judiciários arquivaram


meiro ano de funcionamento, a empresa obteve um lucro um total de 382 processos, em quantidades inversamente
- proporcionais as suas respectivas idades: 28, 32 e 36 anos.
Nessas condições, é úmero de pro-

46
MATEMÁTICA E RACIOCÍNIO LÓGICO

RESPOSTAS 6 - RESPOSTA: “B”.

1 - RESPOSTA: “C”.

7 - RESPOSTA: “B”.
Marcos: a
2 - RESPOSTA: “C”.

3 - RESPOSTA: “E”.
20000 :40000 :60000
1: 2: 3

4 - RESPOSTA: “B”.

8 - RESPOSTA “A”.

382 ߠSomamos os inversos dos números, ou seja:


. Dividindo-se os denominadores por
-
nando-se os denominadores, temos 191 que corres-
5 - RESPOSTA: “B”.
ponde a uma soma. Dividindo-se a soma pela soma:

47
MATEMÁTICA E RACIOCÍNIO LÓGICO

EXPRESSÕES ALGÉBRICAS; FRAÇÃO


ALGÉBRICA; 4 3 2 2 2

Resolução:

Expressões Algébricas - x4 - 5x3 + 9x2 - 7x+2 x2 - 2x + 1


meros e letras. -x4 + 2x3 - x2 x2 - 3x + 2
3 2
-3x + 8x -7x
3x3 - 6x2 -3x
Variáveis 2x2 - 4x + 2
-2x2 + 4x - 2
-
0
Valor numérico -

efetuamos suas operações.

Veja:
2 2

Monômio
por produtos. 7ab2 e 20ab2 são dois termos, suas partes literais são ab2
e ab2

Polinômio
Adição e subtração de monômios

Termos semelhantes: são aqueles que possuem par-


envolvidos na operação de adição ou subtração não forem

Veja:
possuem a mesma parte literal. 2 2
, como os dois termos são
Adição e Subtração de expressões algébricas 2 2
- conservar a parte literal.
- 2
2 2

conservar a parte literal.

Convém lembrar dos jogos de sinais.


- 2- 2 2

tirar o mmc de 6 e 9.

Multiplicação e Divisão de expressões algébricas 3x2 - 4 x2 + 18 x2


18
devemos usar a propriedade distributiva. 17x2
18
2 3 3 2
devemos primeiro unir os termos
3 3 2 2

e a subtração.
3 2
como os dois termos restantes não são
- dos monômios.
2
2
2 2 2
2

48
MATEMÁTICA E RACIOCÍNIO LÓGICO

2
Exercícios

2
2

40

Multiplicação de monômios

que quando multiplicamos as partes literais devemos usar


m
. an

2 3

usar a propriedade am . an .
2
. a . b . b3
-15 a b -
-15 a3b4
-
Divisão de monômios

Respostas

que quando dividirmos as partes literais devemos usar a -


m
: an m-n

2 3 3

usar a propriedade am : an .
2 3 3 9-6 6 9! 3
7 9,6
[(9-6)! x6!]
1 0
9.8.7.6!
3.2.1.6!

Potenciação de monômios

Na potenciação de monômios devemos novamente


utilizar uma propriedade da potenciação:
m m
. bm
n m.n

2
b6 2 aplicando a propriedade
1 2 3 4 5 6 7 8 9
os
2 2 2 6 2
aplicando a propriedade termos do desenvolvimento do binômio, o termo do meio
4
. b12 4 12
b 5

49
MATEMÁTICA E RACIOCÍNIO LÓGICO

b - Solução:

8-4 4 8! 4 4
5 8,4
[(8-4)! .4!]
8.7.6.5.4! 4 4
(4!.4.3.2.1

4 4 4 4 Solução:
5
procurado.

Solução: Ora, se o desenvolvimento do binômio possui


-0,88.

