Anda di halaman 1dari 179

I{TOIE

PEI{GAffTfiR
PABRIK
PEf{GAI{ASAN 6ULA

J.Sartono
85c{Teltno$ogi Gda), MSc tl'lrnu Parqan}

Lembaga Pendidikan Perkebunan


Yogyakarta
1988
iii

PRAK'{TA

Sejarah perkernbanganCollege Cula Negara (CCN) menjadi Akaderni


Gula Negara (AGN), kemudian menjadi LPP hingga sekarangmenunjukkan
bahwa dalam 25 tahun terakhir pendidikandan pelatihanyang paling stabil
yakni:
i, Pendidikan Teknologi Cula (dengan nama CCN' ACN, LPP Jurusan
Teknologi Gula, PencjidikanAhli Usaha Perkebunan(PAUP) Jurusan
Pengolahan
Cula)
2. KursusLaboranCula (KLC).
Fakta ini membuktikan bahwa Pendidikan Teknologi Cula dan KLC
mutunya
benar-benandibutuhkanoleh PT PerkebunanCula. Mudah-mudahan
prn makin meningkat seirama dengan kemajuan ilmi"r pengetahuan dan
teknologi.

Mula-mula peserta Kt-C berlatar pendidikan5D, denganmatapelajaran


PengawasanyanB disebut Praktikum Hitung-menghitung(6 jam seminggu
selama 6 bulan). Selanjutnyapendidikandasar ditingkatkan menjadi SMTP.
Sekarang, peserta KLG rata-rata berijazah SMTA, diam-diam ada juga
vang berijazah sarjana muda, bahkan sarjana (S1). Keanekaragamandasar
pendidikanini sudahbarangtentu menimbulkankesuiitanmengajar.

Buku Pengantar Metode PengawasanPabrik Cula ini diberikan kepada


peserta KLC sebagaibahan pelajaran (teori) 2 jarn semingguselarna5 bulan,
yang ditunjang pelajaran praktek 5 jamlminggu. Dengan bobot pelajaran
tersebut para peserta setelah lulus diharapkan mampu mengerjakanlaporan
'i5
harian (dan yang
harian), lsi buku ini mencakupperhitungan-perhitungan
dilakukandi masadatang.
dilakukansekarangdan yang besarkemungkinannya
Dengan memahami pokok-pokok isi buku ini diharapkan
pengawasanyang rumit rnenjaditidak sesulit seperti
perhitungan-perhitungan
apa yang dibayangkan. Sepertiga isi 'buku ini tidak diajarkan di k las,
diharapkan sebagai bacaan lanjutan setelah mereka kembali ke praktek
{sesuai dengan kesempatan yang ada), atau untuk pelajaran pada kursus
yang setingkatdi lebih tinggi misalnyaKursusAnalis Cula.

Yogyakarta, Desember1988 Srtn


IV

DAFTAR I5I

I. PENDAHULUAN
.,
II. S I S T E ML A M B A N G
4
A. LambangBahanPenyusun.......r.""""""""'t"""'t""""""
B. LambangBahanBaku, Hasil Antara, Hasil sampingdan Ha'
Sil Akhif r..,.................r'....r......,.........r.r.......... 7
't0
C. FaktOf ...............................r.....r.'.......r.'o..r....

D. Pef5entasg ...........r.........r...........r...'.r............. 11
EfisiensidanKemampuan """""""'t""""'t"",
E, Lambang 12

SISTEM
NE B US E B A GAI
I I I . R EN D E MET PABRIK
PENCAW ASAN
CULA ........a.....r.....r...........r..............r.........4..t.............ra.t.
15
Pabrik Cula di Indonesia""r"""""'t"'
A. SistemPengawasan 15
lsScT
B. SistemPengawasan .r..,....r....................'. 20
ISSCTKhususdi Hawaii """"""r"""t'
C. SistemPengawasan 21

lv. cuLA, zAT PADAT DAN BUKAN cuLA .,....r..o..r.......""""' 23


A. Pengertianpol, brix, dan bukangula ..........c.....t........to..... 23
B. Pengertiansakarose,zat kering dan bg sejati """""""""'o 24
C. KemUfnian(HK) dan kfistal (hablUf) ..........................""' 25

v.BoBoTTEBU,AIRIMBIBISI,NIRAMENTAH,AMPASDAN
KAPASITAS CILINC ...........!...o...........o........'.to.....r......'..""' 29
A. BObOt TebU ........r..............or.......r.......................r....'.""o'
29
B. BObOt Nifa Ment8h .n.........r......'..'...'........'......'f......."""'
35
C. BObOt Aif lmbibisi ...,..............................r.,.'o'o...'....o"."t' 38
D. BObOt AmpaS ...i....Gr..i..r,.o.......................r....i......'.ot.'.'r..
38
E. PenimbanganNira Encer ...,........r..r'...r"..c.t.................,..
40

Vl. SUSUNAN TEBU ......r....,.r......r...............t......................o.....


41
A, PgfhitUngan kadaf pOl r.a.r.r..-i.......r.......r...r.....o..rr.r....... 43
B. Pgf hitUngan kadaf $1iy lcJU ........o.......'.'...ttti.o....r..r....... 43
C. Pef hitUngan kada. JabUt tebu ............o.'..,r..........o'......r...
44
(nt) .r.c,.....,........... 44
D. Perhitunga. <ddar nira tebu
d. Pgf higrnganaif tgbu bgbaSbf iX ..ot............r...rr.'............. 44
F. Safnpah tebU ............r........o..............r...o...t...r.....o....r...... 45
V

PENILAIANTERHADAPKEBENARANANCKA-ANCKA.t...... 46
A. Air tebu bebasbrix % sabut ...,........r..........ri.... 46
B. Faktor Campur(FC) ............................................o.....or..47
C. Cara pencocokan (infet'ential method)
menUf ut Noel Deeff ............r.................................o........ 48
SUSUNANNIRA MENTAH ........................r.......................'. 53
A. Diagram Cobenzeuntuk percampurandan pemisahan.....r.. 53
B. PefhitUngannpp % nm dan npl % nm ................................ 57
C. Perhitungannira tebu dalam nira mentah ............oi...,.'..... 58
D. Nilai nira dari nira mentah(konm) ......r......,..........,.-........ 59
E. Kristal dapat diperolehdalam nira mentah/1O0t€bu .......... 61

N E R A C AB A H A N S T A S I U NG I L I N G A N 62
.........O'I""'
A. KebUtuhanData ......'.........................o.....r......o..............62
B. NeracaBahanMenurutMetodeBrix ...."...................r........ 63
C. Neraca BahanMenurut Metode PengawasanCilingan Indivi-
dual ISSCT ...........'.,.................................._...'..r.............68
D. Neraca BahanMenurut Metode Zat Kering (Arus Bahan)..".. 69

EFISIENSICILINCAN ...,...'.o....................'..........o.............,. 7 1
GilinganBersam?....................o.................... 7 1
A. Pengawasan
GilinganIndividu?l..........................'............
B. Pengawasan 84

PENGEMBALIANHASIL SEBELUMNIRA MENTAH ........I''t..O 106


A. Proses nka i..........r...r.............o........r................r.or.'.r.... 106
B. lmbibisi n ira seduh;If'l '....o.................r..............r.....oo......o. 112
teknologidiffuser tebu ........,.....'.....o.....'.....
C. Pengawasan 112

STANDAR GULA .........t..r.......r........."..,...........r. 115


A. Kristal (Hablur)di Indonesia ...o...-.-.................. 1 1 5
B. StandafCula lntefnasiOnil............................,..o.......o..o...119
C. Standar-standarCula Lokal di beberapaNegara ........'....... 124
D. Tafget HK TetgS ...,......r...............o......r......'...,..............o 127
E, Bgda Praktis Tetes ....................oo....r...co'........................ 128
"w

XIII. B O B O TH A S I LA N T A R A ,
F.
HASIL'AKHIR.....'...'...'.... 132
A. Niia Mentah 132
l'= N:.:
B. Blotong ..... 133
C. Nira Encer 136
D. Tetes 140
E. Cula 141

X I V . PE R K IR .A A N (T A K S A S I) 143
A. Teori (Prinsip) *r.i....r.......r.....o.. 143
B. Data untuk Taksasi 144
C. Pelaksanaan 145
D. PerhitunganTaksasiMenurutRumusHommes 146
E. PerhitunganTaksasiMenurut ISSCT 150

XV. PENERAPANSISTEMDALAM PERHITUNCAN


(INDONESIADAN ISSCT) 154
A. PerhitunganMenurut Sistem Homrnes(lndonesia) 155
B. Perhitungan Menurut Sistem ISSCT .r.!r.....*..r..,...,,.......... 162
C. Penyusunan Neraca Bahan Pabrik Cula rorio,-e.roo......r...... va
D. Kehilangan Cula (Pol) ............r.............o.........r.f.r............ 173
1

I. FENDAHULUAT{

Manajemen Produksi Cula menempatkan PengawasanPabrik Gula


sebagai sumber keterangan utama pengendalian proses-prosespemerahan
nira, pengolahan, pembangkitan tenaga serta kemasakan tebu. Pada
hakekatnya, PengawasanCula adalah Teknologi Cula secara kuantitatif,
yang melibatkan perhitungan-perhitungandari yang sederhanahingga sangat
rumit.

Teknologidiangkat dari bahasaYunani, teclne artinya pembuatanba-


"pembuatangula" dari tebu di pabrik gula,
rang, dan togosadalahilmu. lstilah
dari sudut ilmu kimia sebenarnyatidak tepat, karena di dalam pabrik tidak
(sukrose)dalam
ada proses sintesis (reaksi pembentukan)sakarose.Sakarose
tebu masuk pabrik, mengalami kehilangan mekanik dan peruraian kimia,
akhirnya ke luar dari prosessebagaihasil (kristal gula). Frosespengambilan
gula dari batang tebu merupakankombinasiprosespemisahandan pemekatan
(Cambar 1). Pada pemerahan nira, sabut tebu dipisahkan sebagai ampas'
(zat
Nira mentah yang diperoleh dimurnikan untuk pemisahanbukan gula
padat terlarut selain sakarose).Nira bersih yang didapat disebut nira encer.
Untuk persiapankristalisasi,nira encer dipekatkan{diuapkan)hinggahampir
jenuh dengan gr-lla. Kristalisasi sakarose dilakukan secara terkendali'
(dan sebagianair).
Selanjutnyakristal sakarosedipisahkandari bukan gula
Tetes, merupakan hasil sarnping yang disusun oleh sakarosg bukan gula
dan air.
pengawasanCula (Chemicat Controt) merupakanserangkaiankegiatan
pengukuran,analisis dan perhitungan tentang tinggi rendahnya prestasi
'100sakarose
yang dicapai terutama tentang jurmlahsakarosedalam hasil tiap
dalam tebu, atau langsun6tiap 100 tebu. Yang terakhir ini disebut rendemen
tebu.

Tujuan utama pengawasangula yakni:


1. Menjamin tiap operasi satuan dalam pengolahan gula dilakukan pada
"hidup"
ef isiensi tertinggi. Pengawasan bentugas menyediakan data
sebagaipetunjuk langsungbagi para pengawashinggapara tukang'
2

2, Mempertanggilngjawabkanjumtah bahan-bahan dan komponennyayang


masuk proses, yang singgah, yang sedang dalam proses (perkiraan) dan
:,,:'yahgkeluar:dari proses.Dqri sini disusunneraca,kehilangandan efisiensi
:: ,yang dicapai untuk seluruhproses,tiap satuanhinggatiap operasisatuan.
3, Menllai kemarnpuanyang dicapai atas dasar standar kemampuanpraktek.
3

Tebu
I
t
Stasiun PengambilanNira

PembukaanSel

PemerahanAwal

Air
v
---+ PemerahanLanjut/D ifusi --+ Ampas
imbibisi

Nira mentah
I

' Il
Y
Stasiun Pengolahan

CaO
soz-+ StasiunPemunnianNira Blotong
coz

Nira encer

StasiunPenguapan '.+Air embun

Nira pekat

StasiunKristalisasi Tetes

J
Hasil (gula)

Cambar 1. Baganpengolahangula tebu


4

IL SISTEIULAMBANG

PenerapanPengawasanPabrik Gula untuk kepentlngan praktek, pendldik-


an dan peneUtlan membutuhkan lambang-Iambang. Setelah lndonesia rnerdeka,
sudah sewajibnya, lambang pengawasangula berpangkal pada bahasa Indonesla.
Penyusunanlambang pengawasandapat dllakukan dengan mempelajarl penun-
tun, bagan perhltungan dan traporanpengawasan.Pengetahuanslstem lambang
ISSCT dan Betranda akan sangat berguna dalam memetik keunggulan-ke-
unggul.an yang dimiUkinya. Dalam uraian selanJutnya akan dibedakan tiga
sistem yakni lndonesla (i), ISSCT (E) dan Belanda (D). Huruf besar melambanE-
kan bobot (massa), hasllguna (eflslensl) dan hasllbagt (koslen). Huruf kecil
mel.ambangkankadar dan bahan yang dlmaksud. Untuk sistem Belanda, G
(gewicht) menunJukkanbobot, walaupr.rnartt g€ufcht yang sesungguhnyaialah
berat (gayl, obot). Satuan ton (t) masih digunakandalam buku lni denganalasan
kepraktisan, . serra tidak bertentangan dengan slstem satuan lnternastonal
(SI),Undang*undang RepublikIndonesianomor 2i 1981"

A" Iarnbang Bahan Penyusun

1. P,p (I, E. D) pol


7, B,b (I, E, D} brix
3. BG, bg (r) bukan gutra

IE} non-sugar,informally dirt (D)


NS, ns (D ) niet-sulker

4" S,s {r) sakarose (sukrose)


(E) sucrose
S"S {D} saccharose(ware sulker)

5" ZK, zk (r) zat kerlng (bahan'kering)


(E ) dry substance
D"d (D) ware droge stof

6. BGS,bgs (r) bukan gula sejatl = zat kerlng - sakarose


(E ) non*sucrose
WNS,wns (D) ware nlet-suiker (niet-saccharose)
5

7. wrw (r) air, darl bahasa Inggrtrs'water


wo = alr tak mengandungbrlx = air bebas
brix
W,W (E) water
W,W (D ) water
ad = adsorptie water = brlx-wU water

8. N , n (r) nira
(H) Juice
Gs,s {D} sap

NT, nt (r) nira tak dlencerkan (nlra tebu)


(E ) undiluted Julce (normal Juice)
Gos,os (D) onverdund sap
Gors, ors: overdund sap ln ruwsap (nlra mentah
asli)
Gsr, sr {D} sap rlet (onverdundsap)

NMIJT,nmut (r) nira mutlak = tebu - sabut


iE) absolute Juice = cane - fibre
(D ) gemiddeld sap = rlet - vezel

Frf (r) sabut, darl bahasa Inggris ffbre


F,f tE) fibre
V,V (D) vezelstof

Fnmk, fnmk {D kotoran tebu (mestlnya sabut dalam nira rnentah


tertimbang)
F6, f;p {E) suspendedmatter (fibre, insoluble sollds)
ln actual mlxed Julce
Vc, vc (D) vull correctie in bruto rut#sap

HK (i) kemurnlan (hasllbagl kemurnlan)


= i00 pol/brix, dlsebut lugi HK Pol

a (E) apparent purlty


',:
(quotlent of purlty)
RQ {D} reinheld quotient (schljnbare retnheid)
6

FIKsakarose fi)' kemurnlansakarose


= 100sakarose/brlx

[i
lu""r,uro,eRQ :::]:Hf':'#i'TT*1":l*n*purt'iv
HK seJati 0) kemurniansejati
= 100sakarose/zatkerlng

**n [i ;::"':iitd quotlent


14' red (I) gula reduksl

:' l:i :::::lffiIj,H:""'sruc'se)


15. K, k (I) knistal (habltrr)dalam hasll
- Pot)
= p01- faktor tetes 15t1ra
(E) stdndardgranutratedsugar
oot- iOft; (brtx-PoI)
m = molasses gravltY PurltY
K, k (D) krlstal
= pol - melasse factor (brtx - Po1)

Ko, ko (I) kristal &ablur) diharapkan = nllal nlra


=, pol - 0,4 {br1x - Pol}
untuk hasll dlsebut setara kGtal
ESG, esg (E) equivalent standard granulated sugar
Pol- 0,4 (brix'- Pof)
= pol(1,4-
Sf
only for flnal Product
-
WK, wk (D) wlnbaarkrlstal= pol - 0'4 (brlx poil

16' sHK (i)


:"fiffar diharapkan/M:r
PSHK : Perbandlngansetara HK
ERQ (D) evenredigeRQ
= I 00 winbaartrtstaubrlx
ERQV : evenredlge RQ nerhotdlng
1
f

Akhlr
Bahan Baku, Has$ Antara, Hasll Samping dan Hasf,l

;t (r) tebu
c (E ) cane
,(h, r (D ) riet

t (r) alr lmbibisilair dltambahkan ke gilJngan

LT (E ) net added water


GLi (D ) imbibitle water

-NMK.nmk (r) nlra mentah kotor (tertimbang, bruto)


M,il tE) actual mixed Julce, gross mlxed Julce
Grs bruto,
rs bruto tD) bruto ruwsap

N M ,n m (i) nlra mentah bersih (netto)


NM=ttfur-Fnmk

t,l (E ) clean mixed lutcen net mixed Julce


Grs, rs (D ) netto ruwsap

NPRP, nprp
,?\
\I' nira perahan dua rol Pertama
(E) first-exPressed Julce
(D) Eerste ultgeperst sap

NPr, npp (r) nira perahan pertama (npa, nlra perahan


-
awal) = nlra mentah nlra perahan lanJut
(E ) primarY Juice
-
Gvps, vps (D ) vQorpersap= ruwsap naperssap

(r) nira perahan lanjut (npk, nlra perahan


NPL, np1
kemudian)
(E) secondaryJuice
GnPs,t'Ps (D ) naperssap

NGA, nga /T\


tf/ nira gllingan akhtr
(E ) last rniil Julce
GsI, sl {D) sap laatste moLen

llPRA, npra (r) nlra perahan dua rol terakhlr


(E ) last-expressedJulce
(D ) laatste uitgeperst molen saP

-&,
I

merupakan
26. Nl, nl tr) nlra giUngan pertama,'lazimnya
nfa PerahanPertama
(E ) first mlll Ju1ce
.,
1,,, (D) sap eerste (le) molen
merupakan
27 " N 2 ,n 2 (r) nira glllngan kedua, lazlmnya
nlra PerahantranJut
tE) second (Znd) mtlt Julce

Gs2,sZ (D) sap tweede (2e) molen

?8. (r) nira giUngan ketiga


:u,nu tE) 91i16(3rd) mlll Juice

Gs3,s3 (D) sap derde (le) molen

to (t) nira gllingan keemPat


ln'nn (E) fourth (4th) mill Julce

Gs4,s4 (D ) sap vierde (4e) molen

30. atr (1 (I) ampas (akhlr)


Ard
(E ) bagasse,from favanese ompos
Gal, al (D) ampas laatste molen

3 I . A 1 ,a i (r) ampas glbngan Pertama


" . 1 (E ) flrst mlll bagasse

Gai,ai (D ) ampas eerste molen

3?,"AZ,az {I) ampas gillnfan kedua


(E) second mlII bagasse
tiaz, a2 {D ) ampas tweede molen

33. {r) ampas glltngan ketiga


:u,ut (E ) third mill bagasse
Ga3, a3 (D ) ampas derde molen

34. (I) ampas glllngan keemPat


:
:n,un (E) fourth mlll bagasse
Ga4,a4 tD) ampas vierde molen
hasil
nffio
35" 1914o, (r) nira mentah terkoreksl pengemballan
mlsalnya
sebelum penimbangan nlra mentah'
proses NKA (nira kotor kembalt ke ampas)'
imbiblst nira seduhan
9

(D ) gecorrecteerd ruwsap

{r) nira Jernlh (Pengendapan)


(E ) subsiderJulce
(D) schoonsaP

HK, nk (r) ntra kotor


(E ) mud (scum, underflow, settllngs)
Gvs, vs (D ) rnrllsaP

. NTAP,ntap CI) nira taplsan (apit sarlngan)


(E ) flltrate (clear + cloudy)
(D ) filtersaP

NS,ns CI) nira seduhan,nlra Penawarmanls


(E ) cloudy filtrate, filter washings
(D ) afzoetsap

(r) alr seduhan(alr Penawarmanis)


lt'*' (D ) afzoetwater

br CI) blotong
_nL (E) filter cake
Gfv, fv (D ) filter wll

NE, ne (r) nira encer


(E ) clarlfied Julce
Gdns,dns (D ) dunsaP

NP, np (r) nira pekat


salah koPrch disebut nlra kental
(E) syrup
Gdks,dks (D) dtksaP

MSK,msk (r) masakan(rebusar|)A, B, C, D


(E ) massecuite, culte
- (D ) kooksel

M, rI (r) tetes (akhir), darl bahasaInggrls molssses


(E ) molasses
Gmel, mel (D ) melasse
10

$TR, str (r) setrup (tetes antara) A, B, C


{E } molassesA, B
(heavy rnolasses)
Gstr, str tD) stroop A, B, C
BIL, bil tr) bilasan
(E ) wash (llght molasses)
tD) klare (dekstroop)

46. H, h 0) hastLgula (gu1adihasflkan): GPU/GP


s,$ (a) sugar (plantatlon white/raw)
Gprod, prod (E) product (flnale product): SHSIHS
Grg (r) gula (A, B, C, D)
(E ) sugar (A, B, C)
(D } sulker (A, B, C, D)

47^ anu (r) kehtlangan anu (tak diketahui)


(E) undetermined (unknown)losses
ov /\ unl \ onbekendverlles

G" Faktor

48. FR (I) faktor nPP, dlsebut Juga faktor tebu,


rendemen,faktor perah, faktor nira asU
= krlstaL dalam tr+gtl,tlap i00 tebu

+- -
Lkh
= -
konpp
RF {D ) voorperssap'factor = riet factor = rendement
factor = perslng factor

49. FM (r) fahtor molcsses, dlsebut juga faktor kehllangan


menurut Wlnter
= - =
Pm Dm
s E -
HKm
B Gm bgm 100- HKm
(normalnya0,4)
(D) melassefactor
11

(r) faktor kristal, untuk mengrubah'bobot krtstal


dlhasilkan rnenJadlbobot hasll gula, dlsebut
jugafaktor GPU/GP
100
kadar krlstal hasll gula
=
i 0 0 .,""'
- = t
kh

Persentase

tpn* (i) pol nira mentah % tebu, artlnya ton pol


nlra mentah tiap 100 ton tebu
grprs (D) pol ruwsap per 100 riet

tnm (i) nira mentah % tebu


grrs (D) gewipht ruwsap % gewicht riet
fnta (r) nlra tak dlencerkan hllang dalam ampas
% sabut
gvosal (D) gewicht onverdundsapln ampas
laatste molen % vezel
fwoa (r) alr bebas brix % sabut dalam ampas
gvadal (D ) adsorptie water % vesel ln ampas laatste
molen
bnm (r) % brix nira mentah
xNM x ton nlra mentan
100 T
brs (D) 7obrix ruwsaD qulntal
----T0A--
m x Grs x ruwsaP

Contoh membaca

Pt : ton poi tebu


pt : % pol tebu
Bt : ton brix tebu
bt : % brix tebu
12

2. konpp kadar {Yol kristal diharapkan dalam nlra perahan


pertama
= pnpp - 0,4 {bnpp - pnpp)
kh kadar {%) lcristat dalam hasll gu}a
*ph-FM(bh'ph)

3. n =*9 * *n
Ton hasil gula =ffi i00
x ton krlstal dlhasilkan

4. pb1 % pol blotong


zkbl '% zat kering
blotong
pot bloton
PbI=
ffi . BL, dibaca:ton poJ.blotong= % x ton blotons
iitj-==
5. bgg A : % bukangula datramgula A
bgA : % brtx gula A

E" Lambang Eflsilensl dan Kemarnpuan

Efisiensi, n = *):1*?Ill x i00 % {ntlarmaksimum


t00)
masufian

= *ry yang dlcppel


Kemampuan yang terbalk ^x t00
{angkadapatkurangatau leblh dari 100)

Angka:angkapokok dan pentlng

1. Fabrik

a. Kuantitatlf

l) Overull reeoyery =$* xioo (rsscr)


(nPG)

e$s= IL-+fLllI
?l Qverattrecovery x 100
(RPG)
Ph(r,4- frffi-,
---T x l00 trsscr)
Ph(1.{- f;pr
3 ) Yield esg ----tr-sx 100 (rsscr)
(&tsg)
13

Plt- lMiBh: Ph)


tebu(Rt) -
4l Rendemen x 100 (Hommes)

5) Efisiensi waktu = Jam Eiling 7oJam kampanye

6) Kapasitas glling, ton tebu digiling tlap harl (tth)

7) Ton pemakaianuap ttap i00 ton tebu.

b, Kualltatlf
Mutu tebu % pol, % sabut, % sampalr(trush),
kadarnlra tebu
Mutu hasil gula % p01, HK, % alr, warna, % bukan gula,
% gula reduksi,keamanan

Gllingan

d. Hasl]bagl (hasllguna)pemerahanbrix dlsingkat HPB


HPB=#.i00=-6mryg;-"100 (Hommes)

Hasilgunapemerahangula (poU dislngkat llPG (ISSCT)


r. Pembukaansel (HPS),HPC I, HPB l,
percampuranimbibisi fiPt)
Mutu ampas : % pol, pol % sabut, nira hllang % sabut

Ton sabut dikerJakantlap hari (tsh)

a. Boiling house recovery (BHn) = .Jh- * loo


rnrn
= &=Hff.e
BHResg x 100 (ISSCT)
Ph-FM{Bh-Ph (Hommes)
RendemenWlnter (Rw) = 100
IrI-U,

Penilaranmutu hasil gula, blotong dan tetes.

Penurnian

Efek pemurnian (EP) * B G n $ . - B G n e ^* 1 0 0


BGnrn
Kenaikan kemurnlan = HKne - HKnm, atau HKnp - HKnm {Hawali)
Ton bukan gula dtaslngkanlton CaO (Penulls)
Mutu nira €nser : ppm CaO ne
keker*ran
Mutu blotong : % poI, pol% zat kerlng tak larut
14

5. Penguapan
' a. kg alr diuapkan/(m2lP x Jam)
b. Mutu nlra Pekat : % brlx, HK
Mutu alr embun : ada gula/tldak .

6. Masakan
a. pemerahan krlstal = kristal % pol masakan(rumus S.IM Noel Deerr)
b. Lama rnasak= m3 masakanl(m3lsi pan x Jam)
Lama Pendinginanmasakan.

7. Pemutaran dan penyelesalanhasll


'
, - 6
a. kg gula/(mZ kasa x Jam)
Bukan gula dalam sirkulasi
RendemenkristaUsasl (rumus SIM)
b. Mutu gula, setrup/te,tes, bllasan leburan (% pol % br|;1l% alr, HK).

Berkenaan makln dlkenalrya sistem ISSCT dl Indonesla, maka dlperlukan


terJemahanefislensl ISSCT:
oversll recovery : rendemen pabrlk gula (potr) (nPG)

ertroetion :' : hasllguna pemerahan gula (pol) {HPG}


boillnghouse?ecovery; rendemenpengolah"n(pol)' (nP)

esg
overallrecovery e$g ; rendemen pabrik gula (RPG)

BHfi esg : j rendemen Pengolahan (RPl

Javo rutro : faktor Iawa (faktor qol) (FP)


15

III" RENDEMEN TEBU


5EBAGAI SIsTEM PENCAWA5AN PABRIK CULA

Rendernentebu, secarasistematik menyatakan total quality eon'


tyo?, (pengendalianrnutu terpadu) pabrik gula, sekaligusrnendasarimana-
jemen agroteknologi gula tebu. Karena merupakansistem, maka rendemen
kebun, angkutan, gilingan, penS-
tebu menentukanpengawasan-pengawasan
olahandan bahanbakar.

Di Indonesia,rendemen tebu dirumuskanoleh Hommes (PC Condang


, 1932),yang menyatakangula didapat (dinyatakandenganstandar
Winangoen
krista!) tiap 1CI0tebu, Untuk |SSCT,rendemen tebu dirumuskanoleh Noel
Deerr (1932)yang menggunakanstandargula setara kristal (esg)

ton gula
.,^-,- (dinyatakan dengan stand-argula) x 100
K e n c e m--e nr^L..
teDU * =%

Cula yang didapat merupakancarnpuranantara gula pasir murni dan tetes.


Dari sinilah awal persarnaandan perbedaankristal dan eog, Keduanyasama-
sama merupakan standar gula, dan menyatakangula pasir rnurni. Menurut
konsepkrista!, tetes yang dikandunggula pasir tak murni dianggapmemiliki
susunan {HK} sama dengan susunan (HK) tetes didapat. Menurut konsep
esgr tetes dalam gula tak murni itu dianggapmemiliki HK 28,5V sehingga
pacgxef.tnary ton pol yang tak dapat dikristalkan (turut tetes) tiap ton bu-
kan gula = HK tetesl(lOO- HK tetes) = 0,4"

A. Sistem FengawasanFabrik Gula di In&nesia

'1932
1. Rendemen tebu {Rt} rnenurut rumus Hommes

-= ton hasil gula tlinyatakan.denganstandalFristall * 100

x ,-luU
Kh
= j- NA =
tkh

tkh
= konpp
konpp

= nilai nira npp x FR


to

tkonm tkh
= konpp x # x #
konpp rkonm

Konrn Kh
= konpp x:ilffi-pp X -
Konm
- 49
= konpp x Bnm ^ 1,1HKnm o p Kh
;
Tffi;FF 1,4HKnpP-40
Bnm 1.4HKnm - 40 " 6Kh
;
= konpp xT-iTir ^ 1,4 HKnpP - 40
. ! :

= (konpp*+)(#.{fffiffi-ffi'
l{h (ll)
= ..r.r.......r."r'tt"r"tr""i"'r"'3""""'t'rt"
"""'t""'r"""r""
{kot)('*)
Kot
(lll)
konppx nt x HPB x PSHKx RW x 100-4 """3"""""""""""'

ryxRW
Pnm- 0,4 (Bnm- ti"m). x RW
I

('1,4Pnln:Or4Fnm) x RW
=
I

; ('1,4HPG x Pt - 0n4HPB x bt) RW x 100-2 ilv)

= Bnm,1,4FK"m.140)
nWxff
ff)
= HPBx trt (1,4FlKnm- 40) RW x 100-3'......r...oo""""""tttr""

2. Mutu tebu dan efisiensi pabrik gula di Indonesia

membedakan mutu
Rumus rendemen tebu Hommes sebenarnla
dengan kristal dapat
rebu dan ef isiensi pabrik. Mutu tebu dinyatakan
pabrik dinyatakan de-
diperoleh (uinbaar kyisLal) tiap 100 tebu. Ef isiensi
dalam tebu' Hasilkali
ngan kristal didapat tiap 100 kristal dapat cliperoleh
tiap 1@ tebu'
keduanyaadalah rendementebu, yakni kristal didapat

Mutu tebu = % kristal dapat diperoleh dalam tebu


%oniratak diencerkan
= Tokristal ciapatdiperoleh dalam npp xff
= konpPx nt/'100
= kont x nt/'100
= kot
1l l7 .

usan ini n'rula-muladiturunkan dari anggapanbnpp = bnt, kemudian


luas menjadi konpp= kont"
isiensipabrik gula
= kristal didapat d a l a m h a s i l t i a p 100 kristal dapat diperoleh
dalam tebu

=-----m* * T O - * T 0ROW*
PSHKnm/non H P B 4A^
li.Ar
"100 Kh
konm/hnm X - - b nm x NM
T.T-)(.--_--,a 100
100 kCInpp/bnpp Dtx I konnnxNM

= ktnn_I_bryI bnrl x \!fv! *^ k o 5h__


^_ b n t x N T nmxNMx 100
konppx bnm

= !b-x*bo!- "x PryliSg


bnt nt I
x - lSJ,'-- x 1oo
kont x bnm konm x NM

= 6 [ x ' 1 0 0 =Rendenrenpabrik gula.


Kot
'100
ipabrik gula = Efisiensigilinganx RW/'100= Kh/Kot
i gilingan = PSHKnn'r/nppx HPBI100 = 100 Konm/Kot

Dalam praktek" efisiensi gilingan dinyatakan dengan HPB (untuk


wasan bersarna). Efisiensi gilingan individual dinyatakan dengan
I ipemerahanawal), HPB ll, HPB lll dan seteru$nya,yang dapat dihitung
neraca"

PSl-lK diartikan sebagai efisiensi sanitasi gilingan. Makin besar


a PSHK beranti rnakin kecil pengasatTankanena inversi kimia dan
imia (ensim invertase darl tebu rnaupundari mikroorganisrne).Inilah
Lnngertian yang menyesatkan.Arti sesungguhnyadari PSHK semata*rnata
lah jemtratanmatematik (nd.sai.ngLdnk) yahg menghubungkan
konsep-
dan fakta.

