Anda di halaman 1dari 77

MENTERI KESEHATAN

REPUBLIK INDONESIA

PERATURAN MENTERI KESEHATAN REPUBLIK INDONESIA


NOMOR 15 TAHUN 2016
TENTANG

ISTITHAAH KESEHATAN JEMAAH HAJI

DENGAN RAHMAT TUHAN YANG MAHA ESA

MENTERI KESEHATAN REPUBLIK INDONESIA,

Menimbang : a Bahwadalamrangkaperlindunganterhadap jemaah haji agar


dapatmelaksanakanibadah haji
perludilakukanpembinaandanpelayanankesehatan jemaah
sejakdini
b Bahwapembinaankesehatan jemaah haji dst….
c Bahwaberdasarkanpertimbangan a dan b, dst……..

Mengingat : 1 Undang-undangNomor 2 tahun 1962 tentangkarantinaudara,


dst……sampainomor 13

MEMUTUSKAN :

Menetapkan :PERATURAN MENTERI KESEHATAN REPUBLIK INDONESIA


TENTANG ISTITHAAH KESEHATAN JEMAAH HAJI.

BAB I
KETENTUAN UMUM
Pasal 1

DalamperaturanMenteriini yang dimaksuddengan :

1. Jemaah haji adalah :WNI, Islam dantelahmendaftaribadah haji


2. Istithaahadalah : mampusecarajasmani, ruhani,
pembekalandankeamananuntukmenunaikanibadah haji
3. Istithaahkesehatanadalah : kemampuandariaspekkesehatanmeliputifisik mental
melaluipemeriksaanygdapatdipertanggungjawabkan
4. Pemeriksaankesehatanadalah : penilaian status kesehatan jemaah haji
secarakomprehensif
5. Pembinaanistithaahadalah : kegiatanterpadu, terencana,
terstrukturdanterukurdiawalipemeriksaankesehatansaatmendaftarsampaikeberangkatank
earab Saudi
6. Tim penyelenggarakesehatan Haji kabupaten/kotaadalah : Tim
ygditetapkanolehbupati/walikotamenjalankanfungsipenyelenggaraankesehatan haji
7. PPIH embarkasiadalah : panitiaygdibentukolehMenteri Agama
untukmelakukanpembinaan, pelayanan, perlindungansaatoperasionalibadah haji di
Embarkasi
8. PPIH Embarkasibidangkesehatanadalah :
panitiaygdibentukolehmenterikesehatanuntukmelakukanpembinaan, pelayanan,
perlindungansaatoperasionalibadah haji di embarkasi
9. Menteriadalah : Menteriygmenyelenggarakanurusanpemerintahankesehatan

Pasal 2

Pengaturanistithaahkesehatanbertujuanterselenggaranyapemeriksaandanpembinaankesehata
n jemaah haji

Pasal 3

Jemaah haji
harusdilakukanpemeriksaandanpembinaankesehatandalamrangkaistithaahkesehatan haji

Pasal 4

1) Untukterselenggaranyaistithaahkesehatan, dinaskesehatanmembentuk Tim


penyelenggarakesehatan di wilayahnya
2) Tim penyelenggaratersebutmelakukanpemeriksaandanpembinaankesehatan di
puskesmasatauRumahSakit

BAB II
PEMERIKSAAN KESEHATAN
DALAM RANGKA ISTITHAAH KESEHATAN JEMAAH HAJI

Pasal 5

Pemeriksaankesehatansebagaidasarpelaksanaanpembinaankesehatan jemaah haji

Pasal 6

1) Pemeriksaankesehatanmeliputi :
a. Tahappertama
b. Tahapkedua
c. Tahapketiga
2) Pemeriksaantahappertama : dilaksanakantimpenyelenggara haji kab/kota di puskesmas/
RS saat jemaah mendaftaruntukmendapatkannomorporsi
3) Pemeriksaantahapkedua :
dilaksanakanpadasaatpemerintahtelahmenentukankeberangkatan jemaah haji
padatahunberjalan
4) Pemeriksaantahapketiga : dilaksanakanoleh PPIH embarkasisaatmenjelangkeberangkatan

Pasal 7

1) Pemeriksaantahappertama : ditetapkan status kesehatan jemaah :


resikotinggiatautidakresikotinggi
2) Kriteria status kesehatanresikotinggi :
a. Usia 60 thnataulebih
b. Memilikifaktorresikokesehatan

Pasal 8

3) Status kesehatanresikotinggidituangkandalamsuratketeranganhasilpemeriksaandan di
tandatanganiolehdokterpemeriksakesehatan haji
4) Suratketeranganhasilpemeriksaantercantumdalamformulir 1

Pasal 9

1) Pemeriksaankesehatantahapkedua : ditetapkanistithaahkesehatan jemaah haji


2) Istithaahkesehatan jemaah haji meliputi :
a. Memenuhisyaratistithaahkesehatan haji
b. Memenuhisyaratistithaahdenganpendampingan
c. Tidakmemenuhisyaratistithaahuntuksementara
d. Tidakmemenuhisyaratistithaahkesehatan haji

Pasal 10

1) Memenuhisyaratistithaah : jemaah haji ygmampumengikutiibadah haji


tanpabantuandengantingkatkebugaransetidaknyakategoricukup
2) Penentuantingkatkebugaranmelaluipemeriksaankebugaran
3) Jemaah haji istithaahwajibberperandalamkegiatanpromotifpreventif

Pasal 11

Kriteria Jemaah haji istithaahdenganpendampingan :

a. Berusia 60 thnataulebih
b. Menderitapenyakittertentuygbukankategoriistithaahsementaraatautidakmemenuhisyar
atistithaah

Pasal 12

Kriteria jemaah haji memenuhisyaratistithaahsementara:

a. Tidakmemilikisertifikatvaksininternasionalygsah
b. Menederitapenyakitygberpeluangsembuh : TB BTA (+), TB MDR, DM tdkterkontrol, HIV
AIDS, Diarekronik, stroke, anemia, Hipertiroid, Perdarahansal.cerna
c. Suspek/ confirm penyakitmenularberpotensiwabah
d. Psikosisakut
e. Frakturtungkaiygmembutuhkanimmobilisasi
f. Hamilusiakehamilan<14 minggudan>26 minggu

Pasal 13

Kriteria jemaah haji tidakmemenuhisyaratistithaahkesehatan haji :

a. Kondisiklinisygdapatmengancamjiwa : PPOK stad IV, gagaljantungstad IV, CKD stad.IV


dg potensi dialysis regular, AIDS stad.IV, HS ygluas
b. Gangguanjiwaberat : skizofreniaberat, demensiaberat, retardasi mental berat
c. Jemaah denganpenyakitygsulitsembuh : keganasanstad.akhir, Tuberculosis Totally
Drugs Resistance, sirosishepatis decompensate

Pasal 14

1) Penetapanistithaahdituangkandalamberitaacarapenetapanistithaahygditandatanganiketuati
mpenyelenggarakesehatan haji
2) Beritaacarapenetapanistitaahtercantumdalamformulir II terlampir
3) Beritaacarapenetapanistithaahdisampaikankepada jemaah ygbersangkutan
4) Selainkepada jemaah bersangkutan, penetapanistithaahuntuk status
tidakmemenuhisyaratsementaradantidakmemenuhisyaratistithaahjugadisampaikankepadak
ementrian agama kabupaten/kotauntukditindaklanjuti
5) Rekapitulasihasilpenetapanistithaahdilaporkankepadakepaladaerahkab/kotadankepaladina
skesehatanprovinsi

Pasal 15

1) Pemeriksaantahapketiga : untukmenentukan status jemaah laikatautidaklaikterbang


2) Jemaah ygditetapkantidaklaikterbang : jemaah
ygtidakmemenuhistandarkeselamatanpenerbanganinternasional/peraturankesehatanintern
asional
3) Dalammenetapkan status kesehatan jemaah : PPIH
embarkasikesehatanbekerjasamadengandokterpenerbangan

Pasal 16

1) Penetapan status jemaah


tidaklaikterbangdituangkandalamberitaacarakelaikanterbangditandatanganiolehketua PPIH
embarkasikesehatan
2) Beritaacarakelaikanterbangtercantumdalamformulir II terlampir
3) Beritaacarakelaikanterbangdisampaikanketua PPIH embarkasikesehatankepadaketua PPIH
embarkasi

BAB III

PEMBINAAN DALAM RANGKA ISTITHAAH KESEHATAN JEMAAH HAJI

Pasal 17

1) Pembinaankesehatandilakukanberdasarkanhasilpemeriksaankesehatan jemaah
2) Pembinaankesehatanmerupakanupayauntukistithaahkesehatan jemaah
3) Jenisdanmetodepembinaan : penyuluhan, konseling, latihankebugaran, posbindu, media
massa, kunjunganrumah, manasikkesehatan

Pasal 18

1) Berdasarkanperiode, pembinaanistithaahkesehatanterdiriatas:
a. Pembinaanistithaahkesehatanmasatunggu
b. Pembinaanistithaahkesehatanmasakeberangkatan
2) Pembinaanistithaahkesehatanterintegrasidengan program kesehatankab/kota
:keluargasehat,posbindupenyakittdkmenular, posyandulansiadll
3) Pembinaanistithaahkesehatanmelibatkanorganisasiprofesi/masyarakat

Pasal 19

1) Pembinaanistithaahmasatunggudilakukanterhadapseluruh jemaah
ygtelahmendapatnomorporsi
2) Pembinaandisesuaikandenganhasilpemeriksaankesehatan

Pasal 20

1) Pembinaanmasakeberangkatandilakukanterhadap jemaah
ygakanberangkatpadatahunberjalan
2) Jemaah denganpembinaanmasakeberangkatan :
a. Memenuhisyaratistithaahkesehatan haji
b. Memenuhisyaratistithaahkesehatandenganpendampingan
c. Tidakmemenuhisyaratistithaahkesehatansementara

BAB IV
KETENTUAN LAIN-LAIN
Pasal 21

Pemeriksaandanpembinaandalamrangkaistithaahkesehatandilaksanakansesuaistandarteknispe
meriksaandanpembinaankesehatan haji ygditetapkanolehmenteri

BAB V

PENCATATAN DAN PELAPORAN

Pasal 22

1) Setiappemeriksaandanpembinaandalamrangkaistithaahkesehatan jemaah
harusdilaporkansecaraberjenjangolehtimpenyelenggarakesehatan haji
2) Laporandilaksanakandenganmenggunakan system informasikesehatan haji

BAB VI
KOORDINASI, JEJARING KERJA, DAN KEMITRAAN
Pasal 23

1) Dalamrangkaistithaahkesehatan, dibangundandikembangkankoordinasi, jejaringkerja,


kemitraanantarinstansipemerintahdanpemangkukepentingan di pusat, provinsi, kab/kota.
2) Koordinasi, jejaringkerja, kemitraandiarahkanuntuk :
a. Identifikasi, pencatatan, pelaporanmasalahkesehatanterkaitistithaah jemaah
b. Peningkatandanpengembangankapasitasteknisdanmanajemen SDM
c. Keberhasilanpelaksanaanpemeriksaandanpembinaankesehatan jemaah haji

BAB VII
PEMBINAAN DAN PENGAWASAN
Pasal 24

Pembinaandanpengawasanterhadapperaturanmenteridilaksanakansecaraberjenjangolehmenteri,
kepaladinaskesehatanpropinsi, kepaladinaskesehatankab/kota

Pasal 25

Peraturanmenteriiniberlakupadatanggaldiundangkan

Ditetapkan di Jakarta
Padatanggal 23 Maret 2016

MENTERI KESEHATAN REPUBLIK INDONESIA

NILA FARID MOELOEK

Diundangkan di Jakarta
Padatanggal 11 april 2016

DIREKTUR JENDERAL
PERATURAN PERUNDANG-UNDANGAN DAN HAK ASASI MANUSIA
REPUBLIK INDONESIA

WIDODO EKATJAHJANA

BERITA NEGARA REPUBLIK INDONESIA TAHUN 2016 NOMOR 550


MENTERI KESEHATAN
REPUBLIK INDONESIA

PERATURAN MENTERI KESEHATAN REPUBLIK INDONESIA

NOMOR 62 TAHUN 2016

TENTANG

PENYELENGGARAAN KESEHATAN HAJI

DENGAN RAHMAT TUHAN YANG MAHA ESA

MENTERI KESEHATAN REPUBLIK INDONESIA

Menimbang : a Bahwa dalam rangka mendukung kesehatan jemaah haji dst …


b Bahwa pengaturan mengenai penyelenggaraan kesehatan haji
dst…
c Bahwa berdasarkan pertimbangan sebagaimana dimaksud dst…

Mengingat : 1 Undang-undang Nomor 2 tahun 1962 tentang karantina


udara, dst…sampai Nomor 28
MEMUTUSKAN :

Menetapkan : PERATURAN MENTERI KESEHATAN TENTANG PENYELENGGARAAN

KESEHATAN HAJI

BAB I

KETENTUAN UMUM

Pasal 1

Dalam peraturan menteri ini yg dimaksud :

