Anda di halaman 1dari 7

MAKALAH

PENGORGANISASIANINFORMASI/PENGETAHUANDALAM

INGATANMANUSIA

DisusungunamemenuhitugasakhirModul3KuliahDaringProgramPPGDalam

JabatanKemenag

Tahun2019

JabatanKemenag Tahun2019 DisusunOleh: ASWADI KelasPD3 PROGRAMPPGDALAMJABATANKEMENAG

DisusunOleh:

ASWADI

KelasPD3

PROGRAMPPGDALAMJABATANKEMENAG

UNIVERSITASNEGERIMATARAM

2019

BABI

PENDAHULUAN

1.1.LatarBelakangMasalah

Manusiamerupakanmakhlukyangsangatkompleks,terutamadalam

pemikirannya.Sedangkanperangkatmanusiayangpalingkompleksadalahotak.

Prosesberpikirmerupakanprosesyangkompleksdantidakdapatdilihatsecara

langsungbagaimanaotakbekerjadaninformasidiolah.Informasiyangditerima

melaluialatinderaakandipersepsikanolehbagian-bagianyangberfungsisecara

khususuntukkemudiandikirimkeotak.Otakadalahtempatdimanamemoriatau

ingatantersimpanyangkapasitasnyatakterbatas.Namuntidaksemuamanusia

memanfaatkankapasitastersebutsecaraoptimalsehinggabanyakruang-ruang

dalamotakyangtidakterisisecarabaik.

Sepertiyangkitaketahuibahwamemori/ingatansangatpentingdalam

kehidupanmanusia.Denganadanyamemori,kitamenggunakankonsepwaktu

denganmenghubungkanmasasekarangdenganpengalamandimasalaluuntuk

harapandimasadepan.Halinimenunjukkanbetapapentingnyakitamengenal

memoriyangdalamhalmanajugasangatpentingdalampembelajaran.

Olehkarenaitu,pentinguntukmempelajaripengorganisasianinformasi/

pengetahuandalamingatanmanusia.

1.2.RumusanMasalah

a.Teoripengolahaninformasi

b.Pengorganisasianinformasi/pengetahuandalamingatanmanusia

1.3.Tujuan

MakalahinibertujuanuntukmemenuhitugasakhirModulBelajar3padaKuliah

DaringProgramPPGdalamJabatanpadaUniversitasNegeriMataram.

BABII

PEMBAHASAN

2.1.Teoripengolahaninformasi

Pengolahaninformasimengandungpengertiantentangbagaimana seorangindividumelakukanpersepsi,mengorganisasi,danmengingatsejumlah besarinformasiyangditerimaindividudarilingkungan.Halyangdemikianjuga dapatdikatakanbahwapengolahaninformasidapatdikatakansebagai bagaimanaresponindividuterhadapinformasiyangdiberikanolehlingkungandi sekitarnya. Adatigakomponenutamamemoriialah:Rekamanindera,memorikerja ataujangkapendek,danmemorijangkapanjang.Rekamaninderaadalahmemori yangsangatpendekyangterkaitdenganindera.Informasiyangditerimaindera tetapitidakdiberiperhatianakanterlupakandengancepat.Begituditerima, informasidiolaholehpikiransesuaidenganpengalamandankeadaanmental kita.Kegiataninidisebutpersepsi.Rekamaninderamenerimainformasidalam jumlahbesardanmasing-masingindera(penglihatan,pendengaran,sentuhan, penciuman,rasa)danmenahannyadalamwaktuyangsangatsingkat,tidaklebih daribeberapadetik.Jikatidakadayangterjadipadainformasiyangditahan dalamrekamanindera,informasitersebuthilangdengancepat.Informasiyang diterimainderatetapitidakdiberiperhatianakanterlupakandengancepat. Memorikerjaataujangkapendekadalahsistempenyimpananyangmenampung limahinggasembilanpotonganinformasisetiapsaat.Informasimasukke memorikerjadarirekamaninderamaupunmemorijangkapanjang.Pengulangan adalahprosespemanggilankembaliinformasiuntukmenempatkannyakedalam memorikerja.Memorijangkapanjangadalahbagiansistemmemoridimana sejumlahbesarinformasidisimpandalamkurunwaktuyangtidakterhingga. Teoripembelajaran kognitifmenekankan pentingnya membantu siswa menghubungkaninformasiyangsedangdipelajaridenganinformasiyangada dalammemorijangkapanjang.