Pada akhirnya seluruh Pararneter {komponen) rumus Hommes


kan angka-angka se!-nu, karena rnelibatkan anggapan-anggapan
sangatbanyak,dan lebih berpijak pada ideaIisme daripadafakta.
18

'1.
Tabel Pengaruhkekxratanpemerahanawal terhadap
nilai nira dan faktor rendemen

e n d e m e n tebu *-.*_- *- Nitl -tglelll-pgrlqlu


dan konr cnn ljraltsl I i.'raksl l+2

P i g,2g 19,47 l9;02


b 2r,54 21,45 21,46
HK 89,55 88,90 89,63

(l) Nllai nira (ko)* 18,39 IB,12 18,04


(?) nt* 82,25 82,60 82,56
{3} PEHKnm/npp* 97,45 98,09 98,53
{ 4 ) H PB 86,90 86,90 86,90
(5) RW, misalnya 9 8 ,0 0 98,00 98,00

( 6 ) Kadar kristal tebu (kot)* I 5.13 14,97 14,89


= ( 1 ){ 2 )/ 1 0 0
( 7 ) Kadar sabut tebu (ft) I 5,73 15,73 i 5,73
( 8 i Alr bebasbrix % tebu/ 2,02113 1,67ltA 1 , 7| l L l
% sabut *
(e)Kadar nlra mutlak tebu 84,27 84,27 84,27
= ( 2 ' + ( 8 )= 1 0 0- { 7 )

(10) Efisiensi(rendemen)
pabrtkgula * 82,65 83,54 8 3 , 9I
= ( 3 )( 4 ){ 5 )/ l o o z

(t i) Faktorrendemer,(FR)*
= { 2 }( 3 )(4 )(5 )/ 1 0 0 4 0 " 6 798 0,6900 0,6928

{12) Rendemen tebu


12,50 1?,50 12,50
= ( 1 )( 1 1 /) 1 0 0

* Angka-angka semu, hanya sedlkit kebalkannya, Ieblh banyak menyesatkan


pengertian.
Keterangan:
t l
ttebu
I \ n -l
I AA:--+ amPas
I

I
,LJ,u
l l
I v
fraksi I 2 3
19

3. Percobaanpernerahan

Secara konsepslonal,percobaanpemerahan(gil|nU contoh) rnerupakan


keglatanyang tak dapat dipisahkandart rumus Hommes.Percobaanpemerahan
akan menutupi(rnemperkectl)kesalahankonsepslHommes.

TuJuan percobaan pemerahan yaknl menetapkan faktor rendemen


f.iap-tiap Jenis tebu, yang trazim dlsebut faktor rendemen sernentara.Tiap
kali percobaandlsediakantebu (darl satu Jenls)cukup dtgtltng'mlnlmumtiga
Jarn.
perhltunganton gula yang berasdl darl tebu petanl A denganvarletas
V adalah:

Rts.A= konPPAxFR5.Y {s: sementara}


Rts.A
Khs.A = --lT-0- " rA

Ton krlstal sementara (Khsl dari banyak pemlllkan dtJurntah' Dari buku Jumlah
(kh)'
15 harl dipercleh ton kristal dldapat (Kh) dan kadar kristal hasil
g
Faktor koreksl = Khs

Jadi ton krlstal dari Petani tebu A:


Khe = Khs.A x faktor koreksi

Faktor krlstal (habtur) irasil = ff

Hs = Kha x faktor kristal hasil


Kha : ^n
RtA = --A- X IUU
I

Kebun .dan tebangan (termasgk angkutan) secara organlsasl dl bawah


Tampaknya
Bagian Tanaman, tetapi itrmuPengawasannyamitik Baglan Pabrikasi'
pabrlk'
kehilangangula dt luar pabrik Justru lebih besar daflpada di dalam
20

B. Sistern PengawasanISSCT
menyu.
. Penghapu$nanggapanbrix npp = brix nira tebu, yang se|anjutnya
-
sun konsepnira mutlak = tebu sabut'
- ldealisrne diseder.hanakanmenjadi fakta, misalnya faktor tetes .ideal
, - A,4 hanyadigunakanuntuk perhitunganesB,bukanuntuk lain-lainnya'
- Mutu tebu secara sederhanadinyatakan dengan % pol tebu, dan ef isiensi
giling,andenganHPC.

1" Ii.etn (rendemen tebu atas dasar pol)

tf,h
=+x 100

= p t x FPT
h

(l)
= pt x nPC : 100 ..'..........r,..rr..........r!.'...'.....r........r..r.."'t""

= p n p r p * FPt x FPit
n F ; x FPnm -. fr;il

"""""""' (ll)
= pnprp x FP x HPG x nP x 100-2

IieLd. eog (rendementebu atas dasar stanclaresg)


AO
EC,,1
P h ( 1 ' 4- F i f r ]
=E*:x 1 0 0- x ' 1 0 0= p t X R P G : 1 0 0" " " " tlll)
l - T
(lV)
= pnprp x FP x HPG x RP x 100-2 """""""'

(nira perahan dua rol per-


Ada kalanya tidak menggunakanbasis nprp
tarna),tetapimenggunakannpp,sehinggafaktorpol(FP)=pt/pnpp
yakni esg, makarende-
Andaikataistilah kristal hanyamemiliki satu arti
merr tebu tidak lain adalahyield eag'

2. Mutr.l tebu dan efisieqsi pabrik gula rnenurut ISSCT

Mututebu=
;;:;"il'x #w
3 %pornprp_ f;ffi
21

(nprp), dan
Npp clisederhanakanmenjadi nira perahan dua rol pertama
(FP) yang secara internasional
faktor pol tebu/pol nprp disebut faktor pol
dikenal sebagaiJaoa ratdo (JR), yanS tidak lain adalah jembatan mate-
matik. FP dipengaruhioleh mutu tebu (pol, nira mutlak dan sabut),
dan teknik pemerahanawal.

Efisiensipabrik 3 pol didapat dalam hasil tiap 100 pol dalam tebu
o u e w . L Lr e e o D e r y
Dh

ffix 100
Pnm Ph , 4r
Ht * ffix 100
= HPC x nP/100

f- Sistem Pengawasan l55CT khusus di Flawaii

Pada dasarnya Hawaii menganut Sistem ISSCT dengan kekhususan


pengawasn gilingan {inferentiat nethod) &n staRdargula yang clise-
96 U$DA, yakni gula yang memiliki pol 95vo,kemurnian97% dan kadar
1,O3To.
Pengubahan gula didapat menjadi gula 96 DA dilakukan dengan
SJM (sugar" iuice, molasses) Noel Deerr.

Sejafandenganpemikiran infexential method' kadar pol tebu tidak


tung melalui faktor pol iJaz;a ratio)' tetapi melalui faktor brix

ii. ratio) yang di Hawaii sendiri disebut faktor nira rnutlak.

pt=PnPrP.# = PnPrPxFP

= (nmut/100)pnmut
= (100- ft) bnmutx HKnmurt
lfiAz
= (100- ft) bnmut{HPBx HKnm+ t100- HPB)HKnpra}/'1003

- ft)bnprp
(1oo -m - ilffiffi
(100
(HKnm
t3 x ba/100
+ { ) HKnpra)/1003
bnmut x nmut/'i00

I
22

- ft) bfiprp
= ('100 tfiprp x*'*^ (HKnm
\nt\rrrrr rvv -
\('10o
6nprp- ;;ffif
biimut (100 - ft)/100

Faktor brix (FB = Haunii ratid"


-
F B = b n m u t / b n p r p =0 , 9 7 7 1 ' 0 0 0
penebanganmekanik yang dicuci
FB = i,000 dapat rerjadi pada tebu hasil
.denganair.
SetelahdihitungPt, kemudian
ft
tpn. = Pt-tpa=Pt-PaxT;

T = +g x100
'pnm
' rt
A = d a n P a- -- P. tL O
.l O ^ "
fjxT
pt =
ltJI
nm+Pa
HpG = xloo
l-t

SelanjutnYan
= P n m -x- P h
rendemen tebu pt x m
TT

= o'*ffi,.i#
= pt x nPC/100
Serikat (AS)' dan As
Karena Hawaii merupakan negara bagian Amerika
(United states' Department of
, ir€nggunakan standar gula 960 DA.
Agri'culture),maka:
pnm .. -96oDA
960'\ ^ x ' l g g = :- x -
l(t96oDA = # Pi x Pnm
T Pt
IV. CULA. ZAT PADAT DAN BUKAN GUI-A

A. Pengertian pol, brix, dan bukan gula

Kadar gula (C12 H22 O11) dinyatakan dengan % poi (singkatan


dari polarisasi). 9o pol adalah kadar gula yang diperoleh dari analisis cara
polarisasi tunggal (langsung)dengan alat sakarimeter. Sakarimeter ialah
polarimeter yang dikhususkanuntuk mengukur kadar gula (sakarose). Jika
1 k g g u l a m u r n i d i l a r u t k a nd e n g a n9 k g a i r , d a n l a r u t a n g u l a i n i d i a n a -
lisis kadar gulanyadengancara polarisasitungga! maka hasitanalisisyang
diperolehyakni % Wl = T1A x 100 (%} = 10.

Cula di dalam larutan merupakanzat padat {bahan kering) terlarut.


Pengukuran kadar zat padat yang terlarut dilakukan dengan alat pengukur
( p e n i m b a n gb) r i x . B i l a ' 1 k g g u l a m u r n i ' d i l a r u t k a nd e n g a nI k g a i r , m a k a
'l0oBrix,
tadar zat padat terlarut = atau Yo brix = 1/1O x 100 {%) = 10.
Selain dengan alat penimbang brix, kadar zat padat terlarut juga dapat
dengan alat piknometer t Y, brix yang diperoleh disebut % brix
ik) dan neraca Westphal, Sernua cara penentuan brix tersebut
metode densirnerik, Dengan refraktometer (bekerja berdasarkan
sinar oletr larutan yang diukur), lo brix yang diperoleh disebut
refraktornetrikyang mula-muladipraktekkandi Hawaii.
'l
Jika kg gula rnurni dilarutkan dengan B kg air, maka To pol = 119
'f
ffi = i,1"l dan % brix = 1/9 x'100 = 11,11"
'1
ian jika ke dalam larutan gula itu dilarutkan kg zat padat bukan
'10.
yang dapat larut dalam air, maka % pal menjadi .U1A x 100 =
% brix = 2/1Ax 100 = 20

bukangulatbg) = 1/10x 100= 10,atau


%brix-%pol
20-'!0='10.

h r k a n S u l a= % b r i x - % p o l
gula =t brix- t pol t: lambang.satuan ton*,

kuintal ($ tidak digunakandalam buku ini.


24

Ton (t) adalah satuan bobctr yang sekarang lazim digunakan di


pabrik {ula Indonesia. Dalam satuan sistem internasionat (51), ton lebih
dianjurkandaripadakuintal (q).

Dalam larutan gula teknis (nira, setrup, bilasan), bukan gula yang
terkandung biasanya terdiri dari glukose, fruktose, gram-garam dan asann-
asam anonganikmaupun organik. Bukan gula adi yang bersifat optik aktif
(memutar bidang polarisasi) misatnya glukose (memutar bidang polarisasi
ke kanan atau +)r fruktose (memutar bidang polarisasi ke kiri atau'-), asam-
asam amino ( + atau -), ada yang tidak bersifat optik aktif. Hasil analisis
pof sangat dipengaruhioleh zat-zatCIptikaktif non-sakarosa,

B. Pengertian sakarow, Tatkening dan bg sejati


\
\ % pal disebut juga kadar gula semu, 7o brix'disebut kadar zat kering
(!at padat) semu, selanjutnya % brix - % pol = kadar bukan gula semu.
Disebut semu (tidak sepenuhnyabenar) karena kadar-kadar tersebut dipero-
leh dari analisis yang ketepatan dan ketelitiannya rendah. Kebaikannya
ialah % pol dan lo brix dapat dianalisis secara cepat.

Kadar gula dapat dianalisis febih tepat dan teliti denganmeniadakan


pengaruh zat*zat bukan gula yang bersifat optik aktif. Kadar gula yang
demikian disebut % sakarose(kadar gula sejati) yang diperoleh dari analisis
menggunakanpolarisasirangkap (2xi dengansakarimeter.

Kadar zat padat, baik yang larut maupun tak larut, secara lebih
tepat dan teliti diukur dengan.cara pengeringan. Pengeringandilakukan
pada kondisi suhu dan lama pengeringanyang telah ditetapkan (dibakukan).
Fada hakekatnya suhu dan lama pengeringan adalah suhu terendah dan
waktu terpendek untuk mencapai bobot tetap. Kadar zat padat yang diper-
oleh dari pengeringandisebut kadar bahankering sejati. Selanjutnya:

% bg sejati % zat kering - 7osakarose


t bg sejati t zat kering - t sakarose

* bobot tidak sama artinva densan berat. Bobot adalah massa, yans diukur
deneanpenimbansan.Berat aEalaheava (abot), satuannya neivton (N).
1 kg. 9,81 mlsz = 9,81 N,
bpho{nye,1kg memilil<i.br-;rat
Ben'dh.y'a.ne yang
dufu otseour I Kgl rK!rogramEayil.
25

Kalau alat penimbangbrix hanya dapat digunakanpada larutan' pengeringan


epat dilakukan untuk larutan maupun padatan (rnisalnyaampas, blotong,
gula). % zat kering diperoleh dari bobot setelah pengeringandibagi bsbot
'100%,
rcbelum pengeringandikalikan atau

'!00 '
% zat kering = % air (untuk sembarang larutan/padatan)
Vobrix = '100- Voair (larutan/padatan dapat larut)

Pada penentuan % brix masakan dan gula yang % polnya rendah,


rrasakan dan gula dilarutkan dengan air yang cukup banyak, misalnya 300
(berarti pengenceran5x). Jika
5 masakan dilarutkan dengan 1200 g air
jadi kesalahan alat maupun kesalahan pembacaan pada brix larutan
kesalahankecil yang dilakukanbila dikalikan5 akan rnenjadikesalahan
besar. Oleh karena itu kadang-kadangdijumpai %brix suatu rnasakan
dari 100. Hal demikian tidak akan terjadi jika kadar bahan keriilg
tukan denganpengeringarr"

Kemurnian (FIK) dan kristal (hablur)

Dalam suatu larr.ltan gr.ila, apabila % pol = % brix atau fo sakarosa


bahan kering, larutan itu disebut larr.ltangula murni. t-arutan tersebut
murni atau kernurniairnya* 1OO%. Sebaliknya,bila % po! suatu
= 0, di mana % bg = Vo brix, maka larutan mempunyai kemurnian

Kemurniangula atau larutan gula dinyatakandenganhasilbagikemur-


(disingkat HK) ialah perbandinganantara fo Wl dan % brix atau t
dan t brix dinyatakandengan%.

;.19= fg Fol x 1Ae%


% brix

=:=Wl x 100%
t oilx

ya, HK = pl % brix atau pol tiap 100 brix.


26

akan beru-
denganair, maka % po,ldan % trrix
Jika larutan gula diencerkan
tetap' sehinggaHK tetap'
bah, tetapi perbandiniiannyaakan gula
pol dan bukan gula dalam larutan
Hubungan'antara kadar air, brix'
baganberikut:
teknis dapat digambarkandengan

air br ix

bg Pol

gula teknis
Gambar'2. Susunannira atau larutap

Karenaadanyakadargu|asemudansejatiSertakadarbahankering
macam HK:
semu dan sejati, maka dikenal beberapa

a. HK semu (atau disebutHK saja)


t x 100 - pol % bcix
HK= xloo atau ,ool
ffi t bflx

HKpo|adalahsinonimdenganHKsemu.Diberiketeranganpoluntuk
HK sakarosedan HK sejati'
menegaskanperbedaannyadengan
b. HK sakarose = sakaroseVobrix'
c. HK sejati = sakarose%bahankering'

KemurnianSuatu|arutan/bahanmakinrendahjikaperbandinganantar
pengaruh
Bukangula umumnyamempunyai
pol dan bukan gula makin rendah.
gula akan berbanding langsung
yang buruk di dalam proses' Kehilangan
Bukan gula mempunyaisifat memper-
denganjumlah bukan gula yang ada' ,bukan
perkataan |ain, su|a menahan
besar ke|arutan sakarose, dengan (mengha'
sakarose dalam larutan untuk tidak mengkristal
molekul-molekul
b|ur).Suatupengecua|iania|ahgu|areduksi(sebutanbagiglukosed
fruktose.yanEmereduksi|ogammisa|nyacupridalam|arutanFeh|in
atauLuffdireduksimenjadicupro).Cu|areduksi.bersifatrnemperkeciI
27

kelarutan sakarosa,yakni mendorongsakarosauntuk membentukkristal"

winter (1s97) berdasarkanpengalamannyamenyatakanbahwa setiap


1 bagian bukan gula norrnalnya menyebabkan 0,4 bagian pl tak dapat
diperolehdalam hasil,jadi larut dalam retes:
pol tak dapat diperoleh = 0,4 bg = 0r4 (b - p)
pof dapat diperoleh= p - 0,4 (b - p).

Dalam larutan gula murni (bg = 0), semuapof akan daryt dikristalkan,

Pol yang normalnya dapat dikristatkan oleh Winter disebut kristal


dapat diperoleh (ainbaar) atau nilai nira. Nifai nira ialah kristal dapat di-
peroleh dalam 100 nira. Untuk nira mentah:

ko nm = pnm - 0r4 (bnm - pnm)

fstilah "dapat diperoleh" (reeouerable) seringkalidipertukarkandengan',di-


harapkan" (erpeeted).

Selanjutnya:

t kristal diharapkandafam nrn = Pnm - 0,4 (Bnm - Pnm)


(Konm) = NM- ui&*,
Setiap 1% bg akan menyebabkan0,4 % pol tak menghabrur,setiap 'l t
fu menyebabkan0,4 t. pol tak mengkristal.

Berapa pol yang sesungguhnya


rak dapat mengkristar? Dalam proses,
sebagianbukangula dipisahkandalam blotong dan sisanya(sebagianterbesar)
dipisahkan dalam tetes. Hanya sedikit sekali .bukan gula terbawa oleh
l'.crl' guld- Jumtah pol yang sesunggr.rhnya
tak dapat dikristalkan dapat
dlihat pada perbandingan pol dan bg tetes, yang selanjutnya
disebut
faktor tetes (FM).

tor tetes biasanya antara Q,4 - 0,7" Faktor tetes O,4S


artinya tiap
bg menyebabkan 0,45 pol tak dapat dikristalkan (tidak dapat
dijadikan
).
28

FaKror tetes- =
ffiliffis bg tetes

P tetes p tetgs -.- _


Btetes-Ptetes btetes-ptetes

HK tetes
=T0oTFlm-

yang dibicarakan di atas, maka kristal yang didapat


Dari Furnus-r'urrlus
(dihasilkan)dan kristal yang masuk dapat diketahui. Selanjutnyaefisiensi
pengolahan(pabrikat)yang disebut RendemenWinter dapat dihitung.

Winter = t Fristaldi4pgt 4lam hasil


Rendemen x 140%
t kristal dapatdiperolehdalamnm
lSh:i - x 1oo
Ko nm
Ph - FM (Bh - Ph)
i5ffix10g

Hasil gula merupakancampuran gula murni dan sedikit tetes di dalamnya'


Di Indonesiagula murni inl disebut hablur (kristal) yang merupakanstandar
gufa pasir (standard, gnanulated sugan). Kristal didapat berkaitan dengan
faktor tetes didapat (nyata). Kristaf dapat diperoleh berkaitan dengan
faktor tet€s ideal 0,4 (sesuaidenganHK tetes ideal 28'57).

definisi faktor tetes demikian hanyaberlaku di Indonesia,dan tidak ber-


faku untuk ISSCT('bhe Internat;ional Soei.etg of Sugan Cane Iechno-
Logi,sts)
*l'
termasuk ton kristal yang sedangdalam proses.(perkiraan,
taksasi)
29

MENTAH'AMPAS
V. BOBOTTEBU,AIR IMBIBISI'NIRA
DAN KAPA5ITAS GILING

gilingan disusunberdasarkanpersamaan:

tebu

i
I
I
w
nira rnentan

Cambar 3. Dasar neraca gilingan

f&rsukan (inPttt) keluaran (outPut)


nira mentah+ ampas
Tebu + air ir,nbibisi
NMK + (Ai
T + l

kotor (NMK) dipenoleh


(T), air irnbibisi (l) dan nira mentah
atau Pengukuran.

Tetxr

peninnbangtebu disebut bobot bn'tto'


Bobot tebu yang dicatat oleh

tebu'
traitet' atau kereta untuk mengangkut
tebu (selan-
di luar musim giling. Bobot nebto
merupakandasar(basis)pengawasangiIingan.
30

basis 100'tebu akan rnelibatkan pelbagai perhitungan rnengenaipersentase


terhadap tebu.

Contoh : ampas % tebu = x 100

'100.
Fersen (%, per eent) rrernpunyaiarti per 100 atau tiap
Di pabrik gula, bila bob<lt suatu bahan dipersenkan terhadap bobot tebu,
perhitungannya akan melibatkan angka penolong yar6 disebut Faktor C
(faeton eapaeitei*),

Faktor C = 'l 000000 : ton tebuyangdigiling.


_ 1 000 000
Jika faktor C = makabobotsuatubahantiap 100tebu dapatdi-
6;ffiu,
hitungsebagaiberikut,misalnyauntukampas:

ampasro tebu = P*9l*pFe x 100,jika dikalikanr10 000


DoDot teDu 10 000
= bobot ampas 1 000 frn
^
bobottebu m(m

bobotamoas lm(Xn
A -

10 000 bobot tebu

bobjt +mpas x fakts C


10 000

Contott: Dalam $uatu perhitungan laporan harian dtetalrui:

t tebu digiling = 17 461


t trruto nira mentafu = 15 923
BerapakalTnira mentah bruto % tefuil

t bruto nira rnentah Is 013


Faktor C = "l 0O0000 : T A61 Sq,rTIrr
: 10 000
Nira rnentahbruto % tebu ErcA

Faktor C biasanyadihitung denganketelitian 5 *rhdl


Faktor-faktor lain misalnya faktor rpp (faktr pcrldf, fatts tebu, faktor
rendemen), faktor tetes biasanya dengan temltfim 4 acsimal, Hal ini
jangan dipandang sebagai ketentuan yary me4ftrtt. Kernajuan di bidang
31

teknologi dengan diketen-iukannyamesin hitung dan komputer, mendorong


perhitr:nganfak tor-faktor tersebut denganketelitian sesuaikebutuhan.

Bobot suatu bahan tiap 100 bobot tebu lazimnya dihitung denganketetitian
2 desirnal.
Demikian pula angka-angkaefisiensi (misalnyahasilgunapemerahangula
(HPG), hasilgunapemerahanbrix (HPB), rendernentebu, rendemen Winter
(rendemenpengolahan),rendernenkristal, rendemen ketel) dihitung dengan
ketelitian 2 desimal. Angka-angkapol (atau kadar sakarose),brix (atau
kadar zat kering), dan kemurnian (hasilbagikemurnian= HK) juga dengan
k e t e l i t i a n2 d e s i r n a l "
Beberapaangkadirryatakandenganppm (parf per nil,l,isn = per sejuta)
yang kira-kira sama dengan rng per L, misalnya kadar kapur"nira encer
= 637 mg CaO per L ne = 657 kg CaO/m3 ne" Dalam laporan harian/'lS
harian,angka-angkabobot dalarnsatuanton (t) denganketelitian'l desimal,
kecualIgr.rladan tetes 3 desimal(ketefitian hingga5 kg]

Kapasitas gi5ingan,kecepatan giling danrfam benhevrti

Bobot tebu yang digiling dalarn 24 jam (yakni sejak pukul 06.0CI
pagi sampai pukul 06"00 pagi hari berikutnya) disebut kapasitas giling,
dinyatakan dengan ton tebu tiap hari {tth) yang dalam bahasa Inggrisnya
tan eane per day {ted).

Kapasitas giiingan ialah kernampuangilingan untuk nnengerjakan


tebu secara ekonomls (efektlf dan efisien), bisanya pada efisiensi {HPC}
q<q^

hJpc= tt e.ulqieo!?dajegI'de ryqnFh x 1aa%


gula (pol)dalam tebu
tsagi negara-nega!"aberiklirn subtropik, suhu udara yang rendah menrbuat
tebu sulit rnencapaikemasakannya,sehinggaada tebu yang baru ditebang
pada urnur 24 bulan" Sebagai ccntoho di l-"lawaii,kapasitas dibatasi pada
t-lPCdireduksi 97,5%

Bila di suatu pab,rikgula kapasitasmenurut setelangilinganditetap*


&an 2 500 t tebu tiap hari, sedangkan t tebu dlgiling pada suatu hari
2 4AO, mes$cipunpabrik tersebut dalam kenyataannya tidak nnengalan'li
' 3 2

jam berhenti, maka jam berhenti tersamar dapat dihitung:

) 4AO ^,.
24iam-ffi t x24iam =

24 jam - 23,04jam = 0,96 jam

Efektivitas pabrik gula secara umum ditunjukkan dengan kapasitas,


kecepatandan hari giling. Khususstasiungilingan, efektivitas iuga ditunjuk-
kan denganton sabut dikerjakan tiap satuanwaktu. i

Yang disebut kecepatangiting ialah jumlah tebu digiling tiap hari andaikata
tidak ada jam berhenti,
Tebu digiling pada suatu hari= 3 450 t
Jam berhenti menurut catatan = 1 jam

giling =
Kecepatan x 3 450t tiap hari
ffi*
= 3 600 t tebu tiap hari
'150
= t tebu tiap jam.

Angka241{24' iam berhenti) disebut faktor jam giling.


Kecepatangiling tiap hari juga disebut kapasitasgiling tak terrnasuk(esetu-
siue) jam berhenti, artinya tidak memperhitungkanadanya jam berhenti.
Kapasitasgiling efektif, disebut juga kapasitasgiling termasuk (irw\usiue)
jarn berlrenti, ialah jumlah tebu digiling tiap hari yang sesungguhnya.
Selain itu, dikenal kapasitas perencanaan,yakni kapasitas giling menurut
setelangilingan.

Eflsiensi penggunaanwaktu didefinisikan sebagai jarn giling tiap


100 jam kampanye(jika dibagi 24 berarti hari giling tiap 100 hari kampanye).
Janr giling adalah waktu beroperasinyagilingan I mengerjakantebu.
Jam kampanye adalah .iangka waktu tebu peitama masuk gilingan I dan
tebu terakhir telah menghasilkanampas dalam-satu musim giling. Selisih
antara keduanyamerupakanjam berhenti.

Tebu yang rnasuk, digiling' dan sisa tebu

Pabrik-pabrik gula larna menggunakansistem lori untuk pengangkutan


tebu dari kebunke pabrik.
33

Lori-lori diberi nomor dan juga taranya (bobot lori kosonghasit penimbangan
sebelumgif ing).Setelahlori-lori yangbermuatantebu itu ditimbang,lori-lori
berrnuatan itu menunggu di halaman pabrik (emplasemen)dan tebu siap
digiling.

staf timbangan mencatar tebu yang masuk setiap harinya. staf


dari Bagian Pengolahan(Pabrikat) menghitung sisa tebu setiap 06.00 pagi.
Sisa tebu hari ini ialah bobot tebu di halaman pabrik yang sudahditimbang
dan masuk .halarnanpabrik sebelumpukul 06.00 pagi taporanyang bersang-
kutan. Dengan data nomor tori, tara dan bobot bruto, maka bobot tebu
yang masuk dan sisa tebu dengan mudah dapat diketahui sefanjutnya di-
hitung:

Bobot tebu digiling = bobot tebu yang masuk+ bobot sisa tebu kema-
rin - bobot sisa tebu hari ini"

Bagi pabrik-pabrik gula baru yang tidak menggunakansistem lori,


tebu-tebu diangkut dengantruk, kereta atau trailer" Truk-truk/kereta-kere-
ta sebelumnyatelah diberi nomor dan tara, Cara lain ialah menimbang
truk/kereta yang sudahdibongkarisinya untuk mendapatkantara. Tebu-tebu
dibongkar di halaman pabrik dengan katrol atau tenaga rnanusia,kemudlan
timbun. Tebu yang akan digiling diangkat dengan katrol menuju meja
repyak. Dengan cara ini sudah barang tentu sisa tebu tak dapat
rffietahui bobotnya secara pasti, selanjutnya bobot tebu yang digiling pun
dapat diketahui dengan tepat.

Sisa tebu di halanranpabrik (cane yaril biasanya berupa onggokan


tuk kerucut.

Bobot tebu = lsi kerucut x


densitastebu onggokan

lsi kerucut = luasalas (lingkaran)x


1/3 tinggi

4. Tebu tumpukan
=Tr12*l=
#,,,
34

Densitas (p)* semu tebu onggokandalarn istilah asing disebutbulk densdty


Langsurng dijatuhkan dari trailer (tak beraturan)- = 200 kg/m3
Dibongkarhati-hati (agakberaturan) = 3ffi kg/m3
Dibongkardengantenaga manusia,batang-batang
sejajar E 400 kglm3

Sisa tebu optimum

Dengan membatasi waktu siang hari adalah pukul 6.00 pagi hingga
5.00 sore, dan malam hari adalah pukul 5.ffi sore hingga 5.00 pagi, Hugot
(P6 )
menyarankan persediaan tebu di siang hari (P, ) dan di malam hari
sebagaiberikut :

Ps = 12r'.
Pm= 154 '
274 A = tebu digiling tiap jam

Rumusan tersebut memberikan sisa tebu minimum 12,5% kapasitasgiling.


Angka tersebut norrnalnya telah menjamin tidak teriadi pemberhentian
atau kelambatan giling karena kekurangan tebu, serta mengisyaratkan
organisasi tebang yang terbaik yang pernah dicapai. Pada prinsipnya, perse-
diaan tebu makin sedikit makin baik, sepanjangmampu menjamin kapasitas
g i l i n go p t i m a l .

Berapaklh sisa tebu maksimum? Dengan memandang waktu 10


jam sejak tebu ditebang belum terjadi pembentukan dextran, dan peruraian
sakarose masih dalam batas toleransi, maka seburuk'buruk organisasi
tebangseharusnyamemberikansisa t.U, jfl x 100 o 40% kapasitas,ter-
rnasuk tebu yang menginapdi kebun dan di perjalanan. !

* (il '
densitas (napat, p ) tidak sama artinya denganberat ienis
35

Afigka 4Q% dipandargmasih terlalu besar. Dengan mengambil Ps =


dan P, * Pm = 30 A, maka sisa tebu maksimum25% kapasitas,dengan
tidak ada tebu menginap di kebun dan di perjalanan. Organisasi
dikatakan baik bila mampu mencukupi kebutuhan baku pabrik gula
persediaan tebu 112,5 - 125% kapasitas giling. Hasil penelitian
menunjukkan:

Rendementebu = rendemen tebu segar - (0,009) (% sisartebu)

tebu yang dibiarkan 11 hari atau lebih akan memberikan rendemen


negatif (membawagula).

Nira Mentah

tian bobot bruto (kotor) dan bobot netto (bersih) nira mentah ber-
bobot brubo dan bobot netto tebu. lstilah tara tidak digunakan
penirnbangan/pengukuran nira mentah. Yang disebut bobot bmtto nira
yakni bobot nira mentah tertimbang/terukur. Bobot netto (bobot

nira mentah ialah bobot bmtto nira mentah setelah dikoreksi (diku-
denganbobot koreksi kotorannya.

Bobot btwto nm = bobot.netto nm + bobot koreksi kotoran nm

netto nira mentah inilah yang dijadikan dasar utarnaperhitung di ba-


fahan(pabrikat, boil,i,ng house).
(%) pol dan brix nira mentah didasarkanatas nira mentahnatto kare-
mentah yang dianalisis untuk penentuan % Wl dan % brix adalah
tidak mengandungkotoran tak larut (koreksi kotqran).

