Anda di halaman 1dari 67

STA\DAR PROSEDUR OPERASIONAL (

SPO )
INSTALASI LAB ORATORIUM
RSUD KUALA PEMBUANG

KABUPATEN SERUYAN

I{StJ l) KTJAI-A ptrMI}IJA N(;


Alamat: JI. A. yani No.30 Kuara pembuang
742il Karirnarrtal ,r,engarr
Tetpon. (053S) 2t0t7 Faximite. (OS:g)
2t566
e-mail : rsud seruyan@yahoo.com
K.{T.i P!),G,{\TAR

Dengan Rahmat Tuhan Yang lvfaha


Esa, atas kerja keras dan kerja
sama semua pihak,
standar prosedur operasionar (
-ftr' spo ) ini dapat diterbitkan.

sDo ini dimaksudkan untuk panduan


dan persamaan persepsi semua
staf peraksana di
h*rhci rrrrat jalan,
rawat inap dan instalasi penunjang
RSUD Kuala pembuang dengan tujuan
ldrB tonsistensi dalam pemberian pelavanan medis
seoptimal mungkin dan menghindari
h'.hrn dalam pelaksanaan kegiatan sesuai kondisi
dan kemampu&n rumah sakit. spo yang
H ftd ini mengacu pada perkembangan kemajuan
ilmu kedokteran yang mutahir dan
fl-gr-r dengan kasus - kasus penyakit yang
banyak dijumpai di RSUD Kuala pembuang.
h3r&nikian sPo ini dapat menjelaskan alur, tugas
wewenang dan tanggungjawab dari
qEd[ RsuD Kuala Pembuang' Harapan kami setiap
semoga spo ini rnemberikan banyak
manfaat
tqitirmua
Eckhilafan dan kekurangan
dalarn penyusunan Spo ini karni
mohon m.aaf dan kami
*d'arrmasukanlmu,ukanIebihlanjutuntukpenyempurnaannya,Terimakasih.

Pernbuang, Februari2016
UD Kuala Pembuang

PenataTK.l/ IIId
NIP. I 977022? 20a604 I 012
1

ll

i: 'e:'.x
Operasional

S.._ :r- Prosedur Operasional I


- J::::{<saan Urine Carik Celup 2
- !:=;:*<saan Faeces J
- J':'.,"-::ia.rr Basil Tahan Asam (BTA) Sputum 4
: i:-::isaan Sedimen Urine 5
: J =:*::.-:an \{utu Eksternal Kimia klinik dan Hematologi 7
- i:';-::an Gram ( N. Gonorhoe) 9
r I :-:::isaan Kusta l0
: ::-iabilan Sampel Darah Vena 11

- i::;rlbilan Sampel darah Kapiler 13


. !:=::isaan Hemoglobin Metode Sahli l4
- l:-::jsaan Hitung Eritrosit l5
: l:=e:isaan Hitung Lekosit 16
- !::-e::-<saan Hitung Trombosit t7
: l:=e::ksaan Laju Endap Darah (LED) 18
: ::-ei$aan Masa Perdarahan (BT) t9
- l::-e:isaan Masa Ppmbekuan Darah (CT) 20
! J:-:iksaan Golongzur Darah 2t
: :::eiksaan Hematokrit
-- 22
- J::::riksaan Mean Corpuscular Volume (MCV) 23

- j:::enksaan Mean Corpuscular HernogloDir (MCII) 24


-.- l::reriksaan Mean Corpusculur I lcmoglobin Concutlrutittrt (MCIIC) 25
:r !:::reriksaan Hitung Jcnis l-ckosit 26
-- ?:meriksaan Gulo f)nruh 27
-: ?:::reriksaan Kolesterol Total Daruh 28
- : ?:n:reriksaan Trigliserida Darah 29
-
- Perneriksaan Asam Urat Darah 30
: ! ?emeriksaan HDl-Kolesterol Darah 3l
:
- ?emeriksaan LDl-Kolesterol Darah 32
r , Jemeriksaan SGOT JJ
i . ?emeriksaan SGPT 34
- - lemeriksaan Kreatinin 35
- -" ?emeriksaan Ureum 36
: - ?emeriksaan Bilirubin Total 37
:: ?emeriksaan Bilirubin Direk 38
39
:: ?e:tenitsaan Biikubin Indirek
: - ?enerii<saan \\-idal Te st
40

: i Pemeriksaan HBs Ag
4l
42
: i ?eneriksaan HBs Ab
:. Pe=erilsaan Ig G dan Ig M 43
: - ?::eriksaan Malaria 44
:,1 ?:=eriksaan S,vpilis 45

:-" ?:::e:-iksaan HCV 46


:-: ?e:*e :*saan Narkoba 47
50
-j ?::eisaanNS 1 Dengue Test

; :l 51
-l-l
w:.:-_..-..;-.'.,-..l*.'.'-':.=....]=..-.-."T::i::.w
=--- -: - -- : - -- ''-:ri1
-.- 1- - : :
-F

K=F---S::. I;'!(T..lR
RUMAH SAKIT Uli4{.Jti4 DA=Ri:-1 KUALA PEMBUANG
Nomor .4451 -J-' RSUO-K?1112016

TENTANG

KEBIJAKAN PELAYANAN LABORATORIUM

f IREKTUR RUMAH SAKIT UMUM DAERAH KUALA PEMBUANG


tl--
t= - e€ rg

a dalam upaya meningkatkan mutu pelayanan Rumah Sakit Umum


Dan,yA/a
laerah Kuala Pembuang, maka diperlukan penyelenggaraan pelayanan
-aooratorium yang bermutu tinggi;
: cahwa agar pelayanan Laboratorium di Rumah Sakit Umum Daerah Kuala
sernbuang,dapat terlaksana dengan baik, perlu adanya kebijakan Direktur
R unrah Sakit Umunr Daerah Kuala Pembuang sebagai landasan bagi
:enyelenggaraan pelayanan Laboratoriurm di Rumah Sakit Umum Daerah
(uala Pembuang;
: cahwa berdasarkan pertimbangan sebagaimana dimaksud dalam a dan b
perlu ditetapkan dengan Keputusan Direktur Rumah Sakit Umum Daerah
Kuala Pembuang.

'l*le-.Jrngat :

' Undang-Undang Republik lndonesia Nomor 44 tahun 2009 tentang Rumalr


Sakit
i Peraturan Menteri Kesehatan Nomor 269 /Menkes/Per/lll/2008 tentang
Laboratorium
Keputusan Bupati Seruyan Nomor 2gO Tahun 2009 tentang lzin
Penyelenggaraan Rumah Sakit Umum Daerah Kuala Pembuang.
PERDA Kabuapten Seruyan Nomor 01-12 Tahun 2008 tentang Struktur
Organisasi Rumah Sakit Umum Daerah Kuala Pembuang.
Keputusan Menteri Kesehatan Republik lndonesia Nomor
YM.O't .1}lllll}Ogat2010 tentang Penetapan Kelas Rumah Sakit Umum Daerah
Kuala Pembuang Kabupaten Seruyan Prgvinsi Kalimantan Tengah.
<== 9 VV' Q:.,j t I =:.-_= : _:.!:- S:(,; _1,,,1-l,i DAERAH (LiALA
--i E
a- . \
l t9 ^ -=T"-1T. A <EB]JAKAN PELAYANAN
3:( - t_[4uM DAERAH KUALA
',gvi

?, _"rr-

Kebl.laxan pelayanai -ct3'3i3i,-;fi't Rumah Sakit Umum Daerah


Kuala Pembuang se.€ja ^'rana tercantum dalam Lampiran
Keputusan ini.
Pembinaan dan pengavrasan penyelenggaraan pelayanan
Laboratorium Rumah Sakit Umum Daerah Kuala Pembuang
dilaksanakan oleh Seksi Pelayanan Rumah Sakit Umum Daerah
Kuala Pembuang.
Keputusan ini berlaku sejak tanggal ditetapkannya, dan apabila di
kemudian hari ternyata terdapat kekeliruan dalam penetapan ini
akan diadakan perbaikan sebagaimana mestinya

Ditetapkan di Kuala Pembuang

'M ada Tanggal Januari 2016

(d
r RSUD Kuala Pembuang

\o
'-) i
t/*lrnl
au/4-

Sn TK.t/iltd
NtP. 19770222 200604 1 012
KEBIJAKAN PELfi.YAil'Til ITBORATORI U M
RUMAH SAKIT UMUM T}AERA}I KUAIA PEMBUANG

Kebijakan Umum
L Peralatan di unit harus
setatu dilakukan pemeliharaan dan kalibrasi
sesuai dengan kdtentuan yang berlaku.
L Pelayanan di unit harus selalu berorientasi kepada mutu dan
keselamatan pasien.
3- Semua petugas unit wajib memiliki izin sesuai dengan ketentuan yang
bedaku.
tt- Dalam melaksanakan tugasnya setiap petugas wajib mematuhi
ketentuan dalam K3 (Keselamatan dan Kesehatan Kerja)
5. Setiap petugas harus bekerja sesuai dengan standar profesi, standar
prosedur opersinal yang berlaku, etika profesi, etikket, dan menghormati
hak pasien.
6. Pelayananrunit dilaksanakan dalam 24 iam.
7. Penyediaan tenega harus mengacu kepada pola ketenagaan,
8. Untuk melaksanakan koordinasi dan evaluasi wajib dilaksanakan rapat
rutin bulanan minimal satu bulan sekali.
9. Setiap bulan wajib membuat laporan.

Kebijakan Khusus
1. Peralatan laboratorium harus selalu dilakukan dan kalibrasi sesuai
dengan ketentuan yang berlaku
2. Setiap pemeriksaan laboratorium harus berdasarkan atas permintaan
dokter
3. Pelayanan laboratorium harus selalu berorientasi kepada mutu dan
keselamatan pasien
QAt 2 7r p€:uEas

NtP. 19770222 200604 1 012


rL-lr ? :t r
Afl I\-{}'L rA I L-\ sERL-I-.{\
r
'<
RSIID KUAIJI PETf,NUAIYG
'r,:-T,r,. ., r-': r" .\: l- (-;_r pcr,bJ'.ar3 -.1:,. i:r.,:-6r-:.i' :3:€t:
le.3:r. .::i lr;ll ii,rrrark,:r-<ls ::_(it
a-:_i, iirre scrur.li irajt-t l-r,
PEDOUAH PELAYAT{AX UEDIS \o. Dokumen : r spo,L,{8,, ir 2;
--.-a- l::uai:
Tanggal Berlaku
:
Nama Bagian : INSTALASI LABORATORIUM

Halaman

Dtroapkarr olclr ; \
S"ANDAR PROSEDUR Kudt Pombuang
oPERASTONAL (SPO) ,,/:i___ _9trclil'tr
l'Jl i(!)ulJ /
- \ :,tt A i'ti/'tluArl
200604 I O12

Pelayanan pasien BPJS adalah semua pasieen yang


'anannya di
Memberikan pelayanall yang optimal terhadap pasien
BPJS sesuai rosedur
Pasien dinyatakansebagai pasien BPJS bila menunjukkan
kartu anggota BPJS
Pasein datang ke IGD melalui t iis@
rujukan langsung dilayani petugas IGD.
Apabila ada Kartu BPJS, Diminta fotokopinya sebanyak s
lembar atau apabila tidak ada dicatat identitasnya dan
nornor BPJSnya pada lembaran Bukti pelayanan BPJS (g
lembar, warna putih, merah dan hijau).
Kemudian pasien atau keluarganya membubuhkan tand.a
tangan pada lembaran Bukti pelayanan BPJS.
setelah dilakukan pemeriksaan, apabila pasien pulang
(tidak rawat inap), obat-obatan diberikan untuk 1 (satu)
hari dan pada blangl<o resep dilampirkan I lembar bukti
pelayanan BPJS (warna merah), untuk mengambit obat d.i
apotik.
Untuk pasien rawat inap,setelah diperiksa dan dilakukan
tindakan, dibuatka:i resep untuk ke apotik, dan
menandatangani surat pernyataan rawat inap
* ::R.KAIT 1. Instalasi Rawat Inap
2. Instalasi Farmasi
3. BPJS
4. Rekam Medik
P E.\Tf R[\T.r-}tr Lr IJ L I,.\TE\ SERL \",T\
R SEID EUAI.A PE*f,nfl61Yg
(s),
-,
'-,/
i, r' - " E:" 'q:--'. \-.u.r . ; -r,; -.111I (arnrar n Tcngdr
-::r:n. lj-:i : ..- r,r;irrc tu5l8tll5ti
i*:-''L'

PEDOH.A'I{ PEI.AYANAN MEDI 8 5; Dui*rrrcrl : 2 ,/SI'O/ L^l.r/ ll/2016


: Tariggal Uerlak:
)ia:::a [3;rgiirrr : INSTAI.ASI TABORATORIUM
:

PEMERIKSAAI{ URINE
CARIK CELUP

f,
: Prosedur ini memuat tatacara pemeriksaan kehamilan
dengan strip test dengan bahan urin.
adanya kandungan hormon HCG Pada
dan hasilnya dinyatakan secara kualitatif.
: 1. Adanya surat permintaan dari dokter
2. Adanya sampel urin
3. Petugas analis kesehatan
;: -:alUR : 1. Siapkan wadah penampung urin yang bersih dan kering.
2. Tampung sarnpel urin segar dalam wadah yang sudah
disiapkan.
3. Buka kemasan almunium strip test, mengeluarkan strip
' tersebut untul melakukan pemeriksaan.
4. Celukkan strip test kedalam sampel urin sampai bagian
batas tertentu sesuai pada tanda strip, membiarkan 3- 10
detik. Mengangkat strip tersebut.
5. Menunggu 1-3 menit, kemudian baca hasil test'
Cara pembacaan hasil test :
+/Post : Muncul dua garis merah muda (garis C dan T)
-/Neg : Muncul satu garis merah muda (garis C)
Invalid : tidak ada garis yang muncul