1) Jemaah haji adalah : WNI, islam, dan telah mendaftar haji


2) Penyelenggaraan kesehatan haji : pembinaan , pelayanan, perlindungan kesehatan
3) Pembinaan kesehatan : upaya kesehatan dalam bentuk promotif preventif kepada jemaah
4) Pelayanan kesehatan : upaya kesehatan dalam bentuk kuratif rehabilitative kepada jemaah
5) Perlindungan kesehatan : upaya kesehatan dalam bentuk tanggap cepat dan perlindungan
spesifik kepada jemaah
6) Embarkasi adalah tempat pemberangkatan dan keberangkatan jemaah haji
7) Debarkasi adalah tempat kedatangan jemaah haji dari arab Saudi
8) System informasi kesehatan haji adalah pengelolaan data dan informasi kesehatan haji
9) System komputerisasi haji terpadu kesehatan (siskohatkes) adalah perangkat keras dan
perangkat lunak yg berguna untuk pengelolaan data kesehatan haji
10) Rumah sakit rujukan adalah rumah sakit tempat perawatan lanjutan kasus tertentu
11) BPJS kesehatan adalah badan hukum yg dibentuk untuk menyelenggarakan program
jaminan nasional
12) Istithaah kesehatan haji adalah kemampuan secara fisik, mental yg terukur dengan
pemeriksaan yg dapat dipertanggung jawabkan
13) TKHI adalah tim kesehatan yg bertugas memberikan pembinaan, pelayanan, perlindungan
kesehatan di kloter
14) PPIH kesehatan arab Saudi adalah tenaga kesehatan yg ditugaskan melakukan pembinaan,
pelayanan, perlindungan jemaah di sector, daker dan KKHI
15) PPIH embarkasi/debarkasi kesehatan adalah tenaga kesehatan yg ditugaskaan melakukan
pembinaan, pelayan, perlindungan jemaah di embarkasi/debarkasi
16) TPK adalah tenaga pendukung kesehatan haji di arab Saudi
17) PIHK adalah biro perjalananyg mendapat izin melakukan ibadah haji khusus
18) Dokter PIHK : dokter yg memberikan pelayanan jemaah PIHK
19) Manasik kesehatan : pemberian informasi yg bersifat promotif preventif kepada jemaah
20) Kloter adalah sejumlah jemaah haji yg dikelompokkan berdasarkan kelompok penerbangan
21) Sector adalah satuan lokasi yg terdiri dari beberapa pondokan jemaah
22) KKHI adalah klinik kesehatan untuk melayani jemaah haji Indonesia
23) Pos kesehatan satelit adalah fasyankes untuk mempermudah aksebilitas jemaah Indonesia
24) Evakuasi jemaah adalah pemindahan jemaah dari satu lokasi ke lokasi lainnya
25) Muassasah adalah organisasi yg memberikan pelayanan akomodasi, transportasi,
pelayanan umum dan kesehatan bagi jemaah haji di arab Saudi
26) Safari wukuf adalah perjalanan jemaah sakit saat prosesi wukuf berlangsung
27) Menteri adalah menteri di bidang kesehatan

Pasal 2

Penyelenggaran kesehatan haji bertujuan untuk :

a. Mencapai kondisi istithaah kesehatan jemaah haji


b. Mengendalikan factor resiko kesehatan haji
c. Menjaga jemaah dalam kondisi sehat selama di Indonesia dan arab Saudi
d. Mencegah transmisi penyakit yg mungkin terbawa keluar/masuk oleh jemaah
e. Memaksimalkan peran masyarakat dala penyelenggaraan kesehatan haji

Pasal 3

1) Penyelenggaraan kesehatan haji dilaksanakan dalam bentuk:


a. Pembinaan , pelayanan, perlindungan kesehatan haji
2) Penyelenggaraan kesehatan haji dilaksanakan di Indonesia dan arab Saudi
3) Diselenggarakan oleh pemerintah dan peran serta masyarakat secara terpdu dan
terstruktur

BAB II

PEMBINAAN KESEHATAN HAJI

Pasal 4

1) Pembinaan kesehatan haji diselenggarakan melalui kegiatan promotif preventif dimulai saat
jemaah mendaftar sampai kembali ke Indonesia
2) Pembinaan kesehatan terintegrasi dengan program promkes, pengendalian penyakit
menular dan tidak menular, kesling, kes.jiwa dll
3) Pembinaan kesehatan melibatkan lintas program, lintas sector dan masyarakat

Pasal 5
1) Pembinaan kesehatan haji di Indonesia :masa tunggu, masa keberangkatan, kepulangan
2) Pembinaan masa tunggu dan keberangkatan untuk mendukung istithaah kesehatan haji
3) Pembinaan masa tunggu : penyuluhan , konseling, peningkatan kebugaran dll
4) Pembinaan masa keberangkatan : penyuluhan, konseling, manasik kesehatan, dll
5) Pembinaan masa kepulangan : kunjungan rumah, pemanfaatan media massa, dll
6) Pembinaan masa kepulangan : dilaksanakan 14 hari sejak jemaah tiba di tanah air

Pasal 6

1) Pembinaan kesehatan haji : dilaksanakan di kab/kota, perjalanan, embarkasi/debarkasi


2) Pembinaan kesehatan di kab/kota : tanggung jawab penyelenggara haji di kab/kota
3) Pembinaan kesehatandi embarkasi/debarkasi : dilaksanakan oleh PPIH
embarkasi/debarkasi kesehatan

Pasal 7

1) Pembinaan kesehatan di arab : diselenggarakan di KKHI, sector dan fasilitas lain


2) Pembinaan kesehatan di arab : dilaksanakan oleh TKHI, PPIH kesehatan & TPK
3) Pembinaan kesehatan : dilaksanakan dalam bentuk deteksi dini, penyuluhan, pemberia
poster kepada jemaah dll.

Pasal 8

Pembinaan kesehatan haji dilaksanakan sesuai peraturan perundang-undangan

BAB III
PELAYANAN KESEHATAN HAJI
Bagian Kesatu
Umum
Pasal 9

1) Pelayanan kesehatan dilaksanakan di Indonesia dan arab Saudi


2) Setiap jemaah haji wajib memiliki jaminan perlindungan/asuransi kesehatan
3) Sebagai peserta JKN, jemaah memperoleh pelayanan kesehatan komprehensif

Bagian Kedua
Pelayanan Kesehatan Haji di Indonesia
Paragraf 1
Umum
pasal 10

Pelayanan kesehatan haji di Indonesia diselenggarakan di :

a. Puskesmas/klinik
b. Rumah sakit di kab/kota
c. Perjalanan
d. Embarkasi/debarkasi
e. Rumah Sakit rujukan

Pasal 11

1) Pelayanan kesehatan haji di puskesmas dan RS mengikuti system pelayanan kesehatan


sesuai peraturan
2) RS di kab/kota adalah RS pemerintah maupun swasta
3) Klinik dan RS swasta penyelenggara kesehatan haji ditetapkan oleh menteri

Paragraf 2
Pelayanan Kesehatan Haji di Perjalanan
Pasal 12
4) Dilaksanakan dalam bentuk : pertolongan pertama dan rujukan
5) Meliputi perjalanan : daerah asal ke asrama haji dan sebaliknya dan asrama haji ke
bandara dan sebaliknya
6) Pelayanan kesehatan di perjlanan dilaksanakan oleh pemda dimana jemaah berasal
7) Pelayanan kesehatan di embarkasi/debarkasi dilaksanakan oeh PPIH embarkasi/debarkasi
kesehatan

Pasal 13

1) Rujukan dilaksanakan dalam hal jemaah sakit dan buth pertolongan medis lanjutan
2) Rujukan dilaksanakan ke klinik atau RS terdekat
3) Jika Jemaah adalah peserta JKN maka rujukan di RS rujukan yg bekerjasama BPJS kes

Paragraf 3
Pelayanan Kesehatan Haji di Embarkasi/Debarkasi
Pasal 14

Pelayanan kesehatan haji di embrakasi/debarkasi meliputi :

a Pemeriksaan kesehatan e Pelayanan rujukan


b Pelayanan rawat jalan f Pelaksanaan kekarantinaan kesehatan
c Pelayanan rawat darurat g Penanganan jemaah haji wafat dipesawat
d Pemeriksaan laboratorium dan penunjang

Pasal 15

1) Pemeriksaan kesehatan di embarkasi/debarkasi : laik terbang atau tdk laik terbang


2) Penilaian istithaah di embarkasi : jemaah haji tertentu yg berpotensi tdk memenuhi syarat
istithaah kesehatan
3) Penilaian syarat istithaah dilaksanakan sesuai peraturan perundang-undangan

Pasal 16

Pelayanan rawat darurat di berikan di lapangan maupun fasyankes lingkup kewenangan PPIH
embarkasi kesehatan

Pasal 17

Pemeriksaan lab dan penunjang untuk penegakan diagnose berdasarkan indikasi medis

Pasal 18

1) Pelayanan rujukan di embarkasi/debarkasi karena sakit atau utk penegakan diagnostic


2) Rujukan di embarkasi ke RS rujukan yg ditetapkan oleh peraturan perundang2an
3) Rujukan bagi peserta JKN, klinik embarkasi dapat membentuk klinik yg berafiliasi dg JKN

Pasal 19

Pelaksanaan kekarantinaan kesehatan dilaksanakan sesuai peraturan perundangan

Pasal 20

1) Penanganan jemaah wafat meliputi penetapan penyebab wafat dan identifikasi potensi
penyebab wafat
2) Potensi penyebab wafat dapat disebabkan penyakit menular/wabah serta keracunan
3) Data penanganan jemaah wafat digunakan sebagai pelengkap data pengiriman jemaah
wafat ke Rumah sakit
Paragraph 4

Pelayanan kesehatan haji di rumah sakit rujukan

Pasal 21

1) Pelayanan kesehatan haji di Rumah Sakit Rujukan :


a Pelayanan rawat darurat f Pelayanan mobil jenazah
b Pelayanan rawat jalan g Pelayanan penunjang medik
c Pelayanan rawat inap h Pelayanan intensif
d Pelayanan tind medic operatif i Pelayanan rujukan dan evakuasi
e Pelayanan darah
2) Rumah sakit rujukan : pemerintah atau swasta yg ditetapkan oleh menteri

Pasal 22

Rumah sakit rujukan harus menyampaikan kondisi pasien kepada ketua PPIH embarkasi/
debarkasi kesehatan

Bagian Ketiga

Pelayanan kesehatan haji di arab Saudi

Pasal 23

1) Pelayanan kesehatan di arab Saudi :


a Penanganan kegawat daruratan e evakuasi
b Rawat jalan f Safari wukuf jemaah sakit
c Rawat inap g Pemulangan jemaah haji sakit
d Rujukan

2) Diselenggarakan di : perjalanan, kloter/sector, pos satelit, KKHI, armina


3) Dilakukan oleh : TKHI, PPIH kesehatan, TPK, dan tenaga lainnya
4) Rujukan dapat diakukan di RS arab Saudi

Bagian Keempat

Pelayanan kesehatan haji pasca operasional

Pasal 24

1) Jemaah dari RSAS yg dipulangkan ke Indonesi, memerlukan perawatan, dapat dirujuk ke


Rs rujukan
2) KKP berwenang dalam rujukan jemaah sakit
3) Dokter KKP bertanggung jawab atas penilaian kondisi jemaah setiba di bandara
4) Rujukan jemaah ditentukan dokter KKP dengan pertimbangan surat keterangan RSAS da
kondisi jemaah

Pasal 25

Dokter KKP berwenang menilai transportabilitas jemaah sakit untuk penerbangan ke daerah
asal dan merekomendasikan penanganan selama penerbangan

Pasal 26

KKP yang memiliki wilayah kerja tempat jemaah mendarat melakukan koordinasi dengan KKP
asal jemaah haji

Pasal 27
1) Pemerintah bertanggung jawab terhadap pelayanan kesehatan jemaah hingga masa haji
selesai
2) Pelayanan diberikan: monitoring kemajuan, konsultasi medis, pelaporan,evakuasi
3) Evakuasi medic dilakukan sesuai peraturan perundang-undangan

BAB IV
PERLINDUNGAN KESEHATAN HAJI
Bagia Kesatu
Umum
Pasal 28

1) Perlindungan kesehatan haji dilaksanakan di Indonesian dan Arab Saudi


2) Perlindungan kesehatan dilaksanakan dalam bentuk:
a Perlindungan spesifik d Visitasi jemaah haji sakit
b Penyelenggaraan kesling e Penyelenggaraan kewaspadaan dini dan
KLB/kedaruratan kes.masy yg meresahkan/KKMD
c Penyelenggaraan gizi f Penanggulangan krisis kesehatan

Bagian Kedua
Perlindungan spesifik
Pasal 29

1) Perlindungan spesifik : upaya mencegah terjadinya penyakit tertentu kepada jemaah


2) Perlindungan spesifik: vaksinasi dan penyediaan APD

Pasal 30

1) Vaksinasi dilakukan di Indonesia


2) Vaksinasi : yang diwajibkan dan yang disarankan
3) Vaksinasi diwajibkan dilaksanakan di puskesmas/RS yg ditunjuk oleh DinKes setempat
4) Vaksinasi disarankan :pilihan jemaah dilaksanakan di puskesmas atau RS/klinik
5) Jemaah yg telah vaksin mendapat sertifikat vaksin internasional
6) Vaksinasi dan pemberian sertifikat dilaksanakan sesuai peraturan

Bagian Ketiga
Penyelenggaraan kesehatan lingkungan
Paragraph 1
Umum
Pasal 31

1) Penyelenggaraan kesling dilaksanakan di Indonesia dan Arab Saudi


2) Penyelenggaran kesling dengan cara inspeksi kesling dan intervensi kesling
3) Inspeksi kesling : pemeriksaan dan pengamatan langsung media lingkungan berdasar
standar, norma dan baku mutu yg berlaku
4) Intervensi kesling :
a Komunikasi, informasi, edukasi c Pengembangan teknologi tepat guna
b Perbaikan dan pembangunan sarana d Rekayasa lingkungan
5) Media lingkungan : air, udara, pangan, tanah, sarana bangunan, vector penyakit
6) Penentuan hasil inspeksi kesling dilakukan : pengamatan fisik dan pengukuran media
lingkungan, uji laboratorium dan analisa resiko kesling

Paragraph 2
Penyelenggaraan kesehatan lingkungan di Indonesia
Pasal 32

1) Penyelenggaraan kesling di Indonesia dilaksanakan di : asrama haji, pesawat, catering


2) Kesling di asrama haji dan catering dilakukan melalui kegiatan :
a. Tahap 1 : inspeksi kesling 6 bulan sebelum jemaah masuk asrama haji
b. Tahap 2 : inspeksi dan intervensi kesling 1 minggu sebelum jemaah masuk asrama
c. Tahap 3 : inspeksi dan intervensi kesling rutin saat jemaah berada di asrama haji
3) Kesling pada catering berkoordinasi dg KKP, BTKL, DinKes prov dan Kemenag
4) Kesling di pesawat dilakukan dg inspeksi dan intervensi kesling

Paragraph 3
Penyelenggaraan kesehatan lingkungan di Arab Saudi
Pasal 33

1) Kesling di Arab Saudi dilaksanakan di : pondokan jemaah, Fasyankes, catering


2) Fasyankes : KKHI, sector, pos satelit
3) Juga dilaksanakan di tempat yg berpotensi menimbulkan resiko kesehatan jemaah

Pasal 34

1) Penyelenggaraan kesling di arab Saudi dilakukan melalui :


a. Inspeksi kesling : memberikan masukan kriteria pondokan dan catering yg memenuhi
standar kesehatan bagi jemaah
b. Inspeksi kesling : pondokan dan catering selama jemaah haji
c. Itervensi kesling : pemberian rekomendasi kepada PPIH urusan perumahan dan
catering