Bobot btwto nira mentafi = 2 0@ t


% koreksi kotoran nm = Ar25
Vepol nm = 15100
Vobrix nm = 1{i,00
Elerapakaht pol dan t brix nm?
36

n?(
t koreksikotorannrn = ffi * 2 000 = g

t nettonm * 2000-5 = 1995


t pof nm s 15/100x 1 995 = 299,25
t brix nm = '18/'100x 1 995= 359,'l

HK nm = 3-..P,!nn x '100 = !-,p91no' x 100


70DflXnm tDflXnm

1R
= : f t x 1 0 0 a t a u = 2gg,25
ffix1@
= 83,33%

Pada bab-bab selanjutnya akan dibahas fo atau t pol dan brix nira mentah
terkoreksi, Yangpentinguntuk diketahuiialah istilah "terkoreksi".
"Terkoreksi"
di sini artinya telah dikoreksidenganpengembalian,
bukannya
dikoreksi dengankoreksi kotoran.
Bila suatu pabrik mengembalikannira kotor dari setasiun pemurnian ke
ampas (nka), atau mengembalikannira seduhandari penapisanuntuk imbibisi
(ins), maka pengembalianhasil (bahan)sebelumpenimbangannira mentah
harus diperhitungkanuntuk mencari % pol &n % brix nira mentah terkorek-
si, dan selanjutnyat pol dan t brix nira mentahterkoreksi.

Secarahati-hati dibedakan3 macam bobot nira mentah:


a, Bobot kotor (bruto) nira mentah
b. Bobot bersih lnetto) nira mentah
c. Bopot nira mentahterkoreksi nka/ins
Ton pol dan ton brix nira mentahterkoreksinka/ins.

Koneksi kotoran dan koreksi buih

Bila nira mentah ditimbang, maka bobot netto nira mentah ditetap-
kan dengan analisis % koreksi kotoran; % di sini diperhitungkan terhadap
bobot nira mentah bz,uto (kotor, tertimbang). Analisis koreksi kotoran dila-
kukandenganalat silinderdekanter.

Bila nira mentahdiukur isinya,maka bobotnetto nira mentah dihi-


tung:
lsi netto nm s isi bz,wto nm - % koreksi kotoran nm
- Vo buih nm
37

% di sini artinya % isi yakni isi koreksikotorantiap 100 isi nm bz'uto,dan isi
buih tiap 100 isi nm bruto.

Bobot netto nm = isi netto nm pada suhu T"C X


p nm pada suhu ToC

= '
o (rapat, densitas) bobot : isi, atau :
Bobot * P xisi.

Karena satuan Sl sejak 1981 (UU nom.or 2) sudah menjadi satuan si$tem
Indonesia,maka jika bobot dinyatakandalam t, isi m3 dan o kg/m3:
p nm Egda''T' c
t nm netto = m3 nm netto pada To c x

Bobot nara rnentah yang ditakar

Bila 1 kg nira rnentah dipanaskanatau didinginkan, bobotnya akan


tetap, walaupunisinya akan berubah (memuai bila dipanaskandan menyusut
bila didinginkan). Jadi, perubahan suhu akan mengakibatkan perubahan
densitas{rapat,p ). Perubahansuhujuga menimbulkan perubahan le brix,
p maupun brix keduanyaadalahpernyataan mengenaidensitas, ke-
a sama-samadiukur dengan cara densimetrik. Oleh kanena itu ada
(korelasi)antara p dan brix pada suatu suhu.

Pada waktu analisis brix, angka yang dibaca pada tangkai alat pe-
ng brix ialah % brix belurndikoreksi,artinya belum memperhitungkan
ksi suhu. Yang disebut % brix terkoreksi ialah % brix pada suhu l/,$oQ
r,urata'rata di lndonesid. Yang disebut % brix belun'l dikoreksi iala"'
brix pada suhu pqngamatan, % brix nira pada suhu 30oC lebih rendah
da % brix pada suhu 27,5"C. Sebaliknya, brix pada 25oC adalah
besar daripadabrix pada suhu 27o5oC.Makin tinggi suhumakin rendah-
brixnya, selanjutnyarnakin rendahpulalah B (dan BJ).

Untuk mencari bobot nira nrentah pada suhu pengamatan, % brix


digunakanharuslah % brix pada suhu pengamatan' karena isi nira
yang digunakanuntuk perhitunganadalah isi pada suhu pengamatan.
'l'l (terbitan BP3C, sekanangP3Cl)
3 Bulletin 4 dan Tabel 2 Bulletin
tumkan hubunganbrix pada suhu ToC dan BJ pada T"C. Dari sini'
38

t nm nel;bo = m3 nm netto ToC x BJ nm ToC


^ * P-]llH:..|3
' A x
-e-nrlE
= ,n3 n* v B ! v ' T"C
r r l t " netto
1 0 0 0

yang dimaksudialah nira men-


Tanpa keterangan netto berarti nira mentah
''
tah bersih.

C. Bobot air imbibisi

dari penimbangan.Bila
. Bobot air imbibisi dapat diperoleh langsung
diamati, selanjutnya BJ dicari
air imbibisi ditakar, suhu air imbibisi harus
da|amTabe|lBu|letin1,1(PenuntunPengawasanPabrikasi).

= O'994728
Contoh: Pada suhu 29,8"C,BJ
artinYa:
'l = t
bobot m3 air Pada 29'8" C O'994V28

Per|udiingatbahwapada4oC,BJairtepat=ldimanarapat(p)airtepat=
atau |ebih tinggi, d lebih keci|
1 000 kg/m3" Pada suhu |ebih rendah
kg/drn3'
dari 1, dan 'p lebih kecil dari 1000
BJtidakmempunyaisatuan,karenaBJ(speeifiegrauitg).ada|ahperban.
clanrapat air pada 4oC'
dingan antara rapat benda pada ToC

D. Eobot ampas
persamaan:
Bobot ampas dihitung berdasarkan

+ ampas
Tebu + air imbibisi
+ (A)
T + l

Janganseka|i-ka|imenggunakanbobotniramentahnettountukmenghi.
tung bobot amPas'
39

(nira kotor dikembalikankepada ampas),persamaan


jadi:

irnbibisi + nira kotor = nira mentah btwto + ampas


I + NK = NMK +(A)

dapat dihitung, maka semua komponendalam persamaan


haruslahditirnbang.
nira kotor harus juga dianalisiskadar nira ljernih, kotoran
brix.

ampas. dipandang hampir tak ada Sunanya selama


Analisisterhadaptebubukanlah
dianalisissecaralangsung.
it. Yang menjadi masalah ialah bagaimana melakukan
tebu yang muwakil ( representatiue ) .
rnengapa pengawasan di pabrik gula seolah-olah tidak
tetapi dimulai dari nira mentah.

itan pengambilancontoh tebu, maka pengawasangilingan


"selama pernerahan nira tidak
suatu anggapan bahwa
. Bertitik tolak dari anggapan yang diresmikan ini,
ftadar pol, brix, air dan sabut) dihitung dari persarnaan-

di seluruh dunia menyatakan bahwa koreksi kotoran


) dalam nira rnentah tertimbang adalah sabut. Dari

t sabut ampas+ t koreksi kotoran nm

teori tersebut tidak pernah dipraktekkan.


40

Penimbangan Anpas

Di beberapa pabrik gula di Hawaii dan Afrika Selatan ada yang


melakukan penimbangan ampas. Penimbangan ampas difakukan secara
kontinyu denganradisi sinar .y (gamma) atau tenaBa nuklir. Prinsipnya
adalah hukum Lambert-Beer" Dengan mengetahui intensitas sinar masuk
dan iinar diteruskan, maka sinar yang diserap sebanding dengan bobot
ampas. :. ,:
.,

E. Penimbangannira encer

Di beberapa negara, apabila dilakukan pengembalian nira kotor


ke ampas gilingan, penimbangan nira mentah dipandang tidak praktis.
Justru nira encer yang ditimbang (misalnyadengantype Foxboro).

ton pol tebq- ton pol ampas + ton pol nira encer
ton brix tebu ton brix ampas+ ton brix nira encer.
41

VI. SUSUNAN TEBU

susunan tebu dan ampas adalah serupa, keduanya mengandungpof,


air dan sabut (bahan kering tak larut), dengan kadar berbeda. Jika
dilakukanpengembalianhasil ke gilingan (misalnyaprosesnka), maka
brix dan sabut ampas semuanyaberasal dari tebu" Karena pol ampas
isis dan bobot ampas dihitung, maka gula (pol) yang hilang dalam
denganmudahdapat diketahui. Hal serupaberrakudalam penghitung-
hilangdalamblotongdan tetes. Kehilangangula dalam hasil samping
blotongdan tetes) disebutkehilangandiketahui.

Kehilangan tak diketahui dapat dijelaskandengan mengambilcontoh


pol.

Tabel 2. Neraca pol pbbrik gula


(dasar 100 pol tebu)

Keluaran

tebu 100,00 Pol dalam nira mentah 95,04


Pol dalam ampas 4,96
'100,00

nira mentah 95,04 Pol dalam blotong 0,32


Pol dalam tetes 10,04
Pol dalam hasil* 80,60
Pol dalam perkiraan** 2138
Pof hilang tak diketahui 1,69

95,O4

pengawasangilingan, kehilangan tak diketahui (pol, brix,


tak dapat dihitung karena tebu tidak dianalisislangsung.

yaknrigula pangkal(HS)atau gula pangkalurama

masih dalam prosesdiperolehdenganperkiraan (taksasi).


42

Susunan tebu didapat dari perhitungan-perhitungandengan


anggapantidak adanyakehilangandi stasiungilingan.

f-eir bebasbrix
(airadsorpsi)
I
i. --l
I
Lair mengandungbrix
(air dalam nira tebu)
(a) Tebu
pol
(zk terlarut)
bukangufa
a t ke ri n g
sabut (zk tak larut)
kotoran (zk tak larut)

Oleh karena nira tebu = brix + ain mengandungbrix, maka susunan


dapat digambarkandenganskema lain:

air bebasbrix

f*ui.
b) Tebu niratebu -J
(takdiencerkan) *,
| f
Lu.i*-l
sabut L bukan gula
kotonan

Menurut the. fnfurqational Society of Sugar Cane Teehnotogds


(#scr):
Nira tebu + Air tebu brix = nira mutlak = tebu - sabut.
Konsepnina mutlak belum digunakandi Indonesia.

f alr
--j
rnutlak nol
rn'" L-: -l
Ubrix [-
(c) Tebu_--l
;

l-sanut
kotoran

Gambar 5. Susunantebu menurut sistem p€ngawasanIndonesia


(a dan b), dan ISSCT(c)
43

Semenjak perl'iitungansusunantebu, perhitungan-perhitunganselan-


jutnya rnakin bertambah panjang dan rumit. Untuk itu diperlukan lambang-
lambangyang sistematik(telah disajikandalam Bab ll)

Contoh: pt % pol tebu


Pt ton pol tebu
Fnmk % sabutdalamnira mentahtertimbang (koreksikotoran)
rnm nira mentah% tebu= I#. x 100
I

A. Perhitungan kadar po!

A T + f - NMK

Pa . E *^ . d" ,
'100

NM NMK
#!-.x NMK
pnm
Pnm x N M
100
Pt Pa Pnm

pt P'1-t
100
I

Perhitungan kacJarbrix tebu

ba = P 3 , "x 1 0 0
HKa
HKa atau HKna dianggap = HK nga

-.ladi,ba =,_$._ .100


x
fil\nga

Ba = m ba
x l \

Bnm =
bJu x Ntul
100
Bt = Ba + Enrn
Fl*
bt =
?x100
HKa l-"lKnga,secara umufln dinyatakan:
44

Anggapan:
HK ampaske-n = HK nira gilinganke-n

C. PerhituRgan kadar sabut tebu

fa = zka-ba

t u = # ox A

Anggapan: Ft = Fa

E-
ta
ft= x 1 0 0, atau
T
, L a
f a x
100

D. Ferhitungan kadar nira tebu (nt)

Yang dimaksud nt di sini ialah kadar nira tak diencerkan,


nira mutlak.

nt =51{- x 100

Anggapan: bnt= bnpp

J a d'i , n t = , b t x 1 0 0
Dnpp

Catatan : Kadar nira mutlak tebu = 100 - /, sabut tebu, (|SSCT)

E. Perhitr.rnganair tebu bebasbrix (wot)

% kotoran tebu = Fgt''k x 100 = fnmk x tnmk


I
45

g't
bebas brix % sabut = x 1oo
ft
tebu (wt) 100 - zkt
100 - bt - (ft + kotoran tebu)
nira tebu {wnt) nt - bt.

Serqpah tebu

Sampah tebu (eane tTash) merupakanangka pengawasn mutu tebu


t sistem l55CT. Tebu layak giling seharusnyatidak mengandung
lebih dari 2,5Yo. Ttw.slt terdiri dari daun, akar, siwilan, dan ko-
otoran bukan bahan tanaman misalnya tanah, kerikil, pasir. Tiap
trash akan meningkatkankehilangangula sekitar 1% dan mernperpanjang
giling normalnya2% tetapi dapat mencapai3%.

In&nesia menetapkan bahwa sampah tebu tidak boleh lebih dari


Angka ini sebenarnyaterlalu tinggi. Sogolandan pucuk tebu dengan
a kurangdari HK sakarosetetes harusdipandangsebagaisampah"

Dalam pengawasangilingan dianggap:

kotoran tebu = koreksi kotoran nira mentah

i n i secara teknologi dan ekonomi sungguh-sungguhmerugikan"


% trash mencapai 2A%, boleh jadi koreksi kotoran nira mentah
Q,3/0.
46

VNI.PENILAIAN TERHADAP KEtsENARAN ANCKA.ANGKA

Sudah menjadi kelaziman di pabrik gula, angka-angkapengawasan


gilingan dinilai kebenarannyasecara selayangpandangmenggunakanangka
air tebu bebas brix dan faktor percampuran. Angka-angka efisiensi dan
kehilangandi gilingan akan diyakini benar, bila susunantebu yang dihitung
benar.

A. Air tebu bebas txix %sabut

Jumlah air hidrat (air. adsorbsi) yang terikat pada sabut secara
kimia fisika adalah sebandingdenganjumlah sabut tebu. Jumlah air adsorbsi
ini = 20 ' 25% sabut, Karena air adsorbsiini mengandungbrix yang sangat
rendah (praktis tidak mengandungbrix) maka diseburair tebu bebasbrix,

Di dalam pengawasangilingan, air tebu bebas brix dihitung sebagai


pos penutup,yakni:

% air bebasbrix tebu = 100 - % sabut tebu - % kotoran tebu


- % nira tak diencerkan

Angka air tebu bebas brix diperoleh dari serangkaianperhitungan


yang panjangserta melibatkananggapan-anggapan: !

a. brix nira tebu = brix npp (untuk rnenghitung kadar nira tebu
= nira tak diencerkan)
b. HK ampas = HK nga (untuk menghitung brix ampas, % sabut
ampas dan% sabut tebu)
c. tidak adanyakehilanganselamapemerahannira.

Yang paling menentukanbesar-kecilnya.angkaair. bebas brix ialah


anggapan "brix npp = bnix nira tebu" dan cara analisis zat kering ampas.
Pada pabrik-pabrik baru/diperbarui, biasanya pembukaan sel-sel tebu
dikerjakan lebih intensif denganpesawatperusak tebu yang memadai (pisau,
shredder pemukul atau unigrator)" Pemerahanawal yang intensif (di mana
HPB I harganyabesar)akan menghasilkanbnix npp yang rendah, selanjutnya
kadar nira tebu yang dihitung harganyatinggi dan akhirnya diperoleh harga
air tebu bebasbrix (pos penutup) yang rendah.
47

Bulletin 4 menyebutkanbahwa analisis ampas dilakukan dalam


selang waktu 1 jam, dan pengambilancontoh tiap.I jam. Contoh yang
dianalisisyakni yang diambil I jam terakhir. Pengeringanampasdilakukan
pada suhu 110 - 130'C selama 1 jam dengan hembusanudara yang cukup
m e l a l u ik i p a sa n g i n

Harga air tebu bebas brix akan menam.pungkesalahan-kesalahan


i dari anggapan-anggapanyang diresmikan, cara'cara pengambilan contoh,
kesalahan metode dan pelaksanaananalisis, kesalahanpenimbanganserta
kesalahanperhitungan-perhitungan.Harga air bebas brix bervariasi antara
-50 dan +50, kebanyakanantara 10 - 30% sabut. Harga rata-rata di Jawa
I pada tahun 1940 = 21% sabut. Dalam praktek, angka air bebas brix
dipergunakan untuk selayang pandang meneliti kebenaran angka-angka
perhitungan susunan tebu pada pengawasan gilingan dan angka faktor
rendemen jenis tebu pada percobaanpenierahan"

B. Faktor canplr {FC}

Seandainya keadaan ampas mekar sempurna dan se!-sel tebu


seluruhnya terbuka, rnaka air imbibisi dapat bercamptlr rnerata dengan
nira pada semuabagianampas,sehingga:

% pal ninadalamampasakhir = 9oWl nira gilinganakhir


atau:
teoritis = 3-%bK
% polarrNpas x % niraarnpas= '100
'!00 (ef
Keadaanyang ideal ini akan memberikan FC * isiensipercampuran
air imbibisi dan nira daiarnampas 100%|"

FF % pal arnpas teoritis pnga.(100j: fa).


x100 = pa
% Wl ampas dirlapat

Keadaan ideal iru dalam praktek tidak tercapai, karena percampuran


tidak akan sempurRa. Angka FC rata-rata di Indonesia ialah 50, rnasih
harusditingkatkan.
48

. Baik
F,e ini digunakan untuk meneliti kebenaran analisis ampas.
pengambilan contoh maupun analisis ampas mengandungkelemahan-kele-
mahan. Karena sifatnya yang mudahrusak
(pengasaman),maka pengambilan
jam. Contoh
contoh (untuk analisis % pol tiap-tiap jam) diambil tiap I
barang
yang dianalisis ialah contoh yang terbaru. Mengingat hal ini, sudah
pol, nira dalam
tentu contoh ampas kurang representatif. Padaanalisis'
perpecahansaka-
ampas diekstraksi secara panas yang dapat menyebabkan
ekstraksi
rose, Kemungkinanuntuk mengurangi kesalahananalisis ialah
kedua ini
secara ding,in dengan membuka semua sel dalam arnpas' cara
panas'
memberikan % pol ampas lebih besar daripada dengan ekstraksi
berarti FC akan lebih rendah lagi.

Harus disadarl bahwa FC merupakan angka pokok; kunci utama


air/nira
berhasilnyapemerahanlanjut ialah percampuranyang merata antara
bila
imbibisi dan nira dalam arnpas . Percampuran akan makin merata
Teknologi
sel-sel tebu makin banyak yang terbuka dan ampas makin mekar'
Yang ma-
modern telah mampu mernberikan % sel terbuka 90 atau lebih'
"bagairnanamengernbangkan dan menyerabutkan
sih menjadi rnasalahialah
ampasyang keluar dari setiap gilingan antara"'

C, C-araperrocokan (infercnt'faf, wthod) nrenurut Noel Deerr

Dari sudut ilmu pengetahuan,konsepair tebu bebasbrix yang mengi-


kuti nira tak diencerkan tidak dapat dipertanggungjawabkankebeqarannya'
air
Di dalarn bahan tanaman, air tidak hegitu saja dapat dibagi rnenjadi
(bebas zat padat)' Pada
bebas (mengandung zat padat) dan air terikat
pos penutup aljabar,
akhirnya, air tebu bebas brix tidak sekedar sebagai
pengawasanSilingan
tetapi justru sebagai pos penutup kesalahan'konsep
di lndonesia'
49

Faktor campur adalah angka yang sangat penting, tetapi justru


kurang mendapat perhatian di dalam praktek. FC menyatakan efisiensi
percampuranair imbibisi dan ampas, bukan untukmenilai kebenarananalisis

Penilaian kebenaran angka-angka susunan tebu dan pengawasan


gilingan yang paling tepat yaitu cara pencocokan menurut Noel Deerr .
Pemeriksaansilang dilakukan denganmenganalisiskadar sabut tebu. Bobot'
bobot nlra mentah, air imbibisi dan tebu dihitung. Hitungan ini dicocokkan
denganpenggunaanuntuk penBawasanintern.
denganhasil penimbang,an,

Dasar : 100 tebu, atau T = 100


Dihitung : A = dfflpis % tebu (termasukkotoran nira mentah)
NM = nira mentah bersih % tebu
I - air imbibisi % tebu.
Data : To sabuttebu hasil analisis langsung.
Data di bawah ini adalah hasilanalisis dan perhitungansebagaimana lazim-
nya:
fa = lo sabut ampas
= vo brixnira mutiak = 1oo
b nmut x bt
{100 - ft)
bnm = % brix nira mentah
bna = % brix nira dalam ampas

= 100
T0-6:--7e x Da
Dari data tersebut, dihitung:

A. = 100 x i f i 6 ftx 1 0 0 - j : * x{t 1 0 0


= f 100
ffxFt
ir 100-fa tt
nia xA=F(100-fa)
100 ta
Jumlah bobot nira = bobot nira mutlak + bobot air imbibisi
= bobot nira mentah + bobot nira datam'ampas
=NM+Na
16+
=NM**ttOO-fu)
TA
50

Iua hnr (r
brix, ; + # . N M + # .
Jurnlah.irubot, + (100- fa)
TA

iumlalr brix x 100


% brix nira jumlah PoPot
bobot nira
' r.:i...
, i

. f t
b n m . N M + b n a . r - (100- fa)
TA
ft (100 - fa)
NM+
E
bnm . fa . NM + bna . ft (100 - fa)
fa. NM + ft ('i00 - fa)
NIRA
brix nira

I
I bnmut - brix nira = p
NIWUT brix nira

N MUT I
bnmut bi=0

Air imbibisi tiap ffituan nira mutlak


bnm . fa . NM + bna (100 - fa) ft
bnmut -
= p
bnm . fa . NM + bna (100 - fa) ft
fa . NM + ('100- fa) ft

bnmut , fa . NM + bnrnut (100 - ld ft - bnm . fa . NM - bna ('100- fa) ft


P =
b n m . fa . NM + bna (100 - fa) ft

Hasil-hasilperhitungandimasukkanpersamaandasar.
T + l = N M + A
1 0 O+ P ( 1 0 0 - f t ) = N M + l f f i f t l t a
Baik dafam ruas kiri maupunkanan terciapatbilangan anu (unknotrrrJNM.
'11,90(analisis
Contoh: bnmut = 24,9Q ft = tebu)
bnrn = '19,00
bna = 8,80
fa - 48r7Q
51

A=ffix100=24,44
NMUT ='100 -'11,90 - 88,'10
2 0 . 9 0. 4 8 . 7 0 . N M + 2 0 , 9 0 . 5 1 , 3 0 . 1 ' 1 , 9 -0 1 9 , 0 0. 4 8 , 7 0 . N M - 8 , 8 0 . 5 " 1 , 3 01. 1 , 9 0
f =

- 92,53NM + 7386,69
925;3NM-'T37ZJ4
Jadi,
q2,53
NM + 7386,69
100+ EZS,:-rriffi .88,10= NM + 24,44

92530NM + 537214+ 8151,89NM + 650767,39=


925,3NM2 * 22(,14,33NM + 5372,14NM + 131295,1A
NM2 - z8,s6 NM - 1141,gg = o
(NM - 9"1,10)(NM + 12,54) = Q

Didapat: 1, T= 100 3 . N M = 9 1 ,1 0
2. A = 24,44 4" | = 15,54

Setelah diperoleh angka perbandingan(T : I : NM : A), maka salah


satu angka dapat diplotkan pada bahanyang ditimbang. Di Hawaii, inferen-
method didasarkanatas'bobotnira mentah. Kebanyakantebu di Hawaii
tial
dilanqm oleh pabrik gula sendiri, sebagianditananr petani yang memiliki
lahan puluhan hingga ratusan ha, sehinggajika ada selisih Lrobottebu sedikit
tidak menimbulkannrasalahsosial.

Di lndonesia, infenential mathod dapat diterapkanuntuk pengawas-


an intern, dengan mengeplotkan perbandingan kepada bobot tebu, atau
nira mentah. Karena fungsinyahanya sebagiancara pelengkap{untuk meneliti
kebenaran pengawasangilingan), maka bobot nira mentah yang dihitung
tidak digunakanuntuk pengawasanpabrikasi (pengolahan)"

Cara pencocokan di Hawaii memberikan kesirnpuiarrbahwa hanya


meni.mbangnira mentah (tanpa menimbang tebu dan air imbibisi) seria
analisis !9Out sabut tebu secara langsung,'pengawasan gilingan dapat
dilakukan dengan saksarna. Dengan dasar NM, maka bilangan anu dalam
p€ngawasan gilingan tinggallahbrix nira mutlak. Melalui faktor brix (disebut
juga faktor nira mutlak = Hawaii ratio), hrrixnira mutlak dapat dicari.
% b r i x n i r a m u t l a k-
Faktor brix (FB) =
9o brix nira perahan dua rol pertama
52

vo'.,rixniramutlak = Tobrix nira perahandua ror pertama


x FB
Di Hawaii, karena inferertLial, nethod. merupakan
cara baku, maka FB
'ditetapkan denganpercobaan.Di negar.a-negara
yang menggunakan infeien-
tial nethod' sebagaicara pelen8kap,FB dipui-ofehdari.data
laporanharian/
mingguan.

Analisis sabut tebu

Pengambilancontoh tebu hinggakini ada tiga cara:


1' Acak (r'andom), batang-baiangtebu diambil
dari lori/truk/afat angkut la-
innya. ?rc*h dipisahkan,yang dijadikan contoh yakni
tebu bensih.
2. Pengeboran(eoring), dari atas ke bawah
miring bersudut45o, merupakan
cara resmi di Hawaii.
3. Melalui fubang/jendelaftntch sa.npling),
tebu cacah (prepaz,ed
eane) yangakan masukgilinganI diambil contohnya.
Ausiralia mengambil
tebu cacah dari crusher.

Pengolahancontoh sebelum disintegrasi aiau pencucian


memberikan
irisan-irisan tebu dengan tebal kurang dari "r mm. peralaian
yang digunakan
yakni pengiris (sli.cen) atau pemotong - pembelah - r'
penggiras (c.ntter -
shyeddey.- gntnd.er,). I
Anafisis dapat dilakukan menurut dua cara yakni I
card pencucian I
dan cara disintegrasibasah- dingin.
I
Cara pencucian: I
I
. Dari contoh yang sudah dihomogenkandengan pengiris
arau pemotong I
- penggilas,ditimbang200 grarn.
I
. Masukkanke dalam kantungkain, ikat dengantali.
I
' Rendam.dan cuci dalam air mengalir. seringkali diperas
dengan puntiran I
atau dengan .^creL) prless' dan massadirnekarkan- d.iserabutkan
kemba- |
li. Pencucian,pemerasandan penyerabutandiulangi b,erkali-kali.
I
Tandabahwasabut bebasbrix/gula, air cucian menjadi jernih,
I
. Peras sabut bebas brix untuk memisahkan air sebanyak-banyaknya.
I
Pindahkan sabut dari kantung ke dulang kecil., keringkan pada
suhu 125 I
- 'l30ochinggabobotkonstan
(biasanya
memakan
waktu3 jam).

I
53

VIII. SUSUNANNIRA MENTAH


I
l l
r ,
I Telahdibahasdi mukabahwanira mentahtertimbanz(btuto) terdiri
II u,u, koreksikotorandannira mentahbersih (net,to), Susunannira mentah
JI n"tto dapat digambarkandalam tiga bagandi bawah ini:

L-ai. -
J , Niramentun
-1 I
tr ' '
LJcrix --l r'ol
I L b u kangula
I
I
I
I -noo --#
--# seluruhnya
seluruhnyan tebu
nira
I rnoo
l i
Nira mentah_-l pnira tebudalamnpl
t
I L"o'----l
I Lair imbibisidalam npl
II
I
I

L-nira tebu dalam nira mentah


r (ntn*)
I |
l l
II Nira mentah-1
-
I Lair imbibisidalam nira rnentah
I (inm)

I Cambar 6. Susunannira mentah


-
-
I

I ,{. Diagrarn Cobenze untuk percarnpuran dan pemisahan


--
I
(1913), dikem'
I Teori p€rcampuran Cobenze, seorang ahli fotografi
I bangkan oleh industri gula sebagai metode dasar untuk penyusunanneraca
II (bahan,brix dan pol) tidak hanya untuk percampurantetapi juga pemlsahan,
I 6g6 rflercikup pelbagai keperluan. Perbandingan bahan-bahan penyusunan
I dtau hasil-hasil pemisahan didapat dari metode segiempat, atau lebih
I

Ir secjerhanadengan metode segitiga.


I-,
I

I-
I
-I,
-
-
-
--
54

1. Neraca bahan

Metode segiempat atau segitiga brix menjelaskan perbandingan


bobot bahan-bahanpenyusun/hasil-hasilpemisahan. Contoh: percam$uran
nira.nira rol muka dan rol belakanggilinganakhir.
n
{o'o
I,
J,,,
Dengan data analisis brix nira muka (bn'n) dan
brix nira belakang (bn6), perbandingan NCA,
N* dan N6 dapat diketdhui (dalam fraksi atau
%). Jika bobot salah satu nira diketahui, bobot
nira-nira lainnya dapat dihitung. Dengan data
bn* = 2, bn6 = 4 dan bnga = 2,5 makal
NCA
.
Metode segiempat brix ( reetangl,e method,)z4, 7, 14

'1,5 N m = _1d.
Nm =
NCA 2,4 75%
\ ^ . . /
l-rJ

tyb o,/ \n,, u. = 2?/o


NCA 2,4 NGA 2,4 100Vo

Cambar.7. Diagram Cobenze

Metode segitiga brix ( triangle net?nd) :

NGA BerapaN6/NCA?
bnga
12,5) Dengan melihat sisi-sisi segitiga
di muka Nm dan NCA sebagaimana
yang ditunjuk anak panah, dapat
diketahui:

Nm b n 5- b n g a
_ 4 , O- Z , E , , " n
Nm- - 6irb.Tnm 4iff--:ryn= tr-/o
t\m

bnm bnb
(2,0) (4,0)
55

Nb
1'2' *'Y = 25/o atau 100- 75
NCA

2. Neraca brix

HK' Misalnya
Perbandinganton brix bahan-bahandicari dari segitiga
(HK = S = 1ffi) dan semua
nira mentah (HK = J) diolah menjadi gula murni
(HK = M = 28'571'maka:
I
kehilangandianggapditampungdalam tetes

Bnm Eiula x 1oo= J-Y, x 1oo


( H K n m= J ) Bnm S- M
= !:!38- x 1oo
1W - 28,57

= 1,4 J - 40

f f i ^- 0,4 (bnm-Pnm)-. 100


=Dnm
B gula B tetes
HK gula = S ='100) (HK tetes= M = 28'57)

3. Neraca pol

HK rangkap'
Perbandinganton pol bahan-bahandicari dari segitiga
gula murni (kemurnian
Misalnyanira mentah (kemurnian J), diolah menjadi
tetes (kemurnian ideal
5 - 100), dan semua kehilanian ditampung dalam
M = 28,57):

Fnm
P = d' ) + x 1 o o
(J) B ng
m, . h . x l o o

l-J . Esslg = ##
* 1oo xloo
unm
P eula
:*-
Hnm
X xloo
1oo=:id;#i

P tetes
I gula
(S = 100) (M = 28,57)
56

,'sambi| (eugaf,
vo^ ilcrrnhi
Contoh yang diberikan la|u,,itini memberikanrurrtUS SJM
I lahr,r
(1910)' Jika diplot'
juiee" moLasses) yang cliketemukanoleh Noel Deerr
=
kan pada keadaanideal (S = 100 dan M 28,57)' diperoleh:

P eula- 1.,o = J99Jl:!9&- * 1oo


A
Pnm J (100-28,57,
= (1,4- jel 1oo
= Cl4-ffil 1oo
pl,m - 0,1 (blm:-Pnm) x 100
pnm

yang disebutrende-
Rumus sJM khususini tidak lain adalah rumus winter,
men Winter ideal (ideal Winl;et' reeouery), secara empirik diketemukan

tahun 1897,

DiagramCobenzeumumnya,SJMkhususnya,kecualisebagaimetod
(pengambilan
penyusunanneraca, juga untuk meneliti kebenaranpen8awasan
dalam percampuran
contoh, analisis, penimbangandan perhitungan), baik
maupunpemisahan

a- Contoh percamPuran

Pnm
HKnm
Pnpp HKnPP(HKnry1-HKnPI)
ffi=m

l-lKnpp HKnpl
57

b. Contoh pernisahan

Pmsk A PemerahanmasakanA
HKmsk A (J) = kristal % Wl masakanA

= -5 (x J - M ) 100
J(S-M)
(J - M)
= -100 x '100
J (100- M)

P kristal PstrA
HK kristal (S = 100) HK str A (M)

B. Perhitungan npp lo nm dan npl y'onm

NM = NPP + NPL
Bnm = Bnpp + Bnpl
bnm.NM = bnpp.NPP + bnpl " NPL
- bnpp. NPP + bnpl (NM - NPP)
NM (bnm - bnpl) = NPP (bnpp- bnpl)
Nlvl bnm - bnol
=
FIFP Enp,pFS;Fi
- bnql
ryry ,,'100= bnPP
bnm - bnpl
x'loo
NM

Untuk rnudahnya dapat dilihat pada segitiga brix (Cobenze) sebagai


berikut:

NM Panah-panah menunjuk k an:


bnm

ryPP= ?nnf bnpf


NM bnpp- bnpl

NPP NPL
bnpp bnpl
58

NPL x 100 = !ruP.gx 100


NM bnpp - bnpl

Jika diperhitungkan terhadap tebu, maka:


npp 9o tebu = npp fo nm x nm To tebu/'l00
,.npp =nmnpp x tnm/100

pemerahanawal' Penilaian
Angka tersebut telah menampakkanefisiensi
yang lebih tepat ialah dengan HPC I dan HPB l'

C. Perhitungan nira tebu dalam nira mentah

dianggap
Nira tebu (nira asli, nira tak diencerkan, nira normal)
campuran
memiliki brix samadenganbrix npp. Nira mentah merupakan
nira tebu danair imbikrisi.