. ::Ri(AIT Unit sampling


Unit urinalisa

2
,.Gl{\
RSIID I(IIAII*s::fPEIBSA.ilG
(9),, i.
"i: J; . , \ ': r \: :l
-lep:r^ l:ii
.n
-,!"-it
-{-
,-urr5
I I -:nmr;t-
(-& rn.Itr{! - !r'{,J
lJ:"| I !t
\l-/
FEDOMA}{ PEI.AYA!{AI{ rfFDIS .\: -:*-::.tr" : S:: ,..til I; 20l6
Ta::gga, Berlak;
lia::a 3ag:a;. : lliSTAI {SI IIBORATORIUM

ffi
:

Halaman I Dari
1 1

Kueta Pombuang
PEUERIKSAAI{ FESES
Ail"D-
l or2
K"ffirubahan 20,0,60,4
r"t5""
;:1. ::RTI"A,N : Prosedur ini memuat tata cara pemeriksaan feses secara
mikroskopis dan makroskopis.
-- "*-"xj; : Mengetahui unsur-unsur dalam feses yang dapat diamati
secara mikroskopis.
[.- F;"IJ.{N : 1. Adar:.ya surat permintaan dari dokter
2. Adanya sarnpel dengan identitas yang lengkap dan jelas
3. Petugas analis kesehatan

flR:S:DUR : 1. Dengan menggunakan lidi diambil sedikit feses (daeratr


yang mewakili), letakkan pada kaca objek yang bersih dan
kering.
2. Meneteskan 1 tetes eosin 27o, kemudian homogenkan.
3.: Menutup dengan cover glass.
4. Memeriksa dibawah nrikroskop dengan pembesaran objektif
10X dan 40X.
5. Laporkan unsur-unsur yang ditemukan.
Cara pembacaan hasil test :
+/Post : Muncul dua garis merah muda (garis C dan T)
-/Neg : Muncul satu garis meratr muda (garis C)
Invalid : tidak ada gari.s yang muncul
' - ::-?jii.IT 1 Poliklinik
2 Ruang rawat inap
3 Unit mikrobiologi
r'H, PE.\IfRL\-T.{I{m
,(gD Rs;t D EUALA PTTTEUAIVG
Aja:r:ar .', r- 'r i!-, '*: f
: Kalimantan tcngah
\=Efl lc.e:c -:l-. :=.._p-rbuang742lt
llr3l7 ;*,rB,.-(0j3g) 21566

}:SDOIAIi PEI.AYANA!{ UEDIS \-o. Dokumen :4 /sPo/LABI u/2016


-:---laa- Dibuat :
Tanggal Berlaku
, Nama Bagian : INSTALASI LABORATORIUM
-.-

,wa.R-tiAAN BASrL TAHAN


ASAM (BTA)
SPUTUIIT Kurle Pombueng

Peruhnhn4 Besar
L_J
memuat tatacara perwarnaan
Ziehl-Neelsen.
Untuk -"rrg"
l.Adanyasuratffi
2. Pengambilan sampel didaerah yang mewakili (sesuai
rujukan)
3. Petugas analis kesehatan

: 1. Buat sediaan-pEE-o!
merata pada objek glass.
2. Fiksasi sediaan tersebut diatas lampu
spritus.
3. Sediaan/ preparat diletakkan pada rak pengecatan.
4. Menggenangi sediaan dengan larutan
kristar gentian vioret (Gram
A) selama 3-5 menit.
5. Bilas dengan air kran.
6. Menggenangi dengan lanutan Lugol (Gram
B) eelama l-2 menit.
7. Bilas dengan air kran.
B. Menggenangi dengan larutan Asam Alkohol 2_3
menit
9. Bilas dengan air kran.
10. Menggenangi dengan larutan carbol fuchsin
(Gram D) selama 3-S
menit.
11. Bilas dengan air kran dan keringkan
disuhu ruang.
12, Menulis hasil pembacaan yang diamati/formulir
hasil
pemeriksaan dan buku arsip.
13. Setelah di tandatangani oleh sub mikrobiologi
klinik hasil siap
dikeluarkan.

tt,,uifi ..*"t Go1, .ffiil;]tuunplinr{


PT TA,NN:.{{ I(ABL?ATEN SERTIYAN
RST'D KTIAI.A PEMBUANG
Alamu : .il. A Yr. S;-1lr Kua.la Panbuang 7421I Kalimantan Tengah
Tcipcn i'!5i6 r li0l7 Faximilc. (0538) 21565
e-rr,ari . '- l:"'r1l i/ \illlLrl\ !lrlll

FEDOIIAII PELAYANAN MEDIS No. Dokumen:5 /sPo/LAr / ttl2oto


--.ggal Dibuat : TANggAl BCTIAKU
NAMA BAgiAN : INSTALASI LABORATORIUM

Kuala Pombuang
PEXERIKSAAT{ SEDIMEN URIN

ini mem\rat tatacasa sedirnen


- : l; -'3RTIAN melalui
unsur-unsur sedimen dalam urin'
;.:JAKAN dari dokter
,
2. Adanya sampel urin
3. Petugas analis kesehatan

;:-S:fUR @dihornogenkan'
2. Memasukakn 7-8 ml urin yang sudah dihomogenkan
kedalam tabung sentrifugasi'
kecepatan 3000
3.. Mensentrifugasi selarrra 1O menit dengan
rDm.
gerakarr yaflg cepat,
4. Buang bagian tengah urin dengan satu
yang masih
kemudian geraktan lagi tabunt sehingga cltran
melekat pada dinding tabung mengalir
kembali kedasar
tabung (Volume urin yang tersisa t 0'5 ml'
sedimen'
5. Menghomogenkan tabung untuk meresuspensikan
I
6. Dengau mcnggunakan pipet pasteur teteskan
tetes

seclimcn pttcltr kaca objek glass'


7. Menutup tctesan dengan kaca pcnutup'
g.Memeriksadibawahmikroskopd"rrgorrpernbesaranobjcktif
lox dan 40x.
g. kecil)
periksa claram beberapa rapangan pandang (besar dan
* 1O laPangan Pandang'
buku register dan
lo.Catatan ttporrn hasil pemeriksaan dalam
lembaran hasil yang sudah divalidasi'
P T IMNNT.{H L{BL?ATE){ SERUYAN
RST]D TUAI.A PF'MEUAITG
.{ia.-na.i d rr- f.: i. tiL{
-: Fa-.rbuang ?421I Kalimantan Tcngah
ie.p:c- -i3'i l,l;- Farrmile. (0538) 21566

PEDOUAN PEI,AYANAI{ UEDIS 5o. Dokumen : s lsPo|LAB/ II l2016


. a::ggal Dibuat : Tanggal Berlaku Nama Bagian : INSTALASI LABORATOzuUM

PEMERIKSAAN SEDIMEN URIN

Pcrulsbal B€sar

: ;ERKAIT Poliklinik
Ruang rawat inap
IGD/UGD
Unit sampling, Cito dan Urinalisa

6
,1.
PE.\IERI\-T.{.[I L{3 L?A TI.\ Sf.R L-\'$
-.KgD R.SUD KIIAI_A PFTf,EUAIIG
.Llam:: .'. .r" -::r-.\.::- i. t.: P::::,-r.g -.11
., lia.lmanran Tcngah
c;r- -::i l" . i- ;er;-.e \: j-:E 11566
\-rsl "

lEDouAN PELAYAI{AI{ rf,EDIs ro. Dokumen : 6 rspo/LABI tr/2ot6


L-E*1 JrUUd,L Tanggal Berlaku
-! 4ltd : LAE}ORATORIUM

}qilA:{TAPAT{ MUTU EKSTERNAL Kuala Pembuang


MflA I(TIMK DAI{ HEMATOLOGI

g :,1---
Qh
tlerubahan
Prosedur ini memuat tatacara pelaksanaan pemantapan
mutu eksterna-l (PME) ldmia klinik dan hematologi dengan
contoh bahan uii dan nilaian dari KEMENKES.
Untuk melaksanakan pengendalian dan pemantapan
mutu pemeriksaan kimia lclinik dan hematoloei.
- : - i-i"-\; 1. Adanya surat dari KEMENI(IIS RI tentang tatacara PME
2. Adanya srunpel bahan uji dari I(EMENIflCS
3. Petugas analis kesehatru'r
,i "::' _R 1-P"t"gr;l"bor"toriur" -Ft;t*tdrirnan -.ail'i
"*ii;;i;m
KEMENI(trS melalui petugas administrusi I?SUD Seruyan.
2. Kepala Instalasi laboratorium bersama koordinator kimia
klinik dan hematologi mengecek paket kiriman yang berisi :

tatacara pelaksanaan PME dan bahan uji dalam kemasan


terpisah.
3. Koordinator mempelajari tatacara dan mencatat waktu
pelaksanaan PME,Bahan uji disimpan diunit masing-masing
4. Pelaksanaan PME dilaksanakan sesuia dengan jadwal dari
pandnuan tatacara pelaksanaan KEMENKES di unit kimia
ktinik dan hematologi.
5. Koordinator unit kimia klinik dan hematologi selama
pelaksanaan berkonsultasi dengan kepala instalasi
labratorium.
6. Kepala instalasi menerima hasil PME dari masing-masing
unit.
7. Kepala instalasi mengecek dan memvalidasi hasil PME
8. Hasil PME dikirim melalui POS kilat ke KEMENKES
9. Evaluasi PME dikirim dari KEMENKES melalui Direktur
RSUD Seruyan.
10.Kepa1a Instalasi Laboratorium membahas hasil PME dan
tindak lanjutnya dengan masing-masing unit.
1 1. Kepala instal.asi memberi subcopy hasil PME

1
P E.UERLYT.{,E L{B L?ATE N SE RL-}'A*\
R.SUD EUAI.A PEMBUAXG
A:E-T.ai .. 1- ':'r '"::. (--: ?<,-,buarg 74?l I Kalimantan Teneah
.c ;=- .::i l,-"- Farimrlc. (0538)11566

PEDOUAN PELAYANAN I'{FDIS \o. Dokumen:6 /sPo/LABI ttl2oL6


alnGr,ot Dibust t Tanggal.Bcrlaku
I I
n -*Bagian : INSTALASI LABoRAToRIUM

PS}(ITTAPAN MUTU EKSTERI{AL Kuelr Pombuang


raf,rr t KLINIK DAN HEMATOLOGI
au/4-

.g =;-:-

* -:?iA.IT Petu gas administrasi RSU D St:rttyan


Unit kirnia klinik dan hentutologi
Petugus u:rulis kesehatan

S
PE }[ERI\ T"{'H L{ B L.PATE\ SERUYA\
RSUD KTIAIJ\ PFIUBUANG
Alarnal . ji .rt 'r'r- !.:-;.: KuaJa Pqnbuang 74211 Kalinrurrtan Tcngah
Tcia-n ,.5-:tr2l0l7 I'aximilc. (053t) 21566
+Cef ; - r:l\ ill (/ \,lllol a(lll
PEDOIIAIV PELI\YANAI{ !f,EDIS No. Dokumen:7 /SpO/LABI ill2OL6
Tanggal Dibuat: Tanggal Berlaku
Nama Bagian : INSTALASI LABORATORIUM

Ifulh Pomburng
?ERWARI{AAI{ GRAM (N. GONORE)

PerulebeJ Bcssr

;: ); T3ERTIAN : Prosedur ini memuat ta.tacara perwarnaan bakteri dengan


mengzunakan perwarnaan
lllL,rltsEullaAqrr vvl vYql lrqqrl Gram
v

: Mengetahui adanya bakteri gram positif dan gram negatif.