Pasal 35

Penyelenggaraan kesling dilaksanakan sesuai peraturan yg berlaku

Bagian keempat
Penyelenggaraan Gizi
Pasal 36

Penyelenggaran Gizi dilakukan melalui :

a. Rekomendasi kepada Kemenag tentang standar menu dan gizi bagi jemaah dan petugas
selama di embarkasi
b. Pengawasan mutu makanan jemaah di embarkasi dan Arab Saudi
c. Pemberia makanan pada jemaah haji sakit
Bagian kelima
Visitasi jemaah haji sakit
Pasal 37
1) Visitasi jemaah sakit diselenggarakan di RS arab Saudi
2) Visitasi dilakukan oleh : PPIH, TKHI, TPK
Bagian Keenam
Penyelenggaraan system kewaspadaan Dini dan penanggulangan KLB/kedaruratan
kesehatan masyarakat yg meresahkan dunia
Pasal 38
1) Penyelenggaraan system kewaspadan yg meresahkan dilaksanakan di Indonesia dan Arab
Saudi
2) Dilaksanakan sesuai peraturan perundangan yang berlaku
Bagian Ketujuh
Penanggulangan krisi jemaah haji
Pasal 39
1) Sebagai upaya perlindungan terhadap jemaah haji saat di Indonesia dan arab Saudi
2) Dilaksanakan sesuai ketentuan yg berlaku

BAB V
SURVEILANS KESEHATAN HAJI
Pasal 40
1) Dilakukan dg cara pengumpulan, pengolahan, analisa, interpretasi dan diseminasi informasi
terhadap kejadian penyakit atau kondisi yg mempengaruhi kesehatan jemaah
2) Dilksanakan selama di Indonesia dan arab Saudi
3) Sebagai bahan evaluasi dan dasar perbaikan/kebijakan kesehatan haji

Pasal 41

1) Surveilans di Indonesia melalui data : pemeriksaan kesehatan 1,2,3 dari puskesmas, klinik,
RS dan embarkasi, hasil pembinaan kesehatan, factor resiko kesling embarkasi/debarkasi,
pengawasan alat angkut orang dan barang, informasi dari BKJH dan K3JH
2) Surveilans di Arab Saudi melalui data : jemaah sakit di fasyankes, pengamatan penyakit,
potensi KLB, factor resiko kesehatan, penyebab jemaah wafat

Pasal 42

Surveilans kesehatan haji dilaksanakan sesuai peraturan perundangan

BAB VI
PEMBERDAYAAN MASYARAKAT
Bagian kesatu
Umum
Pasal 43

Pemberdayaan masyarakat dalam kesehatan haji dengan melibatkan organisasi masyarakat,


akademisi dan sector swasta

Bagian Kedua
Kemitraan pemerintah-swasta (Publik-private MIX)
Pasal 44

1) Untuk penguatan kesehatan haji, pemerintah melibatkan klinik/RS swasta melalui


kemitraan pemerintah
2) Klinik/RS yg dimaksud bekerjasama dengan BPJS kesehatan
3) Menteri menetapkan klinik/RS swasta yg menjadi mitra pemerintah
4) Kemitraan pemerintah dan swasta dituangkan dalam perjanjian kerjasama
5) Klinik/RS swasta wajib berkoordinasi dengan pemda setempat
6) Klinik/RS swasta wajib melaksanaka system integrasi dan info ksehatan haji
7) Kemitraan tersebut dilaksanakan di Di Arab Saudi

BAB VII
PENGUATAN MANAJEMEN PENYELENGGARAN KESEHATAN HAJI
Bagian Kesatu
Umum
Pasal 45

1) Untuk mencapai pembinaan, pelayanan, perlindungan perlu penguatan manajemen


penyelenggaraan kesehatan haji
2) Penguatan manajemen dilaksanakan melalui :
a. Peningkatan kapasitas sumber daya manusia
b. Pengembangan system informasi kesehatan
c. Koordinasi dan pengelolaan teknis penunjang kesehatan haji di Arab Saudi

Bagian kedua
Peningkatan kapasitas Sumber daya Manusia
Pasal 46
1) Ditujukan untuk meningkatkan pengetahuan, keterampilan dan SDM dalam
penyelenggaraan kesehatan haji
2) Meningkatkan SDM yg diselenggarakan oleh pemda dan organisasi
Bagian ketiga
Pengembangan system informaasi kesehatan haji
Pasal 47
1) Dilakukan untuk mendukung pelaksanaan surveilans pada kesehatan haji
2) Diselenggarakan melalui siskohatkes terintegrasi kab/kota, prov/pusat
3) Dilaksanakan di Indonesia dan Arab Saudi
Bagian Keempat
Koordinasi dan pengelolaan teknis penunjang penyelenggaraan kesehatan haji di arab Saudi
Pasal 48
1) Dilaksanakan sejak sebelum, saat dan sesudah operasional haji
2) Dilakukan dengan pihak KJRI di Jeddah, KUH, dan muassasah
3) Pengelolaan teknis penunjang sebelum masa operasional meliputi :
a Persiapan fasilitas f Visitasi dan pemulangan
b Persiapan obat dan perbekkes g Pembekalan tenaga pendukung
c Kalibrasi alat h Penatausahaan BMN
d Penyiaoan catering petugas dan jemaah i Monev penyusunan program kes di arab
e Penyiapan siskohat
4) Pengelolaan teknis penunjang sesudah masa operasional meliputi :
a Stok opname obat dan perbekkes d Evaluasi siskohatkes
b Penyimpanan alat e Penatausahaan BMN
c Evaluasi katering f Pemantauan jemaah sakit yg dirawat di
RSAS

BAB VIII
PENELITIAN DAN PENGEMBANGAN
Pasal 49
1) Dalam rangka peningkatan kualitas kes haji dilakukan litbang
2) Diselenggarakan dengan melibatkan lintas sector dan lintas program dan kerjasama dg
akreditasi di dalam dan luarnegeri
BAB IX
KOMITE AHLI KESEHATAN HAJI
Pasal 50
1) Menteri dapat membentuk komite ahli kes haji
2) Terdiri dari para ahli yg memiliki kompetensi dalam peningkatan penyelenggaran kes haji
3) Bertugas antara lain : merumuskan kebijakan tekis terkait pembinaan, pelayanan da
perlindungan kes haji
4) Komite ditetapkan oleh menteri

BAB X
PENGORGANISASIAN
Bagian Kesatu
Umum
Pasal 51

1) Dibentuk penyelenggara kesehatan haji


2) Penyelenggara kesehatan terdiri dari : penyelenggara di Indonesia dan arab Saudi
3) Penyelenggara kes di Indonesia terdiri : penyelenggara kes kab/kota, prov, PPIH,
embarkasi/debarkasi
4) Penyelenggara arab Saudi : TKHI, PPIH kes, TPK, tenaga administrasi local dan tim asistensi

Pasal 52

1) PIHK wajib melaksanakan penyelenggaraan kes sesuai standar secara mandiri


2) PIHK merupakan bagian dari system kes haji Indonesia
3) PIHK wajib menyediakan dokter PIHK
4) Dokter PIHK wajib mengikuti pembinaan, pelayanan, prlindungan kes haji
5) PIHK wajib mengikuti pelatihan penyelenggaraan kes haji

Bagian Kedua
Penyelenggara kesehatan di Indonesia
Paragraph 1
Penyelenggara kesehatan haji kab/kota
Pasal 53
1) Bertanggung jawab melaksanakan :
a Pembinaan, pelayanan, perlindungan d Menyediakan perbekkes dan transportasi
kes haji di wilayahnya kes haji
b Menyiapkan dan meningkatkan sarana e Pengamatan penyakit potensi wabah
dan prasarana kes haji
c Meningkatkan SDM kes haji f Membuat laporan kes haji kepada DinKes
2) Membentuk tim penyelenggara kesehatan haji
3) Terdiri dari puskesmas/RS, surveilans, promkes, kes keluarga, kesling, gizi, kebugaran
jasmani, pelkes,dan pengendalian peny. Menular
4) Terdiri dari dokter, dokter spesialis, farmasi, perawat, analis, gizi, sanitarian, epidemolog,
RM, dll
Paragraph 2
Penyelenggara kesehatan haji provinsi
Pasal 54
1) Bertanggung jawab meaksanakan :
a Pembinaan, pelayanan, perlindungan e Peningkatan SDM
kes haji
b Mengkoordinir distribusi vaksin f Melakukan monev
c Monev g Pengamatan peny potensi wabah
d Proses rekrutmen TKHI h Menyampaikan laporan ke menkes

2) Provinsi membentuk Tim penyelenggara kes haji


3) Terdiri dari : promkes, surveilas, keskel, kesling, gizi,dll
Paragraph 3
Panitia penyelenggara ibadah haji bidang kesehatan embarkasi/debarkasi
Pasal 55
1) Menteri membentuk PPIH keseatan embarkasi/debarkasi
2) Bertugas memberikan :
a Pembimbingan dan penyuluhan kes i Pengawasan katering
b Pemerikaan kes embarkasi/debarkasi j Pengamatan penyakit
c Penanganan jemaah wafat k Pengendalian vektor
d Rujukan jemaah sakit l Cegah tangkal potensi wabah
e Evakuasi jemaah sakit m Respon dan penanggulangan KLB
f Penyediaan sarana da prasarana n Respon dan penanggulangan KKMD
g Penyediaan perbekkes dan obat o Respon krisis
h Pengendalian factor resiko lingkunga
3) Terdiri dari : dokter, dokter spesialis, drg dan tenaga lainnya
4) Terdiri dari : KKP, DinKes prov, Dinkes kab/kota, RS, penerbangan dan organisasi profesi
5) Dikoordinasi oleh kemenkes melalui KKP
6) PPIH dimobilisasi penugasannya sesuai kebutuhan

Paragaraf 4
TKHI
Pasal 56
1) Menteri membentuk TKHI
2) Bertugas memberikan pembinaan, perlindungan dan pelayanan jemaah di kloter
3) Terdiri dari dokter dan perawat
4) TKHI di mobilisasi penugasannya sesuai kebutuhan
Bagian Ketiga
Penyelenggarakesehatan haji di arab Saudi
Paragraph 1
PPIH arab Saudi bidang kesehatan
Pasal 5
1) Menteri membentuk PPIH arab Saudi
2) Bertugas memberikan binyandun kepada jemaah
3) PPIH terdiri dari : dokter spesilis, dokter, drg, dll
4) PPIH bertugas : daker mekkah, Jeddah, madinah, armina dan bandara
5) Terdiri dari : tim manajerial, asistensi, TPP, TKR, TGC
6) PPIH arab Saudi bekerja di sector, KKHI serta tempat lain sesuai kebutuhan
7) PPIH arab Saudi dapat dimobilisasi sesuai kebutuhan
Paragraph 2
Tenaga pendukung kesehatan
Pasal 58
1) Menteri mengangkat TPK
2) TPK berasal dari WNI atau WNA yg bekerja dan belajar di arab Saudi
3) TPK tefdiri atas tenaga penghubung RS, POS, petugas kebersihan, pengantar obat, evakuasi
dll
4) TPK diberikan pembekalan pengetahuan dan keteramilan
5) TPK dimobilisasi sesuai kebutuhan
Paragraph 3
Tenaga administrasi local
Pasal 59
1) Menteri mengangkat TAL
2) TAL berasal dari WNI yg berdomisili di arab Saudi
3) TAL memiliki kemampuan bahasa Indonesia dan bahasa arab
4) TAL membantu :
a Mengelola administrasi dan info terkait e Pemeliharaan kendaraan operasional
kes haji
b Pemeliharaan sarana f Penatausahaaan BMN
c Membantu penghubung nstitusi lembaga g Pemantauan dan pemulangan jemaah
Indonesia di Arab dan mitra sakit
d Pemeliharaan perbekkes H Tugas lain sesuai kebutuhan
Paragraph 4
Tim asistensi penyelenggaraan kesehatan haji
Pasal 60
1) Dibentuk untuk memperkuat PPIH arab Saudi kesehatan
2) Terdiri dari : unsur pimpinan di lingkup kemenkes dan tenaga professional
3) Bertugas memberikan masukan dlm rngka penguatan binyandun kes haji arab Saudi
4) Ditetapkan oleh menteri
BAB X
KOORDINASI, JEJERAING KERJA, KEMITRAAN
Pasal 61
1) Pemerintah, pemda, prov dan kab/kota dan organisasi masyarakat membangun koordinasi
jejaring kerja dan kemitraan
2) Diarahkan untuk mempercepat keberhasilan penyelenggaraan melalui :
Pengembangan kapasitas manajemen teknis SDM dan pengembangan inovasi
BAB XI
PENCATATAN DAN PELAPORAN
Pasal 62
1) Pencatatan pelaporan dilakukan secara berjenjang
2) Dilakukan kedaam BKJH dan terintegrasi dengan siskohatkes
3) Disusun oleh tim penyelenggara kes haji kab/kota dilaporkan ke dinkes prov
4) Dilaporkan kepada menteri melalui atker di kemenkes
5) Dibuat oleh PPIH embarkasi/debarkasi selanjutnya dilaporkan ke menteri melalui puskes
6) Laporan secara berjenjang melalui kloter, sector, daker selanjutnya ke menteri
BAB XII
MONITORING DAN EVALUASI
Pasal 63
1) Dilaksanakan oleh penyelenggarakes haji secara berjenjang
2) Dapat melibatkan lintas psektor dan program, organisasi profesi dan masyarakat
BAB XIII
PEMBINAAN DAN PENGAWASAN
Pasal 64
1) Pemerintah melakukan pembinaan dan pengawasan terhadap penyelenggara kes haji
2) Diarahkan untuk :
a. Penguatan program penyelenggaraan kes haji di kab/kota, prov, embarkasi/debarkasi
dan arab Saudi
b. Peningkatan kualitas yanbindun
BAB XIV
PEMBIAYAAN
Pasal 65
Bersumber dari APBN< APBD dan sumber lain yg dianggap sah
Pasal 66
1) Dapat dilakukan melalui mekanisme program JKN
2) Jemaah yg bukan peserta JKN dapat mengikuti mekanisme asuransi kesehatan yg dimiliki
3) Pembiayaan yan kes haji yg timbul akibat keadaan khusus ditanggung oleh pemerintah dan
pemerintah pusat
4) Meliputi kondisi KLB, KKMB, dan keadaan krisis atau bencana
BAB XV
PENUTUP
Pasal 67
Pada saat pearturan menteri ini mulai berlaku maka :
1) Kepmenkes no.442/menkes/SK/VI/2009 dst
2) Permenkes no.2407 tahun 2011 dst