Solução:

1
x

6-p 1 6-p -p 6-2p


.
6,p p 6,p 6,p
x
-
0

0 6! 6.5.4.3!
4 6,3 6,3
[(6-3)!.3!] 3!.2.1
SISTEMAS DE NUMERAÇÃO; OPERAÇÕES
NO CONJUNTO DOS NÚMEROS NATURAIS;
4
OPERAÇÕES FUNDAMENTAIS COM
NÚMEROS RACIONAIS; MÚLTIPLOS E
DIVISORES EM N; RADICIAÇÃO; CONJUNTO
DE NÚMEROS FRACIONÁRIOS; OPERAÇÕES
FUNDAMENTAIS COM NÚMEROS
FRACIONÁRIOS; PROBLEMAS COM
NÚMEROS FRACIONÁRIOS; NÚMEROS
DECIMAIS;

“Caro Candidato, o Tópico acima foi abordado


em: Números inteiros; Números Naturais; Numeração
decimal; Operações fundamentais como: Adição,
6XEWUDomR 'LYLVmR H 0XOWLSOLFDomR 6LPSOLÀFDomR
Medindo o tempo: horas, minutos e segundos;
Problemas matemáticos; radiciação; potenciação;
máximo divisor comum; mínimo divisor comum; “

50
MATEMÁTICA E RACIOCÍNIO LÓGICO

Distância entre Dois Pontos


entre
GEOMETRIA ANALÍTICA; p p q q AB

Estudo do Ponto

Ѯ1ºQuad

Ponto Médio

p p q p
M M

-
rem à mesma reta.

51
MATEMÁTICA E RACIOCÍNIO LÓGICO

de acordo com suas coordenadas posicionais. Outra forma


-

matriz das coordenadas. 2º caso:

-
&RHÀFLHQWHDQJXODU

de uma reta não-perpendicular


Estudo da Reta
&iOFXORGRFRHÀFLHQWHDQJXODU dessa reta.
Consideremos a reta que passa pelos pontos
e , com -
.
1º caso:

varia em função de .

52
MATEMÁTICA E RACIOCÍNIO LÓGICO

Equação Segmentária

Equação reduzida da reta

Vamos determinar a equação da reta que passa por


:

A equação fundamental de

-
ção reduzida da reta, em que
Equação Geral da Reta
Considere duas retas distintas do plano cartesiano:

53
MATEMÁTICA E RACIOCÍNIO LÓGICO

Retas paralelas Retas perpendiculares

As retas e Duas retas, e , não-verticais são perpendiculares se,

De fato:

Assim, para , temos:


Como

Retas concorrentes

As retas e
Então:
Assim, para e concorrentes, temos:

E, reciprocamente, se

Distância de ponto a reta

Considere uma reta , de equação , e


um ponto não pertencente a -
e

54
MATEMÁTICA E RACIOCÍNIO LÓGICO

Circunferência
Equações da circunferência

Equação reduzida

Ângulo entre duas retas


e de duas
retas, e e , podemos de- Assim, sendo C P -
C a P

Se uma das retas for vertical, teremos:

2 2 2

do centro e o raio.
Observação: Quando o centro da circunfer6encia esti-
2
2 2
.

Equação Geral

Desenvolvendo a equação reduzida, obtemos a equa-

55
MATEMÁTICA E RACIOCÍNIO LÓGICO

C GEOMETRIA ESPACIAL;

2 2 6yOLGRV*HRPpWULFRV
-
Desenvolvendo os quadrados dos binômios, temos:

Determinação do centro e do raio da circunferência,


dada a equação geral

o processo de fatoração de trinômio quadrado perfeito


-

- $ÀJXUDUHSUHVHQWDDSODQLÀFDomRGHXPSULVPDUHWR
dições:
2 2

V = Ab x a
Então, vamos determinar o centro e o raio da circunfe-
2 2

Observando a equação, vemos que ela obedece às duas mesma forma que o volume de um prisma reto.
condições.
Assim: para calcular da mesma forma que as acima apresentadas:

x e os termos em y Figuras Geométricas:


e isolamos o termo independente
2 2

2º passo: determinamos os termos que completam os


x e y, somando a ambos
os membros as parcelas correspondentes

3º passo: fatoramos os trinômios quadrados perfeitos


2 2

4º passo: obtida a equação reduzida, determinamos o


centro e o raio

56
MATEMÁTICA E RACIOCÍNIO LÓGICO

O conceito de cone

Observações sobre um cone circular reto


-

Elementos do cone
- Base

- Vértice -
- Eixo - 2 2 2

4. A Área Lateral de um cone circular reto pode ser


- Geratriz -
Lat
a base.
- Altura 5. A Área total de um cone circular reto pode ser ob-
- Superfície lateral
-
2
A
- Superfície do cone