; :: JAKAN : 1. Adanya surat permintaan dari dokter
2. Adanya sarnpel
3. Petugas analis kesehatan

- SEDUR : 1. Oleskffr bahan pemeriksaan pada objek glass, membiarkan


kering disuhu ruang dan fiksasi dengal melakukan dratas
nyala api lampu sPritus.
2. Menggenangi dengan larutan carbol gentian violet sela..'a 2-
. 3 menit.
3. Membilas dengan air mengalir.
4. Menggenangi dengan larutan lugol (iodine) selama 1-2 menit
5. Membilas dengan air mengalir'
6. Menggenangi dengan alkohol 95% selama 2O-4O detik,
kemudian membilas dengan air mengalir.
7. Keringkan disuhu ruang dan periksa dengan objektif 100x.
8. Catatan laporan hasil pemeriksaan datam buku register dart
lembaran hasil yang sudah divalidasi.
Hasil : Gram (-) Diplococcus Intra/ekstra selluler t (merah)
Gram (+) berwarna merah

I :ERKAIT Poliklinik
Ruang rawat inap
Unit sampling

9
PE }TERI\T.TH L,T B L I,ATEN SERU},A}.
R.STID KUAI,A PE.UBUAI{G
,.\ignr,r i .t 'r r- \::- r".,r,.r i'dnhualr8 7421i Kdrmartan Tcngah
. c-3": -: i i I ,- l - l rurnrLc (0518) 21 56{r
C r-- -L

PEDOUAN PELAYANAN MEDIS 5o. Dokurr)elt : u /st)o /t,A|l n/2016


-1-"-a- Dibuat rTanggal l-]erlaku
Nana [3agiqlr : INS'I'ALASI I,AUOIiATORIUM
:

Hnlaman Dari

Kurls Pombuang
PEUERIKSAAT{ KUSTA
a/il4-
20,0,60,4 I O12
Perulahal Besar

rrr :- --:RllAN : Prosedur ini memuat tatacara pemeriksaan Kusta.

lGAUeX : Untuk mengetahui bakteri kusta.


q Tl: *---ii{lV : 1. Adanya surat permintaan dari dokter
2. Adanya sampel
3. Petugas analis kesehatan
nq - !:lUR : 1. Kaca objek diberi nama pasien dan tanggal pemeriksaan.
2. Permukaan kulit pada bagian yang akan diambil
diberisihkan dengan kapas alkohol 7Oo/o.
3. Memjepit kulit pada bagian tersebut dengan forsep atau
dengan jari tangan untuk menghentikan aliran darah
kebagian tersebut.
4. Dengan lanset/pisau steril kulir dibuat sayatan sedikit * 5
mm kedalaman 2mm ngar mencapai dermis. Bila terjadi
perda-rahan, bersihkan dengan kapas steril.
5. Kerok tepi dan dasar sayatan secukupnya dan melekatkan
pada kaca objek, kemudian ratakan hingga membentuk
lingkaran dengan garis tengah * 1 cm.
6. Mengeringkan di suhu ruang.
7. Melisiskan Hb dengan merendam sediaan dengan aquadest
* 1 menit.
8. Mengeringkan di udara.
9. Fiksasi diatas nyala arpi spritus 2-3 kali dan warnai denga
perwamaan Ziehl Nellsen (ZN).
* -:?JiA.IT Poliklinik
Ruang rawat inap
Unit sampling
Unit mil<robiologi

lrl
I,t-!If RI\-T\fi L\BL P.{TE\ SEIiI.;YAN
RSf,D ITUAIT PEITBUAI{O
Aia:r:ri .l r. : lri-- '.- i"- ,u-r-r l'gflbuafl8 74211 Kulrrlrrurtut Icttgu.ll
i:, ;rr -
j:' i : , . - l--arrntrlc. (0,5.j8) 2 l 5fr{r
:-:J-

PEDOUAN PEIITYN{AN DIEDIS No. Dokumen : e /SPo/LAll/ Il /2016


Tanggal Dibuat : Tanggal Berlaku : INSTALASI LABORATORIUM

PENGAITIBILAN SAMPEL DARAH Kuala Pombuang


\rENA

200604 I Or2
neruTl

I
eesar
tf
Perubahan Kecil

piosedur ini memuat tatacara pengambilan sampel darah


vena.
: Mendapatkan sampel darah vena dari medicana cubital.
. ; --'.j.i(AN 1.Adanya surat permintaan pemeriksaan.
2. Adanya pasien yang bersangkutan.
3. Perawat

1. Gtatt<an lengan pasien lurus diatas meja dengan


' telapak tangan menghadaP keatas.
2. Kemudian lengan diikat cukup erat dengan torniquet
untuk membendung aliran darah, tetapi tidak boleh
terlalu kencang sebab dapat merusak pembuluh darah.
'
3. Pasien disuruh mengepal dan membuka tangannya
beberapa kali untuk mengisi pembuluh darah.
4. Dalam keadaan tangan pasien masih mengepal, ujung
telunjuk kiri perneriksa mencari lokasi pembuluh darah
yang akan ditusuk.
5. Bersihkan lokasi tersebut dengan kapas alkohol dan
biarkan kering.
6. Peganglah spuit dengan tangan kanan dan ujung
telunjuk pada pangkal jarum.
7. Tegangkan kulit dengan jari telunjuk dan ibu jari kiri
diatas pembuluh darah tidak bergerak, kemudian
tusukkan jarum dengan sisi miring menghadap ke atas
dan membentuk sudut t 25".
8. Jarum dimasukkan sepanjang pembuluh darah * 1 - I
thcm.
9. Dengan tangan kiri,
perrgisap spuit ditarik perlahan -
lahan sehingga darah masuk kedalam spuit.
10. Kepalan [angan dibuktr clnn Torniquet direnggangkan
aLau dilcpus sampai diduputl<un sejumluh darah.

.1
RSED EUAI-A FItEls urtr u
l'11 I I Keirrnrr'un Tcrgait
i.,d-,-ii ". !- ' rI *r: -rj r"uur ::r':r:rng
--;*:m- lil'[ ] l--:s:rnric r,05it)11566

PEDOUAN PELAYA}TAN UEDIS


l(;--,a tsagran : INSTALASI LABORATORIUM

Kuala Pombueng
PENGA}IBILA SAMPEL DARATI
VENA u/">

Peru\ahan Besar
T5*
: tusukan' jarum
- :.DUR 1.
ditarik kembali.
2. Bekas tempat tusukan ditekan dengan
kapas tersebut
selama beberapa menit dengan tangan masih dalam
keadaan lurus lsiku tidak boleh ditekuk)'
3. f,"pa..t jarum dan spuitny? dan alirkanlah (iangan
"t, kedalam wadah atau tabung yang
ai""*ptotkan)
tersedia melalui dindingnYa'

Unit samPling
Unit Pemeriksaan

t2
P E.\ TEJTLr-.:T.I'H L{B L?ATE\. SERLY.{\
R.STD KUAI.A PEMBUAI{G

@ PEDOHAN PELI\YANAN
A;a-t.l -', r- -: rr. t.::l r.-r-e is:lbuang 7.{2ll Kalimantan Tenga}r

I{EDIS
lc.r:r. -j---i l"li' Faximjle. (053t) 21566

-\c" Dokumen : lo /spo/LAn/ rr /2016


T-:ggal Dibuat: Tanggal Berlaku
J2n.,a Bagian : INSTALASI LABORATORIUM
:

FE;I[ GA.UBILAN DARAH I(APILER Kueh Pombueng

20,0,60,4 I Ol2
- - =i--- Peruf[ql Besar
tl
"- ,:RTL{N : Prosedur ini memuat tatacara pengambilan sampel darah

: Mendapatkan sampel darah kapiler.


1. Adanya surat pefinintaan pemeriksaala.
2. Adanya pasien yang br:rsangkutan.
3. Perawat

1. Bersihkan tempat pengambilan darah dengan kapas


alkohol.
c Memegang tempat pengambilan dengan sedikit ditekan
supaya tidak bergerak dan rasa nyeri berkurang.
3.. Menusuk dengan cepat menggunakan lanset steril
4. Hapus darah pertama yag keluar dengan kapas kering.
5. Tetes darah berikutnya diambil diwadah penampung
digunakan untuk pemeriksaan.

Unit sampling
Unit pemeril<saan
PE }TE.R.T\-T.{H }LTBL?.{TEN S ERUYAIT

RsTID EUAI.A Ptr.MBUAI{G


Ala.r"a i, i- ': r- \:;: ( , a Pernbuang T42l l Kalimantan Tcngalr
ia3ll _i:! lt,;17 Faximile. (0S38) 21566
a-:,L* .,. :,ili(1\.tll(r]!l)il]

PEDOUAN PELI\YAIYNT MEDIS 5o. Dokumen: lt /spo/LAB/ n/2016


---ggal Dibuat : Tanggal Berlaku
\ama Bagian : INSTALASI LABORATORIUM

Pg}TE RIKSAAN HEMOGLOBIN Kuale Pombuang


UE]TODE SATILI

Perulahel eesar

m8qrrl\I[ : Prosedur ini memuat tatacara pemeriksaan kadar


hemoslobin darah
!&mnx : Mengetahui kadar hemoglobin dalam dararr-
1. Adanya surat perm.intaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas anali s kesehatan

f:EI- LR : 1. Tabung hemometer diisi dengan larutan HCI o,1 N sampai


tanda 2 g%.
2. Darah diisap kedalam pipct sahli sampai tunda 20 mm3
3. Bagian luur dari pipet dibcrsilil(an dengan kapeie kering
4. Darah scgera dimasukkan secara hati-hati kedalam larutun
HCI dalam tabung hemomcter tanpa menimbulkur
gelembung udara.
5. Sebelum pipet dikeluarkan dibilas dulu dengan cara
mengisap dan mengeluarkan HCI yang ada dalam tabung
berkali-kali
6. Diamkan t 3 mnit untuk membentuk asam hematin
7. Encerkan dengan aquadest sambil diaduk sampai warna
sama dengan warna standart
8. Baca miniscus dari larutan dan nyatakan dalan g!/o.
9. Catatan laporan hasil pemeriksaan dalam buku register dan
lembaran hasil yang sudah divalidasi.

Unit sampling
Unit pemeriksaan hematologi
Pf -U-[R-[-\-I-{lj lL\L L PA I t} SL}(L } ,L\
R.SID EUALJT PEUBUANG
.{,g:-J --- r- : !c'-'i: :l r"-c-r :"ali.!arE i{li I Kaiinantan Tt,rgalr
l*;r:u, lii.l 1".,- iarrnrlc. i0533) 11566

PEDOUA}I PEI.AYANAN rrFDIS \: !,,ckumen:I2 /sPo/LABI Irl2016


. z::gga-l Dibuat : Tanggal Berlaic.l
, )ia::a Bagran : INSTALASI LAEIORATOzuUM

TEMERIKSAAN HITUNG ERITROSI Kurl,r Pornbuang

Au,U'
200,604 I O,,,2
;9. 3;:-*

'r; , ::RTIAN : Prosedur ini memuat tl


l'erubahan

t.utr.lcura pemeriksaan jumlah


e s1!3"q.liUUdercb,___
r i ! 19
: Mengetahui jumlah eritrosit dularn darah.
1. Adanya Burat pennintaan pemeriksaart
2. Adanya sampel (pasien)
3. Petugas analis kesehatan

1. Darah diisap dengan pipet eritrosit sampai tanda 0,5 bagian


luar pipet dibersihkan dengan kapas kering
2. Segera larutan Hayem diisap sampai tanda 101
3. Kedua ujung pipet ditutup dengan ibu jari dan jari tengatr
lalu dikocok dengan gerakan tegak lurus sampai homogen,
diamkan t 2 menit
4. Sebelum mengisi kekamar hitung buang 3 tetes, kemudian
tetesan berikut diisi kedalam kamar hitung
5. Kamar hitung yang sudah terisi diletakan dibawatr
mikroskop dan perhitungan dilakukan dengan
menggunakan obj ektif 40X
6. Hitung semua eritrosit yang terdapat dalam 5 bidang kecil
yang terbagi-bagi dalam 16 bidang kecil
7. Jumlatr sel eritrosit yang didapat dikalikan dengan 10.000
dan nyatakan dalam nrm3.
8. Catatart laporan hasil pemeriksaan dalam buku register dan
lembaran hasil yang srrdah divalidasi.
* ::3$AIT Unit sampling dan unit pemeriksaan hematologi

15
P E.\ tf Rf\T "{{ L{BL?.{TE N SERU},A]{
R,STD KT'AI.A PEMBUA}IG
A.e;:.ar -, r- : rr- \*: :l lir ?:rrbrwtg 7421 t Kalimanun Tengalt
I:r:c" .i-li l,',i- farrmiic. (053E) 21566
3-:l_ r,r, r, .r,lr

PEDOMAN PELAYAIYAN UITDIS \c. Dokumen : l3 /sPo /LAc_I lll2016


la::ggal Dibuat : Tanggal Berlaku
Na:::oa Bagian : INSTALASI LABORATORIUM
,

o4*s
Kuah Pembuaug
PEMERIKSAAI{ LEUKOSIT

;r : ); IFRTIAN
Pcrulahsl eeEar

: Prosedur ini memuat


tl
Perubahan

t.atncartr pemeriksaan Leukosit


dgl"h. __-_-
-.-Iv
. - _ ..!^\ : MengeLahui kadar t."k""i t ari ia,i:i a*rti
;:.-'AKAN 1. Adanya surat perminta{ln pemeriksuall
2. Adanya sampel (pasien)
3. Petugas analis kesehatan

:: ;-lfDUR 1. Darah diisap dengan pipet leukosit sampai tanda 0,5


dibagian luar pipet dibersihkan dengan kapas kering
2. Segera larutan T\rrk diisap sarnpai tanda 11
3. ;Kedua ujung pipet ditutup dengan ibu jari dan jari tengatr
kemudia dihomogenkan dengan gerakan tegak lurus,
diamkan t 2 menit
4. Sebelum mengisi kekamar hitung buang 3 tetes, kemudian
tetesan berilmtnya isi kedalam kamar hitung
5. Hitung semua leukosit yang terdapat dalam 4 bidang besar
6. Jumlah leukosit yang didapat dikalikan 50 dan dinyatakan
dalam mm3.
7. Catatan laporan hasil pemeriksaal dalam buku register dan
lembaran hasil yang sudah divalidasi.

Unit sampling
Unit pemeriksaan hematologi.