Dicabut dan dinyatakan tidak berlaku

Pasal 68

Peraturan menteri ini mulai berlaku pada tgl diundangkan

Ditetapkan di Jakarta, 18 nov 2016

Ttd

Menteri kesehatan RI

Nila Farid Moeloek


Dokumentasipenyuluhankepadajemaah :
Daftarhadirpenyuluhankepadajemaah :
Lampiran3 :Pembinaan jemaah haji Resti

NO NAMA JEMAAH UMUR J.KELAMIN J.PENYAKIT J.RESTI MATERI & SARAN

1 HadinaBintimafiase 54 thn Perempuan  Hipertensi Merah  Penyuluhankesehatan (factor Diet)


 Dyslipidemia  PHBS
 Pemeriksaanfisik

2 SittihamidabintiNuhan 77thn perempuan  hipertensi Merah  Penyuluhankesehatan (factor diet


 Senility danpembatasanaktifitas)

3 Nursaleh S bin tambih 83thn Laki-laki  Cardiomegaly Merah  PHBS


 Senilyti  Penyuluhankesehatan
 Istirahatcukup
4 Drs.Suaib beta 72thn Laki-laki  Hipertensi Merah  penyuluhankesehatan
 Kardiomegaly  PHBS
 Old  Pembatasanaktifitas
miokardinfark  Jaga diet
 senilyti

5 Patimasangbintilasalang 84 thn perempuan  kardiomegaly Merah  penyuluhankesehatan


 senilyti  aturpolamakandan diet
 pembatasanaktifitas
Dokumentasipembinaankepada jemaah haji Resti :
Lampiran4 :Pemeriksaan kesehatan kepada jemaah haji

NO NAMA JEMAAH UMUR HASIL PEM.KESEHATAN KATEGORI JEMAAH


RESTI ISTITHAAH
1 Patimasangbintilasalang 84 TD = 150/90 Nadi = 88 x/mnt Merah Istithaahdenganpenda
THN P = 24 x/mnt mpingan
Lab :
Hb : 11 gr % LED : 8/jam
LDL : 230 mg/dlAs.Urat : 9,8
Thorax : Kardiomegaly
2 Idaliabintilanasire 75thn TD = 130/70 Nadi = 80 x/mnt Merah Istithaah/Mandiri
P = 18 x/mnt S = 36,5
Lab :
GDS ; 350 mg/dl Hb : 10,0
3 Ammasabintipasandi 55 thn TD = 160/80 Nadi = 88 x/mnt Kuning Istithaah/mandiri
P = 18 x/mnt S = 36,2
Lab :
Hb : 12,3
4 Drs. Muh.Alwi 67thn TD = 100/70 Nadi = 80 x/mnt hijau Istithaah/Mandiri
P = 18 x/mnt S = 36
5 Drs. Suaib beta 72thn TD = 160/100 Nadi = 88 x/mnt Merah Istithaah/mandiri
P = 18 x/mnt S = 36,6
Lab :
Hb : 16 LDL = 240 mg/dl
Thorax ; Kardiomegaly
6 Nursalehsabutung bin 83thn TD = 180/90 Nadi = 80 x/mnt Putih Mandiri/istithaah
tambih P = 26 x/mnt S = 36,5
Lab :
Hb : 9,0
Thorax : kardiomegaly
7 SittihamidahbtNuhan 51 thn TD = 130/90 Nadi = 76 x/mnt Hijau Istithaah/Mandiri
P = 20 x/mnt S = 36,5
Lab :
GDS = 112 mg/dl Hb : 12 gr %
8 Jumriahbitimunding 51thn TD = 130/80 N = 72 x/mnt Kuning Istithaah/mandiri
P = 22 x/mnt S = 36
Lab :
GDS = 260 Hb : 14
9 Madong bin dangu 72thn TD = 160/90 N = 78 x/mnt Merah Istithaah /mandiri
P = 20 x/mnt S = 36
10 Darnibintiharis 39thn TD = 100/70 N = 74 x/mnt Kuning Istithaah/mandiri
P = 18 x/mnt S = 36
Lab :
GDS : 310 mg/dl
11 Norma Azisbintiraden 67 thn TD = 150/100 N = 72 x/mnt Merah Istithaah/mandiri
P = 18 x/mnt S = 36
Lab :
GDS : 107
12 Dg.gassing Bin dg.musi 60 thn TD = 150/100 N = 84 x/mnt Merah Istithaah/mandiri
P = 20 x/mntS = 36
Lab : GDS = 100
Thorax : Kardiomegaly
13 Naisabintinojeng 50 thn TD = 150/100 N = 82 x/mnt Kuning Istithaah/mandiri
P = 18 x/mnt S = 36
Lab : GDS = 108
14 Hartikabintilaselle 49 thn TD = 100/70 N = 82 x/mnt Kuning Istithaah/mandiri
P = 26 x/mnt S = 36
Lab :
GDS = 250 mg/dl Hb : 10,5 gr%
Lampiran 5 :7 Materi Penyuluhan kepada jemaah haji

HEAT
MATERI

STROKE
(Oleh : Syamsuddin Azis Laba )

1. Pengertian
Heat stroke adalah kondisi mengancam jiwa dimana suhu tubuh
mencapai lebih dari 40°C atau lebih. Heat stroke dapat disebabkan
karena kenaikan suhu lingkungan, atau aktivitas yang dapat
meningkatkan suhu tubuh
2. Penyebab
• Kondisi suhu lingkungan yang terlalu tinggi
• Aktivitas yang berlebihan
• memakai pakaian yang terlalu tebal sehingga mengganggu
pengeluaran keringat
3. Tanda dan Gejala
• Kenaikan suhu, sampai 40°C atau lebih
• Tidak berkeringat. Jika heat stroke disebabkan oleh karena suhu
lingkungan yang sangat panas, maka kulit cenderung terasa panas dan
kering
• Kemerahan pada kulit
• Nafas menjadi cepat dan terasa berat
• Denyut jantung semakin cepat
• Sakit kepala seperti ditusuk-tusuk
• Gejala saraf lain, misalnya kejang, tidak sadar, halusinasi
• Otot bisa terasa kram, lalu selanjutnya terasa lumpu
4. Tahapan Heat Stroke
Heat stroke merupakan gabungan dari 2 kondisi serius yang
berhubungan dengan suhu
• Kondisi pertama adalah heat cramp/ kram akibat kenaikan suhu
tubuh, dimana terjadi karena paparan suhu yang sangat tinggi.
Biasanya ditandai dengan keringat berlebihan, kelelahan, haus, kram
otot
• Kondisi yang lain adalah heat exhaustion/ kelelahan akibat kenaikan
suhu tubuh. Heat exhaustion muncul jika anda tidak mempedulikan
gejala dari ‘heat cramp’ yang muncul gejalanya termasuk sakit kepala,
pusing, kepala terasa ringan, mual, kulit dingin dan terasa lembab,
kram otot
5. Akibat
• Syok, karena aliran darah yang kurang secara tiba-tiba
• kerusakan pada otak dan organ lainnya
• Kematian
6. Cara Pencegahan
• Tetaplah di dalam ruangan yang sejuk jika memungkinkan
• Minum air putih dalam jumlah cukup sebelum melakuakn aktivitas
di luar ruangan
• Kurangi mengkonsumsi minuman seperti teh, kopi, alkohol
• Pakailah pakaian yang ringan, longgar, berwarna cerah, dan
menyerap keringat
• Lindungi diri dari matahari dengan menggunakan payung atau topi
saat di luar ruangan
• Jangan berada di luar ruangan pada saat matahari sedang sangat terik
• Jika melakukan aktivias di luar ruangan, usahakan untuk sering
minum setiap 15 sampai 20 menit
7. Cara Penanganan Heat Stroke
• Lepaskan pakaian
• Turunkan suhu inti (internal) sampal dengan 39°C
Gunakan pakaian dingin dan handuk
Taruh es pada kulit sambil menyemprot dengan air biasa.
Gunakan Selimut Pendingin
• Masase pasien untuk meningkatkan sirkulasi
• Posisikan kipas angin listrik sehiugga menghembus pada pasien
• Pantau secara konstan suhu, dan tanda tanda vital
• Berikan oksigen dan pasang infus bila ada
• Segera bawa ke unit pelayanan kesehatan terdekat
MATERI PENYULUHAN

Penyakit MERS dan Virus MERS-CoV

Penyuluh : Syamsuddin Azis Laba


Topic : Penyakit MERS dan Virus MERS-CoV
Pokok bahasan : Cara Penanganan penyakit mers
Sasar : Jamaah haji
Tempat : Makassar
Hari / Tanggal : Juni 2017
Waktu : 40 menit
Media : Livlet
Metode : Ceramah

I. Tujuan Umum
Setelah mengikuti kegiatan penyuluhan diharapkan Jemaah haji dapat memahami dan
mengerti tentangpenyakit Mers dan virus Mers-coV
II. Tujuan Kusus.
Setelah mengikuti kegiatan penyuluhan Jemaah haji dapat memahami tentang:
 Pengertian penyakit mers,
 Penyebab penyakit mers,
 Gejala dan penularan,
 Penanganan penyakit mers,
 Cara penularan mers,dan
 Pencegahan mers,

MATERI PENYULUHAN
1. PENGERTIAN
MERS adalah penyakit yang disebabkan oleh Corona virus yang disebut Middle East
Respiratory Syndrome Coronavirus (MERS-Cov)
MERS-CoV adalah penyakit sindrom pernapasan yang disebabkan oleh virus Corona
yang menyerang saluran pernapasan mulai dari yg ringan sampai berat. Gejalanya adalah
demam, batuk dan sesak nafas, bersifat akut, biasanya pasien memiliki penyakit ko-morbid.
Menurut Kementerian Kesehatan RI, MERS merupakan suatu penyakit yang
disebabkan oleh corona virus yang disebut Middle East Respiratory Syndrome
Coronavirus (MERS-Cov), Virus ini berbeda dengan corona virus lain yang telah ditemukan
sebelumnya, sehingga kelompok studi corona virus dari Komite Internasional untuk
Taksonomi Virus memutuskan bahwa novel corona virus tersebut dinamakan sebagai MERS-
Cov.
Virus MERS-Cov ini tidak sama dengan corona virus penyebab penyakit Severe Acute
Respiratory Syndrome (SARS), namun mirip dengan corona virus yang terdapat pada
kelelawar.
Insiden MERS pertama kali dilaporkan pada tahun 2012 di Arab Saudi. Penyakit MERS
ini juga biasa disebut sebagai flu Arab. Pada kurun waktu tiga bulan, sejak April sampai
dengan Juni 2013, jumlah infeksi MERS-Cov di dunia tercatat sebanyak 64 kasus dengan 38
kematian
MERS menyerang saluran pernapasan yang menyerupai sakit flu biasa, mulai dari yang
ringan hingga berat. Gejalanya adalah demam, batuk dan sesak nafas, dan bersifat akut.
Sebagian besar penyakit MERS dilaporkan terjadi pada usia di atas 50 tahun dan sebagian
besar terjadi pada laki-laki.

2. GEJALA DAN PENULARAN


Penyakit mematikan yang satu ini disebabkan oleh virus Corona MERS (Middle East
respiratory syndrome coronavirus). Virus ini sudah mulai menyerang di Arab Saudi.
Pasalnya, virus MERS yang belum ada obatnya ini sudah banyak menelan korban.
Virus MERS hampir sama dengan virus SARS Corona, hanya saja virus MERS lebih
mematikan. Angka kematian akibat virus MERS sebesar 50% dan untuk SARS hanya 10%.
Dr H. Ari Fahrial Syam SpPD-KGEH, MMB, FINASIM, Dokter Spesialis Penyakit Dalam,
menjelaskan bahwa virus MERS ini memiliki tingkat kematian cukup tinggi dan
penularannya cukup cepat.
Sampai saat ini, infeksi MERS sudah menyerang di berbagai negara terutama di Kawasan
Timur Tengah, seperti Arab Saudi, Uni Emirat Arab, Qatar, dan masih banyak lagi. Virus
MERS baru diketahui pada tahun 2012 dan belum ada vaksinnya.
Menurut, Dr Ari bahwa ciri-ciri seseorang terkena virus MERS itu hampir sama dengan
penyakit flu biasa. Karena hanya pemeriksaan medis saja virus MERS bisa diketahui.
Ciri-ciri penyakit akibat virus MERS, meliputi :
1. Penderita mengalami gangguan pernapasan, seperti nafas pendek.
2. Mengalami demam lebih dari 38 derajat celcius yang disertai gangguan pernapasan.
3. Batuk-batuk dan bersin.
4. Mengalami pneumonia dan gagal ginjal.
5. Merasakan sakit di bagian dada.

Penyakit MERS dapat menular antar manusia secara terbatas, dan tidak terdapat
transmisi penularan antar manusia yang berkelanjutan. Kemungkinan penularannya dapat
melalui kontak langsung melalui percikan dahak (droplet) pada saat pasien batu atau bersin,
maupun secara tidak langsung melalui kontak dengan benda yang terkontaminasi virus
MERS-Cov.
Virus MERS lebih mudah menginfeksi orang yang mempunyai kekebalan tubuh rendah,
misalnya lanjut usia, anak-anak kecil, orang yang sedang dalam perjalanan. Maka dari itu,
sangat penting untuk selalu menjaga kesehatan Anda.
Jumlah korban dari virus MERS di Arab Saudi sebesar 339 kasus. Jadi, bagi Anda yang ingin
berencana ke Arab Saudi selalu perhatikan kesehatan Anda.
Sebagian besar orang yang terinfeksi MERS-Cov berkembang menjadi penyakit saluran
pernapasan berat dengan gejala-gejala demam, batuk, dan napas pendek. Sekitar separuh dari
jumlah penderita meninggal. Sebagian dari penderita dilaporkan menderita penyakit saluran
pernapasan tingkat sedang.
Gejala-gejala dari penyakit ini dapat dan mudah kita ketahui, kalau ada yang merasakan hal
tersebut ada baiknya segera melaporkan dan prikasa ke Rumah Sakit yang terdekat sekitar
lokasi anda. Untuk berkonsultasi tentang penyakit yang dialami , karena penyakit ini
merupakan salah satu penyakit yang serius dan tidak ada pengobatan yang ditemukan sampai
saat ini.