NM NT bnm-0
-
bnm l{M bnpp-O
b n m 'x 'lUO
at
ntnm = .g.:.l.:.
bnpp

. bnpp - bnm
= --
lnm
bnpp

N T I
bnt = bnpp bi = 0

yang disebut "nira mentahasli" tidak lain adalahntnm (nir


dalam nira mentah).
(nira
Dalam praktek, perhitungan kadar nira tebu
tiap 100 tebu) dilakukanseperti di bawah ini'
tntnm
nira menr*trasli % tebu =
= ntnm x tnm/100

-bnm x NM x100
bnpp T
b9 - * + { rco
,r*- y'o
nira asli dalam ampas ._ -__ _ = ,
tebu
bnpp T
59

Jumlah keduanya adalah kadar nira tebu, )/ang perhitungan singkatnya


telah dikemukakansebelumnya:

nt =5ffi x100= ff# x 1002

D. Nilai nira dri nira mentah (k"nm)

Pengalaman winter (1892) menyebutkan bahwa pada proses yang


terbaik yang pernah dicapai, tiap 1 ton bukan gula akan membawa serra
0,4 ton pol yang tak dapat dikristalkan (jadi ikut tetes). pol yang dapat
diperoleh dalam hasil (dapat dikristalkan) tiap 100 nira mentah selanjutnya
disebutnilai nira (ko) nira mentah.

konm
Konm x NM
100
pnm - 0-,4(bnm - pnm)
x NM
100
k"nm adalah nilai nira (sapunarde) dari nira mentah, artinya kristal da-
pat diperofeh (wi,nbanr kriatal atau yeeoueyable (pur.e) sugat,) tiap
100 nira mentah,

Rumus winter didasarkan.pengalaman(empiris), yang kurang dapat


dipertanggungjawabkandari sudut ilmu pengetahuan. Noel Deerr (1910)
rnengilrniahkannya
menjadi rumus sJM (sugar" iui,ee, molasses).
SJM inilah yang mClandasipengawasanISSCT. Jika nira mentah
menjadi gula dan semua kehilangan tertampung dalam tetes, maka
lakulahpersarnaanbrix dan pol sebagaiberikut:

Bh + Bm
Ph + Pm
Bnm HKh. Bh + HKm.Bm
. Bnm HKh. Bh + HKrn (Bnm- Bh)
HKh. Bh + H Km . Bnm- HKm .,Bh
60

Bnm(HKnrn- HKm) Bh (HKh- HKm)


Bh: - HKI
F.tknm
8"rn HKh - HKm
Bh HKh HKnm- HKm HKh
x - HKm HKnm
tr'nm HKnm HKh
Pb - HKh (FlKnm- HFrn) * 100
Pnm HKnm(HKh- HKm)
Jika Ps Ph, Pj = Pnm dan Pm = P tetes
S f{K h , J =H K nnn dan M = l-'lKm,maka

Pj
J .Ps = ilJ:Jut
Pj J(5-M)

l l J - M) x 100
P t * t o o = s.(J
Pj J ((SS - M )

Ps pm
5 , M

Dengan mengandaikan mutu gula ideal (murni, S = 100) dan mutu tetes
ideal(M = 28,57),maka:

Ps 100(J - 4ol
100 = # x 1 0 028,571 ' ' J 1oo
= (1.4
Pj J (100- 28,57)
- (bj - Pi)
= lApi:!d-!i x ,too = Fj 0-,4 * 100
pj pj
pi -.0 ,4{b j : p i )
Ps= xPj
pj
- (bj - Pi)
= Pj 0.'4 xNM
100

t's x 'roo= pj - 0,4 (bj - pj)


NM

Pol dapat diperoleh dalarn gula murni tiap


100 nira mentah = prltn - 0,4 (bnm - pnm)'

konm = pnm - 0r4 (bnm - pnm)


61 :

E" Kristal dapat diperoleh dalam nira rnentah/1fl) tebu

tkonm = - 1.. = !@NU


' v v T

"rendemen tebu harian", karena perhitungan


Dalam praktek disebut
initerdapatpada|aporanharian,dimanabe|ummelibatkanrendemen
dapat diperoleh'
winter (RW). lstilah yang paling tepat ialah rendementebu
(ideal) = 100'
yang mendasarkanpada rendemen winter dapat diperoleh

tkonm = konpp x tkonm


konpp
= konPP x faktor npp dapat diperoleh'
, . t ,
faktor nira asli/faktor
Faktor"npp dapat diperoleh adalah sinonim dengan
"yang dapat
tebu/faktor rendemen yang dapat diperoleh. Keterangan
"yang didapat" (nyata).
diperoleh',diberikan untuk membedakandengan
62

IX. NERACA BAHAN STASIUNGILINCAN

A. Kebutuhan Data

PengawasanCilingan bersamamembutuhkandata: .
. Tdanl
. NMK, fnrnk, pnm, bnm, HKnm
. pnpF,bnpp, HKnpp; pnpl, bnpl, HKnpl; PnBa,bnga, HKnga
. pa dan zka.

Dari data tersebut dapat disusun neraca setasiun gilingan yang


pokok, atas dasar persarnaan:

T + l = N M K + ( A )

Neraca yang leqrgkap membuiuhkan data tambahan untuk perhitungan


bobot nira dan ampas dari setiap gilingan. Selanjutnya dapat dihitung
ton pol, ton brix, ton bukan gula, ton sabut dan ton air masing-masing
bahan. Dari sini dapat dirumuskanpelbagaiefisiensi"

Dikenal tiga metode penyusunanneraca bahan:


1. Metode brix, rnembutuhkandata tambahan analisis pc'l dan brix nira
gilingan ke-3 hingga sebelurn terakhir" Biayanya rendah, perhitungan
sederhana,tetapi kurang teliti.
Metode Blekkingh , membutuhkandata seperti rnetodebrix.
Biayanya rendah, perhitungan panjang, menggunakan banyak sekali
anggapan, hasilnya cukup teliti. Anggapan terpenting yang digunak
yakni:
zat kering nlra = 0,60 brix + 0,45 Pol.
2. Metode pengawasangilingan individual ISSCT(HPC I, II, . . . . . , a k h i
rnembutuhkandata pol dan brix semua nira gilingan,pol dan zat k
semua amDas.
3. Metode zat kering (arus bahan) membutuhkandata pol dan zat k
untuk semuanira dan ampas.

Indonesiamenggunakanmetode brix.
63

B. F.leracaBahan Menr.lrut Metode Brix

Perhitunganmenggunakananggapan-anggapan:
- Seluruh imbibisi yang diberikan kepadaampasyang masuksuatu gilingan
akan diperaholeh gilingantersebut.
- Arnpasyang keluar dari suatu gilingan hanya mengandungnira tak dien-
cerkan(nira tebu, nira asli).
- Brix npp = brix nira tak diencerkan(anggapan
yang sudahlazim).
- Ton sabut tebu = ton sabut setiap ampas.

Contoh:

il ill IV
ebu

w+d
nm

Cambar 8. Skema irnbibisi majernuk (wa4, n5 a3, n4 a2, n3 a1)

1. Menghitr.rngN1 (NFP)

NM
bnm

bnm - bnp-l-,
NPP =. NM (
bnpp- bnpl

NPL
bnpl
64

2. Menghitung N2 NPL)

NPL=NM-NPP= N M

3. MenghitungN3 (lihat gllinganll)

N2 *N3+Ntn2

Karenabrix nira tebu dalamn2 (bntn2)= bnpp,maka:

N2 fl _ bTr pp- bnr ,


bn2 N2 bnpp- bn3

-
N3 = N2 , bIrPP bn" ,
bnpp- bn3

N3 Nt n2
bn3 bnpp

4. Menghitung N4 (lihat gilinean lll)

N3
bn3

bnpp - brJt
N 4 = N 3,
bnpp - bn4

N4 Nt n3
bn4 bnpp

5" Menghitung N5 (lihat gilingan lV)

bnpp - bn4
N 5 = N 4, ,
bnpp - bnS
65

lnilah metode brix untuk perhitungan bobot nira-nira gilingan yang diprak-
tekkan cli Indonesia(laporan 15 hari). Atas dasar bobot nira, dapat dihitung
ton pol, ton brix dan ton air dalam nira.

Metode brix (1928)dikritik oleh Blekkingh(1940).Metode Blekkin$t


pun kurang teliti clibandingdengan metode zat kering. Ringkasan ketiga
metode itu dapat dilihat pada tabel 2.

Perhitunganbobot ampasdilakukandari belakang'

A yakni A5=T*l-NMK
' A 4 = N 5 * 4 5 - l

A 3 = N 4 + A a - N 5
A Z = N 3 * A E - N +
4 1 - T - N P P

Untuk metode brix, sabut dan air didapat dari neraca. Anggapan yang
digunakan:
. HK ampas = HK nira gilingan yang bersangkutan
. Ft =Fa2 = F"3 = Fa4 = V^t
(koreksi kotoran nira mentah = kotoran tebu disendirikan).

Berikut ini disajikan contoh data untuk penyusunanneraca stasiun


'100
gilingan pabrik gula (dasar tebu).

% tebu pol brix HK zat kering

'13,45 74,O5
nira rnentah 94,7O 9,96
kar. kotorannm 0,20
nPP = n'l 13,06 17,16 76,11
npl = n2 6,44 8r95 71,43
n3 5,2O 7,47 69,61
n4 3,06 4,53 67,55
n5 2,25 3,45 65,22
ampas 2,56 5'.l,13
24,41
66

o[,
2l ?l ,l El r-
c
l!
o.
t$
0S
.g
:L;
0)
J
+r
(d
*l'#t#*
?ls t F
vl
| I t J

l;lFIFil-il-
N
t r ulo
o fil
!
o
.p i l te E
o
c E d F s
(d
uc,
f

=
"&,
N c
.b o-
c '* tn ro
I
rI, cl c s

$IlIflIsls xlfr
.b
g
?
E r c
v L

o ot ':. (d
.E N
o

ieHc
r l r -o fil

He
J I
! -c .- b0
al o'
t s- -g o . :
J

rs ,o ut
t- Hg
h0 d] o ( \ l ;IJ O G ' O
g
f T'
o -oz TI N r r E o .
v ' )

.: o
tt
o a r
c c . y
-g o * E c.t cr) ; J I I I :
t-
x : -Ez z z z z N - O U
LL

o
io
o fd
o .k
E c
d
a
(.a E C
k d
-o
n *._
ro .I t(r) J. W
t ! .- :
.o 1- 5
':9 E g
o
ro .o os zl r, ho
. g ' ; c
o 6 l = att
P
C) * E E 5
( g v r J
; -o z-
c{
+ * t r
) N.+
tr
({ 0 - J
A F F
E r r

;5 - gr +E
b0 0_ o-
= z z
' i l
l l
OD

Z z z ' 7 z z
t g"$
fil

z
67

Dari neraca yang disusun,neraca bahan dan neraca brix cocok benar,
sedangkanpada neraca pol terdapat penyimpanganfi1ftol:*

T 100,000 N M E 94,7w
p 10,177 p 9,432
'13,880 b 12,737
b
f 13,741
+
C I LINCAN l - - - - - - 4 Kotoran 0,200
II NPP = 51,854
p 6,772
I 8,898
I b
t
A1 = 47,946
p 3,405
b 4,982
CTL|NGAN ll ---# NPL = 42,846
I p 2,742

i
A 2 =
t 4'1,358
b 3,839

p 2,548
b 3,85',|
CILINTAN
I
I

4 3 =
t, 32,918
p 1,514
b . t 2,443
CILINCAN lv-# N 4 =
p 01851
I b 1,254
$
24,41 A4 = 30,727
p 1,244
b 2,427
{,
G ILINCAN v N 5 = 25,627
I p o,577
I b 0,884
T
A5 = - . 29,11Q
p 00663/0,745'
b 1,143

Cambar 9. Contoh neraca bajran stasiun gilingan


(metode brix)
,68

c. Neraca Bahan Menurut Metode PengawasanGilingan


Individral l55CT
. , 1 .

yang digunakan:
Anggapan-anggapan
(nira
1. Dalam hal,dilakukanpenSambilancontoh flrst-eapreseed iuiee
= HK nira dalam am-
per'ahandua rol pertama, nprp), maka HK ampas |
(nprk)
pas t = HK nira perahan dua rol kedua

HKa, atau HKnal = HK nprk

nprp + nprk = npp atau n1

Jika tidak dilakukanpengambilancontoh nPrPl rnaka:


HKa1, atau HKnal = HKn2'
disamakan dengan
HK nira ddlam ampas I adalah tertalu kecil untuk
HKnpp (nira gilingan I dengan/tanpanira crusher)'

2,HKampassetiapgi|inganbasah=HKniragi|inganyanEbersangku
Untukampasakhir,jikadi|akukanpengambi|ancontohLast-erpreee
jui'ee (nira perahandua rol terakhir, npra)' maka

HK a atau HK na - HK npra.

3 . F t = F a 1 - F ^ 2 = . . . . . . . . , ,= F a
dari 5 gilingan:
Dengansistern imbibisi majemuk dan instalasi terdiri

A 5 = J + l - N M K

A4,A3,42danAldicaridarikadarsabutmasing.masingampas,kad
sabut tebu dan ton tebu.

fa = zka-ba danb" =
HKffi;
{t
=
A iA x T, selanjutnYa:

N5 - A4 - 45 + |
N4 - 43 - A4 + N5
N3 - A 2- A 3 + N 4
Nt = At-AZ*N3=NM-N'I
N1 = T -A1
59

D. Neraca BahanMenunutMetode Zat Kering (Arus Bahan)

Misalnya instalasiterdiri atas 5 gilingan:

r l
O-*i+O,.5

NM

Neraca bobot:

T - N1+,A1
A 1 + N3 = N 2 + A 2
A2 + N4 - N 3 + , A 3
A 3 + N5 = N 4 + A 4
A4 + I
I = N 5 * A 5
+
T + I - N 1 + N 2 + A5 = NMK+A5

A1 N2 = AZ - N3 = A2 ( A 2 + N 4 - , { 3 ) ('t)
- 43 " N 4 -4 3 (A3+N5-A4) Q)
= A+-N S =A 4 (A4+l-45) (3)
= A 5 - l = A 5 (NMK+A5 - T) G)
= T -NMK (5)

Dari persamaan-persamaan itu dapat disdsun neraca menurut metode


arus bahan, didasarkananalisis zat kering, Masing-masingampas dianalisis
zat kering dan pol. Masing-masingnira dianafisis zat kering dan pof.
70

Perhitungan bobot N2 NPL)

Diambil persamaan(4) dan (5):


N2=41 -A5* | dan A5= A(ampasakhir)
41= N2+T-NMK

Persamaanzat kering:
ZKn2=ZKa1 -ZKa5
Z K a l = z k a 1 . A 1= z k a l ( N 2 + T - N M K )
= zkal N2 + zkal (T - NMK)
. ZKa5 = zkas. A5 = zka. A
zkn2"NZ = z k a l. N 2 + z k a ' l( T - N M K ) - z k a . A
'
t\.) =
zkar(T-NM-zka.A)
zkn2 - zkal

zLa,A-zkat (T-N{K)
N2=
zkal - zkn2

Dengancara yang seperti itu ak;in diketemukan:

N1 = NM-N2 41 = T-N1
z k a . A - z k a 1( T - N M )
N 2 = A2 = 41+N3-N2
zkal - zkn2
zka.A-zka2(T-NM)
N 3 = A3 = 42+N4-N3
zka2 - zkn3
zka.A-zkag(T-NM) -
N 4 = 4q 43+N5-N4
zkag - zkn4
zka.A-zka4(T-NMK)
N 5 = 4 5 = f + l - N M K
zka4 - zkn5
71

I
I ,
I X. EFISIENSIGILINGAN

A. Pen6awasanGilingalr Bersanra

Angka-angkaefisiensi gilingan,menurut metode pengawasanbersama


yang berlaku di Indonesiaadalah:
- HPB (hasilgunapernerahanbrix)
- HPG (hasilgunapemerahangula/pol)
'-
kadar nira tebu
- PSHK (perbandingansetara HK nm/npp)
- FC (faktor camPur).
(hasil-
Bab ini hanya akan membahasHPB' HPC dan PSHK, ditambah HPS
guna pembukaansel)" Kadar nira tebu dan FC sudah diuraikan dalam bab
Vl (susunantebu) dan bab Vll (penilaian kebenaran angka'angka). Penulis
tidak menggunakanistilah hasilbagi untuk HPS, HPB dan HPG, karena
hasilguna (efisiensi) lebih memberi arti ekonomi, dan lebih sesuai denpan
teknologi canggih.

1. Hasilguna penbukaan sel (HPs)

HPS disebutjuga % selterbuka,diterjemahkandari % open celle,is'


(1960-an).
tilah ini makin populer sejak diketemukannya proses diffusi
Dari sudut botani, diffusi adalah perpindahanzat padat dari daerah yang
kadar zat padatnya rendah. llmu terapan memberikan definisi yang praktis.
Diftusi adalah pemindahan(penggantian)nira oleh air dalam aliran yang
berfawananpada sel-sel tebu terbuka. Dari sini % sel terbuka dinyatakan
dengan % nira yang dapat dipindahkan (iuiee displaceability indea" DI)
yakni efisiensi pemindahannira oleh air, sekaligussebagai ukuran baik
buruknya pembukaansel pada persiapan pemerahan (eane preparation) '
'merupakan faktor terpenting
Pada proses diffusi, pembukaan sel
untuk mencapai HPC yang tinggi. Diffusi ampas memperlakukan tebu
dengan pemerahanawal {tanpa imbibisi), kernudianampas gilingan I masuk
ke diffuser, denganpernbeiian imbibisi. Ampas basahdari diffuser selanjut-
nya dikeringkan oleh gilingan (tanpa air imbibisi) sambil rnemerah pol
dalam sel yang belum terbuka. Nira gilingan ini dikembalikanke diffuser'
72

panas 80oc untuk rnenjaga suhu


diberikan sebelum pemberian air irnbibisi
kebanyakan mikrobia dengan
z0oc dalam diffuser:(tney,rnal,death point
w a k t u t i n g g a]l- 1 j a m ) "
dikatakan rendah'
HPS sebesar 94% atau kurang pada pros€s diffusi
HPS 4Toakan mening-
Pada gilingan konvensionalmaupundiffuser, kenaikan
rol gilingan). Berkenaan
katkan Hpc 1vo (setara dengan hasil kerja sebuah
'1981, HPS bersama
sejak
dengan ketetapan fakton rendemen minimum
kerugian keuangan
HPB I atau HPG I secara langsungakan rnengakibatkan
mencapainya'
besar-besaranbagi pabrik-pabrik gula yang tak dapat
yakni cara-cara Australia'
Penetapan HPS (W) ada beberapa rnacam
prinsip yan8 sama:
Hawaii dan Afrika Selatan.Semuanyameng6unakan
bobot Po! dalarn sel terbuka
(
- dapat b!el-<st!"aksideneanpembillsan) x 100
Hps (% sel terbuka,
bobqt Pol dalam tebu
"pol bebas", maksudnya sakarose
Pembilang seringkali diistilahkan
sudahtidak lagi dikurungdalan, dinding sel'

d Metode Penrbukaansel Australia

Pembilasan:
(10 k$ dirnasukkanke dalam kaleng (11
Tebu cacah (1 kg) dan air
(twnb\er,/, diputar (70 rpm)
Setelahditutup, dipasangpada wadah
(P1)'
10 menit' Dilakukan pembacaanpol ekstrak

Disintegrasi:
(6 kg) dimasukkan ke dalam disintegra
Tebu cacah (2 kg) dan air
pisau-pisau('15
dan diekstraksi 40 menit. Disintegrator memiliki
Dilakukan
dan ber.larak1,3 cm, berputarpada 5 600 rpm'
pol ekstrak(F2).
Pr
= 7,?Pl4 el(s!r3$.t,YTb'l-e'l::::r:
= (ratio pl/pzj'
fr TWI ekstrakdisintegrator
t ool dalam sel terbuka x 100 = Yosel terbuka
HPS a

= 1000r
ffi8TTFSr
i'rtd'es (PI) '
Di Austraf la HPs {Vo sel terbuka) diSebutpreparation
73

perhitungan,
Tanparnelakukan dibacadengannomogram
HPSdapat langsung
di bawahini.

HPS \Vosel terbuka)


roo 90 BO 70 60 50 40 3o.2
" rilt rgr"ui'rut'trrr:!'rufuglu;ir41ut
,--J"rl,.ll'.",'.,,i1*rl'u
,44 r35 ,30 ,2$ ,24 ,15
nlrtio
P l,P2)
\ I
\
$ t
-'.rt:Ls
'tg.,;.$)Y'
tO
uN
\
I
!

-rr-I-r'T-t-'l
Trrn-rrrrrn+rl-n-rrrrrrrTli
2 3 4 5 6 7 8 9 1 0 1 1 1 2 1 3
tr Pembacaan pol tumbler (P1)
Gambar 8. Nornogram pol dalarn sel terbuka % pol tebu

D Metode indeks penggantian nira Hawaii

Pembilasan:
Botol plastlk 4 - 5 L diisi tebu cacah hingga separo isi, kernudiandiisi
'15
penuh dengan airo digojog tiap 1 - 2 menlt selama menit. Cairan
dituang, dianalisis% brix refraktometrik dan % Wl"

Disintegrasi:
lsi botol dipindahkan ke dalam disintegrator, rnenggunakan300 ml
air untuk membasuh botol. Disintegrasi dilakukan 15 menit" Ekstrak
dianalisis% brix refraktometrik dan Topal.
t dibilas
x ' 100

Metode indeks penggantian nira Afrika Selatan


$ikensangkan dari diffusi ampers)
Pembilasan:
Air (3 kg) dan ampasgilingan pertama (0,5 kg) dimasukkanwadahplastik,
74

'100ml ekstnakdiambil untuk analisis


dlcampurl,diputar selama 30 menit,
% pali,,menggunakan bahanpenjernihO'2 gPb asetat basa'

Disintegrasi;
AmpasIdianalisisvqpo|dan%airmenggunakancaraseperti|azimnya
menggunakan
(l55CT). Polarisasidiperoleh denganekstraksi secaradingin
disintegrator.

,,n. = (3000+5Yva)
Ht') - P e
tt1165: p")*^ 1 0 0

pa = le Pol amPasgilingan Pertama


pe = %Polekstrak
wa = % air amPasgilingan Pertama

dl Metode l55CT

Tidak|ahmudahmengambilcontolrtebucacahsecaramuwak
Contohtebudiambi|cukupbanyakdenganember.Di|aboratoriumconto
dicampur,ditebarkanpadabidang'dataryangbersihdenganteba||apis
misa|nya:sete|ahditebarkan
5 - 7 cm, Kemudiandi|akukansub-sanpldng,
dicampur, ditebarkan' * baBian
dibagi empat silang, 25% contoh diambil,
&ri25%contohdigunakanuntukana|isis'Pekerjaandi|akukanduak
untuk dua contoh (pernbilasandan disintegrasi)'

Metode botol berPltar

Pembilasan;
(3 kg) dimasukkanbotol Plastik, diPasang
Tebu cacah (0,5 kg) dan air
menit' Ekstrak disaring,dilaku-
pada kerangka khususndiputar selama 30
(81)'
kan pembacaanbrix refraktometrik

Disint€grasi:
disintegrator' diekstraksi
333 g tebu cacah dan 2 kg air dimasukkan
pemb""a"n brix refrakto-
selama20 nnenit.Ekstrak disaring, dilakukan
metrik (82).

HPS= 100B1/B2
75

(eane pneparation)
Di fndonesia,pengawasanterhadap persiapan pernerahan
luput dari perhatian dan belum dibakukan.Mengingatpentingnyapengawasn
pernerahan awal (apalagi dikaitkan dengan faktor rendemen minimum
yang "unik"), maka Penulismenyarankanagar setiap pabrik gula melakukan
(khususnya
anafisis % sel terbuka, untuk itu perlu memiliki disintegrator
Elgin type eoLd disintegrator, irka tidak alat buatan dalam negeri)'

Crusher bukan pesawat perusak yang baik. Pisau-pisautanpa disertai


shredderpukul bekerja kurang memuaskan,Tiga set pisau boleh jadi hanya
memberikan HFS serendah60%, tetapi sebuahunigrator dapat memberikan
'
HPS 70 - 8O%" Sebuahhsrmer shvedder yang rnengikutidua set pisau akan
marnpu rnemberikan HFS sampai 95% tergantung dari ukuran pemukul
dan jumlah tenaga yang dipakai. Hugot menyarankan instalasi gilingan
-
terdiri dari dua set plsau, sebuahshredder pukul dan 15 18 rol gllingan
ttergantungkapasitasyang dikehendaki).

2. Fhsilguna pernerahan bnix (HFB)

Bnm in^
H P B ( t o t a l =) f f n 100

=Uffia x1oo
= lbnln -x 1nn
ruu
Ti-

t-tPEI w.
tb,nry
100

bt
* 100
Inqg * roo
nt

tnp=
p ryx1oo=ffi*Pn1oo :
= bnm-bgf*r*,r,,
Eiffir-bnpt
Cara lain untuk menghitungHPB pemerahanawal;

H p B t =W x Ei# " 1ffi


- HPB
.8i'F#ffi
76

u1000 jalan ke Rotrna" dan


Dalam llmu Pengawasan dikenal ada
"berputar-putar", narnun
perhitungan yang dipraktekkan seringkati'
pacb asasnYa:

H P B = f f $ - * P s HPBI= ry x 100

pengawasanmungkin dapat
Secara teori, perhitungan sebuah angka
pun perhitun8an seringkali
dilakukan dengan pelbagai cara. Dalam praktek
"terlalu
yang dilakukan
dilakukan tak langsung, Perhitungan-perhitungan
(biaa) terutama pembulatan
jauh dari data asli" akan mengundangkesalahan
angka.Contoh:
HPB='l00BnmlBtlebihbaikdaripadaHPB='l00tbnm/bt
= 100 tpnm/pt
HPG = 100 Pnm/Pt lebih baik daripada HPC
FM=Fm/BGm|ebihbaikdaripadaFM=HKm/(.100-HKrn)

Dilndonesia,efisiensipemerahanniradinyatakandengan
PSHK bukanlah
FsHKnm/npp x HPB/100 = 100 KonmlKot. Sebenarnya'
hieeing LinH. HPB
angkaefisiensi, tetapi sebagaijembatan matematik
pabrik gula lebih baik
merupakan angka yang kurang bermanfaat. Untuk
denganHPG.

3. l-hsilguna penrerahan gula fiPG)

HPG tidak lain adalah hasilgunapemerahanpol'

Hpc=?,tx1@

pokok dan
Dalanl sistem pengawasan l55CT, F{PC merupakan angka
rnefiduduki tempat terpenting dalam pengawasan gilingan' HPG
pabrik gula'
bersama-samaefisiensi pengolahanmenyusunefisiensi
}tterall recouerly = estraction x boiling house reeouery/l00
(nPG = HPC x nF)

hueral,L recouerU esg = eitm,ction x BHReag


IRPC = HPC x RP)
77

PenetapanHPC I ada 2 (dua) cara:

1. Melalui analisisampasI Qa1 dan zkal)


selanjutnyadianggap:

ba1= *HF
HKal = HKn2sehingsa
fa1 = zkal-ba1

"t " , l = 100 ft, dan tnpp='100-ta1


ffx
tpnpp=
EtrxtnPP

HPct=*Po 1oo

2. Tanpaanalislsampas I

a. Menganggapbahwa ton nira mutlak yang diperah oleh tiap-tiap


gilingan sebandingdenganton pol yang diperoleh:12
NPP pnm - pnpl
=
Nfrl- FnpP-*pnFT
. pnpp = pnpp (pnm- pnpll - elpp
NP_P
NM . pnm pnm (pnpp- pnpl) Pnm
Pnnn Pn- Pnnn
HpC |
-
Tr*x 100= d* * ffi x 100
= Hpcxffi
Walaupuncara ini disarankanHugot sebagaialternatif cara 1, namun
anggapan yang digunakan terlalu jauh dari fakta. Pol terdistribusi
sangat tidak merata dalam nira tebu, sebagaimanatelah dibuktikan
dengan pemerahan kering oleh, batene gilingan, atau penurunan
HK yang menyolokdari nira gilinganl, Jl, ....., akhir.

b. Menganggap ton nira mutlak yang diperoleh sebanding dengan ton


brix yang diperoleh. Cara di bawah ini diturunkan dari neraca stasiun
gilingan rnenurutmetode brix:
78

NPP = #
bnm - bnpl
Nrd- bnpp - bnpl

pnno (bnm - bnpl) Pnpp


= - - = -
pnm (bnPP- bnpl) rnm

H p c l= W . 1 o o = W - f f i x 1 @
-
E HpG x^ PnPP,lFnqt PnPIJ
pnm bnpp - bnpl)
Cara ini lebih teliti daripadacara a.
Pnrn
(HKnm) Pnpo HKnpp (HKnm - HKnpl)
Fffi*=m
H p C =l r y x 1 o o
=ry-mx1oo
Fnpp Pnpl
(HKnpp) (HKnpl)

(HKpE - HKnP!)
H P C I = H P CHKnpp
xIffi

Cara ini lebih teliti daripada cara a dan bn walaupun tidak sebaik cara
4

Cara 2.a, b, dan c dapat diperbandingkandengan contoh perhitungan


berikut:
pnpp 13,57 pnpl 6,77 pnm 1A,78 HPC 95,21
bnpp 17,54 bnpl 9,53 bnm 14,30
HKnpp HKnpl 7A3O HKnm 75,3&
.77,37
a. HpCt = HpC
r xA P - n P(pnpp
Pjenm-PnPll
- pnpl)
pnm
= e5,21
^" 12,sJ119,7,9 = zo,6q
10,78 fi3,57 =2'714"'
- ee!t, =s===

x PnPP"(bnnL-
b. HPC I = HPcJ A PIPII
pnrn {bnpp - bnpl)

= g s ,' '2 Ai t x f f i(17


= \ o -, zrvrt
TE s====
1A,78 r54
HKnpgJHKlm-.HKnpl)
c . H F C I = H P G x FK-m (HKnpp- HKnpl)
77,37V5,38'7034)
* 95,21 x
m= 70,22
79

Dalann llrnu Fengawasan sering di.iumpai hasil-hasil perhitungan


yang hampir sama pada cara-cara yang berbeda. Walaupunselisihnyakecil,
seringkali filsafatnya jauh berbeda. Dalarn kasusdi atas, perbedaanfilsafat
masih tengolong kecil; Perbedaan filsafat yang besar dapat dilihat pada
perhitungan HPC (total) direduksi, yakni diperhitungkan pada standar
rnutu bahanbaku yang telah disepakati

Angka-angkaHPG, belum dapat digunakanuntuk tujuan perbandingan.


Suatu perbandingandapat dilakukan apabila semua faktor yang mempenga-
ruhi adalah sama, kecuali satu, yakni faktor yang diperbandingkan.

Andaikata mutu tebu yang dikerjakan oleh semua pabrik gula adalah
sama, maka FIPGyang diperoleh akan dapat saling diperbandingkan.Konsep-
"masalah andaikata" tersebut adalah Noel
tor pertarna yang memikirkan
Deerr (1932), kemudianMittal {19621,Rein (1975),dan Ugale (19S0).

a. t-lPC12,SNoel Deerr
Noel Deerr menyatakan mutu tebu dengan kadar sabut" la memilih
kadar sabut tebu 12,5% sebagai angka yang normal dan dapat dijadikan
standar untuk perbandingan. HPG12,5 adalah HPC yang diperhitungkan
(direduksi) andaikata kadar sabut tebu 12,5Yo,Dengan rnenganggapbahwa:
1) Brix dan pol terbagi merata dalam nira tebu (dalannhal ini adalah nira
mutlak, ISSCT).Ton brix dan ton pol yang terperah maupunyang terting-
gal dalarnampasadalahsebandingdenganton nira mutlak.
2) Kehilangan pol, brix dan nina mutlak dalarn ampas tiap satuan sabut
adalah konstan,
(100- HPCI) (100- ft1) - HPC2)(100- ft2)
T = (100
T
(100- HPG)(100- ft) (100- '12,5)
{100- HPC12,5)
T
= W

(100- HPC) (100- ft)


F|PC12,51,'gp= 100 - T
80

b. HPG12,5 Mittal

, Mittal memperbaiki hipotesis Noel Deerr. Anggapan bahwa pol


, terbagi merata dalarn.nira mutlak ditiadakan. SelanjutnyahipotesisMittat
' menyebutkan; "Kehilangan pol dalam ampas tiap '100pol tebu tiap satuan
sabut adalah koRstan".