.o
RI;UD KUALA PErr-RErlI[G
!,.a:-d . t- : lri 'a: i"l t"rrn-r i.E:i]-isrd :.111I r.eirr:rarun lcngalr
l1a-ur. l-{}.{ l. " .- ;arirnrk. t053t) ll-s66
:-:.lL

PEDOMA}I PELAYAI{AI{ rrEDIS )i:. lokurnen; l4 /SPO /LABI lll2016


l:,--:3ga"1 Dibuat : Tanst:Ecrtah rm" no&an : INsrAIt$ lttsoRAToRIUM
I

'D Kull,r Pcmbueng


FEMERIKSAAN TROMBOSIT
e,,fl*D

Peurtralalarr
II
: ,:RTIAN : Prosedur ini memuat tatacara pemeriksaan hitung jumlah
trombosit dalam darah.
- :*\i : Mengetahui jumlah trombosit dalam darah.
1. Adanya surat permintaan pemeriksaan
c Adanya sampel (pasien)
3. Petugas analis kesehatan
: :.]UR 1. Bilas pipet eritrosit dengan larutan ammonium oxalat 196
2. Darah diisap dengan menggunakan pipet eritrosit sampai
tanda 0,5 bagian luar pipet dibersihkan dengan kapas kering
3. Segera larutan Ammonium oxaJat 1% diisap sampai tanda
, 101
4. Kemudian ujung pipet ditutup dengan ibu jari dan jari
tengah lalu dikocok dengan gerakan tegak lurrrs sarnpai
homogen, diamkan t 10 menit
5. Sebelum mengisi kekamar hitung buang 3 tetes, kemudian
tetesan berikutnya is;i kedalam kamar hitung.Letakkan
kamar hitung yang sudah terisi tersebut kedalam cawan
petri yang dalamnya ada kertas saring basah dan biarkan
tertutup selama 10-30 detik supaya trombosit mengendap
6. Hitung trombosit dengan objektif 40x yang terdapat dalam 5
bidang kecil yang terbagi dalam 16 bidang kecil
7. Jurnlah trombosit yang didapat dikalikan 10.000 dan
nyatakan dalam mm3.

Unit sampling
Unit pemeriksaan hematologi

17
SERU}'fu\
R,SIU'D KUAJA PEIIIBUAI{G
Ala,c ltt , a, E \: :- r ",$ l\:rrtruarrg ?421 I Kal-rrrrarttur
'1 Tcngah

la'r-'r- :{!i li i'lurmrlc (0518) 21566

5,c. Dokttrtlclt : l5 /Sl'o ll'Altl rr/2016


PEDOUAN PELAYAIIAN I{EDIE
:a;1ggat Dibuat : Tangga[ Bcrlaku Sa:r.a Bagian : INSTALASI LABOITATORIUM
I Ialnman Dari

Kuelo Pombuang
FEMERIKSAAI{ LAJU ENDAP
DARAH (LED) Sori'r:-,t i
zoooo+ I 9t2
Peru.ehert Besar

u endap

: = :?Kecepatan p"ttg"tt?ap"tt dari eritrosit'


Mengetahut
1. Pemeriksaan
2. Adanya samPel (Pasien)
3. Petugas analis kesetratan
w-adah
iY : 1. ffisukkan 0,4 ml larutan natnum
--JV't
2. Menambahkan 1,;; sampel (darah) yang akan diperiksa
berisi natrium sitrat
masukkan kedalam wadah yang
3. Homogent ut tersebut dengan gerakan melingkar
"^*puran
I secata Perlahan
pipet westergren
4. Isap "**pr,*' darah tersebut kedatam
sampai garis bertanda 0 mm
dengan bantuan karet pengisap
lurus pada rak tabung
5. Letakl<an pipet westergren tegakpencatat waktu)
westergren selama I jam fialankan
tingg lapisan plasma dari 0 mm
6. Tepat 1 jarn ;;;;' Uaca
darah dan nyatakart
sampai batas plasma d'engan "tta"pu"
dengan mrr.ljarn
T.Catatanr"po,*hasilpemeriksaarrdalambukuregisterdart
lembaran hasil yang sudah divalidasi'

tm
---r'- Jr(-L f^Lall
^
Urrit samPling
Unit pemeriksaan hematologi'
-.

i5
Pf "U f RI\T TI{ LTBL PATEN SE R L, \,A\
R.SEE KTXAI,A PFT,{BUAITG

@ PEDOMAN PEI,AYAXAH I,FDIS


A.rr"u !- : rrr {r:.il: r.:.&e l-ur,l.lactg ?4211 XeJrrrrulrtur'fcnga}r
le;urr lJl[ ].1.-;arrrnrk (0SlE) 2l5(6

.'i;. Do,i<urnen; l6 /Spo/r,AB/ II /2OL6


- a:rggal Dibuat :
! Tanggal Berlaku lia::a Bagian : INSTALASI LABORATORIUM

PEMERIKSAAN MASA Kuala Pomburng


PERDARAT{AN (BTl
au/4-
"--:.3aru

: Prosedur ini memuat tatacara. pemeriksaan waktu


' - ,\. an.
_ _ .1-\ Mengetahui wakfu mulai perdarahan sampai berhenti
berdarah.
; : :-.AKr{N 1. Adanya surat permintaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
rr ; - i;DUR : 1. Hapus ujungjari dengan kapas dkoho@
2, Menusuk ujung jari dengan lanset steril, saat darah mulai
keluar, menjalankan stopwactJr
3. ,Darah yang keluar hapuslah dengan kertas saring setiap 30
,detik, sampai darah tidak keluar lagi
4. Masa perdarahan adalah waktu murai keruar darah sampai
daratr berhenti dan nyatakan dalam detik
5. catatan laporan hasil pemeriksaan dalam bulnr register dan
lembaran hasil yang sudah divalidasi.

TTERKAIT Unit sampling


Unit pemeriksaan hematologi

19
P E}TERI\-T.{.8 }i{8 L?A TE N sE R UYA}{
R.Str.:D KTJAI-A PEMBUANG
,r,i6-na.i - :- ": r-r 'r: _11 !.;-i pcrnbuang 742 I I Kalimantan
Tengah
lc.:.:r:. .jj! l",t- Faximile. (0539) 21566

PEDOMAN PE,LI\YAXAN MFDIS \O. : I7 /


DOKUMCN SPO /LAB / II 12016
,:--.gga] Dibuat
:
Tanggal Berlaku
Nama Bagian : INSTALASI LABORATORIUM
:

]EU.E RIKSAAI{ IIIASA PEMBEKUAN


5P#t:
8-UD Kuala Pombueng
DARAH (CT)

l|.-. :_:J-,] PeruThal eesar

Prosedur ini memuat tatacara pemeriksaan waktu


Mengetahui waktu darah mulai keluar sampai
membeku.
1. Adamya surat permintaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
: - : =lUR : 1. Hapus ujung jari dengan kapas at
2. Menusuk ujung jari dengan lanset steril, saat darah mulai
keluar, menjalankan stopwacth
3. Darah yang keluar teteskan pada kaca objek glass
isecukupnya
4. Darah pada objek glass dikuit dengan menggunakan jarum
setiap 15 detik, sampai terlihat adanya benang fibrin pad.a
ujung jarum penguit
5. Masa pembekuan dareile adalah waktu mulai darah keluar
sampai darah membeku (adanya benang fibrin)
6. catatan laporan hasil pemeriksaan dalam buku register dan
lembaran hasil yang sudah divalidasi.

Unit sampling
Unit pemeriksaan hematologi

l0
PEMERINTAH KABUPATEN SERUYAN
RST'D KTIALA PE.MBUNTG
Alamat : Jl. A. Yani No.30 Kuala Pembuang 7421I Kalimatrtan Tengah
Telpon. (0538) 21017 Faximilc. (053E) 21566
e-mail : r strtl- -sclttlllttlt l ltltoo crrttt

IqI]O!IAN PELIIYAI{AN UEDIS No. Dokumen : 18 /sPo/LABI trl20L6


:{E:- f :bUar Tanggal Berlaku
" Nama Baeian : INSTALASI LABORATORIUM
-4#-..
Halaman I Pari
1 1

tr
,llrrymrEafl(sAAN Kuala Pombuaag
coLoNGAI{ DARAII {
M--
t\ry rErrt I Ot2
Kecil -.*lfiff/H'rubahan ,"ffi""
, ini memuat tatacara pemeriksaan golongan
F.""t*
rP
HX*r
*-', : Mengetahui antigen eritrosit dengan mereaksikan pada
antisen spesifik ditandai adanya aelutinasi.
--:--_
-, \'
i I Adanya surat permintaan pemeriksaan
2 Adanya sampel (pasien)
3 Petugas analis kesehatan

1. Pada kaca objek glass teteskan 1 tetes daratr disebelah kiri I

d.an 1 tetes darah disebelah kanan


2. Pada tetesan darah se,belah kiri tambahkan 1 tetes anti A
I

dan sebelah kanan 1 tetes anti B


3. Campur baik dengan pengaduk sampai homogen dan gol'ang
4.. Laporkan adanya aglutinasi
5.. Catatan laporan hasil pemcril<suan dalam buku register dan
Iembaran hasil yang sudah divalidasi
i

U"it -
""*plin;
__l t
P TTM NTTT AH KABUPATEN S ER UYAI\{
H\\
(s)
t|=U/
R"ST'D Ifi'AI.A PEIUBUA}IG
Alamat : Jl, A Yani No.30 Kuala Pembuang 7421I Kalimantan Tengah
Telpon. (0538) 21017 Faximile. (0538) 21566
e-mail : iitrtl-rclllJ illl r? -\ illl\r()
'()ll)

PEDOMAN PELI\YAIIAN MEDIS No. Dokumen : 19 /sPo/LAB/ rt/2oro


-i:-ggal Dibuat : Tanggal Berlaku Nama Bagian : INSTALASI LABORATORIUM

.;'Ntl- Rehi-.:r. Halaman I O"ri


,;.ii::')')' oO)ii\,_ 1 2

PEUERIKSAAN HEMATOKRIT i
\

1*-1
"r:i \: rubahan Pemba

Prosedur ini memuat tata cara Pe)meriksaan hematokrit.


- l:RTIAN
-.._\ lf,tengetatrui nilai hematokrit dala m darah.
--:--:;*
------f\--\l\
u Ct""" p"nneriksaan
-
2. Adanya samPel (Pasien)
3. Petugas analis kesehatan

: dcngan darah
- ::fUR 1. @krokapilcr
2. Menutup ujung bawah dengan buhan Penutup khusu
3. Memasukl<an tabung keclnl0rn sentrifugasi mikrohematoknt
4. Sentrifugasi <lengan keccput'utr 16'000 rprrt 5 tnenit
5. Ukur nilni hematokrit scl clurtrlt yang tnetrgendap dengurt
menggunalcan skala grafik khusus
Catatan laporan hasil pemeriksaan clalam buku register
der'n
6.
lembaran hasil yang sudah divalidasi'

]=RKAIT Unit sampling


Unit pemeriksaan hematologi

11
PE}TfR,.]h-T "TH L{BL}ATET SE RL}- A.\
RSU'D ITUN^A PEMPUAIYG
,dar,rr .. "d i rc- .": -i. K:.raie Perrbuang 7421 I kalimentan Tenglh
l:,4:c- lSii li'ii- Frxr-mric. tC5itl 21566
c'i--I: -

FBDOUAII PE_LAYA!{A}I rrEDIS lio. Dokumen : 2o /sPo/LAB/ II l2oL6


-i---E:,a] Dibuat : Tanggal Berlaku Nama Bagian : INSTALASI LABORATORIUM
Halaman I Oari
1 1
leh: \
PEMERIKSAAI{ MEAN
^f!,Hi\
tlffi;slN)
[3
Kuel,a Pombueng
:c R.PUSCTTLAR VOLLTME (MCV)
o ailn,
N 20,0,604 I Or2
KeA\=!t{ rytrfAdaieprubahan Pembatalan
L-l l--l
;rr-l"::p11qg : Prosedur ini memuat tata cara pemeriksaan MCV.
"-- -l-lj : Mengetahui volume eritrosit rata-rata dalam darah (VER).
-
ffii;.""eriL"*."
2. Adanya sampel (Pasien)
3. Petugas analis keseha[rur

-::fUR :

MCV (VER) ' Nilai HT :\ Entrosit x 10

Nyatakan dalam Femtoliter (fl)

catatan laporan hasil pemeriksaan dalam buku register dan


lembaran hasil yang sudah divalidasi.