- Seção meridiana

&ODVVLÀFDomRGRFRQH

Cones Equiláteros

reto -
oblíquo

da base.
Observação
importantes são os cones retos. Em função das bases, os ABase 2

2 2 2
2 2 2 2
-R

57
MATEMÁTICA E RACIOCÍNIO LÓGICO

Assim:
-

A superfície esférica
R3
2
ALat
2
A

O conceito de esfera 4

-
tante em função de suas aplicações a problemas da vida. 4

pela mesma, razão pela quais muitas pessoas calculam o


YROXPH da esfera. Na maioria dos livros elementares sobre
-
rança da Geometria Euclidiana.
Embora não seja correto, muitas vezes necessitamos
falar palavras que sejam entendidas pela coletividade. De

-
-
mensional:
So

S1

Aplicação: volumes de líquidos

-
-
espaço que estão localizados na casca e dentro da esfera.
- -

-
uma vara com indicadores de medidas. Ao retirar a vara,
a fruta.

- Quando indicamos o raio da esfera pela letra R e o centro

<

Quando indicamos o raio da esfera pela letra R e o cen-


,z
o o o
dada por:
o o o

58
MATEMÁTICA E RACIOCÍNIO LÓGICO

A partir da rotação, construiremos duas calotas em


-

o o o
<

- -

-
-

1
e
raio da base r1
- 2
e raio da base r2, de tal modo que
-
lida determinada pela calota maior menos a calota menor

-
-
tender o raio da esfera sobre a qual estamos realizando
-

Algumas fórmulas (relações) para objetos esféricos

Objeto Relações e fórmulas


Esfera

- 1 2

bases r1 1 2
1 2

59
MATEMÁTICA E RACIOCÍNIO LÓGICO

R R

- Vc(h) = 2 {  (h  R)m dm +  R 2  m 2 mdm}


ção da altura da mesma. 0 0

ou seja:
Volume de uma calota no hemisfério Sul R

Vc(h) =  {(h  R)R 2   R 2  m 2 (2m)dm}


raio R. 0

poderemos reescrever:
R2

Vc(h) =  {(h  R)R + 


2
u du}
u=0

VC

VC

Volume de uma calota no hemisfério Norte


-

z = R  R 2  (x 2 + y 2 )

letra r para indicar:


Lançaremos mão de uma propriedade de simetria da
esfera que nos diz que o volume da calota superior assim
< como da calota inferior somente depende do raio R da es-
0<m<R, 0<t<

Vc(h) =   s (h  z)dxdy
Como o volume desta calota vazia

ou seja VC
Vc(h) =   s (h  R + R 2  (x 2 + y 2 ))dxdy -

VC

forma:
2x R

Vc(h) =   (h  R +
t=0 m=0
R 2  m 2 )mdmdt retirar o volume da calota vazia, para obter:

60
MATEMÁTICA E RACIOCÍNIO LÓGICO

Prisma reto

As arestas laterais são perpendiculares ao plano da base.

Poliedro
Prisma oblíquo

as faces do poliedro. As interseções das faces são as ares-

n lados.
Bases

Altura
- as bases
Arestas laterais
- paralelas: mesmas
tido no poliedro. medidas
Faces laterais:
Poliedros Regulares
Prisma reto Aspectos comuns Prisma oblíquo
-
n
Seções de um prisma

Seção transversal
Tetraedro Hexaedro (cubo) Octaedro

Seção reta (seção normal)


É uma seção determinada por um plano perpendicular
às arestas laterais.
Princípio de Cavaliere
Áreas e Volumes

Poliedro regular Área Volume


Tetraedro a2 R[3] (1/12)