100- HPG12.5
100- HPC = -W-
.ft

14= 100- l&I#..HPC).


HFG12,5

C. HPG2,S.1Z,S lt{oe! Deerr - Ugale

Fakta menunjukkan bahwa tebu-tebu yang kadar sabutnya sma'


tetapi kadar polnya berbeda, akan memberikan HPG yang berbeda pula.
Tebu yang miskin gula, akan memberikanHPC rendah.

HPG12,5.12,5 adalah HPC direduksi pada kadar sabut tebu 12,5%


dan kadar pol tebu 12,5%. Llgale menambahkanpembagi 7 + pt/100 kepada
persamaanNoel Deenr.

(100 - HpC) (100 - ft) _ (100 - HPC12,5.12,5,t100 - 12'5)


@ =

-
- {100- HPC)(100 lt) Q,1251
NDU = 100
HPG12,5.12,5

d. HPCp,S.l2oS Mittal - Rein

Rein membuktikanbahwapengaruhpot tebu terhadapHPG merupakan


hubunganberpangkat. la rnenambahkanfaktor pt0'6 pada pembilang dalam
persamaanMittal.
(10o:xl!4l4f (100- HPCqs.rz,s.)
12:50'6
--ft _
=

'100 - 5 (100 - HPC)


-Tt -W', pt .0,6
MR =
HPC12,5.12,5
81

, Menurut Rein, HPC12,5 Mittal kecuall lebih sederhana,juga lebih


dapat. dipertanggungjawabkandaripada HPC1215 Noel Deerr. Hipotesis
Noel Deerr paling sesuaiuntuk HPB.

Untuk HPG12,5 Hugot rnenyarankan rumus Mittal. Untuk


HPC12r5.1215 ia menyarankan penggunaan rumus Mittal-Rein. Dalam
menerapkansistem (pengawasanISSCTdi lndonesia,laporan 15 hari pabrik
gufa (model LP1) masih menggunakanHPG12,5ND yang sudah l<adalu,nrea
(out-dated).

4. Perbandingan setara HK FSHK)

Apabila suatu nira diencerkandenganair, maka kadar pol dan brixnya


akan berubah (menurun) tetapi kemurnian fiK) nira akan tetap. Demikian
pula kristal dapat diperoleh dalam 100 nira akan menurunr tetapi setara
hlK $FlK) retap.

FIK = Px100
D

sHK = Sx100=E!l,6hd*10o
'1,4
= HK - 40

Setara HK tidak lain adalah kristal dapat diperoleh tiap 100 brix. pSHK
nm/npp didef inisikansebagaiberikut:
"100
PSHK nm/npp ' ko nm/bnm x ' 1 0 0
100ko npp/bnpp
= 1,4.5K nm: 4_0x 100
'i,4 HK npp - 40

Jika 1 kg nira (brix 18, poN15) diencerkandengan1 kg air, maka:


nira sebelumdiencerkan:
hablur dapat dipenolehdalam -100nira = '15- 0,4 (18 . '15) = 13oB

setaraHK = ff x 100 = 7G,67


nira setelahdiencerkan:
habfur dapat diperolehdafarn 100 nira = 7,5 - 0,4 (9 - 7,il = b,g
setara HK =V x100 = 76,67
tak diencerkan= 7,9,%^x 100
PSHKnira diencerkan/nira = .r00.
76,67 '."
82
: ,! ,

(tanpa imbibisi)
Fada pemerahannlra, nira tebu diperah secaraker:ing
(dengan imbibisi)' Npp tidak
clilanjutkan dengan pernerahan secara basah
yang diperah secara basah
lain ialah nira tebu tak diencerkan. semua nira
adalah nira tebu Yangdiencerkan.
mengalami
Selama pernerahannira, sakarosedalam nira dan ampas
perpecahan
perpecahan baik. secara kimia rnaupun biokirnia. Fenyebab
= konsentrasi asam yan8 tingSi)'
kimia ialah suasna asam tpH rendah
invertase
Penyebab perpecahan secara biokimia ialah bekerjanya ensim
yang mengurai sakarose nrenjadi glukose dan fruktose. Ensim invertase
jasad renik (mikroorganisme)'
berasal dari tanaman dan juga dihasilkanoleh
sudah tidak lagi
Setelah tanaman ditebang, tanaman masih hidup tetapi
mempertahankan
mengadakanasirnilasi gntuk pembentukansakarose'Untuk
hidupnya, sakarosesebagai makanan cadangandipecah dengan mengaktifkan
plus tena8a'
ensim invertase untuk menghasilkan glukose dan fruktose
serang-
Clukose dan fruktose selanjutnyadiuraikan lagl dan setelah melalui
perpecahan ialah air
kaian reaksi yang sangat rumit, hasil terakhir dari
yang diterangkan di atas
dan co2 plus tenaga. Ferpecahan-perpecahan
secara ringkasdisebut pengasaman.
dan sel-sel
Seandainyapol dan Lrrix terbag! merata datanr nira tebu,
gilingan tidak
tebu mengandungnira dengan susunan seraBarn, serta'di
= IAATodimana HKnm
terjadi pengaffiman maka PSHK nm/npp mestinya
= f-lKnpp.
misalnya
Usaha-usaha sanitasi gilingan (pemberian desinfektan
berat tembaga/
larutan forrnalin, eane rni,Lling aid, salurannira dari logarn
akan membunuh/me-
stainlesssteel, penyemburanair panasluapbertekanan)
akan meningkat' Tetapi
nekan kegiatan mikroorganisme, sehingga PSHK
kegiatan ensim
sanitasi seperti itu belum tentu mampu memberhentikan
protein, maka jalan yang
invertase. Oleh karena ensim tidak lain adalah.
yakni pemanasanuntuk
nlurah untuk rnernberhentikankegiatan inventase
sakarosa secara
menggumpalkan protein. Penekanan terhadap perpecahan
secara cepat'
kimia diusahakan dengan rnelakukan operasi pemerahan
gilingan, selanjut-
nira-nira yang diperah lrarus segera ke luar dari setasiun
pH.
nya dipanaskandan dibubuhisusukapur untuk menaikkan
83

Sanlrasi gilingan tidak mungkin untuk meningkatkanPSHK mencapai


harga 100. Kecuali dari sebab yang telah diterangkan di atas ,iugakarena
faktor anatomi tebu. Kadar sakarose dan HK nira tebu dalam sel satu
dan lainnya dalam jaringan tanarnan satu dan jarlngan lainnya tidakhh
sama; % pol dan HK nira dalam batang tebu bagian bawah, tengah dan
atas, anta!'a ruas dan buku, antara parenchyrn,cortex dan kulit berbeda-be-
da. Pada pernerahanawal (secara kering) hanya sel-sel tua dan mudah
pecah yang mengandungnira dengan kemurnian tinggi yang dikerjakan"
Sel-sel tebu yang sulit pecah, kenasdan mengandungnira denganHK rendah
baru dapat dikerl'akanpada gilingan-gilingandi belakang(pemerahanbasah).

PSHK hanya nnerupakankriteria (pertanda)adanya kehilangankristal


di gilingan dan tidak dapat n'renyatakankehilangankristal secara kuantitatif"
Dilihat dari rumus Hornmes, PSHK tidak lebii'l merupakan faktor koreksi
'LinW
sebagaijenrbatanmatematik (misaing antara kadar nlra tebu dan
HPB di satu pihak dan rendennenWinter di lain pihak, Hal ini akan menjadi
jelas dalarn uraian mengenairendementebu dan faktor rendemen.

Kecuali PSHK nr"n/npp,pabrik gula juga menghitung PSHK npf/npp


dan PSHK nga/npp yang harganya sudah barang tentu jauh lebih rendah
daripadaPSHK nm/npp"
Sementara praktisi menyebut PSHK sebagai petunjuk prestasi tebangan
dan angkutan.Dari sudut organisasi(nanagement) pandangan ini adalah
menguntungkan untuk memupuk kerjasama antara semua bagian sektor
produksi di pabrik gula. Ditlnjau dari sudut teknologi, pernyataan tersebut
tidak benar. PSHK tidak lebih dari jembatan matematik. Rendahnyamutu
tebangan (tebu kotor, batang terpbtong) dan pengangkutanyang terlambat
akan nnemperbesarkegiatan ensim invertase dari tanaman untuk memper-
tahankan kelangsunganhidup batang tebu yang sudahditebang. Keasarnanan
nira akan meningkat (pH turun) cJaninfeks! jasad renik juga meningkat.
Selarna pernerahannira, kondisi tersebut akan rnempercepatreaksi-reaksi
dan menurunkanh3rga PSHK.
pe'nga$aman

Apa yang telah diuraikan merupakan pengertian-pengertian yang


sudah terlanjur tertanam di dalam praktek" FSHK hanya sedikit gunanya,
lebih banyak menyesatkanpengertian. Sanitasi gilingan paling tepat diukur
dengan analis!s resazurin, atau kapasitas buffer, atau jumlah rnikroba
B4

'
antara nira crusher/npp dan nira mentah. cara meningkatkan PSHK

dapat dilihat dari rurnusnYa.

=
nm/npp
P5HK x'loos 1oo
##[ffi
I atau
Dengan mengintensifkan pemerahan awal, hingga diperoleh HPG
HPB I 7O% atau lebih, maka HK npp akan turun, dan PSHK meningkat,
kadar
sekaligus dibarengi menurunnya nitai nira npp dan meningkatnya
nira tebu.

B. - PengawasanGilingan Individual

pengawasangi I ingan individual bertujuan mengukur prestasi/efisiensi


tiap-tiap gilingan, berturut-turut adalah:
- HPB l, ll, ' . . . .' akhir
- Crafik brix
- HPC l, ll, . . , ' ., akhir
- PSA (perbandingansisa ampas)l, ll, . ' ' ' r, akhir
- HPA (hasilgunapemerahanair) l, ll, ' ' ' ' ', akhir
- imbibisi) dan faktor campur'
HPI (hasil6una'percampuran
pengawasart
HPB individual, grafik brix dan PSA individual merupakan
hanya
yang murah, karena, dibandingkan dengan pengawasan bersarna'
(- nira) sesudah gilingan
memerlukan tambahan data analisis brix nira
dengan brix nira gilingan
ll hingga sebelum gilingan akhir (lazimnya cukup
ilt).

PengawasanHPGdanHPAindividua|biayanyamaha|.Niradan
ampasdaritiap.tiapgi|ingandianalisispo|danbrix/zatkering.

1. HPB indivicfrral

Neracastasiungi|inganmenurutrnetodebrixte|ahmemberikan
dan nira tak diencerkan'
keteranganyang cukup tentanSpemerahanbrix
Jika,
NT = ton nira tebu (tak diencerkan)
NPP = ton nira PemerahanPertama
85

NTn2 = ton nira tebu dalanrnlra gilingan ll berasaldari ampas 1


NTn3 = ton nira tebu dalam nira gilinganlll benasaldari ampas2
NTn4 ,ton nira tebu dalam nira gilingan lv berasaldari ampas3
l,
NTn5 * ton nira tebu dalam nira gilingan V berasaldari ampas4
maka,

HPBt = wx100=g#fi#x100
HpBt = Sx'100=-$x'100
NTn:
;4pg1 = #x-t00

HpBgr= Wx100

tv = $pn roo
HPts
NTnc
HPB V = - "' a x'1 0 0

HPB
jumlah = HPB| + HPBll + HFB lll + HPBlV + HPBV

= W*loo=\,Fx1oo
tntnm
= -':;il*' x 100

Karena HPB l, !*lPB ll,


junrlah (total), maka angka-angka tersebut merupakan HPB individual
partial. fnilah yang biasanyadipraktekkan.

HpB individual nnandiri dapat dihitung'berdasarkankeluaran tiap


100 masukandari tiap-tiap gilingan'
- 100 (NT - NTal)lNT
F{FB6 | = 100 NPP/NT
"10o "100(NTa1 -'NTa2)/NT.a1
HPB- rr = NTn2/lrl1'a1=
'100(NTa2 - NTa3)/NTa2
HPBm lll = 100 NTn3/NTa2 =
HPB6 lV = 100 NTn4/NTa3 = 100 (NTa3 - NTap/NTa3
HPBm V = 100 NTn5/NTa4 = 100 (NTa4 - NTa5)/NTa4

HFB individualmandiri disebutjuga HPB unit'


86

2. Grafik fturve) brix

gilingan individual HPB l, ll, lll, . i . . .r HPG l, ll, lll,


Perigawasan
+ . , . ., dan HPA !, ll, lll, sulit, jika tidak, biayanya
. perhitungannya
inahal. Crafik brix adalah pengawasangilingan individual yang terrnudah
dan termurah, yang dapat mewakili pengawasangilingan individual dan
faktor campur.

Grafik brix disebut juga kurve brix. Secara teori, brix-brix nira
dari tiap-tiap gilingan apabila dihubungkan dengan garis, dalam grafik
akan membentuk garls lengkung(kurve). Crafik teoritis selanjutnya diban-
dingkan dengangrafik didapat dari brix-brix pengamatan,akan memberikan
petunjuk gilingan mana yang bekerjanyakurang baik.

Sernuabrix nira gilinganbasahsecarateori dihitungsebagaiberikut:

_1
bng= bn1 x ^ ( x B ) + 1 - B i
-1
1(Xg)+1

!i = l/F yakni air imbibisitiap satuansabut.


bn; : 7obrix nira gilingan basahke-i
bn1: % brtx nira gilingan pertama (bnpp)
rg : jumlah gilinganbasah
gi : gilinganbasahke-i
Rumustersebut hanyaberlaku bagi sistem imbibisi majemuk.

Misalnya batere gilingan terdiri dari lirna gilingan, dengan sistem


imbibisi wa4, n5a3, fiQalt nJa'lr nrr'l= n1 + n2. Dari pengamatandiperoleh
data:
air imbibisi Totebu 24,01 brix npl (n2) 8,96
kadar sabut tebu 13,74 b ri x n ir a gil. lll 7,47
brix npp (n1) 17,16 b ri x n ir agil..lV 4,51
brix nira gil, akhir 3,45
Cilingan ll adalahgilinganbasahke-1
G i l i n g a nl l l a d a l a hg i l i n g a nb a s a hk e - 2
Cilingan lV adalah gilingan basahke-3
GilinganV adalahgilinganbasahke-4
rii,irii,rr+liilll jdguffi
j$lffi jfli
't7

iI-i*iffi * tH
i[Hil
*
il
ilffi |
ffi
ffi
r'itiiiitr['flil
ffi
ff Nl
l
i:ii
16
'i, i[i[i' ill illlii
|-'rriffi *l
il'ti iiiti'il
iiilli' l ill iillllii*l
i ffiffi
l'ii
15

14
[lflJiii1i1liiU'
,,l'.l-''1t1ry,1'rixf
lr,]1il lliHlLir
|llirl
1i,ilil$ii il
13

% brix 12 i-
i: l,
ii.
i'i
ii i'
irii r,
i,'
1;
I
i-'ii,'l-i*:i-,i:\\:i;::ii:i;l'rl,:lui:tlrii:rl*ifrilmi#iitiliriiii
pJj*|g*-iil*
j:L
[1't,ii .i:,ii.\r iliii
11

a ,'\
i:i'liil r[jrill.
l.ii,i t*lt 1.'1
;u1r,'rili
iiriil,.l
i
i,
.'.i., 'r',.i
IU

I :,i'.,,i,. ,l...i
rr,iri.j|rLi;ii[;iiiii'
'ii'.r,i'
i'.i.i, .i.i$;;,j,
ti
9

B
l,1-i.,ii,11,
i
It:tr',I]--.1 fffifurilrilrii-* iii'iiriiri.
ii',,i',ilffii.i,'iii,,i;,;iiLr,ir..riiiiixri
_'-,.,i-,,i,-i,i,i,-
Il 1.=:l..
i,\,.i.,i$rii,iir;,i'.i'rir,l,,ir
,Nrii
,i,,i'..i1,i
1,,'i.i.i,,;'. lffiiiiri'ri'ri,illii.i,.i,
,
I i, t,-,,,i .t,;,,
i,i,, ,i.'.'N'i :.i:i,,.ii, i
i:,.iV- ',i
i
l : i .' i.r. iri' 'i'i i l , i ' . N l .:f:fii ,
I i i i i ,i i , ;i , ;i ,r : ,N i : ri.. '
' i
i ; i
1,;1,1riliiriir'ii'f
i.,,.,, i'itliil , i . l .
li,i :
i l
. 'l i
: i
{it; i '' i'ti
C i f i n g a n 12 3 q 5

Gilingan basahke- 1 2 3 4

Cambar11.Crafikbrix nira-nira gilingan


B8

= = 1'7475
ffi
1,747s4*1'1- 1
bn1 = 17,16x = 9,34
^4+1 - 4
lr I

bn3 = 17,16x
1,747s.4+.1-'2
-- 1. = 4186
1,747s4*1

bn4 = 17,16x
4
I ,uru4+1'3- , = 234
- 1
1,747s4+1
A+1-A
bn5 = 17,16*W = 0,84
1,7475-"- 1
Agar perbandingan antara teori dan praktek menjadi tebih jelas, rnaka
disusunlahgrafik brix nira-nira gilin6an, Dalann hal bnix nira yang didapat
lebih besar daripada teorio ini n'rerupakanpetunjuk bahwa percampuran
imbibisi dan nira dalam ampas kurang merata. Jika sebaliknya,maka lubang
kerja/setelangilingan terlalu lebar.
Crafik brix nira-nira gilingan diturunkan dari anggapan bahwa ton
brix yang terperah sebandingdengan ton nira yang ke luar dari gilingan;
dengan perkataan lain brix dianggap terbagi merata dalam semua sernua
bagian nira tebu, yakni brix npp = brix nira tebu"

Penerapangrafik pol nina-nira gilingan denganrumusn:

^(r$+1-8i - 1
pni =Pfii x;ril;T--;

pensurtd?hg keberatan-keberatan karena anggapan yang digunakan terlalu


jauh dari fakta. Pol yang terperah tidak sebanding dengan nira yang
diperoleh. Pada penelitian pemerahan secara kering dengan beberapa
gilingan, brix nira-nira gilingan relatif konstan, cender'ungagak menurun.
Pol dan HK nira menurun secara menyolok. Fenurunan HK pada gilingan
komersial juga membuktikanbahwapol tidak terbagi merata dalam nira"

3. HPG individua! rnetode l55CT

Anggapanyang diperlukandapat dilihat pada Bab lX {Neraca).


89

HPC individualkumulatif:
HPG I 100(iPt- PallPt
HPG II 100(Pa1- Pafi/Pt
HPGIII 100(Pa2- Pa3)/Pt
HPC IV 100(Pa3- Pa4|lPt
HPG V 100(Pa4- Pa$/Ft

HPCjumlah= 100Pnm/Pt

HPCindividualrnandiri(unit):
l*lPcm| = 100(Ft - Fa)/Pt
l"fPGmll = 100(Pa1- Pafl/Pa1
HPC* lll = 100(Pa2- Pa3)/?a2
FiPCmlV = 100(Pa3- Pa$/Pa3
HPC* V ='100{Pa4- Pa5)lPa4

4" hlPC individrnl rnenurutrnetodezat kering (arusbahan)

HPG individualkumulatif (misalnya5 Bilingan):

HPGI = + F Px 1 o o
Pa.r- Par
HPc ll = --bf-: x 100
t o

t Hpclll
Par - Fac
=__:Fr:x100

Paz - Paa
HPC lV = -:Ffr x 100

F|PGV = tuo;=t"-l * ruO

. Pnpl: + Fa1 - Pa5


HPC jurnlah - -T. : 100

Pt - Fa5 pnrn
=__Ftix.l00=ff* 100

HPC individuaimandiri:
HPC*I = 100Pnpp1Pt
HPG6 lf = 100 (Pa1 - Pa2)/Fa1
HPC* llf = 100 {?a2 - Pa!/Pa2
90

HPC* lV = "100(Fa3- Pa4)/Pa3


HPC' V = "100(Fa4- Pa5)/Pa4
lanjut=100(Pa1- Pa$/Pa1
HPCpemerahan

Cara arus bahanadalah sangat teliti, tidak hanya untuk HPC indi
al, tetapi juga untuk sembarang efisiensi gilingan. Namun cara ter
clipandangterlalu rnahal. Cara yang agak murah, tetapi rnasih mahal,
metode l55CT; semua nira dianalisis pol dan brix. Semua ampas diana
pol dan zat kering.

5. Perbandingansisaampas(PSA)

Angka PSA (perbandingansisa nira tebu dalam ampas) digunakan


sebagai ukuran kekeringan ampas. Pengukuran dengan membandingkan
sisa nira asli dalam arnpasyang sesqngguhnya
terhadap sisa nira asli dalam
ampas yang dipandang normal {pantas) sebagaimanayang tercantum dalam
Tabel lA dan lB Bulletin 4.

Kebanyakan pabrik rnelakukan pengawasanbersama di mana PSA


yang dihitung hanyalah PSA I dan akhir, masing-masinguntuk menyatakan
kekeringan ampas dari gilingan I dan gilingan akhir. Pada pengawasan
gilingan individual, PSA dari tiap-tiap gilingan dihitung. Angka-angka
kekeringan ampag yang diperoleh digunakan untuk menilai prestasi kerja
dari tiap-tiap giNingan.
Harga tiap-tiap PSA dikatakanbaik bila < 100,. cukup
(nonrnal)bila PSA = '100,
dan.kurangbaik/buruk bila > 100).

Fenetapan PSA l, ll, lll, ...". dan akhir pada pengawasangilingan


individual memerlukan data anaiisis nira mentah dan semua nira gilingan,
untuk ampashanyalahampasakhir.

PerhitunganPSA l, ll, lll, ..,.., akhir menggunakanrumus


i umum:
pSA ke-n = l',liralsbu 4alam ampas k e-n 7osabut
trti." t 'x 1@
menurut tabel

Anggapan-anggapan yang digunakan untuk perhitungan bobot nira dan


ampas tiap-tiap gilingan (lihat neraca bahan) akan digunakan pula pada
perhitunganPSA.
91

Berikut ini diberikan cara-cara perhitungan PSA | - akhir pada


instalasidari 5 gllingan menggunakanimbibisi majemuk air a4, n5a3, n4a2
dan n3a1.

Yang penting diperhatikan ialah cara membaca tabel (fA dan lB


Bulletin 4, untuk mencari sisa nira tebu % sabut yang normal (pantas)
menurut hasil penelitian POJ tahun 1928. Dari persamaan matematik
yang c,tiketemukandibuatlah tabel lA dan lBo dan selanjutnya dituangkan
dalam bentuk grafik (Cambar 12)

Cara membacatabel/grafik Bulletin 4:


- Bila kadar nira tetru 6Wfa sabut dan tebu tersebut digiling dengan
'l
instalasi gilingan tanpa crusher yang terdiri dari gilingan, maka sisa
nira tak diencerkandalam ampasakhir % sabutnormalnya 218.
Bila tebu digiling dengan instalasi gilingan tanpa crusher yang terdiri
2 gif ing4n, sisa normalnya 107%sabut.
Dengan instalasi gilingan dengan crusher terdiri clari 4 gifingan, sisa
nira tebu yang norrnaldalam ampasakhir 32o3fosabut.
Dengan demikian tabel lA hanyalah digunakan untuk mencari sisa nira
tebu yang norrnal dalam ampas I dan arhpas akhir (untuk menghitung
PSA I dan akhir).
Untuk nrenghitungPSA ll, !ll, ...". sebelumakhir cligunakan
tabel lB.
- Dengan instalasi gilingan yang terdiri dari sebuahcrusher dan 4 gilingan,
maka dari tebu-tebu yang cligiling yang kadar nira tebunya berbeda-beda
(rnisalnya 400, 500, 600, 700, 800, 9007a sabut), maka sisa nira tebu
(nira tak diencerkan) clalam ampas I dan arnpas akhir dapat dilihat
pada tabel berikut:
Tabel 4, Sisa nira norn-raldalam ampas I dan ampas akhir pada pelbagai
.kadar nira tebu denganinstalasi crusherclan4 gilingan
-Niia
lebu Sisaninatak diencerLa!y_4ng
[rorma!_4!abg!-..-
._f: sahJrt-
" '143,0
400 28,4
500 164,7 30,7
't8'r,6
600 3203
700 194,4 33,7
800 2O3,8 34,6
900 2Q9,4 35,'l
92

+,
ll
{!
t )

\s
(,)
l!
o
E
ct
E
s

c
{g
J
L
o
U
g
.g
T'
J
(!
.|J

d
.:
z

o o o ( ) ( ) o o o q , Q ! ) Q ( ) a 9
O n ( ] t n o t n O t oc J r n
llf,
oo r \ 9 $ q
J .{' rf\ u.i \b \O N C\ C\ U O'-l
. { f l d

Nira dalam tebu Tosabut

Gambar:[2. Sisa nira normal datam ampas pada pelbagai kadar nira tebu
dan instalasigilingan
93

a, PSA| (awal)

Ntal = Nt - n1, sernuanyadipersenkanterhadap sabut

w \liTn'ppr
n r % s a b u t = ! f .1x0 0

rrnt
'100
-= -F bt/bnPP " 100

n1 % tebu
N1 = ur'a = -Ti-
sabut x 100
fffi)'n1fo
100N1/T
fn.1 =-?r- x 100

fntal = fnt - fn1

fntal)-
nira asli dalam ampas 1 % sabut (=
PSA I -- x 100
ilra Ailf dalam ampas 1 % sabut yang pantas
(normal)Tabel lA Bulletin 4

N2
PSAII

i *PP n3
l
{n

\q*F-/
Ntn2 N3
n2 (nPl) bnpp bn3

bnr - bna -
Ntn2 = p, .3Jl3-
- di mana N2 = NM N1
bnpp - bn3

Nta2 Ntal - Ntn2 (lihat PS'{ l)

fnta2 fntal - fnh2

= ffi
PSAII "
Tabel lB Bulletin 4
94

c. PSAlll

n4f
-?"rff
t {
L-y-, Ntn3
n3
bnpp

N3 - N 2 - N tn 2 (l i h a tP SAll)

bn3 - bn4
- N3.
\tn.3 bnpp - bn4

Nta3 = Nta2 - Ntn3

fnta3 = fntu2- fntn3

pSAlil = x 100
Tabel lB Bulletin 4

d. PSAIV
nE
L*oj5
pp
!LJ1/ t
n4

Ntn4 N5
'bnPP bn5

N4 = N 3 ' N t n 3 ( l i h a tP S A l l l )
bn4 - bn5
Ntn4 = tttc.6*ffi5
Nta4 = Nta3-Ntn4

fntal = fnta3- fntn4


95

(= Inta4) ,
PSA IV
nir3 qsli Slam,a.rnpas
t * '100
niraeCiidalamampas4 YangPantas
TabellB Bulletin4

e . P S AV ( a k h i r )

Karena amPas akhir dianalisis pol dan zat kering, maka brix dan
kadar sabut ampasdapat dihitung.

nta= Effi- x 1oo, = # x 1oo= lwx1oo


danfnta

pSAV= x100
T a b e ll A B u l l e t i n4

6. Hasilguna Pemerahan Air fiPA)

HPA merupakan pengawasangilingan individual yang mahal karena


setiap nira gilingan dianalisis pol clan brix, setiap ampas dianalisis pol
dan zat kering (untuk menghitungkadar sabut setiap ampas)"

HpA = lon alr kelual" x 100


ton alr masuK

=
air diperah % sabut -. 4^^
ffiA tvv
alr maSUK 7d SaDut

PerhitunganHPA rnenggunakan anggapan-anggapan:


a . Selain sabut dlperhitungkan sebagai air. Jadi, nira dianggap sebagai
ai r .
b. Perhitungan kadar sabut tiap-tiap ampas menggunakananggapan:HK
nira suatugilingan= HK ampasyangbersangkutan.

pu
pne = J-0.9
10-Q
n bng ba

ff" * { ,
HK'ns= .ry
ba dapat dihitung
L-\/FJ

nB zka=fa+ba
fa dapat dihitung
'100 - fa. Perumusan wa ini hanya digunakan
wa (kadar air ampas) =
pada perhitungan HPA saja. Untuk perhitungan lainnya, wa = 100 -
zka.
artinya ampas tidak
c. Semua imbibisi (airlnira) diperah keluar'gilingan,
membawaimbibisi.
sabut tebu = ton sabut
d. Dalarn semua Perhitungandianggap bahwa ton
setiaP arnpas.
=
F = Ft = Fa'l o Fa2 = Fa3 Fa4 dst'
Harus diingat bahwa:

tt*ta1*fa2*fa3*ta4'
air - a3'
Perhitungan r:{PA rnembutuhkanbagan imbibisi, misalnya
n 4 - a 2 ,n 3 - a 1 , n m = n 1 + n 2 .

il ill IV

l{PA dihitung dari gitingan akhir, kemudian maju (berpedornanpnda bagan


imbibisi).

d. HPA lV = .Nq . x 100, atau


Na3+l
N a 3 + l - Na4
100
Na3+l
It n a 3 + 4r. l - ,+n^ ^4 4
= x 10t)
fn"3 * fi

Rincian perhitungan:
'100
ba4 = Pa4lHKn4
ta4 = zka 4 -b a 4
97

= Fa4 =.Fa3 = Fa2 = Fa1 = P1

=# x A 4= % x ( T + I - N M K )
100 - fa4
^
Na4 = --Tm-- x /\4
Naa
lt fnu4=t'x100
I
lt f1 = 100
F-x
ba3 = 100Pa3/HKn3

fa3 = zka3-ba3

na3 = '100'fa3
na? '100
lt fn"3 = 1fr x
fn4 =f633+f;-fna4

c a t a t a nN: 4 = k * ,

N a 3= H * -
A4 = T+l-NMK

A 3= f f i " 0
nira gilingan yang sudahdibahas
Inilah cara menghitung ton ampas dan ton
pada Bab Vll.

Ne
b. HpAnt = -N+t-N-az x 1oo

= y * N a r - N a t
ffix100
rl+
= irj"lzr-rj""l* 1oo
Rincian:
= 100 Pa3/HKn3
ba3
'l3 - zka3'ba3
na3 = 100-fa3
98

lt fna3=ffi* 100
b2 = 1oo P2lHKn2

fa2 = zka2- baz

n a z = 1 0 0 -fa 2
na7
tl tna2 = x 100
6.
tt fn4 sudahdihitung

It fn3 = fn4 + fna2 - fna3

c. HPAll = -#g;1 x 100


Nar - Na2
= Il*
Tffix.'r00
t"*rY t"-
= x 1oo
t13 + ,fl4.1

Rincian:
lt fna2 sudahdihitung
ba1 = 'l0OPa1/HKn1

fa1 = zkal-ba1

. na1 = 100 - fa1

nuJ 'too
tr tn"1 =
Tt, *
{t fn3 sudahdihitung
-
fn2 = fn3 * fn"1 - fnu2

N.r
d. HpAl = -T.;- x 100

Nt - Na1 at
= --*1:x100

fnt - fnal
=ffx100
Rincian:
ba1 = 100Pa1lHKn1

ta1 =zka1 -ba'l

na1 = 100-fa'l

ll fna. = -1"1 x 1oo


' Ta1

Ft = F a 4= 44
#x
Nt = T-Ft
F+
ft =?* 100

nt ='100-ft

{t fnt =#* 100


fn.l =fnr-fnal

7" l-lasilguffr perclmpuran irnbibisi (HFl)

Efisiensiimbibisi(HPl)oleh Hugot didefinisikanB.

g
" = x100
brix diperah karenapemberian imbibisi
yang bercampur sempurna

Jika percampuran airlnira imbibisi dan nira dalarn ampas sempurna, maka:

t b{x nnasg! eiljlgan .. 4^^


= df6 brix
L
nira gilingan
t nira rnasukgitinefr x 100
5 % brix nira dalamampas
Misalnya:
8n3, N3 ll
;
Bn3 + Bnal
en"1,t
i"f fi Na2
-_--1,
x 100 = bn2
\z
->
N3 + Na1
C
\-r-J
O = bnaz

{,
N2
100

Bagan tersebut menupakanpenyederhanaandari metode Hugot yang mem-


perhitungkan ampas halus yang kembali ke krepyak arnpas. Jumlah ampas
diperkirakan, niranya dianalisis pol dan brix. Karena cara ini pun masih
kurangteliti, makaampashaluslebih baik diabaikan.