.R]{AIT Unit sampling


Unit pemeriksaan hematologi
PE ULR.L\-T.{H L{'BI P.A.TE\ SERL.I A.\
RSETD EEIAI.A PEUBUANG
{"a.ir,!.I .. r- ': r- l.:.:. .r.-:--r Pg:rbiwrg 7421I iialimantan Tenga}r
la::r:- .-j:i l.,u,i Farrmrlc. (0538) 21566
c'r,a;l r' r ' "rlltrLr !'r'rl

PEDOMAN PELAYANAN UEDIS No. Dokumen:21 /sPo/LAB/ II 12016


. a:-Iggal Dibuat :
Nama Bagian : INSTALASI LABORATORIUM

PEMERIKSAAN MEAN Kueh Ponbuang


C ORPUSCULI\R HEMOGLOBIN
(McHl
20()604 I Ol2
g 3"ar'.i

', Pt.^-drt it i-.t e*uat tata cara pemerikBaAn MCH'


.- -...\ , Meft"t"hui hemoglobin eritrosit rata-rata dalam darah
ER).
; :. --.1KAN 1. Aaanya surat pernintaan pemeriksaan
2. Adanya samPel (Pasien)
3. Petugas analis kesehatan
; - ::DUR
MCH (HER) = Nilai HB : I Eitrosit x 10

Nyatakan dalam Pikogram (Pg)

Catatan laporan hasil pemeriksaan dalam buku register dan


lembaran hasil yang sudah divalidasi'

: :ER.KAiT Unit sampling


Unit pemeriksaan hematologi

21
PE }IER.h-T.{H KAB U PATEN SERUYAN-
RST'D Ifl'ALI\ PEMBUAI{G
Alamat : Jl. A Yani No.30 Kuola l)onrbualg 742il Kalimuntan Tcngah
Telpon. (0538) 21017 Fuximitc. (0538) 2l56fi
C-mail : rrrr,l ,,r.lr\,lr // \.rltrrr conr

TEDOUAN PEI.AYANA:{ UEDIS No. Dokurnen : 22 /spo/ t.ABl u/20t6


Tanggal Elerlaku
Nama Btrgian : INSTALASI LABORATORIUM

llalaman I Dari

PEMERIKSAAN MEAN
I,3 RPUSCULAR HEMOGLOBIN Kurle Pombueng
coNcENTRATrOrr (McHcl

:
tl
Pcrubahan

Prosedur ini memuat tata cara pemerikiaan MCHC,


Mengetahui konsetrasi hemoglobin eritrosit rata-rata
_ , - -
darah
I \'
: -.:-1^\ 1. Adanya surat pennintaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan

! ::,;R
MCH (KHDR) = Nilai HB : I Hematokit x j)O

Nyatakan dalam Persen (%o)

catatan laporan hasil pemeriksaan dalam buku register dan


lembaran hasil yang sudah divalidasi.

. : RIAIT Unit sampling


Unit pemeriksaan hematologi

:5
r TiT TNT:.{,H KA T}L I'ATEN SERU}'A:i
R,STID Ifl'ALI\ PEUBUAI{O
i,
Ala.lrrrt ., I 1 rr, \c -j,, Kusir I'ctttlruutg 7421 I Kulrrtrrullur lcngrrh
I cr;u-. 1[r5-it ) 21017 I arrrnlle ((]5lt) 2lSffr
e-mall ,, ,,,1 ,1, L lrl

PEDOMAN PELI\YANAN MEDIS No. Dokunlen : 2:] /sl'o/l,AIli Il /2016


-r:.-al Dibuat
Nama Bagian : INS'IALASI LAIIOIIATORIUM
:

Kusla Pombuang
}ESEzuKSAAI{ JENIS LEUKOSIT

Pcmbatalan
pgruhahan Besat

ffi
Imemu.at tata cara pemeriksaan jenis
.bahan

sel
leukosit.
acam jumlah jenis sel leukosit'

: 1. Aaanya surat pefinintaan pemeriksaan


2. Adanya sampel (Pasien)
3. Petugas analis kesehatan
tmpada ujung objek glass yang bersih
2. Gelas penghapus letakkan dimuka tetesan darah dengan
membuat sudut t 30-450 , kemudian geserkan kebelakang
sampai menyentuh darah dan merata
3. . Dengan gerakan cepat kaca penghapus digeser kemuka
sampai tetesan darah tersebut merata diatas kaca objek
gelas (apusan cukup tipis dan tidak terputus)
4. Dikeringkan dalam suhu ruang
5. Fiksasi dengan methanol, biarkan selama 2 menit
6. Genangi sedian denga Giemsa yang sudah diencerkan l:4
selama 10 menit dan bilas dengan air mengalir
7. Keringkan dan periksa dibawah mikroskop dengan objektif
1O0x gunakan minyak emersi. Jumlah sel leukosit dihitung
sebanyak 100 dan nYatakan dalam %'
8. Catatan laporan hasil pemeriksaan dalam buku register dan
lembaran hasil yang surdah divalidasi'

": TERKAIT Unit sampling


Unit pemeriksaan hematologi

76
PE}IERL\T.-\HM
RSTID I(['AIJ\ PEMBUAIYG
Alamu : Jt A. \,ani No 30 Kuata_t)enh;;-t;iK-"tirrrurrul .t.cngutr
Tclpon. (0538) 2 I 0l 7 rrarimikl (0538)
,15(,6
e-mail : r.,r't,L.ru\,rri,.r.,i,,,.,,,,111
3E€UAN PELI\YANAN UEDIS
* i]F_
/sp.' /, n-,/ ,,
No. Dokumen:24 /sPo/LAr] ,lll
il/20tb
J-Jqdt

Namet Bagian : INSTALASI LABORATOzuUM

ilryTil:IRJ}(sAAI{
GLUKOSA DARAH Kuala Pombuang,

au/+-
:-- --=ia;aqEesar
II
Prosedur ini rnemu"t t"ffi*i;-a;hl
Mengetahui
1. Adanya surat
2. Adanya sampel (pasien)
3. Petugas analis kesehatan

l. Menyiapk
glukosa
2. Menyiapkan Rl glukosra, larutan standa_rt
dan serum
3. Memipet Rl 1o0o pI m*sukkan kedaram
tabung reaksi unruk
masing - masing blanko,sampel dan standart
4. Memipet 10 gl larutan standart dan homogenkan
5. Memipet lO pl se nm, homogenkan
6. Mengingkuasi 1O menit pada suhu ruang
7. ukur dengan fotometer n 546 nm dan nyatakan
daram mg/dl

Unit sampling
Unit pemeriksaan kimia klinik

:7
PE.\tf P51.{H I({B L?ATEN SER UYAN
RSUD IfiIAI.A Ptr.]\rRUAIgG
Alarnd . jl ,,{. 'rmi \o jC KuaJe pernbuang 74211 Kalimantan
Tcngah
Tctpon- i0,s38) 2t017 Faximilc. (0538) 21566
e-ma:l : ,--'i.\.,1-i/ rrrilLro urrnr

No. Dokumen : 25 /spo/LAB/ n/2016


---al Dibuat: Tanggal Bertaku
Nama Bagian : INSTALASI LABORATORIUM

PE.UERIKSAAN KOLESTEROL
Kual,e Pombuang
TOTAL DARAH

Prosedur ini memuat tata cara pemeriksaan kolesterol


darah.
_.r_.; : Menget
1. Adanya surat perrnintaan perneritcsaan
2, Adanya sarnpel (pasien)
3. Petugas analis kesehatan
;; i:JUR l. Menyiapkan alat y
glukosa
Menyiapkan Rl kolesterol, larutan stand.art dan serum
Memipet Rl looo pl m:esukkan kedalam tabung reaksi unruk
. masing
- masing blanko,sampel dan standart
Memipet 1O gl larutan standart dan homogenkan
Memipet 10 pt serum, homogenkan
Mengingkuasi l0 menit pada suhu ruang
ukur dengan fotometer n 546 nm dan nyatakan datam mg/dl

TTERIAIT Unit sampling


Unit pemeriksaan kimia ldinik

28
PE}IERf\TAHKABffi
RST'D KUAI.JT PE.MBUAIYG
Alarnat : Jl. A. Yani No.30 Kuala pembuang 7421I Kalimantan Tcngah
Telpon. (0538) 210t7 Faximitc. (0j38) 21566
o-mail : r.rr,l -:( ilr,\ iln ri \ irlroil f 0rrr

PEDOMAN PELAYN{A}I MEDIS No. Dokumen:26 /spo/LAB/ ul2016


. arggal Dibuat : Tanggal Berlaku
Nama Bagian : INSTALASI LABORA?ORIUM

Halaman I Oari
I 1
/gtftftaql€n oleh :
EMERIKSAAN TRIGLISERIDA \
*y-[EBrd
P
f,tun Kuah Pcmbuang
DARAH
KUALA PEMBII IANG
t ft au/+
$
I

**EJ" '0222 20,0,604 I Ot2


fl
esar Perubahan

: : l;3ERTIAN Prosedur ini memuat tata cara pemeriksaan- trigliserida


darah.
-- - -AN : Mengetahui kadar trigliserida dalam dtah.
" : -JAKAN 1 Adanya surat permintaan pemeriksaan
2 Adanya sampel (pasien)
3 Petugas analis kesehatan
;r ; - SEDUR : 1. Menyiapkan alat y""g aigu
glukosa
2. Menyiapkan R1 triglise:rida, larutan standart dan serum
3. Memipet Rl looo pl masukkan kedalam tabung reaksi unruk
,masing - masing blanko,sampel dan standart
4. Memipet 10 pl larutan standart dan homogenkan
5. Memipet lO pl serum, homogenl<an
6. Mengingkuasi 10 menit pada suhu ruang
7. ukur dcngnn fotometer n 546 run clan nyutul<an dalarn rng/cll

: TERKAIT Unit sampling


Unit pemeriksaan kimia ldinik

:9
PE }TERh'TAH KABUPATEN SERUYAN
RSI'D KUALI\ PEMBUAIYG
Alamat : Jl. A Yani No.30 Kuala pembuang 7421 I Kalimantan Tcngah
Telpon. (0538) 2t0t7 Faximite. (0S3S) 21566
g-mail : r :irtl*:cltrr lur rr'] irlrop errrrr

PEDOMAI{ PELAYA!{AI{ !ilEDIS No. Dokumen:22 lspo/LABI u/20t6


Tanggal Berlaku
Nama Bagian : INSTALASI LABORATORIUM

IE.UEzuKSAAN ASA}I URAT Kuala Pombuang

Prosedur ini memuat tata cara pemerikaaan as. Urat


darah.
. -'.-.\ : Mengetahui kadar as. urat dtiam darah-
1. Adanya surat permintaan pemeriksaan
2. Adanya sampel (parsien)
3. Petugas analis kesehatan

UR : 1. Menyiapkan alat yang digunal<an unauk@


2. Menyiapkan R1 as. urat, lurutrur standart dan serum
3. Memipet Itl to00 pl masukkan l<cda-ltrm tabung reaksi untul<
rnasing - nrasing blanko,surnpcl dun standart
4. Memipct 20 pl larutan standart dan homogenkan
5. Itdemipet 20 pl serum, homogenkan
6. Itlengingkuasi 1O menit pada suhu ruang
7. ukur dengan fotometer n 546 nm dan nyatakan dalam mg/dr

- :3RKAIT Unit sampling


Unit pemeriksaan kimia klinik

_10
PE }IE R.L\TAH KAB UPATEN SERUYAI\I
RSTTD KT'ALI\ PEMBUAIYG
AlBmat : Jl. A Yani No.30 Kuala Pembuang 7421I Kalimantan Tengah
Tclpon. (0538) 21017 Faximile. (0538) 21566
e-mail : r:rr,l \allr\ i[l r/ \ iil](\) !()nl

PEDOMAN PE.LAYANAN IIEDIS No. Dokumen : 28 /sPo/LAB/ n/zoL6


Nama Basian : INSTALASI LABORATORIUM

FEUERIKSAAN HDLKOLESTEROL
DARAH

S,x
I l;3pp11O* : Prosedur ini memuat tata cara pemeriksaan HDL-
kolesterol darah.
- --lAN : Mengetahui kadar HDl-kolcst.erol dalam darah.
AI(AN : 1. Adunya surat permintuart pcrncriksrrrrrr
2, Adanyei sampel (pasien)
3. Petugas analis kesehatan

SEDUR : 1. Menyiapkan alat yang digunakan untuk pemeriksaan HDL


Kolesterol
2. Rl kolesterol dan serum
Menyiapkan
3. Memipet Rl 500 pl masukkan kedalam tabung reaksi
tambahkan 200 pl serum,sentrifugasi 3OO0 rpm selama 5
rnenit (terbentuk supernatan)
4. Memipet Rl HDL Kolesterol 1OOO prl untuk blanko
5. Memipet 100 pl supernatan dan 1000 pl HDL kolesterol
homogenkan
6. Mengingkuasi 10 menit pada suhu ruang
7. Ukur dengan fotometer n 546 nm dan nyatakan dalam mg/dl

Unit sampling
Unit pemeriksaan kimia klinik

3l
PE}IERN-T.{H }C{BT PATE\ SERI,ryAN
RSt D ITUALA PtrtrdBUAt{G
Alamat : Ji. A l'ari
No.3r3 Kuala Pcrnbuang 7421I Kalimantan Tcngah
Telpon (0538) 21017 l:axinrilc. (0538) 21566
9-6{l ; r.LrL1 \r'tr\,[] r/ t,tltrrtr.i ottl

PEDOMAN PELAYANAN MEDIS No. Dokumen : 29 /spo/ LABI ul20t6


" :--:ggal Dibuat
:
Nama Bagian : INSTALASI LABORATORIUM

zf,#s
LDL.KOLESTEROL

rbrutflt Irccir

aRTIAN : Prosedur ini memuat tata cara pemeriksaan LDL-


kol.esterol darah.
. -.:.li : Mengetahui kadar kolesterol dalam darah.
1. Adanya surat permintaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan

fUR : LDL-CHOLES = Cholesterol total -fG15 - HDL Choles


f TERKAIT Unit sa:rrpling
Unit pemeriksaan kimia klinik
PEIIERL\-TAr{KABUI,ATENffi?,N-
RSTID ITUAL/T PEIiIBUAI{G
Alamal : Jl. A )'ani No 30 Kuala lrcnrtruang 7421I Kalimantur Tcngah
Telpon. (053t) 2l0t 7 Furimitc, (0j3E) 2t566
G{Dlil : r\u(,_\rr u1 ilr,n.1 rrlrixr.,;orrr
PEDO!ilAIII PELI\YANAN lIEDIs No. Dokuuren : :]o lspo/LABI It/2016
Nama Bngiun : tNSTALASI LABORATORIUM

llrrkrman I ffnrt

PEMERIKSAAN SGOT Kurle Pomburng

@ffi
T5u"*
::\GERTIAN
'p.oseffi
AN : Mengetafru
":EIJAKAN 1. Adanya surat permintaan perne.it saan
2. Adanya sarnpel (pasien)
3. Petugas analis kesehatan
::-.rf SEDUR 1. Menyapkan alat yang
2. Memipet (Rt+p2; roo0 pI masukkan keda.ram tabung reaksi
3. Memipet 100 pl serum, homogenkan
4. ukur dengan fotometer n 34o nm dan interval walrhr
r inkubasi didalam alat 1-3 menit.