2.2.Teori-teoripengolahaninformasi

Teori-teoripengolahan informasimemfokuskan perhatian pada bagaimanaorangmemperhatikanperistiwa-peristiwalingkungan,mengkodekan

informasi-informasiuntuk dipelajari,dan menghubungkannya dengan pengetahuanyangadadalammemori,menyimpanpengetahuanyangbarudalam memori,danmenariknyakembaliketikadibutuhkan.Informationprocessing

modelmemandangmemorimanusiaitusepertisebuahkomputeryang

mengambilataumendapatkaninformasi,mengelolanya,mengubahnyabaik

bentukdanisi,kemudianmenyimpannya,danmenghadirkankembalipadasaat

dibutuhkan.Daripengertiantersebutdapatdikatakanbahwateoripemrosesan informasimerupakan modeldalam teorikognitivismeyang mencoba menjelaskankerjamemorimanusiadalammemperoleh,menyandikan,dan mengingatinformasi. Komponenbelajarmenurutteoripengolahaninformasisepertiyangtelah dijelaskanpadapembahasandiatas,bahwakomponenbelajaradalahperhatian yangditujukanpadastimulus,pengkodeanstimulus,danpenyimpanandan mendapatkankembali(retrieval). Atasdasarkomponendasartersebut,selanjutnyahalyangesensialdari pembelajaranadalah(a)membimbingsiswauntukmenerimastimulus,(b) memperlancarpengkodeandan(c)memperlancarpenyimpanandanretrieval. a.Membimbingpesertadidikdalampenerimaanstimulus Sistemmemoridapatmelakukanprosesseleksiatasstimulus-stimulus yangakandiperhatikannya,inijugadapatdikatakanbahwasistemmemori manusiamemilikisuatuaplikasifiltrasiterhadapstimulus-stimulusyang diperhatikannya.Kegiatanpembelajaranyangdapatdilakukanberkaitan denganmemberikanbimbinganperhatianpesertadidikterhadappenerimaan stimulusantaralain:

Memusatkanperhatiankestimulus-stimulustertentuyangdipilih. Dalamhalinipendidikakanmemberikanperhatiankhususterhadap siswamengenaistimulus-stimulusyangakandipilih.Jadidengan demikiansiswa/pesertadidikakanlebihterkosentrasipadastimulus yangtelahditentukan. Mengenalisecaraawalstimulusdengankode-kodetertentu.Dalam pengenalanawalstimulusmelaluipengkodeanyaitubagaimanaindividu mengubahstimulusyangadasehinggadapatdisimpandanpadawaktu yang laindapatdimunculkankembalidenganmudah.Dalam pengkodeaniniakanterjadiprosespengulangandanmenghubungkan

denganinformasilamayangsudahtertanamdalammemorimanusia. b.Memperlancarpengkodean Pengkodeanberfungsiuntukmenyiapkaninformasibaruuntukdisimpan kedalam memorijangkapanjang.Prosesinimenghendakiadanya transformasiinformasimenjadikoderingkasangunamemudahkandan mengingatkembalidiwaktukemudianmengenaiinformasitersebut.Ada duarancanganyangberbedayangdapatmemudahkanpengkodeanyaitu denganmemberikanpengisyaratan,elaborasi,dancaratitianingatan sebagaipembantu untuk menyusun sandiatau kode-kode guna memudahkandalamprosespenyimpananpadamemorikerjapesertadidik. c.Memperlancarpenyimpanandanretrieval Suatutaktikatausiasatpengkodeansangatpentingkarenahalinidapat meningkatkankemampuanmengingatkembalipadawaktuyangakan datang.Inidapatditujukanberupa:iramabunyi,sajak,kata-katapokok,citra visualdansebagainya,yangsemuanyamemberikanpengisyaratanuntuk maksudretrievalbagipesertadidikdalamprosesbelajar.

2.3.Konsepsiawaltentangteorimemorimanusia

Konsepsiawaltentangmemorimanusiamenganggapbahwamemori hanyasekedartempatpenyimpananataukolektorinformasiyangpasifselama

periodewaktuyanglama.Tetapi,padatahun1960-anperisetmulaimemandang

memorimanusia sebagaisistem kompleks yang memproses dan mengorganisasikansemuapengetahuankita. Carakerjamemorimanusiameliputitigamacamsistempenyimpanan

ingatan,yaitumemorisensori(sensorymemory),memorijangkapendek(short-

termmemory)danmemorijangkapanjang(long-termmemory).