Virus ini dapat menular antar manusiasecara terbatas, dan tidak terdapat transmisi penularan
antar manusia yang berkelanjutan.
Kemungkinan penularannya dapat melalui :
1. Langsung : melalui percikan dahak (droplet) pada saat pasien batu atau bersin.
2. Tidak Langsung : melalui kontak dengan benda yang terkontaminasi virus.
Sampai saat ini, masih terus dilakukan investigasi mengenai pola penularan MERS-Cov,
karena telah ditemukan adanya penularan dari manusia ke manusia yang saling kontak dekat
dengan penderita.
Penularan dari pasien yang terinfeksi kepada petugas kesehatan yang merawat juga diamati.
Selain itu, cluster dari kasus infeksi MERS-Cov di Arab Saudi, Jordania, the United
Kingdom, Prancis, Tunisia, dan Italia juga diinvestigasi.

3. CARA AGAR TERHINDAR


Jika Anda ingin berpergian ke Arab Saudi, entah itu untuk umroh ataupun liburan
sebaiknya Anda untuk tetap waspada penularan virus MERS (Middle East Respiratory
Syndrome).
Saat ini Arab Saudi sedang gencar-gencarnya membuat peringatan tentang bahaya virus
tersebut. Virus ini belum ditemukan obat untuk mengatasinya sehingga sudah 69 korban
meninggal. Sementara 194 orang dinyatakan positif terkena virus MERS (Middle East
Respiratory Syndrome).
Cara agar terhindar dari virus Corona MERS:
1. Melaksanakan Perilaku Hidup Sehat
2. Usahakan untuk selalu mencuci tangan dengan sabun antiseptik. Segera demam, batuk, dan
kesulitan bernapas.
3. Lindungi diri dari penularan
4. Lindungi diri Anda dari virus penyakit yang hampir sama dengan influenza. Sebaiknya Anda
tunda lebih dulu untuk bepergian jika merasakan gejala influenza. Agar lebih aman, tutup
mulut dan hidung dengan tangan.

4. PENGOBATAN DAN PENCEGAHAN

Belum ada vaksin spesifik yang dapat mencegah infeksi MERS-Cov hingga kini. Selain
itu, belum ditemukan juga metode pengobatan yang secara spesifik bisa menyembuhkan
penyakit yang disebabkan oleh MERS-Cov. Perawatan medis hanya bersifat suportif untuk
meringankan gejala. Tes laboratorium Polymerase Chain Reaction (PCR) untuk MERS-Cov
tersedia di Kementerian Kesehatan dan beberapa laboratorium internasional, namun tes
tersebut bukan tes rutin.
Pencegahan dengan PHBS (pola hidup bersih dan sehat), menghindari kontak erat
denganpenderita,menggunakan masker,menjaga kebersihan tangan dengan sering mencuci
tangan dengan sabun dan menerapkan etika batuk ketika sakit.
Selain itu, disarankan untuk berkonsultasi ke dokter setiap 6 minggu sebelum
bepergian. Dan melakukan vaksinasi meningitis sebelum berkunjung ke Arab Saudi.
Melindungi diri dan orang yang mengalami penyakit yang menyerupai
influenza juga sangat penting. Caranya :
 Jika Anda merasakan gejala-gejala penyakit seperti influenza, disarankan untuk tidak
keluar rumah.
 Selalu cuci tangan menggunakan sabun dengan air mengalir.
 Setiap kali batuk dan bersin tutup mulut dan hidung.
 Selalu pakai masker saat terkena flu atau berdekatan dengan orang yang terkena flu.
Ketika Anda mengalami gejala demam, batuk dan sulit saat bernapas, segera
konsultasikan ke dokter. Apalagi jika Anda sudah mengalami gejala ini dalam waktu
14 hari.
Pendapat WHO
Pernyataan WHO tanggal 17 Juli 2013 pada pertemuan IHR Emergency Committee
concerning MERS CoV menyatakan bahwa MERS CoV merupakan situasi serius dan perlu
perhatian besar namun belum terjadi kejadian darurat kesehatan masyarakat
(PHEIC/Public health emergency of international concern).

Persediaan sebelum berangkat


1. Sentiasa memastikan tahap kesihatan berada dalam keadaan baik, khasnya yang berpenyakit
kronik seperti asma, penyakit salur pernafasan tersekat kronik (COPD), sakit jantung,
diabetes dan lain-lain. Kerajaan Arab Saudi mencadangkan agar bakal jemaah haji warga
emas dan yang mempunyai penyakit kronik menangguhkan pemergian.
2. Mengambil vaksin tambahan iaitu vaksin influenza dan Pneumococcal (amat digalakkan)
terutama yang berumur atau mempunyai penyakit kronik dan mengikut nasihat pegawai
perubatan.
3. Membawa bekalan penutup mulut dan hidung (mask) yang mencukupi dan pencuci tangan
(hand sanitizer) untuk kegunaan sendiri semasa berada di Mekah dan dalam kapal terbang.
4. Sentiasa mengikuti perkembangan semasa mengenai wabak ini dan langkah pencegahan
yang perlu diambil dari semasa ke semasa.

Pencegahan di Mekah
1. Sentiasa mengamalkan tahap kebersihan diri yang tinggi, seperti kerap mencuci tangan,
terutama selepas batuk, bersin atau selepas bersalam.
2. Sentiasa membawa penutup hidung dan mulut seta pencuci tangan untuk digunakan ketika
perlu.
3. Sentiasa mengamalkan etika batuk (cough etiquette) yang baik.
4. Mengelakkan daripada mengambil makanan mentah atau tidak dimasak sepenuhnya.
5. Membasuh buah-buahan dan sayur-sayuran terlebih dahulu sebelum dimakan.
6. Mengelak minum air tidak terawat.
7. Memakai penutup hidung dan mulut sekiranya terdapat tanda-tanda jangkitan MERS-CoV
dan dapatkan rawatan segera.

Hal yang dilakukan Kementerian Kesehatan


1. Peningkatan kegiatan pemantauan di point of entry, pintu masuk negara.
2. Penguatan Surveilans epidemiologi termasuk surveilans pneumonia.
3. Pemberitahuan keseluruh Dinas Kesehatan Provinsi tentang kesiapsiagaan menghadapi
MERS CoV, sudah dilakukan sebanyak 3 kali.
4. Pemberitahuan ke seratus Rumah Sakit Rujukan Flu Burung, RSUD dan RS Vertikal
tentang kesiapsiagaan dan tata laksana MERS CoV.
5. Menyiapkan dan membagikan 5 (lima) dokumen terkait persiapan penanggulangan
MERS – CoV, yang terdiri dari :
1. Pedoman umum MERS CoV
2. Tatalaksana klinis
3. Pencegahan Infeksi
4. Surveilans di masyarakat umum dan di pintu masuk negara
5. Diagnostik dan laboratorium
Semua petugas TKHI sudah dilatih dan diberi pembekalan dalam
penanggulangan MERS-CoV. Menyiapkan pelayanan kesehatan haji di 15
Embarkasi / Debarkasi (KKP)
Meningkatkan kesiapan laboratorium termasuk penyediaan reagen dan alat
diagnostik.
Diseminasi informasi ke masyarakat terutama calon jemaah haji dan umrah serta
petugas haji Indonesia. Meningkatkan koordinasi lintas program dan lintas sektor
seperti BNP2TKI, Kementerian Perhubungan, Kementerian Agama, Kementerian
Luar Negeri Republik Indonesia tentang kesiapsiagaan menghadapi MERS CoV.
Melakukan kordinasi dengan pihak kesehatan Arab Saudi.
MATERI Perilaku Hidup Bersih
dan Sehat (PHBS)
( Oleh : Syamsuddin Azis Laba )

 PHBS adalah semua perilaku kesehatan yang dilakukan atas


kesadaran sehingga anggota keluarga atau keluarga dapat
menolong dirinya sendiri di bidang kesehatan dan berperan
aktif dalam kegiatan-kegiatan kesehatan di masyarakat.
 PHBS itu jumlahnya banyak sekali, bisa ratusan. Misalnya
tentang Gizi: makan beraneka ragam makanan, minum Tablet
Tambah Darah, mengkonsumsi garam beryodium, memberi
bayi dan balita Kapsul Vitamin A. Tentang kesehatan
lingkungan seperti membuang sampah pada tempatnya,
membersihkan lingkungan.
 Setiap rumah tangga dianjurkan untuk melaksanakan semua
perilaku kesehatan.
Apa Manfaat PHBS ?
 Setiap anggota keluarga menjadi sehat dan tidak mudah sakit.
 Anak tumbuh sehat dan cerdas.
 Anggota keluarga giat bekerja.
 Pengeluaran biaya rumah tangga dapat ditujukan untuk
memenuhi gizi keluarga, pendidikan dan modal usaha untuk
menambah pendapatan keluarga.
MATERI Penyakit Jantung:
Gejala, Penyebab, Diagnosis,
dan Cara Mengobati
( Oleh : Syamsuddin Azis Laba )
Pengertian
Penyakit jantung adalah kondisi yang memengaruhi fungsi
jantung. Jantung adalah organ muskular kompleks yang
memompa darah keseluruh tubuh dalam ritme yang tetap.
Penyakit jantung, juga diketahui sebagai penyakit
kardiovaskular, merupakan salah satu penyebab utama,
kematian di seluruh dunia. Mengenali tanda dan gejala
penyakit jantung dapat membantu mencegah kondisi Anda
menjadi lebih buruk, sehingga Anda dapat menghindari gagal
jantung yang biasanya menyebabkan kematian.

Ada beberapa jenis penyakit jantung. Yang paling umum


adalah:

 Penyakit jantung hipertensif – kondisi ini disebabkan oleh


darah tinggi atau hipertensi utama dan sekunder. Hipertensi
tidak memiliki penyebab pasti. Namun, infeksi ginjal atau
kelenjar adrenal dapat menyebabkan hipertensi sekunder.
Hipertensi memaksa jantung untuk bekerja lebih keras,
sehingga dapat menimbulkan malfungsi.
 Penyakit jantung peradangan – kondisi ini ditandai dengan
peradangan pada otot-otot, lapisan dalam, atau kantung
membran pada jantung.
 Penyakit jantung iskemik – adalah penyakit jantung yang
muncul, saat arteri yang mengarah ke jantung menyempit,
sehingga pasokan darah ke jantung berkurang.
 Penyakit jantung reumatik – kondisi ini disebabkan demam
reumatik yang merusak jantung, terutama katup jantung.
 Penyakit jantung serebrovaskular – adalah penyakit yang
didefinisikan sebagai penyempitan pembuluh darah dari
jantung ke otak. Kondisi ini menyebabkan insiden
serebrovaskular atau stroke.
 Penyakit jantung kongenital – ini muncul sejak lahir, ini
berarti seseorang lahir dengan malformasi jantung.
 Gagal jantung – jika otot-otot jantung terlalu rusak, sehingga
tidak dapat berfungsi dengan normal untuk memasok darah
ke bagian tubuh lainnya, kondisi ini disebut sebagai gagal
jantung.

Penyebab
Ada banyak faktor seperti hipertensi, obesitas, kolesterol
tinggi, diabetes, tidak aktif secara fisik atau diet tidak sehat,
dapat menyebabkan penyakit jantung. Merokok dan
menggunakan tembakau, penyalahgunaan obat, konsumsi
alkohol berlebihan, dan riwayat keluarga dengan penyakit
jantung adalah faktor berisiko lainnya.

Gejala Utama
Tiap kondisi memiliki gejala-gejala yang berbeda. Namun,
beberapa gejala yang umumnya muncul adalah napas yang
memendek, dada terasa sakit, nyeri atau mati rasa pada kaki
dan tangan, sakit leher, rahang dan punggung, atau di
bagian atas perut.

Aritmia jantung (detak jantung abnormal) memiliki gejala lain


seperti detak jantung sangat kencang, pusing, pingsan, atau
detak jantung lambat.

Jika ada cacat pada jantung, gejala seperti warna kulit biru
atau abu pucat dan pembengkakan pada kaki serta sekitar
mata, perut, kaki dan tangan atas maupun bawah.
Penyakit jantung yang disebabkan infeksi, seperti demam,
lemah, kelelahan, batuk tanpa henti, ruam kulit, dan
perubahan detak jantung.

Siapa yang Harus Ditemui dan Pilihan


Pengobatan yang Tersedia
Gejala umum dari penyakit jantung juga dapat
mengindikasikan penyakit lainnya. Sebaiknya, Anda
berkonsultasi dengan dokter untuk menentukan penyebab
pasti dari gejala yang Anda rasakan. Jika Anda mengalami
nyeri di dada dan napas yang pendek, pingsan, segeralah
pergi ke unit gawat darurat untuk mendapatkan pengobatan.
Semakin cepat, semakin besar kesempatan Anda bertahan
dari serangan jantung.

Untuk mendiagnosa penyakit jantung, dokter akan


melakukan serangkaian tes seperti elektrokardiogram
(EKG), ekokardiogram, monitor Holter, katerisasi jantiung,
pemindaian CT, atau magnetic resonance imaging (MRI).
Anda juga perlu melakukan tes darah dan sinar X pada
jantung.
Setelah dokter berhasil mengetahui masalah jantung secara
tepat, pengobatan akan dimulai. Jika kondisinya tidak parah,
pilihan pengobatan akan termasuk obat-obatan untuk
mengontrol penyakit jantung, dan perubahan gaya hidup
sederhana. Namun, jika kondisinya mengacam nyawa, Anda
perlu melakukan bedah jantung.

Ada beragam tindakan pembedahan untuk penyakit jantung.


Jika dokter menentukan bahwa masalahnya adalah satu atau
beberapa katup tidak berfungsi, Anda perlu menjalani bedah
perbaikan atau penggantian katup. Ini dapat dilakukan
dengan bedah terbuka atau teknik bedah minim sayatan.

Penyakit jantung yang melibatkan penyumbatan arteri ke


jantung, dapat diatasi dengan berbagai cara berbeda. Jika
penyumbatannya tidak parah, obat-obatan dapat membantu
membuka arteri, sehingga lebih banyak aliran darah ke
jantung. Namun, jika arteri benar-benar tersumbat, Anda
perlu menjalani angiogram koroner dengan cincin, untuk
menghilangkan penyumbatan dengan memperlebar arteri
dan menempatkan cincin untuk mencegah jantung berhenti
berfungsi.