-:;JT TERI{AIT Unit sampling


Unit pemeriksaan kimia klinik

JJ
lsYl
\-,
I : !f
-.;r:r
.,: i,.
:jr!:
.";lA :=-,:,-aC:f -l]
- -if,i;=ll ljll
r.! -.A",_tE: ---6li
] (:t

IEDOUAN PEI.AYANAT rfFDIS )ic. Dok;::ler: : 3 i SpO ,,,LAB/ lt/20 16


- i-:-43=
Dicuat :Tanggnf BerlaJnr
Sarna Bagran : II{STALASI LABORATORIUM

PEUEzuKSAAN SGPT Kuslr Ponbuang

eerulahel eesar

r : :-:RTtr{N : prosedur ini memuat taia


---.:-'; : Mengetahui kadar SGFIf dalam darah-
1. Adanya surat pernintaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
- _ j;lUR : 1. Menyiapkan alatyang digunakan n@
2. Memipet (R1+R2) looo pI masukkan kedalam tabung reaksi
3. Memipet 100 pl serum, homogenkan
4. ukur dengan fotometer n 340 nm dan interval waktu
,linkubasi didalam alat l-3 menit.

: ISR"IGIT Unit sampling


Unit pemeriksaan kimia klinik

34
PE}IERL\TAH LA,BL P.{TE}- SE R L' \'d\
R.ST'D ITUAI.A PEM-RUAIVG
.lla;rrai jl ,{. Yr"; \: I- i(;a.a ic:,c.;a:rg'.llII La.lrntiurran Tcngah
Tclptrn ;5_sit r I [01 ] Farrmrtc. 10538) 2l5t{
c-nLai

PEDOUA}I PEI.AYANA}T r[E'DIs No. Dokumen : 32 /spo/ LABI u/2016


Dibuat
. a::Egal ; Tanggal Berlaku
Nama Bagian : INSTALASI LABORATORIUM

PEMERIKSAAN KREATINII{
ffi\ Halaman
1

Kuelr Pombuang
I Oari
I

- -.- :€j-.: perufbal B,-'sar Perubahan re\f

;:; ;JiRTIAN : Prosedur ini memuat tata cara peffi tl -.-


1/.fidakqda:eiuffi
lJ n
*
-- ,'.i\ : Mengetahui kadar kreaLinin dalam aar-ah
; : - --.iiiAN 1 Adanya surat permintaan pemeriksaan
o Adanya sampel (pasien)
3 Petugas analis kesehatan
r; : SSDUR : 1. Menyiapkan alat yang digunakan@
kreatinin
2. Memipet reegen 1000 pl masukkan kedalam tabung reaksi
3. Memipet 100 pl serum, homogenkan
4.. Ukur dengan fotometer n 340 nm dan interval wakru
inkubasi didalam alat 1-3 menit.

.: TERKAIT Unit sampling


Unit pemeriksaan kimia klinik

35
PE -\lE RL\-TAII }L{B t?A TL\ SE R IrYAI.{
RSI'D KT'AI.A PEUBUAIYG
Alamar : Jl. \'ani \ci3 ii..era pcrnbr:ang 7421I Kalimantan Tcngalr
.,C-
Telpon (rl5lt) 21017 Faximilc. (05Jt)21566
e+natl :. .\ r:r

PEDOIIAN PELAYANAN !ilEDIS No. Dokumen : 33 /spo/LAB/ il /2016


langgal Dibuat : Tanggal Berlaku
:
Nama Bagian : INSTALASI LABORATORIUM

tryw Nn
Hala.man
,ll
I

Kuele Pombuang
Oari

PEMERIKSAAN UREUM

. -:: Baru psruhalan gesar ---- pd[baha


__.r
,--

;I);GpplrO* :
t_J fl
Prosedur ini memuat tata caiaffi
-- --' AN : Mengetah"t urell'm dalam darah
:3]JAKAN Y"t
1 Adanya surat permi@
2 Adanya sampel (pasien)
3 Petugas analis kesehatan
r': : SEDUR : 1. Menyiapkan alat yang digunakan untuk p
2. Memipet RI 1000 pl mer.sukkan kedalam tabung reaksi.
3. Memipet 10 pl serum, homogenkan, lalu inkubasi selama 5
menit pada suhu 2O-25"C.
4.. Memipet R2 1000 prl masukkan dalam tabung reaksi dan
homogenkan.
5. Inkubasi selama 10 menit pada suhu 2O-?5"C.
6. Ukur dengan fotometer n 578 nm
,:: TERKAIT Unit sampling
Unit pemeriksaan kimia klinik

36
, r,ur LUL r_1 l.E--\ ]LI{L I "{\
RSUD EUAj-A Pr.ffiRUrAIYc
1.4'a
I :--.
-- .._ r g:. \: _.- .1 ' a :5-,*r_Ir€ -r1 .. r-r_:rgrun Tcngih
ie,pr.n _-{_:! l, _l- ;er::":rc :Jjg :i-(66

PEDO!{AIT PETI\YAHAIT I{EDIS No. Dokumen:33 /spo/LAt^/ ul2ot6


- -:ggal Dibuat :
Tanggal Berlaku
Nama Bagian ; INSTALASI LABORATORIUM

FSUERIKSAAI{ BILIRUBIN TOTAL Kuala Pombuang

Perufhal Bcsar

ERTIAN , PTo"

AN : Mengetahui
;::JAKAN l. Adanya s
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
UR : l. Menyiapkan
bilirubin total
2. Memipet T-BIL 1o0o pl dan T-NIT 40 pl masukkan keda]am
tabung reaksi.
3. Lalu inkubasi selama 5 menit.
4. Memipet 100 pl serum, homogenkan, lalu inkubasi selama
1O-30 rnenit pada suhu 2O-25,'C,
5. Ulcur clengun fotometcr rr 546 nrn

TERKAIT Unit samplinli


Unit pemeriksaan kimia klinik

37
PE }TER.L\-T.{.8 KABL?ATE)i SERUYA}{
RST'D K(IALII PEMBUAI{G
\"r: \'o-}i Kuala Pernbuang 7421I Ka.limantan Tengah
,{larnar . .1 .r-
Telp.n r,05it') 21017 Farimile. (0538) 21566
e-rnatl : .: '. I L I \ ,rI I rt r .t/IL
'1 '. q rI 1 I

PEDOUAN PEI.AYANAIT MEDIS No. Dokumen : 34 /sPo/LABI trl20L6


la:-ggal Dibuat : Tanggal Berlaku
Nama Baeian : INSTALASI LABORATORIUM

(,*
Kuale Pombuang
:3}IERIKSAAN BILIRUBIN DIREK
aul+

!: - ".. 3aj-U Perulahal sessr


tl
Perubahan Kccil
h ffiruuanan
Pembatalan

:: ; \; IIRTIAN : Prosedur ini mem\rat tata cara pemeriksaan bilirubin


direk
_ -' . \- : Mengetahui kadar bilirubin direk dalam darah
- - ^.^.\
;:.,-.dIiAN : 1. Adanya surat permintumn trdiffi;it """t
2. Adanya sampel (pasien)
3. Petugas anulis lcesehatan

; - *i:DUR : 1. Menyiapkan alat yang digunakan urltuk pemeriksaarl


bilirubin direk
2. Memipet D-BIL 1000 pl dan D-NIT 40 pl masukkan kedalam
tabung reaksi.
3. Lalu inkubasi selama 2 menit.
4. Memipet 100 pl serum, homogenkan, lalu inkubasi sela:rra 5
menit pada suhu 2O-25"C.
5. Ukur dengan fotometer n 546 nm

: :ERKAIT Unit sampling


Unit pemeriksaan kimia klinik

38
P E}[[RT}-T.{.}I iL{B L?ATEI{ SERI.IYAN
RSTID IfiIAII\ PEMBUAI{G
Alama.l : .'; -!- i'rr- \:l; Kuala Pembuang 7421 I Kalimantsn Tengah
ie.pr- 1'538,i 21017 Faximile. (0538) 21566
C-fna.1 . ' .l '.ili\.llll/ \ill){r() !()rl1

PEDOMAN PELI\YANA}I UEDIS No. Dokumen:35 lsPolLABl lll2OtG


langgal Dibuat: Nama Bagian : INSTALASI LABORATORIUM

NEUERIKSAAN BILIRUBIN INDIREK

::I;GERTIAN : Prosedur ini memuat riksaan bilirubin totat


iiruUin total dalam darah
, :3IJAKAN 1- Adanya surat permintaan pcmeriksaan
2. Adanyn sanrpel (Pasien)
3. Pctugas trnulis kesehatan
.--SooUn : eit. Total - Bil. Direk = Bil. Indirek
- );:l TERKAIT Unit sampling
Unit pemeriksaan kimia klinik

39
PE }tf RL\-T.{,I{ KABL?ATE\. SERI,YA]Y
R,ST]D KTTAIJT PF}fPUAITG
Aiamar .li d\a \c __ri Kuaia Pernbuan g742ll Kalimantan .tengah
;cltrxr r;5-18)2101? Farrmile. (0538) 2156d
c-rnarl .. rrir rr 1/ r,ilrrrr,.rrrrr

PEDOUAN PEIAYAHA!{ UEDIS No. Dokumen : 36 /spoILAB/ rI /2016


Tanggal Berlaku i

Nama Bagian : INSTALASI LABORATORIUM

PEMERIKSAAI{ WIDAL TEST Kuala Pombueng


au/+
200,60,4 I Ol2

::I;GERTIAN : Prosedur ini memuat ta.ta curu pcmeriksuoii*idal t€Bt


- - -'UAN : Mengetahui adanya kadar antibodi dari salmonella
.3IJAKAN 1. Adanya surat permintaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
:: iSEDUR : 1. Menyiapkan alat yang digunakan untuk peffi
test
2. Pipet 20 ti pada papan khusus pemeriksaan widal test
3. Lalu tambahkan 1 tetes reagen anti salmonella O, H, OA dan
lOB, lalu homogenkan
4. La-lu di rotator selama 30 detik
5. Lalu baca adanya aglutinasi pada mikroskop pada
perbesaran 10x

.T TERKAIT Unit sampling


Unit pemeriksaan imunoserologi

,i

,il
I

40
rl
I

I
PE.\tf.Rt\-T.{H }L{B U PA TE}_ SE RUYA.\
RSUD ITT'AI.A PEMBUAI{G
AIaTEI ..1, .{ i'r; \o li Kuala Punbuang 74211 Kalimantur Tenga}t
TciFt r0-<3t) 21017 laxinrilc' (053E) 21566
e-rnarl : - i,\,r I r/ \,lllt)i) !(lllt

PEDOMAN PELAYANAN MEDIS No. Dokumen : 37 /SPo/LAB/ II l20L6


Tanggal Tanggal Berlaku Nama lJagiutr : INSTALASI LABORATORIUM

Kurh Pcmburng
PEMERIKSAAN HBS AG
peruaulHo
SUau

ur ini memuat tata cara pemeriksaan HBs Ag


- - JUAN ;dar antigen dari virus HePatitis
:"=BIJAKAN : t. Adanya surat permintaan pemeriksaan
2. Adanya sampel (Pasien)
3. Petugas analis kesehatan
: ?.TCSEDUR 1. Menyiapkan alat Yang digunakan untuk pemeriksaan HBs
Ag
2. Ambil rapid test HBs Ag, lalu tambahkan serum 100 pl pada
kotak sampel raPid test
3.' LaIu tunggu selama 5 - 10 menit
4. Lalu baca hasil
- )itrT TERKAIT Unit samPling
Unit pemeriksaan imunoserologi

4t
PE }I E RL\'T.{H KA B L; I'ATEN SER UYAN
RSUD ITUAIJ\ P.IIIUBUADIG
Alarrrat .il ,r- \'rir \o.j0 Xusk l,clrrhu&rg 742 II Kalirrruttut.l,cng;$l
Tclrn r.05lt) 2l()t7 l,urlmilc. (0j.tB) 21.1((,
C-m8fi : .l\.rrrl,,rlr ,,,,rrrr
PEDOUAT{ PE.II\YA.IYAN I,{FDI 8 No. Dokurnen ; 3B / st,<) / t,Atll n /20tO
Tanggat Dibuat ;
Nama Bagian : INSTALAST LABORATORIUM

'#s
PEMERIKSAAil HBS AB Kual. Pombuang
au/4-

E
Perubahan Kecil

:::,iGERTIAN . P
d
*
-.- UAN Mengetahui adany" kadar
""U
"":3IJAKAN 1. Adanya surat pennind€n fmeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
::. f SEDUR 1. Menyiapkan alat yang
Ab
2. Ambil rapid test HBs Ab, lalu tambahkan serum 100 ul pada
kotak sampel rapid test
3. : Lalu tunggu selama 5 -- 10 menit
4. LaIu baca hasil
';:T TERKAIT Untt samptirrg
Unit pemeriksaan imunoserologi