Sensorymemoryatausensoryregistermerupakankomponenpertama

dalamsistemmemori.Sensorimemorimenerimastimulusatauinformasidari

lingkungan(sepertisinar,suara,bau,danlainsebagainya)secaraterusmenerus

melaluialatpenerima(receptor)kita.Reseptordisebutjugadenganalat-alat

indera.Informasiyangditerimadisimpandalamsensorymemorykuranglebih

duadetik.Keberadaansensorymemorymemilikiduaimplikasidalamproses

belajar.Pertama,orangharusmemberikanperhatianpadainformasiyangingin

diingatnya.Kedua,waktumendapatkanataumengambilinformasiharusdalam

keadaansadar.Setelahresponditerimaolehsensorymemory,otakmulaibekerja untukmemberikanmaknaterhadapinformasiataurangsangantersebut. Short-termmemoryataumemorijangkapendekadalahsistemmemori

dengankapasitasyangterbatasdimanainformasidisimpanselama30detik,

kecualiinformasitersebutdiulangataukalautidakdiproseslebihlanjut,karena

jikadiprosesinformasibisadisimpanlebihlama.

Long-termmemoryataumemorijangkapanjangadalahjenismemori

yangmenyimpanbanyaksekaliinformasiuntukperiodewaktuyanglamadalam

carayangrelatifpermanen.Kapasitasmemorijangkapanjangmanusia

sangatlahmengejutkandanefisiensidimanaindividu-individubisamendapatkan

kembaliinformasisangatlahmengesankan.Representasipengetahuandalam

Long-termMemorytergantungpadafrekuensidan“keberlanjutan”.

2.4.Pemanfaatanteoripengolahaninformasidalampembelajaran

Aplikasipengolahaninformasidalampembelajaranmembantupara

siswameningkatkanmemori,dengancaraantaralain:

1.Memotivasianak-anakuntukmengingatmateridenganmemahaminya

daripadamenghafalkannya.

2.Membantusiswa-siswadalammengaturapayangmerekamasukkandalam

memorimereka.

3.Mengajarkanstrategimnemonik.Mnemonikadalahbantuanmemoriuntuk

mengingatinformasi.Strategimnemonicbisamelibatkanimajinasidankata-

kata.Beberapajenismnemonikantaralainmetodelokus,sajak,akronim,dan

metodekatakunci.

Manfaatteoripemrosesaninformasiantaralain:

1.Membantuterjadinyaprosespembelajaransehinggaindividumampu

beradaptasipadalingkunganyangselaluberubah.

2.Menjadikanstrategipembelajarandenganmenggunakancaraberpikiryang

berorientasipadaproseslebihmenonjol.

3.Kapabilitasbelajardapatdisajikansecaralengkap.

4.Prinsipperbedaanindividuterlayani.

BABIII

SIMPULAN

Daripemaparandiatasbisadisimpulkanbeberapahal:

1.Pengolahaninformasimengandungpengertiantentangbagaimana

seorangindividumelakukanpersepsi,mengorganisasi,danmengingat

sejumlahbesarinformasiyangditerimaindividudarilingkungan.

2.Komponenbelajarmenurutteoripengolahaninformasiadalahperhatian

yangditujukanpadastimulus,pengkodeanstimulus,danpenyimpanan

danmendapatkankembali(retrieval).

3.Carakerjamemorimanusiameliputitigamacamsistempenyimpanan

ingatan,yaitumemorisensori(sensorymemory),memorijangkapendek

(short-termmemory)danmemorijangkapanjang(long-termmemory).

4.Teoripengolahaninformasibisadigunakandalampembelajaran.

Sumber:

Cahyono,TriAgusdanLastriningsih.2013.TeoriPemrosesanInformasi.

Makalah.Yogyakarta:PascaSarjanaUNY.

Slavin,RobertE.2011.PsikologiPendidikan(TeoridanPraktik).Jakarta:

PT.Indeks

https://agungekonugroho23.blogspot.com/2017/10/teori-pengolahan-informasi-

dalam-memori.html

https://psychologymania.wordpress.com/2011/07/11/memori-dan-pemrosesan-

informasi-dalam-proses-berpikir/

https://rizkayuni01.wordpress.com/2015/07/02/teori-belajar-pengolahan-

informasi/

https://blogzulkifli.wordpress.com/2011/06/08/teori-pemrosesan-informasi/