Jika kerusakan pada jantung terlalu parah dan tidak dapat


diperbaiki, Anda akan dimasukkan ke dalam daftar kandidat
penerima donor jantung. Artinya, Anda perlu menunggu
untuk donor jantung. Saat Anda menunggu, Anda akan
disambungkan ke jantung artifisial, yaitu sebuah alat yang
dikoneksikan ke pembuluh darah utama yang memompa
darah ke seluruh tubuh.
Jika Anda didiagnosa dengan penyakit jantung atau a ingin
mencegah perkembangannya, Anda perlu memiliki gaya
hidup sehat termasuk pola makan yang tepat. Menjauhi
makanan dengan berkolesterol tinggi, berhenti merokok,
mengurangi minuman beralkohol, berolahraga paling tidak 30
menit sehari. Jika Anda kegemukkan, Anda perlu mengurangi
berat badan, karena obseitas adalah salah satu penyebab
utama penyakit jantung.

Anda juga perlu mengetahui bahwa stres dapat berkontribusi


terhadap perkembangan penyakit jantung. Anda dapat
mencoba teknik manajemen stres, atau menghindari situasi
stres. Depresi juga menyebabkan penyakit jantung. Jika
Anda seringkali merasa depresi, berkonsultasi dengan
dokter. Bukan hanya menyebabkan masalah jantung, tapi
juga masalah psikologis.

Selalu ingat, bahwa penyakit jantung adalah penyebab


kematian utama di seluruh dunia. Namun, dapat diobati, jika
diketahui lebih awal. Menjalani gaya hidup sehat dan
melakukan olahraga cukup, setiap harinya juga dapat
mencegah penyakit jantung.
MATERI PENYAKIT PERNAFASAN
(Oleh : Syamsuddin Azis Laba )

Pengertian pernafasan atau respirasi adalah suatu proses mulai


dari pengambilan oksigen, pengeluaran karbohidrat hingga
penggunaan energi di dalam tubuh. Manusia dalam bernapas
menghirup oksigen dalam udara bebas dan membuang
karbondioksida ke lingkungan.

Sistem pernafasan tersusun atas saluran pernafasan dan paru-paru


sebagai tempat perrtukaraan udara pernafasan. Pernafasan
merupakan proses untuk memenuhi kebutuhan oksigen yang
diperlukan untuk mengubah sumber energi menjadi energi dan
membuang CO2 sebagai sisa metabolisme.
Sistem pernafasan terdiri daripada lubang hidung, rongga hidung,
faring, laring, trakea , peparu , tulang rusuk , otot interkosta ,
bronkus , bronkiol , alveolus dan diafragma . Lubang hidung sampai
bronchiolus disebut pars konduktoria karena fungsinya sebagai
saluran udara respirasi.
ANATOMI
kekurangan oksigen atau kurang darah alias anemia.

Kelainan Lain meliputi :

1. Asfiksi, gangguan Pernafasan pada waktu pengangkutan dan


penggunaan oksigen oleh jaringan, akibat tenggelam,
pneumonia dan keracunan.
2. Asidosis, kenaikan kadar asam karbonat dan asam bikarbonat
dalam darah.
3. Difteri, penyumbatan oleh lendir pada rongga faring yang
dihasilkan oleh infeksi kuman difteri.
BRONKITIS

Definisi
Bronkitis (Bronchitis; Inflammation – bronchi) adalah suatu
peradangan pada bronkus (saluran udara ke paru-paru).
Penyakit bronkitis biasanya bersifat ringan dan pada akhirnya akan
sembuh sempurna. Tetapi pada penderita yang memiliki penyakit
menahun (misalnya penyakit jantung atau penyakit paru-paru) dan
pada usia lanjut, bronkitis bisa bersifat serius.

Penyebab
Penyebab Bronkitis infeksiosa adalah virus, bakteri dan (terutama)
organisme yang menyerupai bakteri (Mycoplasma pneumoniae dan
Chlamydia).
Serangan bronkitis berulang bisa terjadi pada perokok dan
penderita penyakit paru-paru dan saluran pernafasan menahun.
Infeksi berulang bisa merupakan akibat dari:

* Sinusitis kronis

* Bronkiektasis

* Alergi

* Pembesaran amandel dan adenoid pada anak-anak.


Bronkitis iritatif bisa disebabkan oleh:
– Berbagai jenis debu
– Asap dari asam kuat, amonia, beberapa pelarut organik, klorin,
hidrogen sulfida, sulfur dioksida dan bromin
– Polusi udara yang menyebabkan iritasi ozon dan nitrogen
dioksida
– Tembakau dan rokok lainnya.

Gejala
Gejala bronkitis berupa:
– batuk berdahak (dahaknya bisa berwarna kemerahan)
– sesak nafas ketika melakukan olah raga atau aktivitas ringan
– sering menderita infeksi pernafasan (misalnya flu)
– bengek
– lelah
– pembengkakan pergelangan kaki, kaki dan tungkai kiri dan kanan
– wajah, telapak tangan atau selaput lendir yang berwarna
kemerahan
– pipi tampak kemerahan
– sakit kepala
– gangguan penglihatan.
Bronkitis infeksiosa seringkali dimulai dengan gejala seperti pilek,
yaitu hidung meler, lelah, menggigil, sakit punggung, sakit otot,
demam ringan dan nyeri tenggorokan.
Batuk biasanya merupakan tanda dimulainya bronkitis. Pada
awalnya batuk tidak berdahak, tetapi 1-2 hari kemudian akan
mengeluarkan dahak berwarna putih atau kuning. Selanjutnya
dahak akan bertambah banyak, berwarna kuning atau hijau.
Pada bronkitis berat, setelah sebagian besar gejala lainnya
membaik, kadang terjadi demam tinggi selama 3-5 hari dan batuk
bisa menetap selama beberapa minggu.
Sesak nafas terjadi jika saluran udara tersumbat.
Sering ditemukan bunyi nafas mengi, terutama setelah batuk.
Bisa terjadi pneumonia.

Diagnosa
Diagnosis bronkitis biasanya ditegakkan berdasarkan gejala,
terutama dari adanya lendir.
Pada pemeriksaan dengan menggunakan stetoskop akan
terdengar bunyi ronki atau bunyi pernafasan yang abnormal.
Pemeriksaan lainnya yang biasa dilakukan:
– Tes fungsi paru-paru
– Gas darah arteri
– Rontgen dada.

LARINGITIS (RADANG PITA SUARA)


Definisi
Laringitis adalah peradangan pada laring (pangkal tenggorok).
Laring terletak di puncah saluran udara yang menuju ke paru-paru
(trakea) dan mengandung pita suara.
Penyebab
Penyebab yang paling sering adalah infeksi virus pada saluran
pernafasan bagian atas (misalnya common cold). Laringitis juga
bisa menyertai bronkitis, pneumonia, influenza, pertusis, campak
dan difteri.
Laringitis bisa terjadi akibat:
– Penggunaan suara yang berlebihan
– Reaksi alergi
– Menghirup iritan (misalnya asap rokok).
Gejala
Gejala biasanya berupa perubahan suara berupa serak sampai
hilangnya suara. Tenggorokan terasa gatal dan tidak nyaman.
Gejala lainnya yang juga bisa ditemukan:
– demam
– tidak enak badan
– kesulitan menelan
– sakit tenggorokan.
Pembengkakan laring menyebabkan terjadinya gangguan
pernafasan.
Diagnosa
Diagnosis ditegakkan berdasarkan gejala dan hasil pemeriksaan
fisik.
Dengan cermin kecil bersudut seperti yang digunakan dokter gigi,
dokter bisa melihat kemerahan dan pembengkakan pada laring.
Pengobatan
Pengobatan pada infeksi oleh virus tergantung kepada gejalanya.
Penderita sebaiknya mengistirahatkan pita suaranya dengan tidak
bicara atau bicara dengan berbisik. Menghirup uap bisa
meringankan gejala dan membantu penyembuhan daerah yang
meradang.
Jika penyebabnya bakteri, diberikan antibiotik.
FARINGITIS (RADANG TENGGOROKAN)

Definisi
Faringitis adalah suatu peradangan pada tenggorokan (faring).
Penyebab
Faringitis bisa disebabkan oleh virus maupun bakteri. Kebanyakan
disebabkan oleh virus, termasuk virus penyebab common cold, flu,
adenovirus, mononukleosis atau HIV.
Bakteri yang menyebabkan faringitis adalah streptokokus grup A,
korinebakterium, arkanobakterium, Neisseria gonorrhoeae atau
Chlamydia pneumoniae.
Gejala
Baik pada infeksi virus maupun bakteri, gejalanya sama yaitu nyeri
tenggorokan dan nyeri menelan.
Selaput lendir yang melapisi faring mengalami peradangan berat
atau ringan dan tertutup oleh selaput yang berwarna keputihan atau
mengeluarkan nanah.
Gejala lainnya adalah:
– demam
– pembesaran kelenjar getah bening di leher
– peningkatan jumlah sel darah putih.
Gejala tersebut bisa ditemukan pada infeksi karena virus maupun
bakteri, tetapi lebih merupakan gejala khas untuk infeksi karena
bakteri.
Ada 2 jenis faringitis
Faringitis Virus Faringitis Bakteri

Biasanya tidak ditemukan Sering ditemukan nanah di


nanah di tenggorokan tenggorokan

Demam ringan atau tanpa


demam Demam ringan sampai sedang

Jumlah sel darah putih normal Jumlah sel darah putih meningkat
atau agak meningkat ringan sampai sedang

Kelenjar getah bening normal Pembengkakan ringan sampai sedang


atau sedikit membesar pada kelenjar getah bening

Tes apus tenggorokan Tes apus tenggorokan memberikan


memberikan hasil negatif hasil positif untuk strep throat

Pada biakan di laboratorium Bakteri tumbuh pada biakan di


tidak tumbuh bakteri laboratorium

Diagnosa
Diagnosis ditegakkan berdasarkan gejala dan hasil pemeriksaan
fisik. Jika diduga suatu strep throat, bisa dilakukan pemeriksaan
terhadap apus tenggorokan.
Pengobatan
Untuk mengurangi nyeri tenggorokan diberikan obat pereda nyeri
(analgetik), obat hisap atau berkumur dengan larutan garam
hangat.
Aspirin tidak boleh diberikan kepada anak-anak dan remaja yang
berusia dibawah 18 tahun karena bisa menyebabkan sindroma
Reye. Jika diduga penyebabnya adalah bakteri, diberikan
antibiotik.
PLEURISI (RADANG PLEURA)

Definisi
Pleurisis / radang pleura (Pleurisy/Pleuritis/ Pleuritic chest pain)
adalah suatu peradangan pada pleura (selaput yang menyelubungi
permukaan paru-paru).
Pleurisi terjadi jika suatu penyebab (biasanya virus atau bakteri)
mengiritasi pleura, sehingga terjadi peradangan.
Bila disertai dengan penimbunan cairan di rongga pleura maka
disebut efusi pleura tetapi bila tidak terjadi penimbunan cairan di
rongga pleura, maka disebut pleurisi kering.
Setelah terjadi peradangan, pleura bisa kembali normal atau terjadi
perlengketan.
Penyebab
Penyebab utama:
Pneumonia

Infark paru akibat emboli paru

Kanker
Tuberkulosis

Artritis reumatoid

Lupus eritematosus sistemik

Infeksi parasit (misalnya amuba)

Pankreatitis

Cedera (misalnya patah tulang iga)

Bahan/zat iritatif dari saluran pernafasan atau tempat lain (misalnya


abses) yang sampai ke pleura

Reaksi alergi terhadap obat-obatan seperti hidralazin, prokainamid,


isoniazid, fenitoin, klorpromazin.

Gejala
Gejala yang paling sering ditemukan adalah nyeri dada, yang
biasanya muncul secara tiba-tiba. Nyeri bervariasi, mulai dari rasa
tidak enak sampai nyeri yang tajam dan menusuk. Nyeri bisa
dirasakan hanya pada saat bernafas dalam atau batuk, atau bisa
juga dirasakan terus menerus, tapi bertambah hebat bila bernafas
dalam dan batuk.
Jika cairan tertimbun dalam jumlah yang besar, maka akan terjadi
pemisahan lapisan pleura sehingga nyerinya hilang. Cairan dalam
jumlah yang besar menyebabkan penderita mengalami kesulitan
dalam mengembangkan paru-parunya pada saat bernafas
sehingga terjadi gawat pernafasan.
Diagnosa
Diagnosis seringkali mudah ditegakkan karena nyerinya yang khas.
Pemeriksaan foto dada mungkin tidak akan menunjukkan adanya
suatu pleurisi, tetapi bisa menggambarkan adanya patah tulang iga,
penyakit paru-paru atau penimbunan sejumlah kecil cairan di
rongga pleura.
Pengobatan
Pengobatan pleurisi tergantung kepada penyebabnya.
Jika penyebabnya adalah infeksi bakteri, diberikan antibiotik.
Jika penyebabnya adalah virus, tidak diperlukan pengobatan.
Jika penyebabnya adalah penyakit autoimun, dilakukan pengobatan
terhadap penyakit yang mendasarinya.
SINUSITIS

Definisi
Sinusitis adalah suatu peradangan pada sinus yang terjadi karena
alergi atau infeksi virus, bakteri maupun jamur.
Sinusitis bisa terjadi pada salah satu dari keempat sinus yang ada
(maksilaris, etmoidalis, frontalis atau sfenoidalis).
Penyebab
Sinusitis bisa bersifat akut (berlangsung selama 3 minggu atau
kurang) maupun kronis (berlangsung selama 3-8 minggu tetapi
dapat berlanjut sampai berbulan-bulan bahkan bertahun-tahun).
Penyebab sinusitis akut:
Infeksi virus.
Sinusitis akut bisa terjadi setelah suatu infeksi virus pada saluran
pernafasan bagian atas (misalnya pilek).
Bakteri.
Di dalam tubuh manusia terdapat beberapa jenis bakteri yang
dalam keadaan normal tidak menimbulkan penyakit (misalnya
Streptococcus pneumoniae, Haemophilus influenzae). Jika sistem
pertahanan tubuh menurun atau drainase dari sinus tersumbat
akibat pilek atau infeksi virus lainnya, maka bakteri yang
sebelumnya tidak berbahaya akan berkembang biak dan menyusup
ke dalam sinus, sehingga terjadi infeksi sinus akut.
Infeksi jamur.
Kadang infeksi jamur bisa menyebabkan sinusitis akut. Aspergillus
merupakan jamur yang bisa menyebabkan sinusitis pada penderita
gangguan sistem kekebalan. Pada orang-orang tertentu, sinusitis
jamur merupakan sejenis reaksi alergi terhadap jamur.
Peradangan menahun pada saluran hidung.
Pada penderita rinitis alergika bisa terjadi sinusitis akut. Demikian
pula halnya pada penderita rinitis vasomotor.
Penyakit tertentu.
Sinusitis akut lebih sering terjadi pada penderita gangguan sistem
kekebalan dan penderita kelainan sekresi lendir (misalnya fibrosis
kistik).
Penyebab sinusitis kronis:
Asma

Penyakit alergi (misalnya rinitis alergika)

Gangguan sistem kekebalan atau kelainan sekresi maupun


pembuangan lendir.
Gejala
Gejala khas dari kelainan pada sinus adalah sakit kepala yang
dirasakan ketika penderita bangun pada pagi hari.
Sinusitis akut dan kronis memiliki gejala yang sama, yaitu nyeri
tekan dan pembengkakan pada sinus yang terkena, tetapi ada
gejala tertentu yang timbul berdasarkan sinus yang terkena:
Sinusitis maksilaris menyebabkan nyeri pipi tepat di bawah mata,
sakit gigi dan sakit kepala.