42
P E.\I f RI\T"{,H I(ABUPATEN S ER U YAN
RSUD KTIALA PEIIBUAT{G
Alama.l . .t,1. ,r. Ynr \c.i0 Kuala l,cmbuang 74211 Kalinrantan Tcng,ah
Tclpon 1053t) 2I0l7 Faximilc. (05J8) 2t jffi
e<nail : .i,,1-,ert\,rllr/\illt()() Lrlll
PEDOUAN PELAYANAI{ MEDIS No. Dokumen : 39 /Spo/LAB/ rr /20t6
Tangga,l Dibuat :
Nama Bagian : INSTALASI LABORATORIUM

#HQr,
PEMERIKSAAN Ig G dan Ig M

T5"'* "'*rJ
:
: NGERTIAN : Prosedur ini memuat tata cara pemeriksaan Ig G dan Ig M
-IJUAN : Mengetahui
-:BIJAKAN
: 1. Adanya surat pennintaan temedksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
:.f,OSEDUR : 1. Menyiapkan a-lat yang d
dan Ig M
2. Ambil rapid test Ig G dan Ig M, lalu tambahkan serum s pl
dan tambahkan 1 tetes diluent
3.1 Lalu tunggu selama l0 - 15 menit
4. l,alu baca hasil
. ];IT TERKAIT Unit sampline
Unit pemeriksaan imunoserologi

43
PE }TERL\-TAH KABUPATEN SERUYAN
RST'D I(UALI\ PEMBUA}TG
Alamar Ji No.30 Kuala Pcmbuang 74211 Kalimartan Tengah
.n- \-a.ri
Telpon. (0538) 21017 Faximile, (0538) 21566
e-mail : i'Lr,l \iIIt\:lrt,/ \,tlr(\) !olll

PEDOMAN PEI,AYA}TAIII If,EDIS No. Dokumen:40 /sPo/LABI trl20L6


Tanggal Dibuat: Tanggal Berlaku
Nama Bagian : INSTALASI LABORATORIUM

Kuole Pombuang
PEMERIKSAAN MALARIA

T3"*"
::\GERTIAN :
E
Peru'bahan

prosedur ini memuat tata cara pemeriksaan malaria


*
- JUAN : Mengetahui adanya kadar antigen dari virus malaria
."=EIJAKAN : 1. Adanya surat permintaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
:3.CSEDUR @at yang digunakan untuk pemeriksaan
malaria
2. Ambil rapid test malaria, lalu tambahkan darah utuh 10 pl,
lalu tambahkan 3 tetes diluent
3.1 Lalu tunggu selama 15 menit
4. Lalu baca hasil
- ];IT TERKAIT Unit sampling
Unit pemeriksaan hematologi

44
P E.\tf.Rf\.T.{H KABL?ATE){ S E RTIYAN
R.SI'D KUAII\ PFMPUAITG
Aia.TrEL .;
- 'f .il \o.30 Kuala Panbuang 7421 I Kalimantan Tengah
Tcipm. i0538) 21017 Faximilc. (053E) 21566
C+nail : r'r.i \rtu\ iln (/ \ irll(r(r e(rlll

PEDOMAN PEI.AYANAIY ITEDIS No. Dokumen : 4t /spo ILABI rrl2ot6


Tanggal Dibuat :
Nama Bagian : INSTALASI LABORATORIUM

##{r,
PEMERIKSAAN SYPILIS

2 200,60,4 I Otz
Perulahal Besar Pembatalan
T5u"*
::NGERTIAN : Prosedur ini memuat tata cara pemeriksaan sypilis
. IJUAN : Mengetahui adanya kadar antigen dari virus sypilis
."":tsIJAKAN : 1. Adanya surat permintaarl pemeriksaan
2. Adanya sampel (pasien)
3. Petugas anelis kesehatan
:ROSEDUR : 1. Menyiapkan alat yang digunakan untuk pemeriksaan sypilis
2. Ambil strip test, lalu tambahkan serum 100 pl taruh pada
tabung, lalu celupkan strip test
3. Lalu baca hasil

. ];IT TERKAIT Unit sampling


Unit pemeriksaan imunoserologi

45
P E.\IERI\-T.{I{ I(A.BL?ATEN SERLYAN
RSTID Ifi'ALIT PEMBUA!{G
Alar,al .-. .i. Ya \o.3C Kuala Pernbuang 7421I Kalimantan Tengah
Tcipn- 10538) 21017 Faximile. (0538) 21566
e<naiJ : i 1L;,1_:crLi\ iril-r/ \ itllr )() !()il1

PEDOMAN PELI\YANAI{ UEDIS No. Dokumerj-:42 lSpO/LABI u/2016


Tanggai Dibuat: Tanggal Berlaku
Nama Bagian : INSTALASI LABORATORIUM

PEMERIKSAAN HCV Kuale Pembuang

::IiGERTIAN :
Perulahal nesar

Prosedur
tl
Perubahan

ini memuat tata cara pemeriksaan HCV


---UAN : Mengetahui adanya kadar antigen dari virus hepatitis C
::3IJAKAN : 1. Adanya surat permintaan pemeriksaan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
::. ] SEDUR : 1. Menyiapkan alat yang digunalcan untuk pemeriksaan HCV
2. Ambil strip test, lalu tambahkan serum l0O pl taruh pada
tabung, lalu cclupkan strilt tr:sl
3. Lalu buca husil

. ],;:T TERKAIT Unit sampling


Unit pemeriksaan imunoserologi

46
P E.UERL\-T.{II }L{B L?A TE }_ S E R l,ryA}i
Rsl[ID Kt AII\ PF,rrrualvc
Alariai .': ".t- Ya; Noji Kuala pembuang742ll Ka.limantan Tcngah
Tcigr [053t) 2I0t7 Forimite. (0533) 2t566
caml : ..1;,i \!ilt\ itil (/ \ irll()o c()nl

PEDOUAIY PELAYANAN MEDIS No. Dokumen:43 lspo/LABI ul20L6


Tanggal Dibuat: Tanggal Berlaku
Nama Bagian : INSTALASI LABORATORIUM

PEMERIKSAAN NARKOBA Kuela Pombuaug

au/+

: r );GERTIAN : Prosedur ini memuat tata caraffi


.-.JUAN
: Mengetahui adanya kadar nenioaiazephine
:,:S{Jtrffi1q : 1. Adanya surar permintaan F;;i;fksaan
2. Adanya sampel (pasien)
3. Petugas ana.lis kesehatan
:-iTCSEDUR : 1. Menyiapkan alat t*rg ,lig""rk*, untuk perneriksaan
narko b a (B enzo diazephine)
2. Ambil strip test, lalu tambahkan urine pada tabung, lalu
celupkan strip test
3.; Latu baca hasil

-.];IT TERKAIT Unit sampling


Unit pemeriksaan imunoserologi

47
PE }TERI\TAH KABUPATEN- SEMF
ji d
RST]D I(IALI\ PEMBUAITG
A;a.ma \"ari No-30 Kuala-pembuan gl42ll Kalimantan Tengah
iclpon. (0538) 21017 t;aximitc. (0538) 2tj66
amail : rstr{1 .\cnr) iln.ir \ ;rhix,.corn
PEDOMAN PELI\YANAN MEDIS No. Dokumcn:44
langga-l Dibuat
/spo/LAB/ rt/2016
:

Nama Bagian : INSTALASI LABORATORIUM

PEMERIKSAAN NARKOBA Kurl,r Pombueng

PeruJatu1 lresui:

:: );GERTIAN : Prosedur ini rnemuat tata caro pemerikeaon narkob€r


--'"uAN : Mengeta@p.tlr""-**
" :.3IJAKAN 1. Adanya surat permintaan-ffiEffi aan
2. Adanya sampel (pasien)
3. Petugas analis kesehatan
:.: ] SEDUR 1. Menyiapkan atat yt
narkoba (Ampethamine)
2. Ambil strip test, lalu tambahkan urine pada tabung, laru
celupkan strip test
3.; Lalu baca hasil

-:;:T TERKAIT Unit sampling


Unit pemeriksaan imunoserologi

48
ERUYAN
pt'nuu- ela?))-Ka1-imantan Tensah
'' ,ii-li"'i-iuuru
^rs'rq ,,
Alamar : 'i.ip.".
tos38) 2lol7 raximile'.(0538),21565
(/ crtttl
e-mail : r.il.1-t. rtr) 'rrl 1 ;lltrrtt

No. Dokumen : 45 lSPo fr12ore


PEDOMAN PEI,AYANAN MEDIS
!!Nl
-anggal Dibuat: Nama Bagian : INSTALASI LABORATORIUM

Kucll Pombuang
PEMERIKSAAN NARTTOBA
sffiffi
t*[: ""*
n narkoba
pBNcpnrnN
M""u.t"f.;[da;f k^dtr morphine
:UJUAN '
aan Pemeril<sa'an
{BBIJAKAN
2. AdanYa sarnpel (Pasien)
3. I?etugas analis kesehatan
pnosBOUn :
- r- MffiaPkan alat Yang Asfiilan untuk pemeriksaan

narkoba (MorPhine)
urine pada tabung, la1u
2. Ambil strip test, lalu tambahkan
celuPkan striP test
3. Lalu baca hasil

'.JNIf TERKAIT Unit samPling


Unit pemeriksaan imunoserologi

49
PE }TERf\-T.{II I(ABUPATEI{ SERIIYAN
RSIID Ifl'ALII PEMBUAIVG
Alamat : Jl A. Yani No.30 Kuala Pernbuang 7421I Kalimantan Tengah
Telpon. (0538) 21017 Faxirnile. (053E) 21566
e-mail : t.tr,l \rtll\illl./ \lllttlrt ct'tll

PEDOMAN PELAYA}IAN IIEDIs No. Dokumen:46 /SPO/LAE / tr/2o76


Tanggal Dibuat : Tanggal Berlaku
Nama Bagian : INSTALASI LABORATORIUM

/ffi;)r.
'l{,t
Halaman
I
Kuala Pcmbuang
I Dari
1

PEMERIKSAAN NS 1
'l
Ir
KUATA
n'l
alil+
.d) 200604 I Ol2
)oTEfT Baru Besar I'erubahan
n
PENGERTIAN : Prosedur ini memuat tata cartr pemeriks&an NS 1
bahun Penrbatalan

TUJUAN : Mengetahui adanya antigen dar,i clcmam bcrclarah

2. Adanya sampel (pasien)


3. Petugas analis kesehatan
pROSEDUR : 1. Menyiapkan alat yang digunakan untuk pemeriksaan
:

NS I
2, Ambil rapid test, lalu tambahkan serum 100 pl
3. Lalu tunggu selama 10 - 15 menit
4. l,alu baca hasil

Unit pemeriksaan imunoserologi

50
\o Dokurnen : SPO LAB ll20i6
PROSEDUR PELAPORAN Nanta Bagian :

NILAI KRITTS TNSTALASI LABORATOzuUM


Tanggai Dibuat :

I Febuari 2016

Standar Prosedur OPerasional


{f
frv
*t
\t\s
pixsrslr'
yang merawat Pasten'
Pengertian 1. proses p"ny**puiin hasil kritis ffiffil'd-okter
diagnostic penunjang yang
z. Nilai l{asil Kritis adalah hasil pemeriksaan
se gera"
memerlukan Penanganan
3,PelaporanHasilKritisaclalalrprosespenyampaiannilaihasilpemeriksaan
yangmemerlukanpenanganansegeladunl-,a.,sdilaporkankeDPJPdaianr
rnaktu kurang dari 1 (satu)
j?m'
r,l,aspadai (aler.t
friiuan
ffi-i
valuesinterpretasilaboratorium,kardiologi,danradiologitrntuktenaga
kesehatan).
2.Metrcegahketerlambatanpenatalaksanaanpasiendenganhasilkritis.
3'HasilkritisdapatditerirnaolehDP.IP,Vangmerawatdandiintbrmasikan
lL'201I ta,ggal
Kebiiakan $H'""-"
Pasien Rumah Sakit'
24 Agustus 2011 tentang Keselamatan
't;;;"-*;;*;t, tentang Pedoman Penerapan
(IPSG)'
lnternational Patient Safety Goals
dipastikan hams diterima oleh dokter
Semua hasil yang p".t,, ii waspaclai
akan mengunllll tiodakan
altti*rqrr terhadap lalil kritis ter::!lt,
l,ang _@saan laboratodum
'rosedul ffiiatoriumYangme Biia DPJP tidak bl::-t'*::::
menyampaikan hasil kritis ke DPJP'
langsung
;il;;;;, iuro'*torium vang melakukan pemeriksaan
gawat
rawat inap' rawat jalan dan unit
menghubungi dokter/ peraw.at unit
daturat.
Dokter/pettrgasyangmelaporkanhasilkritismencatatTANGGALdan
PE'TUGAS KESEHATAN
WAKTLI m"n.lporl Nervrn LENGKAP
YANG MENELEPOI'{'
YANG DiHUBLNGI dan NAMA LENGKAP
Dokter/perawatftlanganyangmenerirnahasilkritisnrenggunakanteknik
Baca (read back) Konfirmasi
komunikasi verbal ir-riis (write back)/
(Confirmation).prosespelaporaniniditrrlisdidalamrekammedis(fotm
catatan perkembangan teri ntegrasi)'
Dokteri peraw'at ruangan -Yang menerima laporan hasil kritis langsung
menghubungi DPJP/'PPDS Y*g *"t
i. Buku register
1. Laboratorium
2. BagranPoliklinik Rawat Jalan
J. BagaaRawat lnaP
(IGD)
4. Bagan Instalasi Garnat Darurat
r-+^l--i D-rlqh Central
PE\tERI\T {H L{BLP.{TE\ SERL \ .$
''''F,,
\lamal .il \. \ anr \!r-lr, Kuala penthuanq 7-ll1I Kalimartan Iensah
Ielptrn r(ij-l8r 11017 Farimile. (05j8) :i566
e-mail : rsud seruvan.rivahoo.com