Jika imbibisi sama sekali tidak bercarnpurdengannira dalam ampas, maka


hanya airlnira imbibisi sa.ja yang diperah gilingan. Dalam bagan di atas,
maka: N2 = N3, Bn2 = Bn3 dan bn2 = 5nr.

Dalam hal percampuran imbibisi dan nira dalam ampas sempurna


(nraksimuml,% brix nira gilingan diistilahkandenganbn maks. Sebaliknya,
bila percampuransama sekali tidak terjadi, nnakabrix nira gilingan disebut
bn min, di manahrnmin = bn imbibisi(bni)"

'I = Hp! = Pn- ,- q!J-.x 1oo


Dn maKs- Dn!

Dengandata dari Bab Vll (Neraca)diperoleh:


tnu.l 34,21 rb".14,98 tn 1 51,85 bn1 17,16
tnr2 27,62 tb^z 3,85 tn2 42,85 bnz 8,96
'nu3 '19,18 tb"3 2,44 tn3 36,26 bn3 7,47
tnu4 16,99 tb"4 2,03 tn4 27,82 bn4 4,53
tnos 15,37 tb"5 1 , 1 4 tn5 25,63 bn5 3,45
t; 24,41

bn2 - bn3
a. l-lPl x '100
-
bn2 rnaks bn3

Bnar + Bna tbal + tbn3


bn2maks = 614: x '100= tnal + tna3 x 1 m

= ' 1
"t0,9
Wxloo=
= Bxg!;-H ^ .loo= 43
10,91- 7,47 x
r-'tPlI
101

bn3 - bn4
b. HPI ll =
ffix1oo
Bna2 + Bn4 tnnz*
bn3 maks =
ffi;lqt: x 1oo= ?I1 x 100
tnaz + tn4

=
_ 3,85+ 1,26
mTTw' r
.100= 9,22

HPI II =ffix'l0o=63
bn4 - bn5
c. HPI lll x 100
6fi1ffi;6;s
tbna3 + tbns
bn4 maks x 100
tna3 + tn,

2,4O+ 0,BB
Te;18-863 ^ 100 = 7,32

HPt ill = ffi." = 28


1oo
bn5 -
d. HPI IV x 1oo
' bn5 maks

bn5 maks ='on",o-"100


tna4 + ti
i

= '100
= 4,eS
ffi6rx
HPI IV =tg*.100=70
.Di lndonesia,ef isiensi imbibisi diukur dengan faktor campur (FC'
gilingan akhir, yang ha-
oennengi,ngsfaotofi. FC itu hanyaditerapkanpada
ampas'
nya menjelaskanpercampuranair imbibisi dan nira dalam

pol ampasteoritis
ijiku p"rq
pol ampas didaPat

data Bab vll


Berikut ini disajikan perhitungan FC individual. Dengan
(Neraca), dengan sistern imbibisi air a4, n5a3, n4a2 dan n3a1 akan dihitung
tanpa mengana|isis
FC l, |1, |l| dan |V, wa|aupun neraca tersebut disusun
ampasantara.
102

pn2 5,40 tu2 35,47 pa2 6,16


pn3 5,20 fa3' 44,06 pa3 4,60
pn4 3,06 ta4 47,20 pa4 4,04
pn5 2,25 ta5 49,82 pa5 2,56

&. FC | (derajad percampurann3 dan na1)

FCr pa2
-w-
pnz(100- faz) = 6,40(100- 35,07) = 67
(cf HPI | 43)

Pnr (100- fa3) = -T 44,09I = 63


s,30J_100_-
b. FC il = -:Gt-
(cf HPI ll 63)

Pna ('100- fa4) = - 47,2U


3,06 (.JOO = 40
= *
c. FC lll pa4- T
(cf HPI lll 28)

pn5 {'100- fas) 2,25 nOO- 49,82!


_-T_ = 44
d. FC IV pa5
(6f HPI lv 70)

Tabel 5. Faktorcampurdi Jawa(1941)

Banyaknya Air irnbibisi Faktor


lnstalasi cafilpur
gi!ingan pabrik gula lo tebu

10 14,4 63
4 gilingan
10 18nT 50

2A 14,5 56
crusher + 4 gilingan
26 17,0 48
31 18,7 46
13 21,4 43

5 gilingan 7 14,9 51
7 24,3 12
'i0 15,2 55
crusher+ 5 gilingan
I 18,8 41
103

Az,chief memberikankesimpulanyang keliru tentang faktor campur


(FC) dari data di atas: I'Perfimpuran air dan nira dalam ampas rnakin
jika jumlah
sempurnapada harga FC yang makin tinggi. FC akan menurun
nira yang terperah bertambah, jumlah air imbibisi bertambah dan ampas
makin halus; Hubunganini agak aneh, karena ketiga faktor yang meningkat-
kan hasil gula, justru memperkecil faktor campur. Karena alasan inilah
faktor campur digolongkansebagai angka untuk meneliti kebenaranangka-
angka pengawasn. FC yang tinggi rnenunjukkan penentuan pol a!'npas
yang terlalu rendah"(lihat Bab Vll,B).

Penulis bermaksud meluruskan pernyataan tersebut. Percampuran


air imbibisi dan nira dalarn ampas makin sempurna pada harga FC yang
makin tinggi. FC akan menurun dengan meningkatnya kepadatan ampas
dan kecilnya % sel terbuka. tli samping HPC, FC merupakanan6ka pokok
untuk meni!a.iefisiensi imbibisi. Anllisis pol ampas tanpa disertai pembukaan
sel '{disintegrasi},akan rnemberikan% pol.yangrendah,dan menipu/memper-
tinggi FC. Demikian pula angka HPC. Kebenaranangka-angkapengawasan
gif ingan dapat diteliti denganinfenentiaL method (lihat BabVll, C).

Pandangan tentang meningkatnya jumlah air irnbibisi akan


menurunkan Lf isiensi percarnpuran sungguh-sungguh menyesatkan
(kesimpulanTabel 5.l. Dengan mengingat asas pelarutan, maka makin besar
jumlah soLuent (irnbibisi), makin besar tenaga {panas)pelarutan yang dimi-
miliki, sehinggameningkatkanjumlah zat yang d!larutkanbolute yakni nira
dalam ampas).RumusHPI {8) menjelaskanbahwaefisiensi percampuranme-
ningkat dengan bertambahnyajumlah imbibisi. Dalam praktek ada kalanya
(FC
dijumpai penambahanair imbibisi tidak dapat nrenurunkanpol ampas
tetap rendah). Ha! ini disebabkan karena kurangnya pembukaan sel dan
padatnyaampas yang menyulitkan air in'rbibisimenembusampas"

Karena perumusn faktor campur kuring mengikuti asaspercampuran


dan pelarutan, maka tidak ada pilihan lain kecuali meninggalkanangka
tersebut, dan menggantinyadengan HPI yang lebih sesuaidengan teknologi
mutakhir. l-{Pl(g} yang dirurnuskanHugot secara teliti memperhitungkan
ampas Nralusyang kembali ke gilingan. Sebagai akibatnya perhitungan
Hugot menjadi panjang,sulit dan tuuet. Perhitungandapat disederhanakano
dan lebih teliti, tetapi datanya mahal, yakni analisis yo sabut tebu; pol;
104

zat kering dan sabut semua ampas; pol dan zat kering semua nira gilingan
(termasuk ampas halusnya).

Sesuaidenganrumus g Hugot buku ini mengukurpercampuranim-


bibisi denganciisribusi brix, bukan pol (Hugot 197il,
A
I
j, airlnira imbibisi
r
To
o% oo
Masalah penelitian yang rnenarik ialah
"di mana airlnira imbibisi itu

seharusnya diberikan; di A atau B?" Pemberian imbibisi di A akan


memperbesarwaktu kontak antara imbibisi dan ampas. Walaupundemikian,
b!la sef-sel dalam ampas tersebut masih utuh, maka waktur kontak yairg
cukup lama pun akan mubazir karend dindingsel tetap memisahkanimbibisi
dan nira dalam sel. Dengan crusher sebagai satu-satunya alat preparasi,
maka HPS akan. rendah sekali, sehingga pemberian imbibisi yang terbaik
yakni di B. Ketika sebagiarrsel terkruka karena tekanan gilingan, segera
sesudahitu dibilas dengan imbibisi. Dengan HPS yang besar, maka tempat
terbaik yakni di A yang memberikan waktu kontak terpanjang. Berapakah
HPS minimum agar dapat memberikan imbibisi di A? HFS maksimum di
B? Atau, HPS berapauntuk A dan B?

:
1
105

Tabel 6, Angka*angkanormal (rata-rata)


pengawasn gilingan Indonesiadan Hawaii

lndonesia Hawaii
A. '1. Tebuo umur 12
'10,5
24 bulan
pol 14,5
'16,0
brix 13,5
HK nira 7B 90
sabut 15,0 13
traah 5 7* + tebanganmekanik
2. Anpas
pol ampasgilingan 2 ,5 2* r disintegrasi
1 .l*
pol ampasdiffuseg
kadar air ampasa, 49 45
3. Nira mentah
l-{K nprp - HKnm 2,5/2* 2,5 HKnprp> HKnpp'
4, Air dmbibiei, % sabut 'uo. 250

B. 1. HPS (% aet terbuknlb)


gilingan B7
diffuser 94
1
EPG I 64 80* * gilingandandiffuser
ampas
3. ILPGtotal
gilingan ,:,, 96
diffuser arnpas 97
diffuser tebu 96,5 98
4. Brir npt:a
i gi!ingan 5,5/4* 3 bnpra > bngar
diffuser 1'5 1'5

a) kenaikan kadar air arnpas 1%, menurunkan HPG 1% dan nilai bakar
1%. 'l%
b) 4% HPS setara dengan HPG (hasilkerja 1 rol gilingan)
Angka-angkanormal lndonesiadiambil dari lkhtisar Angka-angkaPerusahaan
1986.
106

Xl. PENGEMBALIAN HASIL SEtsELUMNIRA tvtENTAH

Pengembalianhasil dapat clikelompokkan:


'1.
Sebelum(timbangan)nira mentah
a. nira kotor kembali kepadaampas(nka)
b. irnbibisinira seduhan(ins)
2. Sebelumnira encer (sesudahnira mentah)
3. Sesudahnira encer.

Pengendalianprosesmempersyaratkanagar hasil yang dikembalikanterl


dahulu ditirnbang/ditakar, dianalisis rninimtrm pol dan brix, sehingga
<iiketahuiton pol dan ton brix yang dikenrbalikan.
Froses nka dan imbibisi nira seduhansudahsangat jarang dilakuk
Adakalanya,pabrik-pabrikguta baru mengembalikannira kotor ke gifi
misalnya karena stasiun penapisan belurn dapat heroperasi sebaga
mestinya. Dalam ha! sebagian nira kotor ditapis, dan nira
c!igunakan untuk imbibisi, dan sebagian nira kotor dikembalikan
berlakulah prosesnka clanimbibisi nira seduhanbersama-sama"Perhi
nya rnenjadirurnit, namun tidaklah sulit asal mengetahuiasasnya.

A. Frosesnka

Proses nka memiliki keunggulandalam mengatasi pencemaran


"blotong" ditampung
kulngankarena llmbah blotong. Pada proses nka,
ampas, dan dibakar untuk menghasilkanpanas yang mengubahair men
uap (stasiun ketelan). Selain itu juga menghematbiaya investasidan opt
' 25%)
penapisan.Kerugiannya ialah terjadi sirkulasi kotoran fiS
"banjir muka".
seringmenimbulkan

l.Jntuk tujuan penBawasan,nira kotor terlebih dahulu dit


= 100 -
dianatisispol, brix dan kotor6n. Nira jernih dalam riira kotor
kotonan. Karena am!'iassebedai medium penapis nira kotor, maka
harus kF',.6 dan lembut, lagi pula ton nira kotor tidak boleh lebih
daripada ton sabut. Jika nira kotor diber"ikankepada ampas gili
persyaratan nka harus dipenuhi seba6airnanayang dirumuskan Bogstra
diGFbalikan s 'tr00
P5A | {_ton nira_kogrr
ton sabut
107

(uoorbeuerkers) rni-
Agar PSA I rendah,jumlah pesawatpreparasi
(Maxwell), atau
ninrurn dua set, misalnya crusher + shredder penyayat
pisau + hammer shredder,atau unigrator. Setelan gilingan I harus menjamin
tercapainya F{PG I atau HPB ' lebih dari 7O%. Jumlah nira kotor dapat
p€ngg1lnaan
diperkeci! dengan meningkatkan konsentrasi rnisalnya dengan
nina kotor dari bejana pengendap'Pembubuhan
ulir (screwl pada pengefu.laran
kapur kepada nira mentah dalam bentuk sakarat tidak dianjurkan, karena
akan memperbesar volurne nira kotor. Sarna sekali tidak diperkenankan
memperbesarkadar sabut tebu denganjalan apa pun'
pada prosesnka, skernaimbibisi menjadi agak berlainan dibandingkan
dengan sistenl imbiL,isi majemuk tanpa nka. Contoh: waJr n/.alt nkal'
npl = n2 + n3, nm * n'1* n2 + n3.

8o n k l
\q "l-*f O jd(
o n'l
)oo

Carnbar 13. Skema imbibisi majemuk dengan nka pada instalasi crusher,
shredderdan 4 gilingan

Perhitungannka memberlakukananggapan-anggapan:
- semua nira jernih dalarn nira kotor ikut ke npl' selanjutnyake nira
mentah
= kotoran
- koreksi kotoran dalarn nira mentah tertimbang tanpa nka
tebu (anggapansebaga!manalazirnnya).
(endapan)dalam nira
Dalam Bulletin 4 disebutkan, bahwa semua kotoran
kotor dianggap tertinggal dalam ampas.' Terhadapan88apanini, kalangan
praktek menaruhkeberatan"
108

% kgjglarl nk x N K
ton kotCIrannk -

1AA- Vokotoran nk x N K
ton nira jernih dalam nira kotor ( N J n k ) a ff

ton pol nira jernih dalam nk (Pnjnk)


tE# x Nrnk

ton brix nira jernih dalam nk (Bnjnk) EBr-tx Nrn[


Ton nira jernih, pol dan brix yang dikembalikan dikoreksik
(diperkurangkan)terhadapton nira mentah netto, Pnm dan Bnrn.

'!,
Kstoran Yang bersirkulasi

Pada awal giling, atau sehabis berhenti, di mana belum ada


kotor dikernbalikanke gilingan, % ltoreksi kotoran nira mentah terti
dianalisis, ton koreksa kotoran yang didapat met'upakanton kotoran
yang digiling, Setelah ada pengembalian,% koreksi kotoran dianali
ton koreksi kotoran yang ciidapattermasuk kotoran yang bersirkulasi.

Jika;
F', f' = koreksi kotoran dengannka
F, f = koreksi kotoran tanPanka, maka:
F,
F ' n r,n k = ff'nrnk
fo*xNMK
,
Fnm k = +fnnrk
f6'o*xNMK
=
Ton kotoran dari nira kotor yang kembati ke nira mentah F'nmk

Kotoranyangbersirkulasi(uudl doot'slag)
- F'lqr3 - Fnm\ x 100
ton kotoran nK

2. B&ot nira mentah, Pol dan brix terkoreksi

Bila tanda aksen(') rnenuniukkantak terkoreksi nka, maka:


109

NMK F'nmk = NM'


NM NM' - NJnk

x NM' dan Bnm'= lm-


t
bnm'
Pnm' x NM'
%t
Pnm Pnm' - Pnjnk dan Bnm = Bnm' - Bnjnk
Pnm ,100
pnm (70pol nira mentah terkoreksi nka) Tiil[ x
Bnm
pnm (Tobrix nira mentah terkoreksi nka) T m ' x 100
HKnm(HKniramentah nka) = fififr x 100
terkoreksi

NM, nm adalahnira,mentah(net'to) terkoreksi nka. tnilah yang digunakan


dasarpengawasanpabrikasi (boiling house eontrol,). Pada prosesnka, ti-
dak dikenal istilah nira encer (NE, ne) terkoreksio kecuali jika ada
pengembalianhasil sebelurnnira encer.

3, Anrpas nka

Pada cara kerja nka, karena tak ada stasiun penapis6n,maka tidak
ada blotong. Endapan (kotoran) dalam nira kotor sebagian besar ikut
ampas,dan sisanyakembali ke nira nnentah.
ton kotorandalamnk = NK - NJnk
I torrkotorandar! nk ikut ampas
I
I = ton kotorannk - ton kotoranbersirkulasi
t
II = (NK-NJnk)-(F'nmk-Fnmk)
I Dari sini arnpas tanpa nka dan lo kotoran nk dalam ampas dapat dihitung.
I

I 4. Perhitungan PSA pada nka


I
I Misalnya instalasi gilingan terdiri dari crusher, Maxwell shredder
I
I
dan 4 gilingan:
I
I

I PSA I dihitung seperti hriasanya


I

I fntal (= fnt - fnpp)


= x'100
I
I Tabel lA Eulletin 4
I
I

I
I
110

PSAII

Ll^o uz,
o,o Ntn2 NJnk
n2
bnpp bnjnk

N2 dihitungdari:
NPL = NM,-NPP
= N2 + N3 (dalamhal ini NPL # Nz)
NPL
-
N2 * NPL bnpl bnq
bn2 - bn3

N2 N3
bn2 bn3
Nta2 = Ntal-Ntn2
fnta2 * fnta.l -fntn2

tnta2
FSA ll =
nira asfi dalam ampai 2 % sabut yangpan-tai x 100
Tabel lB Bulletin 4
N3
bn3
PsA ill
I

-J-i^o:=*
c,o
,t
Ntn3
bnpp
N4
bn4
n3

Ntnr = '-r
Na 39:*11
bnpp- bn4

Nta3 =Nta2-Ntn3
fnt.3 = fnta2-fntn3
111

fntu3
PSAlV = x 100
nira tebu dalarnampas 3 % sabut yang pantas
Tabel lB Bulfetin4

PSA fV (akhir)dihitungbiasa

fnt"4 g*9*.1oo

PS AlV = . - fnta
nir" rubr6 x 100
T a b e ll A B u l l e t i n4

5. Penimbangan nira encer

Di beberapa negara yang nrelakukan pengembalian


nira kotor ke
arnpa$gilingan (nka), penimbangannira rnentah
clipandangtidak praktis.
Yang ditimbang justru nira encer, biasanya
dengan penimbang otomatis
Foxboro. Perhitungan bobot nira nrentah cJan
ampas serta garis tresaFDer_
hitungansusunantebu sebagaiberikut:

a. Dengan menimbang cran menganalisispol, brix dan kotoran


dalam nira
kotor maka clapatcliketahui:

ton pol nira kotor = x ton nira kotor

ton pof nira mentah = tofi pof nira encer + ton pol nira kotor

ton nira mentah netto = 'r*l-# x ton pol nira mentah


"c"r"h
ton nira mentah bmtto =
x ton nrn netto

ton ampas = ton tebu + ton air imbibisi + ton


nira kotor _ ton nira mentah
bz,uto
b. ton pol tebu = ton pol nira encer + tompol ampas
ton brix tebu = ton brix nira encer + ton brix "*Ou,
c" Kadar sabuttebu dihitungdengan:

Ton kotoran nira kotor dalam ampas = ton


kotoran daram nira kotor
- ton kotoran yang bersirkulasi.

Ton sabut ampas = ton sabut tebu = ton zat


kering ampas - ton kotoran
dari nira kotor dalannarnpas.
112

B. frnbibisi nira seduhan

pada carakerja ini, nira kotor tidak dikembalikanke gilingan,tetapi


pemberlan
ditapis. Nira tapis yang pertama keluar adalahnira jernih. Setelah
air pencuci blotong (disebut air seduhan),nira tapis yang keluar disebut
nira seduhan.Padapenapishampa (vqcuumfiT,ter) nira seduhanini keluar
clari saluran hampatinggi (high uaeuum).

Air inrbibisi untuk ampas sebelum terakhir, seluruhnyaatau sebagian


dapat diganti dengan nira seduhan. Sebelum pengembalian, nira seduhan
ditimbang/ditakar, dianalisis % pol dan fo brix. Nira seduhan dianggap
ticlak mengandungkotoran (endapan).

Perhitungannyahampir sama dengannka.


NM, (ton nira mentah tak terkoreksi nira seduhan)= NMK - Fnmk
Ntvl (ton nira mentah terkoreksi nira seduhan)= NM'- NS
Bnm = Bnm'- Bns,selanjutnyabnm = 100Bnm/NM
Pnm * Pnm'- Pns,selanjutnyapnrn = 100 Pnm/NM
'100
HKnm = Pnm/bnm'

C. FengawasanTeknolagi Diffuser Tebu

Teknologi diffuser dikenal pertama kali di lndonesiadi pabrik gula


Keclawungmilik PT PerkebunanXXIV-XXV Jawa Timur. Karena merupa-
kan teknologi baru, maka mengundangbanyak permasalahan penelitian.
jika tidak
Pengawasanteknologi diffuser hingga kini kurang diperhatikan,
terlupakan.
'yang
Diffusi adalah prosesperpindahansolute dari daerah kadar

so?utenyatinggi ke daerahyang kadar so\utenya rendah.Untuk pabrik gula,


eolute ini tidak lain aclalahpol atau brix. Dikenaldua macam teknologidif-
fuser yakni cJiffusertebu dan diffuser ampas. Pactadiffuser tebu, setelah
tebu dirombak struktLtrnya dan dilakukan pembukaan sei secara intensif,
tebu cacah dibawa rantai berjalan, di dafam diffuser diberi imbibisi' dan
(sekaligus
nira mengalir ke bawah rnelaluiplat statis yang ber"lubang-lubang
-
menyanggaranrai). waktu tinggal tebu cacah rJalamdiffuser 45 60 menit,
selama itu dijaga jangan sarnpai terjadi pemadatan. Air panas diberikan
113

di bagian belakang, dan nira-nira dengan kadar gula rendah digunakan


dipompa untuk n"renginrbibisiampas-ampas di mukanya, berr,rlang-ulang
misalnya 12 kali. Selama itu susu kapur diberikan untuk menaikkan pH
5,5 rnenjadi 6,0 - 6,5. Ampas yang keluar dari diffuser dikeringkan dengan
1 ' 2 gilingan, sehingga kadar air ampas kurang dari sa%. Jadi diffuser
tebu tidak lain adalah pengambilangula denganperkolasi;pelarut air (pez,-
co1'ated eol'uent eatnaction) " denganpembubuhankapur secarabertahap
(ft'actional, Limingl untuk memperbanyaktitik isoelektrik berkenaanpem-
bentukanendapan,yakni penggumpalan
koloid-koloid.
Pada diffuser ampasotebu cacah mengalami pemerahanawal, kemu-
dian arnpasdiffusi. Efisiensibagaase diffuser ternyata tidak lebih baik da-
ri cane diffusen karena terjadinya pemadatanampas.Hal terpenting dalam
proses diffusi yakni kualitas tebu harus prima, khususnyakeLrersihandan
kesegarantebu. frasfo harr-rs
kurafig dari 2%, jika tidak, zat warna klaras
akan memperberat pengolahan" Dalam teknologi konvensional dengan
gilingan, zat lvarna (molekul besar)akan cJitahanoleh ampas.

Pembubuhansusu kapur {skp) kepadanira mentah sebelumditimbang,


memberikanpersamaan:

T + l + ( S K P ) = N M K + ( A )
T + l= NMK+ (A-SKp)

Dalam praktek, karena jumlah susu kapun (sKp) ticrak diukur, bahkan
diabaikan,maka:

T + l = N M K + ( A ' )

Maka:A=A'+SKP

Ton ampas yang seharusnya(A) sebenarnyalebih besar daripada ton ampas


yang dihitr.lngdengan rnengabaikansusu kapur (A1" Dari sini akan dijumpai
angka-angkaef isiensiyang terlatrutinggi daripadayang.seharusnya.

Banyak sekali kemungkinan untuk nnemecahkanmasalah tersebut,


antara lain:
1. Penimbangansusu kapur termasuk penyediaanbak tunggu berpengaduk,
setidak-tidaknyapengukuran debit.
2. Cara inferential" metlead Noel Deerr, setidak-tidaknyarnenetapkanbo-
114

bot annpasdan susu kapur, sekaligus rnemanfaatkanuntuk pengawasan


intern.
3. Tidak dilakukanpengapurannira sebelumtlmbangannira mentah.
4. Analisis kapasitas buffen nira tebu dan nira mentah sekafigus
menggantikanresaaurine test atau total' mie?obee.
5. Penimbanganampas(secarakontinyu) denganradiasi sinar T (gamma)
tenaganuklir.
atau menggunakan

fnferential method telah terbukti keunggulannyadi Hawaii, walau-


pun tidak untuk diffuser. Dunia industri gula telah membuktikan
analisis langsungkadar sabut tebu dapat dipercaya.

Denganpersannaan:

T + l + ( S K P ) = N M K + ( A )

di mana tanda kurung merupakanbilangan anu (unknoutil maka pener


inferential method untuk pengawasanintern masih memerlukan peneli

-,lika hanya menghitung ton susu kapur (SKP)' rnaka A


diperhitungkandari analisis langsungkadar sabut tebu (ft).
^ 100 ft
A = *1ffi * t
T;-

S K P = N M K + A - T - l

NM'{ton nira rnentahtak terkoreksi) = NMK - Fnmk


NM (ton nira mentahterkoreksiskp) = NM'- SKP
Selanjutnya dihitung Pnffi, bnm dan HKnm untuk perhi
ef isiensi-efisiensipengolahan.

Padaprosesdiffusi tebu, HFS tidak boleh kurang dari 94%.

rr,Ftr * rF
115

XII. STANDAR GULA

jnter-
Stanctardisasinrgtu gula telah dilakukan secara lokal maupun
nasional. Negara-negarayang memiliki standar gula misalnya Afnika
Selatan(kristal), Arnerika Serikat (ruurvalue dan 96 VSDArthe United $tates
Depurtment of Agriculture), Australia (CCS; cornmercial cane sugrcr), Indo-
nesia(kristal)dan Perancis (titre). lstilah kristal oleh Noel Deerrdiinggris-
(1932)
kan menjadi standqrd granulated.sug6r, dan selanjutnya Noel Deerr
menyusun konsep standar gula yang setara dengan kristal yang disebut
equiva'lentstondcrd grnnutated (esg) sr.rgon Bsg dalam Kongres l55CT 1932
di Puerto Rico disetujui sebagai stanclar gula internasional, dan dalarn
perjanjian inl HK sakarose tetes 28057dlanggap ideal. Sesuai sejarahnya'
maka buku ini rnengindonesiakanesg denganistilah setara kristal (sk).

A. Kristal (l-bblur) di Indonesia


(sakarosekering)
cula (A, B, c, D, H5, SHS)disusunoleh 6ula murni
clan tetes (larutan sakarose dan bukan gula dalam air)' Cula murni itu
(film) tetes. l-apisan
disebutkristol yang pada permukaannyamelekat lapisan
tetes tersebut memiliki kernurnian(FlK) sama dengantetes didapat'

Dengan HK tetes didapat = l-lKm, maka perbandinganpol dan bukan


gula dalam tetes (<jisebutfaktor tetes, FM) adalah:

D
t m pm HKrn
F M =
BCm bgm 100- FtKm

Dari H ton gula yang nrengandung BCh ton bukan gula dalam lapisan
tetesnya,ton pot dalam lapisan tetes adalah;

P lapisantetes = _g,H. x BC lapisantetes


p*
= '=!I:- (BCh)
tJurn
= FM tBh - Ph)
ton pol sebagaigula murni (kristal) ialah:
Kh = Ph - F dalam laPisantetes
116

Kh = Ph-FM(Bh-Ph)

5elanjutnya,
kh = ph-FM(bh-ph)
= kh
Kh i(b rH
H = I100
frxKh
100/kh disebut faktor krlstal atau faktor hablur 5H5/HS, yakni kebalikan
dari kadai kristat hasit(kh < 100).

'1
Faktor hablur SHS/HS = 100/kh >

Faktor hablur ini digunakanuntuk mengubahton kristal menjadi ton hasil


(Sl"JSlFtS),
sebaiknyadenganketelitian 5 (lima) desinralatau lebih.

Agar disadari, pengertian kristal sebagaikonsepstandar gufa berbeda


dengan kristal sebagai bentuk fisik gula pasir. Teori lama menyebutkan
bahwa bukan gula dalarn lapisan tetes terdapat pada permukaangula pasir,
Penemuanbaru membuktikanadanyanon-sugorrnclusfon (masuknya bukan
l
gula ke dalam kristal, gula). , Praktek yang dilakukan di. PC Panji
(Jawa Timur) memperkuat kebenaranpenemuantersebut. Ketika carakerja
rafinasi Sijmans dilakr:kan (gula dari pabrik muka difebur, diberi larutan
NaOH untuk memucatkanwarna bukangula, kemudiandikristalkankembali),
hasif gula rafinasi justru bernrutu rendah. Perbaikanwarna gula dilakukan
dengan nrelebur gula, tanpa dibubuhi larutan soda, selanjutnyadikristalkan.
Dengan peleburan dan pengkristalan kembali, maka bukan gula dalam
gula pasir menyisih. Selain itu, penambahanNaOH justru menambahbukan
8ula.

Baik tetes sesungguhnya(hasil samping) dan "tetes" dalam gula


memiliki kemurniansama, sehinggakeduanyamerniliki kadar hablur (kristal)
= nol.

km = prn- j#Sffi (bm- pm)


= pm - FM (bgm)
= pm-ffi (bgm)
=0
117

menfandunggula pasir' Ketika


Ini tidak ber.arti bahwa di ctalamtetes tidak
endapan gula pasir. Apa
tangki tetes dikuras,. di dasar tangki terlihat
(kristal) sebagai konsep standar gula'
yang sedang dibahas adalah hablur
Bagaimanapun, konsepbukanlahfakta'
tetes, ton pol
Dari keterangan di atasn apabila hasil gula dituangi
keunggulankonsep kristal'
akan bertambah, tetapi ton hablur tetap. lnilah
7'
Kelemahannyadapat diterangkandenganTabel
dari
Tabel 7. Pengaruhmutu tetes terhadapbobot hablur
rJuamacarn gula yang bobot dan mutunya sarna

PabrikGula
A

(1) pol tetes (Pm) 27,37 30,95


(2) brix tetes (brn) 93,O7 94,27
(3) HK tetes(HKm) 29,41 32,83
(4) faktortetes(FM= a$fu1 0,41663'l 0,488760
(5) pol SHS$h) 99,75 99,75
(6) brix SHS(bh) 99,95 99,95
kristal 5H5 99$66 674 99,652248
ffi
lkh = ph - FM (bh - ph)l
(8) faktor kristal SHS= 100lkh i,003 344 1,003490
(9) ton SHS(H) 100 100
(10) t o n k r i s t{aKl h= f f i x H i 99,667 99,652

sama, bobot dan


Jadi, padakonsbpkristal,gulagJlayangbobotdan rnutunva
berbeda'
kartar kristalnya akan berbeda bila HK tetes yang Qrsangkutan
dan
Pada konsep esg {setara kristal) yang akan dijelaskan-lebihlan.!ut,bobot
kadar esg ticiak tergantungpaclaHK tetes yang didapat'
kristal
Kristal (hablur) sebagai standar gu|a membuahkan istilah
(gula
didapat (dihasilkan)sebagai pernyataan lain dari hasil yang dldapat
prestasi pada
dihasilkan). Kebutuhan untuk rneningkatkanefisiensi dan
setiap langkah proses mempersyaratkanperumuganangka-angka efisiensi
118

atau kemarnpuanYang di lndonesia biasanya clinyatakan dengan rendemen.

keluaran
E f i s i e n s (i n ) = masuKanx 100 s 100

Winter berdashrkan pengalarnannyarnerurnuskantiap 1 ton bukan


gula akanrneningkat0,4ton pol tak dapat ctikristalkansebagaihasil, jadi ikut
tetes; pada prosespengolahanyang terbaik yang pernahdicapai:

pm = Prn l-lKnr
= _]OO:-TiKil = Aurn
A
bgrn Em-
pm = 0r4 bgrn, atau HKnr * 28,57-

Mula-mula rendemen Winter dimaksudkan sebagai angka ef isiensi,


lama-kelarnaanbergeser menjadi angka kemampuan (Wrfarmance).