Sinusitis frontalis menyebabkan sakit kepala di dahi.

Sinusitis etmoidalis menyebabkan nyeri di belakang dan diantara


mata serta sakit kepala di dahi. Peradangan sinus etmoidalis juga
bisa menyebabkan nyeri bila pinggiran hidung di tekan,
berkurangnya indera penciuman dan hidung tersumbat.

Sinusitis sfenoidalis menyebabkan nyeri yang lokasinya tidak dapat


dipastikan dan bisa dirasakan di puncak kepala bagian depan
ataupun belakang, atau kadang menyebabkan sakit telinga dan
sakit leher.
Gejala lainnya adalah:
– tidak enak badan
– demam
– letih, lesu
– batuk, yang mungkin semakin memburuk pada malam hari
– hidung meler atau hidung tersumbat.
Demam dan menggigil menunjukkan bahwa infeksi telah menyebar
ke luar sinus. Selaput lendir hidung tampak merah dan
membengkak, dari hidung mungkin keluar nanah berwarna kuning
atau hijau.
Sinusitis & Gangguan Sistem Kekebalan
Pada penderita diabetes yang tidak terkontrol atau penderita
gangguan sistem kekebalan, jamur bisa menyebabkan sinusitis
yang berat dan bahkan berakibat fatal.
Mukormikosis (fikomikosis) adalah suatu infeksi jamur yang bisa
terjadi pada penderita diabetes yang tidak terkontrol.
Pada rongga hidung terdapat jaringan mati yang berwarna hitam
dan menyumbat aliran darah ke otak sehingga terjadi gejala-gejala
neurologis (misalnya sakit kepala dan kebutaan). Diagnosis
ditegakkan berdasarkan hasil pemeriksaan mikroskopik terhadap
jaringan yang mati tersebut.
Pengobatannya meliputi pengendalian diabetes dan pemberian
obat anti-jamur amfoterisin B secara intravena (melalui pembuluh
darah).
Aspergillosis dan kandidiasis merupakan infeksi jamur pada sinus
yang bisa berakibat fatal pada penderita gangguan sistem
kekebalan akibat terapi anti-kanker atau penyakit (misalnya
leukemia, limfoma, mieloma multipel atau AIDS).
Pada aspergillosis, di dalam hidung dan sinus terbentuk polip.
Diagnosis ditegakkan berdasarkan hasil pemeriksaan terhadap
polip.
Pengobatannya berupa pembedahan sinus dan pemberian
amfoterisin B intravena.
Diagnosa
Diganosis ditegakkan berdasarkan gejala-gejala, foto rontgen sinus
dan hasil pemeriksaan fisik.
Untuk menentukan luas dan beratnya sinusitis, bisa dilakukan
pemeriksaan CT scan.
Pada sinusitis maksilaris, dilakukan pemeriksaan rontgen gigi untuk
mengetahui adanya abses gigi.
Pengobatan
Sinusitis akut , Untuk sinusitis akut biasanya diberikan:
Dekongestan untuk mengurangi penyumbatan

Antibiotik untuk mengendalikan infeksi bakteri

Obat pereda nyeri untuk mengurangi rasa nyeri.

ASMA

Pendahuluan
Penyakit asma berasal dari kata “asthma” yang diambil dari bahasa
Yunani yang berarti “sukar bernapas.” Penyakit asma dikenal
karena adanya gejala sesak napas, batuk dan mengi yang
disebabkan oleh penyempitan saluran napas.

Penyakit asma adalah penyakit yang mempunyai banyak faktor


penyebab, dimana yang paling sering karena faktor atopi atau
alergi. Faktor-faktor penyebab dan pemicu penyakit asma antara
lain debu rumah dengan tungaunya, bulu binatang, asap rokok,
asap obat nyamuk, dan lain-lain.

Penyakit ini merupakan penyakit keturunan. Bila salah satu atau


kedua orang tua, kakek atau nenek anak menderita penyakit asma
maka bisa diturunkan ke anak. Prof Dr. dr Heru Sundaru, Sp.PD,
KAI, Guru Besar Tetap FKUI menjelaskan, “penyakit asma bukan
penyakit menular tapi penyakit keturunan.”
Gejala Penyakit Asma
Frekuensi dan beratnya serangan asma bervariasi. Beberapa
penderita lebih sering terbebas dari gejala dan hanya mengalami
serangan serangan sesak nafas yang singkat dan ringan, yang
terjadi sewaktu-waktu.

Penderita lainnya hampir selalu mengalami batuk dan mengi


(bengek) serta mengalami serangan hebat setelah menderita suatu
infeksi virus, olah raga atau setelah terpapar oleh alergen maupun
iritan. Menangis atau tertawa keras juga bisa menyebabkan
timbulnya gejala.

Diagnosa Penyakit Asma


Diagnosis ditegakkan berdasarkan gejalanya yang khas. Untuk
memperkuat diagnosis bisa dilakukan
pemeriksaan spirometri berulang. Spirometri juga digunakan untuk
menilai beratnya penyumbatan saluran udara dan untuk memantau
pengobatan.
Saluran pernapasan penderita asma memiliki sifat yang khas yaitu
sangat peka terhadap berbagai rangsangan (bronchial
hyperreactivity = hipereaktivitas saluran napas). Asap rokok,
tekanan jiwa, alergen pada orang normal tidak menimbulkan asma
tetapi pada penderita asma rangsangan tadi dapat menimbulkan
serangan.
Pada penderita asma,
penyempitan saluran pernafasan merupakan respon terhadap
rangsangan yang pada paru-paru normal tidak akan mempengaruhi
saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai
rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara
dingin dan olahraga.
Gambar 1 : Respon Kekebalan Tubuh

Pada suatu serangan asma, otot polos dari bronki mengalami


kejang dan jaringan yang melapisi saluran udara mengalami
pembengkakan karena adanya peradangan dan pelepasan lendir
ke dalam saluran udara.

Hal ini akan memperkecil diameter dari saluran udara (disebut


bronkokonstriksi) dan penyempitan ini menyebabkan penderita
harus berusaha sekuat tenaga supaya dapat bernafas.

Sel-sel tertentu di dalam saluran udara (terutama sel mast) diduga


bertanggungjawab terhadap awal mula terjadinya penyempitan ini.
Sel mast di sepanjang bronki melepaskan bahan seperti histamin
dan leukotrien yang menyebabkan terjadinya:

 kontraksi otot polos


 peningkatan pembentukan lendir
 perpindahan sel darah putih tertentu ke bronki.
Sel mast mengeluarkan bahan tersebut sebagai respon terhadap
sesuatu yang mereka kenal sebagai benda asing (alergen), seperti
serbuk sari, debu halus yang terdapat di dalam rumah atau bulu
binatang.

Faktor Pencetus Serangan Asma


1. Faktor pada pasien
1. Aspek genetik
2. Kemungkinan alergi
3. Saluran napas yang memang mudah terangsang
4. Jenis kelamin
5. Ras/etnik
Faktor lingkungan
0. Bahan-bahan di dalam ruangan :
o Tungau debu rumah
o Binatang, kecoa
1. Bahan-bahan di luar ruangan :
o Tepung sari bunga
o Jamur
2. Makanan-makanan tertentu, bahan pengawet, penyedap,
pewarna makanan
3. Obat-obatan tertentu
4. Iritan (parfum, bau-bauan merangsang, household spray )
5. Ekspresi emosi yang berlebihan
6. Asap rokok dari perokok aktif dan pasif
7. Polusi udara dari luar dan dalam ruangan
8. Infeksi saluran napas
9. Exercise induced asthma, mereka yang kambuh asmanya
ketika melakukan aktivitas fisik tertentu
10. Perubahan cuaca
Pengobatan Asma

Tujuan pengobatan anti penyakit asma adalah membebaskan


penderita dari serangan penyakit asma. Hal ini dapat dicapai
dengan jalan mengobati serangan penyakit asma yang sedang
terjadi atau mencegah serangan penyakit asma jangan sampai
terjadi.
Ada usaha-usaha pencegahan yang dapat dilakukan untuk
mencegah datangnya serangan penyakit asma, antara lain :

1. Menjaga kesehatan
2. Menjaga kebersihan lingkungan
3. Menghindarkan faktor pencetus serangan penyakit asma
4. Menggunakan obat-obat antipenyakit asma
Mengobati disini bukan berarti menyembuhkan penyakitnya,
melainkan menghilangkan gejala-gejala yang berupa sesak, batuk,
atau mengi. Keadaan yang sudah bebas gejala penyakit asma ini
selanjutnya harus dipertahankan agar serangan penyakit asma
jangan datang kembali.

Obat-obatan bisa membuat penderita penyakit asma menjalani


kehidupan normal. Pengobatan segera untuk mengendalikan
serangan penyakit asma berbeda dengan pengobatan rutin untuk
mencegah serangan penyakit asma.

Untuk mengobati serangan penyakit asma yang sedang terjadi


diperlukan obat yang menghilangkan gejala penyakit asma dengan
segera. Obat tersebut terdiri atas golongan bronkodilator dan
golongan kortikosteroid sistemik.

PNEUMONIA (RADANG PARU)


Definisi
Pneumonia adalah peradangan paru yang disebabkan oleh infeksi
bakteri, virus maupun jamur.
Penyebab
Penyebab pneumonia adalah:
1. Bakteri (paling sering menyebabkan pneumonia pada dewasa):
– Streptococcus pneumoniae – Staphylococcus aureus –
Legionella – Hemophilus influenzae
2. Virus: virus influenza, chicken-pox (cacar air)
3. Organisme mirip bakteri: Mycoplasma pneumoniae (terutama
pada anak-anak dan dewasa muda)
4. Jamur tertentu.
Adapun cara mikroorganisme itu sampai ke paru-paru bisa melalui:
– Inhalasi (penghirupan) mikroorganisme dari udara yang tercemar
– Aliran darah, dari infeksi di organ tubuh yang lain
– Migrasi (perpindahan) organisme langsung dari infeksi di dekat
paru-paru.
Beberapa orang yang rentan (mudah terkena) pneumonia adalah:

1. Peminum alkohol
2. Perokok
3. Penderita diabetes
4. Penderita gagal jantung
5. Penderita penyakit paru obstruktif menahun
6. Gangguan sistem kekebalan karena obat tertentu (penderita
kanker, penerima organ cangkokan)
7. Gangguan sistem kekebalan karena penyakit (penderita AIDS).
Pneumonia juga bisa terjadi setelah pembedahan (terutama
pembedahan perut) atau cedera (terutama cedera dada), sebagai
akibat dari dangkalnya pernafasan, gangguan terhadap
kemampuan batuk dan lendir yang tertahan.
Yang sering menjadi penyebabnya adalah Staphylococcus aureus,
pneumokokus, Hemophilus influenzae atau kombinasi ketiganya.
Pneumonia pada orang dewasa paling sering disebabkan oleh
bakteri, yang tersering yaitu bakteri Streptococcus pneumoniae
(pneumococcus).
Pneumonia pada anak-anak paling sering disebabkan oleh virus
pernafasan, dan puncaknya terjadi pada umur 2-3 tahun. Pada usia
sekolah, pneumonia paling sering disebabkan oleh bakteri
Mycoplasma pneumoniae.
Pneumonia dikelompokkan berdasarkan sejumlah sistem yang
berlainan. Salah satu diantaranya adalah berdasarkan cara
diperolehnya, dibagi menjadi 2 kelompok, yaitu “community-
acquired” (diperoleh diluar institusi kesehatan) dan “hospital-
acquired” (diperoleh di rumah sakit atau sarana kesehatan lainnya).
Pneumonia yang didapat diluar institusi kesehatan paling sering
disebabkan oleh Streptococcus pneumoniae.
Pneumonia yang didapat di rumah sakit cenderung bersifat lebih
serius karena pada saat menjalani perawatan di rumah sakit,
sistem pertahanan tubuh penderita untuk melawan infeksi seringkali
terganggu. Selain itu, kemungkinannya terjadinya infeksi oleh
bakteri yang resisten terhadap antibiotik adalah lebih besar.
Gejala
Gejala-gejala yang biasa ditemukan adalah:
– batuk berdahak (dahaknya seperti lendir, kehijauan atau seperti
nanah)
– nyeri dada (bisa tajam atau tumpul dan bertambah hebat jika
penderita menarik nafas dalam atau terbatuk)
– menggigil
– demam
– mudah merasa lelah
– sesak nafas
– sakit kepala
– nafsu makan berkurang
– mual dan muntah
– merasa tidak enak badan
– kekakuan sendi
– kekakuan otot.
Gejala lainnya yang mungkin ditemukan:
– kulit lembab
– batuk darah
– pernafasan yang cepat
– cemas, stres, tegang
– nyeri perut.
Diagnosa
Pada pemeriksaan dada dengan menggunakan stetoskop, akan
terdengar suara ronki.
Pemeriksaan penunjang:
Rontgen dada

Pembiakan dahak

Hitung jenis darah

Gas darah arteri.


Pengobatan
Kepada penderita yang penyakitnya tidak terlalu berat, bisa
diberikan antibiotik per-oral (lewat mulut) dan tetap tinggal di
rumah.
Penderita yang lebih tua dan penderita dengan sesak nafas atau
dengan penyakit jantung atau paru-paru lainnya, harus dirawat dan
antibiotik diberikan melalui infus. Mungkin perlu diberikan oksigen
tambahan, cairan intravena dan alat bantu nafas mekanik.
Kebanyakan penderita akan memberikan respon terhadap
pengobatan dan keadaannya membaik dalam waktu 2 minggu.
Pencegahan
Untuk orang-orang yang rentan terhadap pneumonia, latihan
bernafas dalam dan terapi untuk membuang dahak, bisa membantu
mencegah terjadinya pneumonia.
Vaksinasi bisa membantu mencegah beberapa jenis pneumonia
pada anak-anak dan orang dewasa yang beresiko tinggi:
Vaksin pneumokokus (untuk mencegah pneumonia karena
Streptococcus pneumoniae)

Vaksin flu

Vaksin Hib (untuk mencegah pneumonia karena Haemophilus


influenzae type b).