PROSEDUR DAFTAR I{ILAI No. Dokumen : ;,SpO,rLAB1lI/2016

KRITTS
INSTALASI LABORATORIUM
I anggal Dibuat Tanggal Berlaku : No Revisi :
Halaman
I Febuari 2016
Ditetapkan olch :

* Kuala Pemb uang

/.+ sa
{q'l
Standar Prosedur Operasional *
tll, "RSUD
a.l
xtff-ApeMeu*Ne
T +
$ 2 200604101
Pengertian l\lral flasu hJltll
I diagnostic penunjang yang

Irj*" @
1. Proses penyampa i""
lganan segera.
h".rt k
2. Terlaksananya pr oses pelaporan nilai (nilai yan_u perlu di
waspaclai "alert )
interpretasi laborc rtoriun.
3. Mencegah keterla mbatan penatalaksanaan pasien dengan hasil kritis.
Kebijakan l.Peraturan Menteri
24 Agustus 2011 te ntang Keselamatan Pasien Rurnah Sakit.
2. SK Direktur Norr or: tentang pedoman penerapan
Intemational Patier rt Safety Goals (iPSG).
3. Semua hasil yang perlLr di waspadai dipastikan harus diterima oleh dokter
1'ang akan men_qarrrbil tindakan terhadap hasil kritis tersebut.

T-r--* ]ffi1**"''=Yffi--=
I :* I I}LarERffis_L{]\- RH\D-+II I rrr-cci sArL_{,{ i

l
I lmlr-rroI-ocr I i

f p**r;u. ;;r-.i
I - rLeur.ostt _ __ -.--*l_-.
[_r <f0o ---[:o--
l>i0.ooo'
*:ut{ka?Gb.r.,
f : Trttr*G-tr- I

I l**rosr.rrrs I
tt I

l r ll - -_ _[+:.= __-__ :b&r-Eq+ __l


l-++*P@erIlqsl-Plj -:* ;'**]
,

I lrmu+rr-rmtr(
I I lu'"** :
I - i

[=.r, segdl i

l| j-i lgl+,."n
lGlukotaDarahfEalii '<+0 l=-i::
j
ffil I

s"t tr*_n = r__-* ramol 1


l: 1
I

i
j

I l-lsrxtrr-lx-+r.rsr I

I |**D-{R+H I l
ino.i \tLll hRlI l: \lL{ihj{I1[1 ll\LL1
II.
PARAMEmR
RL\L) \II
-,il
If
lll,,mnulnhin fllb)
r1 :' rr ;
llf, il,i.''
I

i li.'l'i:::i 1':1.
i
__.:-t
i 1r.:t,r.",1iii iI l. ,

i !r.11-r.,,,.i':l Il';r':l-1:. '


'rrL,i -- ltr-i1 " -
1'

I i,',: f, l: l i

i.l l: iil ..-


j.iliil li!1,1 ,i
ll,,-1.;trll - r: .1 L

t-'tl.,t.ll'
Lllr'.ii::'. i:nlr r il i I
1..i,r,, ',ir"l -.

'ilr,t,,,l;r',li L'].ii,lll i'-l1i \r! l:i.r:,1. :il'irr:l:

\1at-alat B Lrliu re gister Laboratorir-rm


L nit Kerja 1. Laboratoriurn
2. Bagian Poliklinik Rawat Jalan
3. Bagian Rawat InaP
4. Bagian Instalasi Gawat Darurat GGD)
5. Instalasi Bedah Central
PE}IERI\T-{H T-{BT PATEN SERT]YAN
\lanrai .Ii .'\ \ 311 \;,.-ilr Kuaia Penlbuirng l-1111 l'alimantiul Tengalt
le1pon i05-i8r 11011 Farinrile (0518) 21566
e-mail I rsud senllan i'ilahoo.com
No. Dokurnen:
{LUR PELAYANAN LABORATORIUM Nama Bagian :

Instalasi LaLroratorium
Tanggal Berlaku: No Revisi : Halaman
i Tanggal
I Dibuat: 01/01/2016 i
I 12/1212015

;ts*
"ffi. Y*
Pemtruang
'4{J
,*, ,

Standar Prosedur Operasional uI


o,!
.@ry
f-e-F
.$7742 20A604101?
"22
Pengertian @asien(rarvatjalarr/rawatitrap)yangakannrelakukan
pemeriksaan di instalasi laboratorium.
Tujuan 1. Sebagai acuan petugas dalam memberikan layanan.
2. Agar pasien mendapat pela.vanan terbaik, cepat dan terarah.
Kebi-jakan

Prosedur

AI.UR PfIAYAI\UTN T.AB{}NATORIU*I

PASIEN RAWA-r JATNAI P&SITN IIAWA' INAP

Pemeriksaan Pefieriksaan
di lakukan di lakukan
se ndiri sendiri

. Cetak Has,l
. Validasi oleh analis
. verifikasi oleh dr. PK

. Cetak Hasil
. Validasi oleh analis
. Verifikasi oleh clr. PK
I .- L) ,', -- l- --
r\-r'i-r-l-11\!.\:-!-*- L'

T:-.:1... tst;:h L irtrJi


L nit Care intensir e

6 L'nit Rau.atJalan
lffi\ PEMERIIYTA[I KAIBUPATEN SERTIYAF{
I

(@)i
i

A Ptr$ffi-$A3'ic
\\\ r?ffi'r ,// ,\lamat .Il. A Yani No l'0 Kuala Pembuarg
. 74211 Kalimantan Tengah
\\ffi,//
|

l
IeiPon. (053 8)2101 7 Faximile. (0538) 21566
e-nrail ISLlO. eruvan@vahoo.com

TDENTU 'lK ASIPASIEN SEBELL,N'[ , No. )okumen: *

PEI\G TMBILAN DARAH DAN Narna Bagiatr :

SPECIMEN LAIN Instalasi Laboratorium


No Revisi : [{alaman
T""gg"l Tar-sgA Betlaku :

0 I /0 1r201 6
l
Dibuat:
12i1212015 "4F"
Dit"tupffifi$S-$ 4
\)(Direktur ala Pembuang
{/,, :
,/s
Standar Prosedur OPerasional {{f
I' msuu
Lxu*t*psilie
I
Iti

1I*
$h".r
,r
I 012
22200604

Pengertian Merupakan proses verifikasi id ;tt.tas pt".. "*belum pengambilan darah dan
specimell iain

rri.*" T- 1. Mengurangi teriadinya kesalahan dalam mengtdentlllKasl past€Ii prosedri'r


\ z. Sebagai acuan daiam pemberian pengobatan dan tindakan atau
1 otmeriksaan'
3. Terpeliharanva mutu pela-vanan
1. Menjaga keselamatan Pasien

n Pada Pasien
,',',.r ,k=.
dengan benar
harus melakukan kontirmasi identifikasi pasien dengan benar
rPeraruran Direktur Nomor :...'.'.'/RSLID KP-SK/ilIzuxIl2}15
tentairg

Pencarrlbilan darah dan specimen lain'

.. . :. . S iaprf,sn status Pasien

- Teur a nanla pasien (pasien langsung atau keluar')


:' Liliat gelang identifikasi }'ang terpasang
i (-trcokkan antara status pasien. nama yang disebut dengan gelang
.;r'rtit-tkasi ) ang telPasang
l--:..''r:nLrengamtlilanclarairatauspecimeniainsesuaiadistatus
:::,.n.nal]la \.ang disebut dan gelang identifjkasi sesuai'
rekar
,:;::,;lk:"-ci ulang pasien bila ticlak ada kesesuaian identitas kepada
mfis
status pasien'
Dokumentasikanpengambilan darah dan specimen lain di
PEMERINTAH KABUPATEN SERUYA1Y
R:SI$E il:iI-TAiLA EtE"qyillB-r i$"{n:{ ;
Alamat : Jl" A. Yani No.30 Kuala Pembuang 74211 Kalimantan Tengah
'Ielpon. (0538) 21017 Faximile. (053ii) 21566
e-rnail seruy aar!?1'ahoo. com

HASIL PEMANTAUAN WAKTU No. Dokunren :

PENYAMPAIAN HASIL PEMERTKSAAN Nan"u Bagian :

LABORATORIUM UI{TTTK PASIEN Instalasi Laboratorium


URGEN (CrTO)
Tanggal 'langgal Berlaku : No Revisi :

Dibuat:
12/12/201s

fi"6"'
fEit
eL
qa,
Standar Prosedur Operasional
rt r$ru-anSUi)
22204604 I AD
Pernantauan waktu penvampaian hasil perneriksaan iaboratorium 3,ang telalr diperiksa
oleh petllgas laboratorium r-rntuk pasien u'gen (cito) dalam kegiatan pelayanarr
laboratorium.
.,t,,111 Sebagai acuan penerapan langkah- langkah untuk digunakan sebagai
perencanaan. pemantauan, dan evaluasi serta pengambilan keputusan dalam suatu
t i ndakan unt uk peningkatan pelayanan laboratorium.

-\danr a stlrat permintaan pemeriksaan dari dokter


Tertulis :

1, Laporkan hasil pemeriksaan dengan menyerahkan hasil tertulis yang telah


diketik kepada bagian yang menangani pasien
l. I ocokkan identitas irasil dengan identitas pasien dibagian vang menangani

P.'riksa kembali pemeriksaan laboratorium yang diminta


TuLis bukti pelaporan hasill,'ang diterima : Nama, paraf dan naktu pada
: :.u serahterima hasil pemeriksaan laboratorium.

T.i.r,n
Lryo*an hasil pemeriksaan dengan membacakan hasil lewat telepan yang
rcIah selesai dikerjakan
}{enml"akan keberadaan pasien
\{embacakan hasil pemeriksaan laboratorium dan nilai rujukan dengan
beuar k€pada penerima telepon yaag menangani pasien tersebut
Mcmimpenerimatelepon rurtuk membaca ulang dengan benar
Hamb di buku serahterima hasil pemeriksaan labaratoriuni (hasil lewat
hhm) : rpm+ paraf dan waktu pembacaan
as laboratorium . radiologi dan perawatan yang melakukan
:-., -- *- ...' t :.r.., r::tp:;kari hastl kritis . biiatidak bisadihubungi.

-- .. - -. -: - ::,:rlhubLr"nci dokteri peran,at unit rawat inap"


i _. -l .l_-1.:i
__- -' -_
t,- =_ _ :
_ _ .:t r. -:t. --:>..,,tl:lc-t-l iCttO) menCatat tanggal dan
, -: :, --., I;>=l;iJ1t \ ang dihubungi dan
Unit Kerja 1. Laboratorium
2, UGD
3. Ruang Rawat lnap Keperau.at
4. Instalasi Bedah Central
5. t]nit Care intensive
6. Unit RawatJalan
PENUTUP

1. KESIMPULAN
Standar Prosedur Operasional adalah :

a. Suatu standar atau pcckrrrun tertulis yiurll, tlillergunakan rrrtluk mendorong (lllll
rncnggcrukarr suutu ke lorrrpok urrtuk nre rrclpli lu.juutt orgitttisusi.

b. Tata cara atau tahapan yilng lrarus dilalui clalarn suatu proscs kr:r.ja tcrtcttlu, yattg
dapat diterirna oleh scorang yang berwenarrg atau yang bcrtarrggurrg jawatl utltuk
mempertahankan tingkat penarnpilan atau kondisi tcflentu schingga suatu kegiatan

dapat diselesaikan secara efektif dan efisien.

c. Tata cara atau tahapan yang di bakukan dan yang harus dilalui untuk penyelesaian
suatu proses kerja tertentu.

Tujuan Standar Prosedur Operasional :

a. Agar petugas menjaga konsistensi dan tingkat kinerja petugas atau tim dalam
organisasi atau unit.
b. Agar mengetahui dengan jelas peran dan fungsi tiap-tiap posisi dalarn organisasi.
c. ivlemperjeias aiur tugas, wewenang dan tanggung jawab dari petugas terkait.
d. Melindungi organisasi dan staf dari rnalpraktek atau kesalahan administrasi
lainnya.
e. Untuk mengindari kegagalan atau kesalahan, keraguan, duplikasi dan in eflrsiensi.
2, SARAN
Kepada staf RSUD l(uala Pembuang agar memiliki motivasi ke depannya semakin
baik, terutarna dalam pelayanan medis, antara lain :

a. Supaya melaksanakan pelayanan medis di setiap instaiasi tetap mematuhi standar


prosedur operasional yang telah ditetapkan.

b. Agar selalu rnelakukan evaluasi terhadap tenaga medis di setiap instalasi dalam
memberikan pelayanan medis sehingga diharapkan selalu melakukan pelayanan
sesuai dengan standar prosedur operasional.