Pada proses pengolahannira y"ng t*rbaik, tiap 100 pol nira mentah
akan dapat diperolehkristai

= Fnmj-Q,4bBIq x ru'
pnm

- (bnm - pnm)
E ErT 9y' x 100
i, POffi

= (1,4- ;ffi1 ,oo


Rumus tersebut terkenal di dunia pergulaandenganistilah Winter reeavery
(rendemen Winter) yang dimaksudkan sebagai angka efisiensi. Carp juga
menernukanrumus tersebut. Oleh Prinsen Ceerligs (1907),rumus Winter
(1897) dipublikaslkan dalarn bahasa tnggris dengan sekrutanWinter-Carp
recavery. Dari sini timbul istilah recovercble$ugor (gula dapat diperoleh)
atau ruinboarsutker.Dalam hal gula dinyatakandenganstandar kristal, nnaka
menjadi urfnbaarknstal(kristaliseerbare)dan dalam bahasaln-
rurnboorsurlcer
donesia diistilahkan'kristal (hablur) dapat cliperolehJdiharapkan),dalam
buku ini dilamb'angkanKo dan ko.

Konm * Pnn'r- 0,4 (Bnm - Pnm)


konm = pnm - 0,4 (bnm - pnm)
119

konm adalahkristal dapat diperolehtiap 100 nira mentah,yang juga disebut


nilai nira (sopuoarde)dari nira mentah.Dalam bahasasehari-hari(pasaran),
konrn disebut kadar kristal nira mentah. lstilah ini pembingungkan
masyarakat awam, karena pada kenyataannya dalam nira (larutan) tidak
terdapatkristal.
'1932,
Sejak Winter recoverydijadikanstsndard of effictency untuk
merurnuskankemampuanstasiunpengolahan.

yane.digpd
Kernampuan = efi.sie$;i x 100
efisiensistandar

Pengertian rendemen Winter (RW) sebagai efisiensi pengolahankemudian


bergeser rnenjadi kemampuan pengolahan.Pembilang.adalah 100 KhlPnm
dan penyebutnya100 Konm/Pnm, sehingga:

RendemenWinter = kemarnpuanpengolahan-
"100
Kh/Pnrn
x 100
100 KonmlPnrn

= Kh-
x 100, atau:
Konm

Ph . FM (Bh. Ph)
RendernenlVinter = x 100
Pnm - 0,4 (Bnm - Pnm

Ph - FM (Bh . Ph) Kh = ton kristal didapat(dihasilkan)


Pnm - 0,4 (Bnrn- Pnm) Konm = ton kristal dapat diperolehdalam nira
mentah.

B. Standar Cula tnternaslonal

Kristal adalah standar gula pasir (stcndsrd granuloted sugar) cJari


Jawa yang cJidasarkan rumus empirik Winter fl597)" Noel Deerr dari Hawaii
('1910) mengilmiahkan rumus yang didasarkan pengalaman itu menjadi
rumus SIJM(sugcl"-;'uice - molasses)yang menurunkanstandargula lain yang
setara kristal, disebut eqwivalentslandcrd granulated,sugor, disingkat esg.
120

pol dalam bahan


Ton pl yang didapat dalam hasil tiap 100 ton
baku
= s (J-:-l4l xA .100
'vv
JIFTII

S = HK gula (sugar)

J = HK nira $uice)
M = HK tetes (molasses)
kemudian pada Kongres l55CT
lvlula-mula 5, J dan M adalah HK sejati,
yang clipraktekkan umumnya HK
1932 disepakati HK sakarose, sekarang
po|.Mu|a.mu|aJditerapkanuntuknirapekat;diJawaditerapkanuntuk
nira rnentah'
nira encer, sekarangditerapkan untuk
Pnm
Pg
Pnnr
1oo=|S;S x 1oo
Pnm ton pol nira mentah
Pe ton pol gula (hasil)

Pg Pm
M
5

(gula tersedia) yang men8andaikansemuakehi-


lnilah rumus availab'lesugor
|anganditampungtetes'atautidakadakehilanganse|ain.da|amtetes
pengolahanteoritis ftheonticar
100 5 (J - M)/J (5 - M) disebut ef isiensi
fui|inghouserecovery),sec|angkan100Pg/Pnmmenurutana|isisdanpenim
mbangandisebutefisiensipengolahansesungguhnya{actwo'|bo|inghouse
recovery).

PadaKongres|SscTlg32diadakanperjanjianbahwaHKtetes
idealada|ah28,57dangu|amurnimernilikiHKl00$o|100,brix.10o
Cu|aada|ahc;ampuranantaragu|amurnipltlstetes.Cu|arnurniinidise
,esg. Esg tiaP 100 Pol hasil

iffix1oo
121

100 J - 2857 =
*7w 4 A 4 A
t t q ' A

--Er-
ph - 0,4 (bh - ph)
x 100

dimana J = HK hasil (h).

Ph
J
100(J : 28,57'
f f - . r o o= rft00-- 26FI x 100
=' \ o -3
Ph - 0.4 (Bh- Ph) .t00
=----Tfr-- x

E5C Pm
5 = '100 fv{= 28,57

Jadi,

ESC =
W xPh
(5K)
-
= Fl1- 0,4 (bh ph) x P h
ph
= Fh - 0,4 (tsh- Ph)

SK = ton setarakristal = ESC

I Angka 0,4 tidak lain adalah faktor tetes (FM) ideal:

--im'.
M
N{- = 166-:-HKm
FM ideal = A,4 = FlKm = Dm = Pm
frfr mm
28,57- _.
10a- 28,57
Konsepstandargula esg (sk) kebetulandielukung oleh fakta di mana jika
gula rrErahdiraf inasi, pol yang tak dapat dikristalkan sebesar0n4dari bukan
gula yang dikandungoleh gula menah.

Secara tegas, faktor tetes Indonesia benbeda dengan faktor tetes


|SSCT.Jika M = HK tetes, maka;
122

Faktor tetes (FM) lndonesia =


M = Pm
1 0 0 - M BCm
dinyatakandenganpecahan(fraksi),

.100Prn
100 M , BCm.
Faktor tetes (MF) ISSCT = =
lm;m\ge;m/ E;7;--
dinyatakan denganTo.
Tabel 2 menyatakanfaktor tetes (FM) pada pelbagaiHK tetes.

Tabel 8" HK tetes dan faktor tetes (lndonesia)

HK tetes Faktor tetes HK tetes Faktor tetes


{M) M/(100 - M) (M) M/(100-M)

50,00 1rA 33,33 or5


47,37 0 ,9 28,57* o,4
44,44 0r8 23,08 0r3
41,18 4,7 16,67 o,2
37,50 0,6 9,09 0r1

* Kongres l55CT 1932 menyetujui sebagaiHK tetes ideal secara perjanjian


(bukan secara ilmiah). Masih acJa kernungkinanHK tetes ideal selain
28,57dan nol.

Rumus SJM Noel Deerr kecuali menu!'unkan standar gula, juga


angka-angkaef isiensi dan kemarnpuan,seperti theoritical boiling house
recovery (BHR), bssic BIIII, i.deat tsIIR, qctusl BHR' BIIR esg, botldng
house perfarmance (tsltP), dan di Indonesiaditerapkan pada rendemen kristal
(isasi)maupunpemerahanrnasakan"

BIIR= +{d;#
1. rheoriticat x 1oo
5, J dan M adalah HK - HK pengamatandari gula (hasil), nira
dan tetes.

2. BgsicBHR _ 100{J -
= 28,57}
x 'loo= (1'4'40lJ)1oo
ffi
J adalahHK nira mentah/bahanbaku.
123

100 (J -
= jffiffi Mo) .. 4,.'n
x 100
3 . IdCAIBHR
= antara nol eian
J = F I K ' n i r a mentahlbahan baku, Mo HK tetes ideal,
28,57"

4. Actucl BHR = # k x l o o=W

5. BIIR esg =f**1oo=Pnffx1oo


- fi,4 -
4olHKh)Ph x 100
="-T16-
5K = ,&SG

6. BHP =#ffi-*'loo=ffi
=ffi,*1oo
J = HK nira mentah
100 (FlKh - M) DL
_FIRFT1OOTilT'r'r
* 100 = ffi x 1oo
7. Rendemenkristal = #
ilioo:-Nil- ' rne

=ffixloo
= nira encer, M = HK tetes, dan FM = M
J HK fc,6:fr-

8. Pemerahanmasakan = l%#*i.1oo
yang bersangkutan'
J = HK masakan,M = ilK setrup/tetes dari masakan
JikaJadalahHKmasakanA,rnakaMacla|ahHKsetrupA.
kristal) ternya-
Ferbedaanstandar-standargula krista! dan €sgGetara
diithami konsepkristal dari Ja-
ta hanya.selapis,karena'konsepe.sg memang
wa.

9. Kristal
li
Kh= ffiffix rir = Ph - im:M (Bh- Ph)

kh * ph -#, {nh-ph)
Faktor hablur (faktor kristal) hasil = 100/kh.
124

10. Setara kristal (esBr)


- Ph)
(Bh
* rr, = Ph- ,#'!'zg',sz
sKh= ffiffi
= Ph - 0,4 (Bh - Ph)

skh= ph - 0,4 {bh - Ph)


=
Faktor setara kristal (esg)hasil skh/'100'

Negara
C. Standar-standar Gula Lokal di beberapa

Beberapastandargu|aloka|yanBakandiuraikanSecarasing
(ccs) di Australia' gula96%
yakni nettitre {nt) dan comrnercislccne sugcr
pol $6a test)dan rsrv volue rnenurut the Llnited stctes Department of
gula merah'
Agricultur e (IJSDA), dan beberapa rendemen

'
'
1. Gula 94 ht dan CCS di Australia
murni mengandunglWTopol
N"1 1;1ps(NT) artinya gula murni' Cula
= '100nt' Perhitt-rngan
nt gula merah dirumuskan:

nt = %Pol-70gulareduksi-5xVoabu

sama direduksi(diperhitungkan)
Pelbagai gula merah denganrnutu yang tidak
(100
Jadi' 100 ton gula murni
pada rnutu gula yang'normal yakni 94nt''
106,4 ton. gula merah 94 nt- 5e-
nt) atau NT = 100 ton setara dengan
b a l i k n y a , l 0 o t o n g u l a g 4 n t s e t a r a d e n g a n g 4 t o n 6 u | a 1 0 0 '100
nt(gulamurn
pengalaman (di Australia)' Dari ton gu-
Net titre ditetapkan berdasarkan
normalnyaakan meng-
fa merah 94 nt yan6 diolah, pabrik raf inasi ffefinery)
hasilkan 94 ton refined $ugar'
gula merah sebagai bahan baku
Jika net titre merupakanstandar
dari mana gu|a merah
refinery, maka CCS ada|ahstandargu|a da|am tebu
yang berb'eda-beda'direduksi menjadi
berasal. Tebu-tebu dengan mutu
ccs,yangdidefinisikansebagaiberikut:''CCSia|ahtongulamurni(100
yangdapatdipero|ehdari,l00tontebujikaoperasipabrikgu|arnera
(mitl}dan.refinerydiselenggarakanpaclastandarefisiensiyangdisepaka
yaknitiapltonbukangu|aakanmenyebabkankehi|angan0,5tonpo|.
125

ecs = pt - 0,5 bgt = pt - 0,5 (bt - pt)

= 3 - *bt
ipt
3 ft+5) -
, - - -.:im-) -
Z PnPrP\r f bnPrP(1 %1t)
ccs
UUJ= I
mTx
"rendementebu dapat diper-
Secaragampangnyacc.s rnemiliki makna mirip
oleh (diharapkar0",yaknl ton gula murni dari reftnery yang dapat diperoleh
"Rendemen tebu clidapat"dirumuskansebagaiberikut:
tiap 100 ton tebu.

Yield 94 nt titre rsw sugsr


ton gula n'lerah
-. (dinyatakandengan standar nt)
-94 x 100
ton tebu
= ccs x coefficten[ of worlc/100

ad NT
=;ff*
ccs
frdf * 100
Coefficient of work = rendernen(kemampuan)pabrik gula
= W x 1 0 0
(kurang lebih 100, namun dapat mencapai 115a/o,
ini menunjukkanlemahnya
konsep ccs untuk mernperkirakanrendementebu).

2- Gula 96 USDA dan rutr vo'hrc di Amerika Serikat

Cula g6 USDA,di Amerika Serlkat(USA)disebut96 DA, 960 tesl,,


960 sugor atau 96 pol, yakni standar gula dengansusunan96% pol, 1,A3%air
dan 97% HK. Pengubahanton gula dihasilkanmenjadi ton guta g6 DA oleh
Copp dihitung denganrumusSJM Noel Deerr (S = 97, J - HK gula dihasilkan
dan M = HK tetes didaoat).
126

Ph
J

t*3+ x 'roo
= 9 7 U - M ) * 100
liTiT:r161

P96D Pm
S=97 M

G u l a ?6 DA tiap 100pol sula dihasilkan


= 100 97 (J - M)
T6- x 1t57;541-
Gula 96 DA tiap 100 gula dihasilkan
100
= 97 (J - M)
T6- x 1197;-p6 x Pn
Rendementebu 96 DA = gula 96 DA tiap 100 tebu
= yield 96 DA
-
=6100 * 97 (-.' M) * Ph x 4^^
ruu
JT9T- illl T"
96 DA berkenaandenganstandarmutu gula. Di sampingitu dikenat
standar harga gula yang disebut raw value.

1 ton gula dengan p % pol setara dengan


1,A7 - 0,0'175 {100 - p) ton rsu vclue

1 ton reftnedsugor (gula murni, 1O0Yapol) setara dengan 1,Q7- 0,0'175


(100 - '100)= 1,07 ton raw vclue.
"l 'l
ton gula merah 96 DA setara dengan 1,O7 - 0,0175 (100 - 96) = ton
ravj \rawe.
1 ton reffneclsugar setara dengan 1,07 ton gula merah 96 DA atau \47 ton
ra:utvehte,

Sejalandenganrumusanraw vahte, faktor untuk mengubahton gula


denganp Vopol menjadi gula merah 96 DA yakni:
127

Faktor a 1 + o,o'trzs(p-e6)
ffi'ffi
Untuk p * '100(gula rnurni atau refined.sugcr), faktor = 1,A7.Jadi 1 ton
refined sugor setara dengan1,02 ton gula merah 96 DA.
Untuk p = 97,5, 'l ton gura setara dengan 1,0252s ton gura
merah 96 DA.
Untuk . 96, rnakafaktornya < .1"
.p
3. Rendernengula rnerah

Rendennen gula merah iarah ton gufa raf inasi beftnedsugor,gula mur-
ni) yang dihasilkantiap 100 ron gula merah (roursugcr atau HS). pabrik-pa_
brik rafinasi di negara-negarayang berbedamenggunakanrumrrs-rumusyang
berbedauntuk menerapkanrendemengula merah.

Australia pol - 5xabu -'l xgulareduksi


Belanda pof - 5xabu - 2xgulareduksi
Inggris pof - 3xabu - Zxgulareduksi
Jerman pol - Sxabu - 4xgulareduksi
Perancis pol - Sxabu - lxgulareduksi

D. Target HK Tetes

Ton sakaroseyang hilang .ikut tetes ditentukan oteh kadar sakarose


tetes dan tan tetes.
-
S m = SlTl
ffixl* a r a up m = #nm * U
Ton tetes (M) adalah fungsi dari ton bukan gula dan ton air dalam
teres.
Jumlah bukan gula dalann tetes adalah fr.rngsidari pengasinganbukan gula
di stasiunp€ft!u!'nian-

(Ep) = ggffi*
Efekpemurnian
BGne praktis = BCm Sm, atau bgm ,e $rr1"
Ton air dalam tetes ditentukan oleh brix masakanakhir dan (sedikit
pengaruh
dari) jumlah air siranranlpenurunviskositas.untuk pernutaran"
Usaha untuk
mempertinggibnix tetes {misalnyahinggags) tidaklahsulit,
dengandemikian
untuk menurunkan kadar sakarose tetes (srn), masatah yang
harus diatasi
ialah penurunanHK tetes.

Penetapan target HK tetes bertuiuan untrrk


mengetahui HK tetes
terendahyang mestinya dapat dicapai {expected
molassespu.rity), Keberha-
128

silan penurunan kacJarsakarose tetes dapat diketahui dar; li:birapa jauh


HK tetes yang didapat (sesungguhnya) lebih tinggi daripada HK tetes yang
Selisihini selalu positif, dan disebut beda praktis tetes (uitput-
c$targetkan.
tingsverschfl),Selainitu, target HK tetes merupakanrintisan untuk menetap-
kan t{K tetes ideal dalam rangka rneningkatkanefisierrsi pengolahandan
menetapkanstandar guta yang secara ilmiah dapat diterima oleh industri
gula internasional"
(Javra,
Tabel 3 menyajikan target HK tetes dari beberapa negara
Amerika Serikat, Australia dan Filipina).
Hasil perhitungan dicocokkan dengan HK tetes menurut analisis. Tetes
biasanyadianalisispol, sakarosenbrix, zat kering serta Eula reduksi dan
abu, selanjutnya HK pol, HK sakarosedan l-"lKsejati. Analisis zat kering
dapat ditiadakan jika angka-angkasebelurnnyasesuaidenganrumus Hugot:

HK sejati tetes = 1,2 HK sakarosetetes

atail, zat kering dihitung denganrrinr:s Sijlrnans:

zkrn= bm-axabusulfat

untuk defekasia = {J072,sulfltasi 0,86 dan karbonatasiQ,74.

E" Beda Praktis Tetes

HK tetes tergantung dali rnutu tebu {nira), carakerja dan oper


pabrik, Misalrryamanajernenakan menilai .prestasipabrik-pabrikgula sulfi
A, B, dan C yang dikelolanya:

Pabrik Cula
Farameter
A B

HK tetes 35,72 41,84 43,30


rarget HK tetes 3A,72 39,0'l 43,00

beda praktis tetes 5,00 7,83 0,30

Penilaian bahwa PG A berprestasi terbaik karena HK tetesnya terendk


adalah keliru. Yang sebenarnyaialah PC A memiliki prestasi ter
walaupunmutu nira .tebunyatertingBi, PC C justru memiliki prestasiterba
walaupun mutu nira tebunya terendah. Penilaian baik-buruknya sta
pengolahanantara lain dapat dilakukan dengan beda praktis tetes. Mak
besar beda praktis tetes, makin besar jumlah gula dalam tetes yang rnest
masih dapat dlkristalkanmenjadi hasil. Pada contoh data di atas, seharu
129

,."'- .- f"E
t s t-
F'J
F.* ' b s s6s€ I. E t
H 6 E
sE s
A* ili I ic l E A -Ept +t {n "
\r-
s. d *; 5s* ;
f
c do
(,(t
c fr
f (E eb 5c9 5$? t "c Er H +
= c rr
! *r ; ;
?^ h€

s f, :l
i: e-

fU E l - ob i - o * s - s E E € € ' a F € €
00
g 'aE\ '5rR -o o>
fo
.-!+, {+, . - E \S + , p { . - { . - i J ${.-S

F E ; E E ,.$FE
g ? *t:$E$;*-gttE
L
o
()
V 'u G
,z4ewjl *v*vtu v*v{
fA€XA€ ffi il € f ro=ror\s\Rr60r60
i l f f i l f l f i r ! [ i l i l l t l t l l [ [ i l [ f i l t i l t l
t-N rc{ r- c! rr! 1 r(\
(s >'X X >X X >X X X >-X >X >"XX >X >'X
t-
(It
00
tO
t\
E x l n
GI
c
- " ' 5 (\
X
o 3s I o\
qt u, v P G i
o, o dn rrte{ = X
g P
: F X X + c-l c.l c{
o o
+J

:t
I
)< +
.-d KR Ir- f ; 3 X
v Ctd crr T
, X F
A

E X fr
I I h0
.+r
o
o0
P
o
$ ; :x Ix e.l
o
i, X
+

t- DO
t-
8 [
^\ (\ i- .f)
; llit : ?
v -
. f ) c o r
' t'l
t . t
09-
{tt d ,d r.: v
F +) . \J rF t r ( \ g)
' lX .o'i
; ?? *- l H
* trr,o r.l
tn ; r ' r r t
qr

(l,
a
f
E 3[ ;.if ; h l, b
M 7
C
6 \ 9
O I \ O
0 r c ) \ g
\ 9 '
Ln {"e Q IC) ltr O € ( } r n N . f
tlt t cn s c..t c! lr l_o l/) r / l l f f f l l f . f
F ilil llt || [ tl l t r i l | | l l

(r (,
L
ftlE ct.-
.g
L
i E = ' tf r o
':
(!J
--) s, -r( t
6
= g
bg r'b I o
q
i " 6
o o o Sr 4 c :
* f cl
o_ -v. (\
'fr oi- 9 < H ct t r . ?
t-l *; (' .a. !4
H
s tfr
(d 3(a .g F (/j c/) o
-o J O C :
L
\,re
S
o :=
(n
e . s a)
c
n\
6 . r
u)
d
E
- 3
o I :5 I 0. cf .:
o- p b a. J C \
(6 PO U
f-
rd <J
F
cl
u )
:J s c . s
u0
(u h(l' -o u E & { ^ i
2
a
o,l .tl r!- ro \0
130

kandungangula dalam tetes PC A masih dapat diturunkan 20,2% (lihat


diagram). Kerugian/kehilangangula yang mestinya tidak terjadi sekitar
6,56/100x ton retes. lnilah yang disebut €rhcustdbfldtyof rnolosses(kemung-
kinan pemerahangula lebih lanjut dari tetes). SementaraHK tetes'ideal
belum diketemukan, target HK tetes yang dirumuskandalam Tabel 3 dapat
dianggap HK tetes ideal. Dengan rumus SJM, gambaran tentang kerugian
yang diderita pabrik dapat dihitung.
Pm

fif,=w=Q,202
Pg = 0,202 Pm
Fg Pmo
100 30,72

Jika kadar sakarose tetes 32,50 dan produksi tetes setahun 18.000 ton,
=
maka kerugian gula sebesarA,202 x32,5A = 6,56% tetes 1.182 ton akan
diderita oleh sebuahpabrik gula berkapasitas3.t000 tth lama giling 150
hari denganhasil tetes 4% rebu.

Manajemen dapat mernanfaatkanangka-angkatetes untuk pelbagai


pepgambilankeputusandi bidang agroteknologigula, baik di dalam maupun
di luar pabrik, Manajemen agroteknologi itu secara langsungmemberikan
gamhraran keuangandan akibat-akibatsosial.

Dalam buku Sistem PengawasanFabrik Cula, Penulismenganjurkan


agar sogolandan pucuk tebu tidak perlu turut digiling jika HK sakarose
niranya sama atau kurang dari HK sakarose tetes didapat atau target
HK sejati tetes, Dari l-{K dapat ditentukan korelaginya dengan panja
sogofan dan pucuk tebu area! setempat. Data lain yang menunjangyak
k (= sakarose/gula reduksi) dari pucuk tebu, sogolan, tebu muda,
-
kefewat masakdan tebu wayu yang mendekati k tetes (sekitar 1,3 1,6r.

Pembelian gula rnangkok, nira pekat dan semacamnyauntuk dio


131

rnenjadi gula pasir, dapat diperhitungkan rlengan rumus SJM berpedoman


padaHK sejati yangdidaPat.

Proses pengolahan yang baik ditandai dengan bedi praktis tetes


nol atau hampir nol, atau tetes dalam keadaan tepat jenuh (tetapan
kejenuhan; 1). Untuk mencapai hal itu, HK masakanakhir ditetapkan
denganrumus SJM dinranaM = target HK pol tetes.

Target HK nnsakan akhir

Menurut tenminologi lndonesia,YanB disebut masakan akhir ialah


masakan D, walaupun skema masakan hanya cJibagidalam tiga tingkat,
ABD atau ACD, Dengan menganggaptarget HK tetes adalah HK tetes
ideal (Mo), nraka target FIK masakanD adatah l--lKmasakanD yang ideal,
narnunrrrasihdapat dicapai (dapat diperoleh),

Pmsk Do = HK gula ideal = '100,


Jo^ 50
Jo = target l-{K masakanD
Mo = tar8€t HK tetes
PemerahanmasakanD
FoO
= _----.:--a-- x 100
PmskDo
(Jo -
= #50x 1 0 0Mo)
Prno Jo (5o - Mo)
M0
x 'roo
=ffi,*s*#*i-
Pemerahan masakan (A, B, C, D) yang baik antara 60 dan 65 untuk
yang diputar satu kali; 62 - 67 untuk pahrik-pabrikgula
masakan-masakan
putih perkebunan. DenganmengambilpenrerahanmasakanD = 67, mak,a:

TargetHKmasakan D = Jo didapat dari


'lo0 (J_o- Mo)
x 100 = 6 7
Jo (100- Mo)

Misalnya target HK tetes (Mo) = 30, Jo = 5605.


132

XIII, BOBOTHASILANTARA, :
I-IASILSAMPINGDAN HASIL AKHIR

Bobot dari bahan-bahan yang akan diuraikan yakni bahan-bahan


baku dan hasil-hasilakhir dari stasiun-stasiunpemurnian, penguapandan
kristalisasi.Bobot bahan-bahanlainnya akan dibahas pada Bab Vl (Neraca
bahan)"

A" Nira Mentah

Bobot nira mentah telah diuraikan dalam Metode pengawasan


Silingan. Bobot nira mentah lazimnya didapat dari penimbangan,adakatanya
dari pengukuranisi. Di luar negeri, nira mentah mungkln tidak ditimbang
jika dilakukancarakerjanira kotor kembalike ampas(nkal.

Cara pencocokan(inferentiai methadldi Hawaii pada hakekatnya acla-


lah cara yang luwes, boleh digunakansebagaicara baku, boleh juga sebagai
cara tarnbahan(pengawasaninterm untuk meneliti kebenaran angka-angka
pengawasangilingan). Sebagai cara baku untuk pengawasangilingan, tebu,
air inrbibisi dan anlpas tidak ditimbang, hanya nira mentah saja yang
ditimbang. 5etelah melalui serangkaian perhitungan yang melibatkan
data analisis kadar sabut tebu, maka diketemukan angka perbandingan
keempat bahan (T : | : NM : A). Dengan mengeplotkanpada bobot nira
mentah ditimbang, rnaka T, I dan A dapat dihitung.

Sebagai cara tambahan di mana T, I dan NMK merupakan hasil


penimbangan,maka kebenaran pengawasangilingan dapat diteliti dengan
mengeplotkan angka perbandingan rxda bobot tebu atau nira mentah.
Jika berpatokan pada bobot nira mentah tertimbang, maka kebenaran
penimbangantebu dapat diteliti. Jika berpatokanpada bobot tebu, kebenar
penirnbangannira mentah dapat cliketahui..Jika terjadi perbedaan y
menyolok antara bobot ditimbang dan bobot dihitung, perbedaan
menjelaskanadanya kesalahan pengambilan contoh, analisis, peni
dan perhitungan. Kenrtrngkinandilakukannya kesalahansecara sistema
akan dapat diketahui dengancara pencocokan.
133

Secanahari-hati diberiakan3 (tiga) macamboLct nira nrerrtah:


1. NlvlK (bohrotnira nrentahkotor) yakni bobot nira mentah tertinrbang.
2. t"ltvl (bobot nira mentah bersih) yakni hobot nira mentah tanpa kotoran
kasaryang disebutkoreksikotoran.
3. NM' (bohotnira mentah tak terkoreksinka/ins)yakni bobot nira nrentalr
setelah dikurangi bobot hahan yang rJikembalikan sebeiurrr
tinrbangannira mentah; clalanrhal ini ialah nira jernih yang nrasuk
ke nira mentah karena pengenrbaliannira kotor ke ampas, atau
nira seduhanyang cligunakan
sebagaipenggantiair inrbibisi.

Dari bobot-bobotnira menrah cli atas diturunkan:


4. F' nrnk yakni ton koreksi kotoran (yang sebenarnyasabut) dalanr nira
mentah tertimbang, nrelipuri kotoran yang berasal clari t.ebu
dan kotoran dari nira kotor yang nuslrk ke nira mentah.
Fnrn yakni ton koreksi kotoran yang irerasaldari tebu.
5 . P n m ' y a k n it o n p o l n i r a m e n t a ht a k t e r k o r e k s n
i ka/ins
Pnm yakni ton pol nira mentahrerkoreksinka/ins.
D e m i k i a np u l a B n n r ' d a nB n m .

Dari 4 dan 5 rJiturunkanTo kotaran tebu, o/opol dan % brix nira mentah
terkoreksinka/ins.

NMK = NM'+ F'nn:k Pnnr' = Pnm + Pnjnk atau Pns


NM' = NM + NJnk atau NS pnm = 100 Fnni/NM
F"lKnm= 100 pnnr/bnnr
B. Blotong
Bobot brlotong(bungkil) lazinrnyadiketahui clari peinimbang,an,
acla-
kalanya cukup dihitung atau sebagai faktor tetap. 'L)ua
cara terakhir ini
tidak dianjurkan.

1. Penimbanganblotong
,Alat angkut yang digunakanialah lori (kacip) atau truk. penetapan
tana untuk lori {kacip) biasanyadilakukan di luar rnasagiling. Tara untuk
truk dilakukansesaatsebelumdinruatiblotong.Dari bobot bruto dan tara,
clapatdiketahui bobot netto yakni bobot blotong.
Penimbangandilakukan pacla tinrbangan tebu atau timbangan ten-
sendiri, Peneraan timbangan seperti pada tinrbang,antebu. Selama musim
giling, tara (larilkacip blotong) sewaktu-waktudiperiksa,
134

Hinggakinipabrik-pabrikkarb<rnatasimasihmembakukanapit
Karena sifat endapan-
saringan(presan, filterpress) untuk menapisniranya.
bahanpenolong
nya yang kasar, kompak dan banyak, maka tidak memerlukan
tradisional juga
ampashafus(bagaciua). Pabrik-pabriksulfitasi dan defekasi
halus'
masih menggunakanpresan,biasanyatanpa bantuanampas
penapis
Pabrik-pabriksulf itasi dan defekasi motlem membakukan
halus sebagaiba-
hampa kontinyu (contdnuousvacuilm filter) disertai amPas
dikehendakiperhitungan
han pembantu(mempercepat)prosespenapisan.Jika
dipandang
yang agak lebih teliti, bobot blotong hasil peninrbangandapat
(BL')' Dengan mengambil
sebagai bobot blotong tak terkoreksi ampas halus
kadar gula blotong
ampas halus % blotong rata-rata 15%, maka bgbot dan
terkoreksiadalah:

EIL = 0,85 BL'


pbl = ('100pbl'- 15 Pa)/85

2. Perhitungan bobot blotong blotong tak ditimbang)

a" Penapisan nira kotor tanpa ampas halus

Zatkeringadayang|arutdantaklarut.Perhitungan
% zat kering tak larut dalam blotong:
* zktl blotong = zkbl - bbl

dengan rnenganggap : FIK blotong = HK nira taPis

'100
maka bbl = Pbl/HKntaP
pol dan zat kering blotongdidapatdari analisis'

Perhitunganton zat kering tak larut dalam blotong:.


-
c BCnm mengendaP= Bnm Bne
= Pne
denganmenggunakananggapansementara: Pnm
maka Bne = 100Pnm/HKne
' '
(HKne didaPatdari analisis)'
135

o Ton endapanekstra (garam Ca) = faktor CaO x ton CaO


Faktor CaO untuk karbonatasi dan sulfitasi = '1,8 diperoleh dari
BM caco3/BM cao = 1,8 sedangkanBM caso3/BM cao sebenarnya
2,'14tetapi karena ada gas so2 yang lolos (sekitar 1s%) maka faktor
menjadi 1,8.
Faktor CaO untuk pabrik defekasi= 1,0.

r Ton koreksikotorandari nira mentah(Fnmk)


,
Fnmk=NMKxfnmk/100

# Jadi, ZKTLbI = BCnrn mengendap+ ton ganamCa + Fnmk

'o-u
Ton blotong = " -* x ton zat kering
- tak larut dalam
Tozat kering tak larut U6toni
dalam blotong

n.
s L = f f i x100 ZKTLbI

b. Penapisan nira kotor dengan arnpas halus

PerhitunBannya seperti pada blotong tanpa ampas harus, dengan


perbedaanperhitungan ton zat kering tak larut yang melibatkan ton sabut
dalam ampas halus. Pemakaian ampas halus tiap 100 tebu rata-rata =
0,5.

I AnggapansementaraPnm = Pne tetap digunakan.


Bne = '100Pne/HKne = 100 Pnm/HKne
BCnm mengendap= Bnm - Bne
o ton endapanekstra (garam Ca) = 1,8 atau "1,0x ton CaO
o Fnmk = NMK x fnmk/'100
o ton ampashalus= -9& * f
i 0 0 A '
ton sabut dalarn blotong dari ampas halus:

Fbl=#"ffixr
fa (kadar sabut ampas)dipenolehdari pengawasangilingan.
136

ZKTLbI' = BCnrn mengendap+ ton endapanekstra + Fnmk + Fbl

BL' =
;#3r- x XKrLbl'
B L * 0,85 tjl_'
pbl = ('100pbl'- '15pa)/85
Pbl = BL x pbl/100,selanjutnya:
Fne = Pnrn- Pbi.