PENYAKIT TBC

Pendahuluan
Penyakit TBC dapat menyerang siapa saja (tua, muda, laki-laki,
perempuan, miskin, atau kaya) dan dimana saja. Setiap tahunnya,
Indonesia bertambah dengan seperempat juta kasus baru TBC dan
sekitar 140.000 kematian terjadi setiap tahunnya disebabkan oleh
TBC. Bahkan, Indonesia adalah negara ketiga terbesar dengan
masalah TBC di dunia.

Penyebab Penyakit TBC


Penyakit TBC adalah suatu penyakit infeksi yang disebabkan oleh
bakteri Mikobakterium tuberkulosa. Bakteri ini berbentuk batang
dan bersifat tahan asam sehingga dikenal juga sebagai Batang
Tahan Asam (BTA). Bakteri ini pertama kali ditemukan oleh Robert
Koch pada tanggal 24 Maret 1882, sehingga untuk mengenang
jasanya bakteri tersebut diberi nama baksil Koch. Bahkan, penyakit
TBC pada paru-paru kadang disebut sebagai Koch Pulmonum
(KP).

Cara Penularan Penyakit TBC


Penyakit TBC biasanya menular melalui udara yang tercemar
dengan bakteri Mikobakterium tuberkulosa yang dilepaskan pada
saat penderita TBC batuk, dan pada anak-anak sumber infeksi
umumnya berasal dari penderita TBC dewasa. Bakteri ini bila
sering masuk dan terkumpul di dalam paru-paru akan berkembang
biak menjadi banyak (terutama pada orang dengan daya tahan
tubuh yang rendah), dan dapat menyebar melalui pembuluh darah
atau kelenjar getah bening. Oleh sebab itulah infeksi TBC dapat
menginfeksi hampir seluruh organ tubuh seperti: paru-paru, otak,
ginjal, saluran pencernaan, tulang, kelenjar getah bening, dan lain-
lain, meskipun demikian organ tubuh yang paling sering terkena
yaitu paru-paru.
Saat Mikobakterium
tuberkulosa berhasil menginfeksi paru-paru, maka dengan segera
akan tumbuh koloni bakteri yang berbentuk globular (bulat).
Biasanya melalui serangkaian reaksi imunologis bakteri TBC ini
akan berusaha dihambat melalui pembentukan dinding di sekeliling
bakteri itu oleh sel-sel paru. Mekanisme pembentukan dinding itu
membuat jaringan di sekitarnya menjadi jaringan parut dan bakteri
TBC akan menjadi dormant (istirahat). Bentuk-
bentuk dormant inilah yang sebenarnya terlihat sebagai tuberkel
pada pemeriksaan foto rontgen.
Pada sebagian orang dengan sistem imun yang baik, bentuk ini
akan tetap dormant sepanjang hidupnya. Sedangkan pada orang-
orang dengan sistem kekebalan tubuh yang kurang, bakteri ini akan
mengalami perkembangbiakan sehingga tuberkel bertambah
banyak. Tuberkel yang banyak ini membentuk sebuah ruang di
dalam paru-paru. Ruang inilah yang nantinya menjadi sumber
produksi sputum (dahak). Seseorang yang telah
memproduksi sputum dapat diperkirakan sedang mengalami
pertumbuhan tuberkel berlebih dan positif terinfeksi TBC.
Disamping itu daya tahan tubuh yang lemah/menurun, virulensi dan
jumlah kuman merupakan faktor yang memegang peranan penting
dalam terjadinya infeksi TBC.

Gejala Penyakit TBC


Gejala sistemik/umum
 Demam tidak terlalu tinggi yang berlangsung lama, biasanya
dirasakan malam hari disertai keringat malam. Kadang-kadang
serangan demam seperti influenza dan bersifat hilang timbul.
 Penurunan nafsu makan dan berat badan.
 Batuk-batuk selama lebih dari 3 minggu (dapat disertai dengan
darah).
 Perasaan tidak enak (malaise), lemah.
Gejala khusus

 Tergantung dari organ tubuh mana yang terkena, bila terjadi


sumbatan sebagian bronkus (saluran yang menuju ke paru-
paru) akibat penekanan kelenjar getah bening yang membesar,
akan menimbulkan suara “mengi”, suara nafas melemah yang
disertai sesak.
 Kalau ada cairan dirongga pleura (pembungkus paru-paru),
dapat disertai dengan keluhan sakit dada.
 Bila mengenai tulang, maka akan terjadi gejala seperti infeksi
tulang yang pada suatu saat dapat membentuk saluran dan
bermuara pada kulit di atasnya, pada muara ini akan keluar
cairan nanah.
 Pada anak-anak dapat mengenai otak (lapisan pembungkus
otak) dan disebut sebagai meningitis (radang selaput otak),
gejalanya adalah demam tinggi, adanya penurunan kesadaran
dan kejang-kejang.
Pada pasien anak yang tidak menimbulkan gejala, TBC dapat
terdeteksi kalau diketahui adanya kontak dengan pasien TBC
dewasa. Kira-kira 30-50% anak yang kontak dengan penderita TBC
paru dewasa memberikan hasil uji tuberkulin positif. Pada anak usia
3 bulan – 5 tahun yang tinggal serumah dengan penderita TBC
paru dewasa dengan BTA positif, dilaporkan 30% terinfeksi
berdasarkan pemeriksaan serologi/darah.
Penegakan Diagnosis
Apabila dicurigai seseorang tertular penyakit TBC, maka beberapa
hal yang perlu dilakukan untuk menegakkan diagnosis adalah:

 Anamnesa baik terhadap pasien maupun keluarganya.


 Pemeriksaan fisik.
 Pemeriksaan laboratorium (darah, dahak, cairan otak).
 Pemeriksaan patologi anatomi (PA).
 Rontgen dada (thorax photo).
 Uji tuberkulin.
BATUK DAN PILEK

Baik batuk maupun pilek


merupakan suatu gejala, bukan penyakit. Batuk adalah suatu
refleks pertahanan tubuh untuk mengeluarkan dahak, riak, dan
benda asing (misal kacang, dsb) dari saluran nafas, sedangkan
pilek adalah suatu gejala adanya cairan encer atau kental dari
hidung yang disebut ingus.
Obat batuk dan pilek digunakan untuk menghilangkan gejala
penyakit sehingga disebut simtomatik. Batuk dan pilek menyerang
saluran pernapasan bagian atas dan seringkali mengganggu
aktivitas sehari-hari. Obat batuk dan pilek dapat digunakan bila
dirasakan gejala sudah mengganggu.

Obat Batuk

Batuk terdiri dari 2 jenis, yaitu batuk kering (non produktif) dan
batuk berdahak (produktif). Untuk mengobati batuk tergantung dari
jenis batuk yang diderita.
Obat batuk dibagi menjadi:

1. Anti-tusif: dekstrometorfan dan difenhidramin


2. Ekspektoran: guaifenesin, gliseril guaikolat, ammonium klorida,
bromheksin dan succus liquiritiae
Antitusif digunakan untuk mengobati batuk kering, sedangkan
ekspektoran untuk mengobati batuk berdahak.

Antitusif bekerja dengan menekan rangsangan batuk di pusat batuk


yang terletak di sumsum lanjutan (medulla), sedangkan
ekspektoran bekerja dengan memperbanyak produksi dahak encer
yang menyebabkan kekentalannya mengurangi sehingga
mempermudah pengeluarannya dengan batuk.

Obat Pilek

Obat pilek dibagi menjadi 2 macam, yaitu:

1. Antihistamin: klorpeniramin, difenhidramin, feniramin dan


tripolidin.
2. Dekongestan: pseudoefedrin, efedrin, fenilefrin dan
fenilpropanolamin.
Pilek dapat juga disebabkan alergi. Antihistamin (AH1) berguna
untuk pengobatan simtomatik berbagai penyakit alergi dan
mencegah atau mengobati mabuk perjalanan. Penyakit alergi tipe
eksudatif akut dapat diobati oleh AH1 tetapi efeknya hanya
membatasi dan menghambat efek histamin yang dilepaskan pada
saat reaksi antigen-antibodi terjadi.

Dekongestan bekerja dengan menimbulkan venokonstriksi


(penyempitan pembuluh vena) dalam mukosa hidung sehingga
mengurangi volume mukosa dan akhirnya dapat mengurangi
penyumbatan hidung.

Obat saluran nafas golongan dekongestan digunakan dengan


tujuan untuk memperlancar pernafasan di hidung. Bentuk sediaan
yang tersedia bisa tablet lepas lambat, sirup dan drop, balsam,
inhaler, tetes hidung atau semprot hidung. Untuk semprot hidung
baiknya konsultasi dulu ke dokter.

Ketahui Penyebab Batuk dan Pilek

Sebelum memutuskan untuk mencari pengobatan, sebaiknya dicari


dahulu penyebab pilek dan batuk tersebut. Untuk pilek dan batuk
yang disebabkan oleh alergi sebaiknya menghindari zat penyebab
alergi tersebut.

Dalam mencari tahu penyebab batuk dan pilek, anda bisa mencari
pertolongan dokter. Untuk mengobati batuk, penting untuk
mengidentifikasi jenis batuk penderita apakah batuk kering atau
batuk berdahak.

Antihistamin memiliki efek samping dapat menimbulkan kantuk,


sehingga penggunaannya disesuaikan dengan aktivitas.

Untuk pemilihan obat saluran nafas yang tepat ada baiknya anda
harus periksakan diri dan konsultasi ke dokter.
MATERI : MAKANAN DAN MINUMAN YANG
BAIK SAAT BERHAJI
( Oleh Syamsuddin Azis Laba )

Pengertian Makanan sehat adalah merupakan makanan yang


memiliki kandungan gizi yang seimbang, memiliki kandungan serat
serta beberapa zat yang dibutuhkan badan untuk proses tumbuh
kembang. Menu makanan sehat harusnya kaya unsur zat gizi
seperti karbohidrat, protein, mineral, vitamin, serta sedikit lemak
tidak jenuh, atau lebih tepatnya disingkat dengan nama menu 4
sehat 5 prima.

Makanan yang memenuhi ketentuan kesehatan atau makanan


sehat yaitu makanan yang higienis, bergizi serta
berkecukupan.

Makanan Higenis
Makanan higienis tersebut yaitu makanan yang bersih serta tak
memiliki kandungan kuman penyakit dan tak memiliki kandungan
zat yangberesiko untuk badan.
Makanan Bergizi

Makanan yang bergizi yaitu makanan yang memiliki kandungan


karbohidrat, lemak, protein, vitamin, serta mineral yang jumlahnya
seimbang sesuai kebutuhan tubuh

Makanan Berkecukupan

Sedang makanan yang berkecukupan yaitu makanan yang dapat


memenuhi kebutuhan tubuh sesuai dengan keadaan badan serta
umur seseorang. Kebutuhan orang yang tengah sakit bakal tidak
sama dengan orang yang sehat, seseorang pekerja keras bakal
tidak sama dengan seseorang pengangguran. Begitupun dengan
keperluan seorang bayi, anak-anak, remaja, dewasa serta orangtua
memerlukan makanan yang tidak sama.

Untuk melindungi supaya badan kita terus bugar, makanan yang


masuk ke badan kita mesti di perhatikan. Makan seperlunya serta
tak terlalu berlebih yaitu langkah bijaksana supaya badan kita tak
rawan terhadap problem kegemukan, bergerak lamban, kerap
mengantuk, serta gampang diserang rasa malas. Di samping itu,
tak seluruhnya makanan dapat kita makan walau kita mempunyai
duit lebih untuk beli serta mencicipinya. Tiap-tiap orang mempunyai
system fisiologis yang unik didalam badannya, umumnya
mempunyai penolakan pada type makanan spesifik lantaran bakal
punya potensi mengganggu kemampuan salah satu organ badan.
Lampiran6 :Profil kesehatan Jemaah haji Kota makassar

1. berdasarkan jenis kelamin


a. lakilaki : 349 Jenis kelamin
b. perempuan : 624 laki-
pere laki
mpua 36%
n
64%

2. berdasarkan pendidikan:
a. SD : 218 orang Pendidikan SD
b. SMP : 126 orang
SMP
c. SMA : 283 orang 1%
SMA
4%
d. D3 : 47 orang 26% 22% D3
e. S1 : 254 orang 5% 13%
S1
29%
f. S2 : 38 orang S2
g. S3 : 6 orang S3

3. Berdasarkan umur :
a. 20 – 29 thn : 15 orang UMUR
b. 30 – 39 thn : 85 orang 20-29 th
2%
c. 40 – 49 thn : 314 orang 7% 9% 30=39 th
d. 50 – 59 thn : 311 orang 18%
32% 40-49 th
e. 60 – 69 thn : 173 orang 32% 50-59 th
f. ≥ 70 thn : 72 orang 60-69 th
≥70 th
4. Berdasarkan Pekerjaan :
a. IRT : 367 orang
b. PNS : 223 orang Pekerjaan
c. BUMN : 29 orang Irt
2% 2%
d. TNI/POLRI : 12 orang 6% pns
39% bumn
e. Swasta : 214 orang 23% tni/polri
f. Petani : 20 orang swasta
1% 3% 24% petani
g. Pelajar : 16 orang
pelajar
h. Wiraswasta ; 52 Orang

5. Berdasarkan Kategori Resti :


a. Merah : 83 orang kategori Resti
b. Kuning : 186 orang
c. Hijau : 134 orang 8% merah
19%
d. Putih : 570 59% 14%
kuning
hijau
putih

6. Berdasarkan penyakit terbanyak:


a. Z.00 : 366 orang
b. I.10 : 184 orang penyakit terbanyak
c. R.54 : 224 orang Z.00
d. E.11 : 78 orang 6% 6% 7% I.10
7% 35% R.54
e. K.30 : 65 orang E.11
f. N.30 : 58 orang 21%
18%
K.30
g. E.66 : 70 orang N.30
E.66

Kesimpulan :

Berdasarkan hasil tersebut dapat kami simpulkan potensi kesehatan


jemaah haji kota Makassar tahun 1438 H/2017 M adalah : 25 % jemaah
adalah usia > 60 thn, 40 % dari total jemaah adalah resiko tinggi dengan
klasifikasi resti usia dan resti penyakit.