3. Perkiraan bobot blotong

Bobot blotong dapat diperkirakan atas dasar pengalaman-pengalaman


dalam penimbangandan perhitunganbobot blotong tahun-tahunsebelumnya,
Karena angka-angka harian/"|S harian selalu rnemberikan blotong % tebu
yang hampir sama"maka dibuatlahfakror.,misalnya:

blotongPC defekasi + 3%"tebu


blotongFC sulfitasi + 3,5% tebu
hrlotongPC karbonatas! !7yo tebu

Pabrik-pabrik dengan carakerja yang sama, belurn tentu menggunakan


faktor yangsama.

Perhitungan bobot blotong, apalagi perkiraan bobot blotong tidak


dianjtlrkan" Dewasa ini pengawasanstasiun pemurnian masih rawan, bahkan
sangat rawan untuk pabrik gula sulfitasi. Kerawananitu lebih diperberat
dengan perhitungan dan perkiraan bobot blotong. Kelihatannya sederhana
dan praktis, narnun hal itu akan menjadi kendala bagi kemajuan dan
perkernbanganteknologi gula di masadepan"

C. Nira Encer

Karena ada sebagian bukan gula yang mengendap secara kimia


(reaksi pengendapan),abdsorbsi dan penggumpalan ko.loid, maka bobot
nira encei'dihitungatas dasarneracapol, bukanneracabrix.

Pne = Pnm-Pbl
NE= -'vaXPne
pne
137

Pengarnbilan contoh nira encer secara kontinyu ternyata


tidak
mudah.contoh biasanyadisadapdari'pipa pengeluaran(outtet)
pompa nira
encer, dan pipa sadapan yang cukup panjang diserubungi
air pendingin.
Pipa sering buntu jika menggunakanpipa perdaganganyang
biasanya halus'
di luar, kasar di dalam, Teknologipanganpada umumnya
mempersyarakakan
pila-pipa yang halus di bagian dalam. Jika terjadi penguapan
pada contoh
nira encer, maka % por dan % brix akan meningkat.
contoh yang diambil
secaradiskontinyurnemberikankesarahanpor cranbrix
serta data rainnya.
Nira pekat

Bobot nira pekat (Np) dihitung dari neraca brix.


NE
bne

Np=ffixrrrr

AE_bnp:'_bne-xNE
onp

AE = NE(.1-.!re;
onp
bae=0
=NE-NP

Maskan

setiap kali menurunkanmasakan,isinya (rn3 atau


hL) dicatat, contoh
diambil untuk analisis por dan bnix, Dari tabel,
dicari hubunganTo brix
masakandan ton brix masakantiap m3 masakan{q brix/hL)"
Secara urnumberlakul:

ton masakan= =J00 -- tcn brix masakan


vobrix masakan 'l
-*i:--__-_

x m3 masakan
mJ masakan.
138

pemberian
Ton gula dan ton seterup dari masakan yang diputar tanpa
'siraman dapat dihitung dengan neraca bahan (segitiga brix)' Karena
air
pada.pemutaranpertamasudahdilakukanpenyiraman(denganjumlah
airsedikit)yan8biasadi|akukanpadapabrikgulaputih,maka
(segitigaHK)'
perhitungannyamenggunakanneraca brix
(dengan
Sebagai contoh maskan A, pada pemutaran pertama
pemberianair siraman)diperoleh gula A dan seterup A'
BmskA
HK=J

B eulaA
BmskA
= s:]fr-
J . M

BstrA S . J
= 5:1fr
E ms[-A

B gula BstrA
HK=S HK=M

ton gula A = x B gulaA, atau:


;Z#X-

ton gula A ## A
x Bmsk
6-#F.

ton seterup A = T#.ffi' xBmskA

Selanjutnyajikagu|aAdariputaranpertama(A1}diputarpada
pemhrian air siraman'
pemutaran kedua dengan cairan pencampur air dan
makatongu|a42danbilasanAdapatdihitungsebagaiberikut:
139

B gula Al
HK gula AI

B gula BbilA
HK gula HK bi} A

B gula ,42 l-JKgula At HK bil A -


_-
B gula41 HK gula42 - HK bil A

HK gulaA1 - HK bil A
ton gula AZ = x B g u l aA 1
HK gula42 - HK bil A

B bil.A HK gula 42 - HK gula 41


B g u l a4 1 HK gula 42 - HK bil A

100 HK gula 42 - HK gula A1


ton bilasanA = X x B g u l a4 1
b , b i lA HK gula A2 - HK bil A

perhitungan masakan/gula/seter'up/tetes/b.ilasanlainnya
untuk
menggunakan nretode yang sama. Dalam hal digunakan cairan/larutan
pencampur bukan air, misalnya bilasan, nira pekat atau nira encer' maka
perhitungannyatetap sama dengan cara tersebut, hanya saja sedikit lebih
panjang.
140

D. Tetes
untuk cairan cocok untuk
Pada umumnya, timbangan-timbangan
penimbangantetes.'Setiapka|imenimbanStetes'taraditentukan;tidak
dibenarkanmenggunakantara tetap'

Timbanganyangdigunakanbiasanyabasku|ataujembatantimbang
dengandayatimbangyangbesarsehinggafrekuensipenimbangankeci
udara (berbuih)' penim-
Karena tetes mengandunggelembung-gelembung
yang mengukurtekanan
banganyang tebih teliti menggunakanweumercfdor,
yang tidak dipengaruhigelembung
hidrostatik pada dasar bejana timbangan
Sas.PipaUberisiairraksa(Hg}dipasang,darisinitekananhidrostati
dapat dibaca.

A p = p g h

(Pa),diamati
A p = tekananhidrostatik
(kg/m3)' diamati
A = densitastetes tanpa uclara
o
t)
= percepatangravitasi(9,81m ' '-t)
[ = tinggi kolom tetes (m), dihitung'

PengisiandanpengosonBanbejanatimbangharusper|ahan.|ah
agartidakmembawaudara.Tetesyangturundaria|atpemutar(sentrifuga
menanjak dan masuk ke dalam bejana
diatirkan melalui saluran yanB agak
turun ke dasarbejana'
timbang melalui salurandari atas

SeteIahditimbang,tetesdidinginkandandiencerkandengana
dilakukan sehinggasuhu kamar
yang telah diketahui bobotnya, Pendinginan
pada pemakaian' Dalam
(maksimum 35.C) dan pengenceran tergantung
cjensitas tetes encer mengikuti syarat
hal tetes dijual, maka brix atau
yang ditentukan Pernbeli'

Pengencerandanpenimbangandapatjugadi|akukansebe|umpenim
yang dianalisis sama dengan
u"ne"n, ";;r; harus diingat bahwa tetes
tetes YangditimbanS.

Penyimpanantetesdipandangcukuprawan.Te|ahbanyakriway
141

terjadi karena
tentang meledaknya tangki penyin"lpantetes. Peledakan
oleh reaksi
kelebihantenaga, dan tenaga adalah panas.Panaselitimbulkan
(aksi mikroorganisme)'
isotermik yang diyakini bukan karenareaksi biokimia
yakni reaksi antara asam
tetapi reaksi kimia Maillard (browningreactfon)
gas' Walaupun
amino dan guia reduksi;reaksi ini isotermikdan menghasilkan
praktis untuk
penyebabnya belum diketahui secara pasti, namun usaha.
tetes setelah
mencegah peledakan dapat dilakukan dengan pendinginan
penyim-
clitimbang dan selama penyimpanan.Pengamatansuhu tetes dalarn
panan seharusnyarnenupakanpengawasanrutin" Tangki tetes maksimum
atau venti-
berisi 213, ruangandi atas tetes dilengkapi klep-klep pengaman
besi/logam'
lasi. Jika tetes disimpanpada bak, bak seharusnyadibuat dari
Bak dari beton (pasangansemen)betapapunkuatnya akan mudah diretakkan
oleh tetes, karenasifat beton yang ticlakelastis'

Reaksi eksatermik sebenarnya berlangsung makin cepat apabila


pada
panas yang dihasilkan segera ditiadakan, namun reaksi akan berhenti
Maillard yang
suhu di bawah suhu terendah yang dipersyaratkan' Reaksi
pada
eksoterrmikdan menimbulkan ledakan tarnpaknya hanya berlangsung
diturunkan
suhu di atas 400. Jika suhu tetes tidak terkendali dan sulit
dengan pendingin air, rnaka dapat dilakukan pendinginan dengan cairan
(titik didih - 'l'190c) pada73 at'
co2, cairan dimasukkanke dasar tangki
mosfer),gasdingin ini tersebar,rnendinginkandan mengaduktetes.

E. Cula
panas yang
Cula utarna yang turun dari putaran dikeringkan dengan udara
dingin
berkelembaban(mutlak) agak tinggi, atau lebih baik dengan udara
gula,
dengan kelembaban yang rendah. cara kedr"laselain mengeringkan
juga rnendinginkan;sayang cara ini jarang dilakukan. sabuk pengangkut
(belt convelarr),talang goyang(Emshopper G?rn€ycr) clanperalatan-peralatan
yang rnengerjakanpenyelesaianhasil dibuat tertutup agar'debu dan ampas
pa-
halus yang beterbangancli udara tidak rnengotori gula. Di lndiaoada
brik-pabrikgula yangryplskukan sterilisasidengansinar ultra violet.

Cula yang sudahdidinginkanhingga suhu kamar dan memiliki kadar


air di bawah batas maksimum(misalnyauntuk gula putih A'ASfr)ditirnbang,
142

atau manua|. Bobot bersih


dimasukkan karung, dijahit, secara otomatik
dikurangi bobot karung'
gula setiap karung yakni bobot kotot" tiap karung
'100 contoh karung, kemudian
iouot karung ditetapkan dengan mengambil
teliti dan dirata-rata bobot tiap karungny;r'
100 karung itu ditinrbangcJengan
gula melakukan pen8-
Demi p€nyerapantenaga kenja, pabrik-pabrik
angkutanguladaripabrikkegudang,danpenyusunanguladidalamgudan
dengantenagamanusia,yakniditlsungdiataspungguns.Bobotgulatiap
hampir tidak manusiawi'
karung sebesar100 ke hetto) makin lama dirasakan I
Yangmanusiawiyakni50kg/karung,denganmengambilambangba
dengan bobot orang yanS
bahwa bobot sekarung gula maksimum sama II
mengang,kutnYa. I
karung goni (rosela)'
untuk menjaga kebersihangtrla dari serat-serat I
plastik yang sebelumnya telah ditusuki denga"
seringkali dilapisi karunB I
Hal ini dilakukan a8ar panas di dalam karung dapat keluar'
paku-pakubaja.
'sehingga I
gula tidak berwarnakuning' I
pabrik-pabrik guta rnerah biasanya menyimpan gula dalam timbunan
I
dan mingguan mencantumkan bobot gula ('!uga
Oulk storcge). Laporan harian I
1 kg. Dari sudut neraca pol, 1 kg gula hampir
tetes) dengankatelitian lringga I
mentah. Dari sudut neraca bukan gula' 1 kg tetes
setara dengan 10 kg nira
I
143

XIV" PERKIR.AANffAKsAsI)

A. Teori (Prinsip)

Di Indonesia, laporan pengawasan pabrik gula dilakukan harian


'15
clan harian (tanggal 1 - 15 dan tanggal 16 - akhir bulan). Di luar negeri
kebanyakanrnelakukanlaporanharian (untuk intem pabrik) dan laporan
"Kalender" pahrrikgula berbedadengantanggal-
mingguanuntr.lkmanajemen"
an Masehi, lslam dan Jawa. Satu hari giling ialah Jangkawaktr.lantara
pukul 6.00 pagi hinggapukr.rl6.00 pagi hari hrerikutnyadalam masa giling.
Jadi, untuk lndonesiapenutltpanpcriode (rnasa)dilakukan tiap-tiap tanggal
'16 '1, pada pukul 6.00 pagi.
dan tanggal rnasing-masing

Tujuan taksasi ialah memperkinakanselisih ton pol (serta ton brix)


dari bahan-bahanyang sedangdiprosesyang berasal dari tebu yang digiling
antara penutl'panpeniodeini dan penutupanperiode yang lalu.

Misalnya mesin giiing suatu pabrik gula terdiri dari 10 periode,


maka persamaantaksasiadalah:

t a H1 01
T2 O1 H2 A2
T3 A2 H3 o3

T9 Og Hg * o g
Tro 09 Hto

T1 + + T1o H1 + H2 +.., + H1o

ton tebu digiling pada periode ke-i


( i = 1 , 2 , 3 n " " . " " " . . -'.!,0 )
H s ton pol (sertaton brix) daiam hasil gula dan tetes tertimbang
O = ton pol (serta ton brix) dalarn perkiraan ($tock on hsnd).
144

Denganmengambi!contoh nnasaini adalah periode lll' maka:

T 3 + O2 O3

T3 (O3" o2).
- (per-
Ton gula cJihasilkandari tebu T3 sebesar!*13(tertimbang) dan 03 02
dari bahan-bahan
kiraan masa ini - masa lalu). Ton gula yang diperoleh
gula sekrap
yang singgah(tidak berasa! dari tebu yang dlgiling) misalnya
yang diolah,pengolahan
tahun lalu yang cliolahkernbali,gula dari pabrik lain
prinsipnya'
gula rnangkok,dan semacamnyaharus dihitgng tersendiri' Pada
dan perhi-
laporan pengawasanpabrik gula hanya rnenyajikanangka-angka
tungan bahan-bahandari teLruyang digiling'
pada akhir periode
Sennuapabrik guia berkewajibanmelakukantaksasi
('15harian untuk Indonesia.mlngguanuntuk luar negeni). Sementarapabrik
untuk pengawasan
ada yang rnelakukan taksasi harian. rnaksudnya ialah
pol clan tgn brix taksasi
intern, atau kebanyakanuntuk tujuan latihall, Ton
dalam laporanharian'
harian tidak cjimasukkan

B" Data untuk Taksasi


pol dan ton brix
Taksasitidak dimaksudkan untuk mengetahu! ton
tujuan taksasi yang
seluruh bahan yang sedang diproses, Sebagaimana
untuk rnengetahui
telah dinumuskanpada parag,raf A, taksasi dilakukan
yan8 sedangdiprosespada
selisih ton pa! serta ton brix dari bahan-bahan
pengt'lkuranbahan-bta-
penutupanmasa ini dan masa lalu. Dengan dernikian,
penuh tidak diperlukan'
han dalarn pipa-pipa dan bejana-bejanayang selaltl
)za/2,

s>ri>a-7/pa 3zang 6tksan5-a e--zzr'Z ?az/e/

l-etgsaas nenlBwa alar'ta? )-aPE

1*qr gs\-ae\r \\\\Bx \an \ei5asra*\€1ansa.


nyatanya. Pengarnatandirnuiai dari nira n'rentahtertinrbang ke belakang,
'4-a.z'.-zdr/4-:o/g:2"
'145

, lsi rnasakanAo B, C, dan D dalam pan-pan masak, palung-palungpendi-


ngin dan palung-palungputaran pertarna.
. lsi setrup-setrup A, B dan C dalam peti-peti tunBgu di stasiun putaran
dan stasiunmasakan
lsi bilasan-bilasankotor (wat;erklare), bersih (stoom klare), C dan D da-
lam peti-peti tunggudi stasiunputarandan stasiunmasakan.
. lsi babonan(mcgma, einusurf) dalam palung-palungtunggudan pencam-
pur (rnf,xer/rningler).
. Bobot gula belurn ditimbang (pada sabuk pengangkut, talang goyang,
saringandan silo).
. Eobot gula krikilan, gula halusdan gula kotor.
2, Data analisis (pol, brix, dan HK) terakhir/jarn terakhir dari nira, rna-
sakan, setrup, bilasan dan babonan"untuk masakandalem pan dilakukan
analisissogokan.Kadar po! dan bnix gula urtun"tnyadianggap100.
3" Tabel hubunganantara % brix dan ton brixlm3
4, Data anaiisis poln brix dan HK gula dan tetes diarnbiNdari nrasa ini;
di Hawaii diarnbilkandari data jumlah (to date reqrt).
5. Data ton pol dan ton brix taksasi masa lalu (satu periode sebelum rnasa
'
i*i) did"pat dari cara 'l - 4 untuk masa lalu.

Daianr taksasi, ton masing-rnasingbahan tidak diperlukan, sebab yang


dicari adalahton pot dan ton brix. Dari Tabel XVlll Bulletin 'l'1,ton brix/m3
dapat diketahui dari % brixnya, Ton pol dicari dari ton brix dan"HK.

Perlakuan da|am taksasi perioclesatu dan fainnya haruslahsanna,artinya


macam-rnacarnpeti tarik dan bejana-bejanayang diamati sarna. Jika pada
waktu taksasi (5,oo' 6"00)terjacti pembenhentian6iling, maka bejana-bejana
dan pipa-Ftpa yang biasanya penuh kemungkinan dalam keadaan kosong
3r., tidak penuh" Jadi, ton pol dan ton brix menurut pengarnatanbiasa
harus dikurangi dengan ton pol dan ton brix dari kekurangan isi darl be-
jana-bejanadan pipa-plpa yang biasanla p.:nuh" tsolehjadi hasilnyanegatif.

C. Pelaksanaan

Fetugas menrhawa daftar yang rnencantumkan jenis dan volume


penuh dari peti-peti tunggu dan bejana-bejanayang akan diamati volume
nyatan)ra. Pengarnatandirnulai dari nira mentah tertimbang ke belakang.
Ci lingantidak ditaksasi.
146

Peti.petidanbejana-bejanaseharusnyadi|engkapidenganpet,unjuk
kaca pelihat' atau yang lebih sederhana
permurkaan(level rndicator) berupa
{untukpeti.petitunggu)pe|ampungbesertapenunjukyangdapatmembaca
men'ie-
tersedia, isi peti diamati clengan
skala isi. ".fikalevel indfcator tidak
dengan tangan untuk memperkirakan
nguk, atau dinding luarnya diraba
batasantarayanghangatdandingin.Carainisepenuhnyirseniyangsansat
subjektif dan tergantungdari pengalaman'

Cairan.cairanyangseluruhbagiannyaberbuihtakdapatdiamati
seca!.a|angsung"Carapraktisdansederhanayaknidengantabungyan
hinggadasar pet!, kemudianujung
dapat diamati islnya" Tabung.dicelupkan
(perlu rliseka rnekanismenya)'setelah
rabrungbawah ditutup dari clatam
semuagelennbung gas naik ke permu-
dibiarkan beberaparnenit, atau setelah
kaan,perrnukaancairandapatdibaca,daritinggidikonversikankeisi
cairan dalam bejana.

Pengukuranbrixnira/setrup/bi|asansecararefraktometrikpada
saattaksasictipandangtidakperIu(rnerepotkan).Untukmasakanyan
yang betum nnemasir diukur
sudah rnemasir rJilakukan analisis sogokan;
dengan HK yan8 diperoleh
brixnya secara refraktometrik, selanjutnya
clari laboratoriurndapat dihitung polnya'

Bcbotgu|abe|umditimbanglangsungcliperkirakan;atau'nru|a.mu|a
ciensitassemu gula (sekitar
clipenkirakanvolumenya, kemudian dikalikan
0,80 - 0,90)' Densitassernudimaksucl-
s00 - 900 kg/m3 atau breratjenis semu
- kgl
kan untuk bulkdensdty,sedangkan densitassejati gula sekitar 1550 1600
-
nrl atau berat jenis 1,55 1'60)'

D" Perhitungan Taksasi Menurut Rumus Hornrnes


= masa ini' m'l' = masa lalu' dan
Dengan mengarnbi! notasi m'i'
perk = Perkiraan,maka:

Pperk Pperk m.i. Pperk m.l.


Bperk Bperk m.i. Bperk m.l.
BGperk Bperk Pperk
147

pada akhirnya seluruh pol dan bukan guta dalam perkiraan akan didapat
dalam blotong dan kehi-
dalarn hasil dan tete$. Kehilanganyang diketahui
yang menjadi kristal dalam hasil
langan tak diketahui diabaikan. Ton pol
dalam tetes total (Pm') dalarit
{Kh} cJanton pol yang tidak rnengkrista!
perkiraan dirumuskansebagaiberikut:

Pperk = Kh perk + Prn'Perk


Khperk = Fperk - FM (BPerk' Fperk),
= F M BGperk
Pm'perk = FM (Bperk- PPerk)

'15
Dari angka rata-rata hari cliketahui:

4
Faktor tetes (FM)
HKm pm Pm
= G =

100 - HKm bgm BGm


* - (bh - ph)
2, Kadar kristal (hbalur)dalam hasil ph Fftrl
100
Faktor kristal (hablur)hasil =
ph - FM (bh - Ph)

(Hper"k)
Jadi, ton hasil clalarnperkiraan

100 x Khperk
ph - FM (bh - Ph)

(Mh perk) = Hperk - Khperk"


Ton tetes cialamhasil cialarnperkiraan
- 100 - x Pm'
Ton teles total dalam perkiraan {M'perk}
pm

= M',perk- Mhperk
Ton tetes akhir dalam perklraan (Mperk)
dan rendemen tebu di-
Angka-angka rendemen ka'istal, rendemen winter
+ kristal dalam hasi! dalam
dasarkanatas kristal dalamrhasil tertimbang
perkiraan.
148

(!

E
f g
o t\t
o. r!
tr G F .!
{n J
Itr $ -| d
.:
J
t
. 7
-
E
E
8.
.E d
c
r- a k^ = rd
o ts .!
*-v T H . t -c o
S J
f- J
C
q o L
E tr* i5{ o
L

t\t_ ts o
- E

-g s-
-S -c
c
ri GV t d.C .F 8. o
'6
v\l = E = d = v r <

(!
]f, a 5 (It
(,l
+J ! q 6 v, J
.9 . E g o
.p f\t
l- .! q) o
\l ) 4 F F E
sfi
E
c
c,
s
- ltt
c ({ !
t$ d o
t! .: U
.! J ts
J t- t-
t o o
o o g
o- F ^ c
|It
E F+ !
5 'i- nO
'lf.{ 6 rco ?o
o
.Il .d: fit
! U v
v o (d
b(} +a
L
th o
{'' o g
+J
IT o c
I F (o
l-

I
DID
.g
o
v
r!
-o
E
nt
E
fit
u
E
- o
?
x v
t c
fC lH-
E=
.t-
l-

d8.
149

Contoh:

ton pol perkiraan masa ini - nrasalalu 589,4


ton brix perkiraanmasaini - masalalu ' 759,2
l-iK tetes 32J6
pol tetes 30,95
brix tetes , 94,17
pol hasil 99,68
brix hasil 99,97
ton hasil tertirnbang 3 9'16,400
'2
ton tetes tertimbang A69,100
ton tebu digiling 52 748,4
akan dihitung rendementebu dan t€tes % tebu.

Perhitungan:

1. Faktor tetes (FM) = =Ll5[ ", . = ==12,76=-=,


- = O,4g721
100 - HKm 10Q- 32,76

2. Kadar kristal hasil (kh) = ph - FM (bh - ph)


= 99,68- A,48721$9,97- 99,68)= 99,53871
,1,00463
Faktor hablur hasil = _100 . .- =
99,53871

3. Pperk=589,4
B perk = 759,2
ton kristal hasil dalam perkiraan(Kh perk)
= - FM (Bperk - Pperk)
. Pperk
= 589,4 - A,48721959,2- 589,4) = 5O6,67
ton hasil dalam taksasi(Hperk)
= faktor hablur x Kperk
= '1,00463x 5Q6,672* 509,0'16
ton hasil didapat(H)
= ton hasil tertinrbang+ ton hasil dalam perkiraan
= 3 9 ' 1 6 , 4 0 0+ 5 0 9 , 0 1 6= 4 4 2 5 , 4 1 6
1s0

ton kri$tal didapat(Kh) = Kh tertimbang+ Kh perk


- '99'JJg71(3 916,400
+ 506,67)

"r", fi*g x4425,416


= 4 405,00

tebu=$ * 1oo=ffix
5" Rendemen 1oo=9:1:

6. Ton pol dalam tetes total (tak menghablur)dalam perkiraan ffim perk)
FM (Bperk - Pperk)
= O,48721{759,2- 589,4)= 82,73
pm = 30,85
ton tetes total dalam perkiraan (M'perk)
= 268,169
=-3ffi x 82,73
=# x Pm'perk
Karenahasil terdiri dari kristal dan tetes, maka
H perk = Kh perk + Mh Perk
Mhperk = Hperk - Khperk = 509,016- 506,67= 2,346

7 . Ton tetes akhir dalam perkiraan(Mperk)


= M'perk - Mhperk = 268,'169- 2,346 = 265,823
Ton tetes akhir ternrasukperkiraan (M)
=Mtertimbang+Mperk
= 2 069,100+ 265,823 = 2 334,923
iln 2 334,923 100=
Tetes% rebu=t * 100=ffi x !13=

E. Perhitungan Taksasi menurut l55CT

Perbeclaannyaclenganperhitungan taksasi.,rnenurutrumus Hommes


( l n d o n e s i ay)a k n i :
'1. rumus SJM Noel Deerr
ISSCTsecarakonsistenrnenggunakan
(J = HKperk, S = HK hasil dan M '= HK tetes)'
(segitiga
2. .Ton hasil dan tetes dalam perkiraandihitung melalui neracabrix
HK), atau melalui neracapol (segitigaHK rangkap,rumussJM).

Dengan contoh cjata paragraf D, perhitungan dilakukan sebagai


berikut:
151

1. Ton hasildan ton tetes dalam perkiraan

HK perk = .PP9rI. = I9L1 x 1oo = 77,63


' Bperkx 1oo Wz
=
HK hasil = Pb x 100
bh ffi x'loo= 99,71
Hk tetes = 32,76

Neracabrix:

Bperk * 759,2
HK perk 77,63

6fu perk = Hk perk - HKm


E per[ gfi;:--i1g;

Bh perk Bm perk
HKh 99,7',1 HKm 32,76

Bh perk = 77,63- 32,76 ..


^ TSI,Z = 50g,g2
w7T:776
H perk =# xBhperk =# x 508,82 = 508,973
'!, 50910

Bm perk = B perk - Bh perk = 759,2- 508,82 =.250,38

M perk = 100 x Bm Perk = S* 250,38 = 265,88'1


x^ &Jv'rv
I* iqn ,\, z6s,g

Di samping melalui neraca brix, cara lain untuk rnenghitung


hasil dan ton tetes 6lalamperkinaanialah rnelalui rreraca(runnus$JM).
152

Pperk= 589,4
J 77,63

The"lk s(J-M)
P perk fTffii

Fh perk Pmperk
s 99,71 M 32,76

Ph perk =
ffix5Be,4
0,8608 x 589,4 - 5O7,37
rnhr
H perk = S
pn * Fh oerk =3'frh x 507
'37 = 508,999
'\, 50910
Pm perk F perk - Fh perk = 589,68 x 5Q7,37 = 82103
100 = 100 x 82,03
M perk x rm perK = 265,899
pm mFs
'r, 265,9

2, Ton hasil dan ton tetes total (termasukperkiraan)

H = Htertimbang + l-l perk iraan 3 916,4 + 509,0 4 425,4


M = Mtertimbang + M perkiraan 2069,1 + 265,9 2 335,0
a4
Tetes fo tebu = #. x
I
1oo= #*x 1oo= !:!:=

Ton hasil dan ton tetes termasuk perkiraan, yakni H dan M, merupa-
kan data untuk pelbagai perhitungan neraca, kehilangan dan efisiensi.
Untuk pabrik g,ula,neraca dan kehilanganydng terpenting yakni pol, Dari
sini, H dan M perlu dikonversikan ke ton pol hasil (Ph) dan ton pol tetes
(Pm). Data Fh dan Pm ini sudahtersediadalam buku jumlah.

untuk contoh perhitungan sesuai data yang diketahui pada paragraf


D, Ph dan Pm dihitungsebagaiberikut:
153

Ph = x H = i k f f x 4 4 z s , 4= 4 4 1 1 , 2 4
s
P m = A
100 100

Hasil merupakan caffipuran gula murni dan tetes. Pol yang menjadi gula

m u r n iy a k n i :

ESC (ton setarakistal atau SK)


- (bh - ph)
= Ph - '0,4 (tsh - Ph) - ph 0'4. x Ph
ph
= (1,4 - 40/HKh) Ph

= { 1 , 4 ' 4 0 1 9 9 , 7 1 ) 4 4 1 1 , 2 4= 4 4 0 5 , ' 1 ' l

3, Rendementebu

a. Atas dasar pol, disebut yield

= fh * 1oo= +,4:1++
x 1oo= 8,36
T 52 748,4
b. Atas dasarsetarakristal, disebut yield esg

= : x5K '\ 1'-J 4 406,11 - { 0 0


0 O- * ' ==gg
T 52748,4
(kebetulansamadenganrendementebu kristal Hommes).
154

XV. PENERAPAN SI$TEM DALAM PERTTITUNGAN


(INDONESIA DAN ISSCT}

Berikut disajikan data rnasa III (perlode ke-3) suatu pabrtk gula sirlfl
Data p, b, dan HK nm, bl. m dan h dlperoleh darl hltungan balik P, B dan
bahan.
T 53102,20 pne I l,
T l2 810,00 bne j t4,
HKne 78,
NMK 5 0 7 3 9 ,3 0
Fnmk 85"10 pnp 50
pnm 10,78 bnp 62
bnm 14,30 HKnp 80,13
HKnm 7 5 ,3 8 Jam giUng 352
LP penEuapan 000
pnpp 13,57
bnpp 17,54 H K m s kA 82,17
HKnpp 77,37 FiKstr A 63,

pnpl 6,77 M ditlmbang 2 2t4,


bnpl 9 ,6 3 pm 27,
HKnpl 7 0 ,3 0 sm 34,
bm 93,07
pnga r,77 zkm 78,21
bnga 2 ,5 8 HKm 29,41
HKnga 6 9 ,6 0 HK sakarosem 36,77
HK sejati m 43,75
pa 1 , gl
zka 5l"26 P perkiraan rnasalnl 817,20
F perklraan mqsa lalu 890,40
Bt r 9 5 V ,4 4 B perkiraan masa lnl I 208,40
pbl 0 ,8 8 B perklraan masa lalu I 320,
zkbl 2 9 ,9 6
H ditimbang 4 819
pntap 10.82 ph 99,75
bntap 14,35 bh 99,95
HKntap 7 5 ,4 4 HKh 99
4 r f
t)3

akan di.hitung:

A. Angka-angka pokok llommes B. Angka-angka pokok ISSCT


l. pt. bt 1" pt
2. konpp 2. ft
3" nt 3. nmutt
4. PSHKnm/npp 4. r'P
5. HPB I dan HPB 5. HPGI
6. RW 6" HPG
7. FR 7. HPG12,5
8" Rt = tkh B . H P G 1 2 ., 5l 1 , s
9. fwot 9. Ph dalam perkiraan
10. fnta 10. nP
11. faktor campur (FC) Ii. RP
12. % pengasinganbukan gula 12. RPSS
13. air diuapkan 1 3. nPG
14, pemerahanmasakanA 14. RPG
15. rendemen }crietal 1 5 . R P G 1 2 , 5l ?. , S .g s
16" kehilangangula (pol) anu 1 6, Rtp
17. kehilangan bukan gula anu 17. Rtsk

A. Perhltungan menurut slstem Hcrnmes Sndonesta)

l. pt dan bt
Pt=Irnm+Fa
T + I = N M K + A
5 3 1 0 2 , 2+ 1 2 8 1 0 = 5 0 7 3 9 , 3 + A
A = 15 17?.,9

Pa = #. A = -i#* 1 51 7 2 , s= 2 7 4 , 6
NM = N M K - F n m k= 50 739,3- 85"1 = 50 654,2

P n m = f Tf Ui xU N M = x 5 0 6 5 4 , 2 =5 4 6 0 , 5
* ipU I
Ft = 5 4 6 0 , 5+ 2 7 4 , 6= 5 7 3 5 , 1

pt = + . ioo=#3# x 100= lg,=eg


156

Ba= #*o
=
ba dihltung atas dasar anggapanHknga HKa atau HKna
| 17
H K n s =a #Dnqa
Hxi00=,ffi"
100=68,60
HKa H K n a = f f i x 1 0 0= H K n g a

ba
ft. Ioo=6f;S" loo= 2'64
= i
Ba
tr# x I5r72,s 400,6
= = 7243,6
Bnm ffi x NM 1?#9x 50654,2
Bt 3 n 6 + B a = ? 2 4 3 , 6+ 4 0 0 , 6 = 7 6 4 4 , 2

br + " r o o =f f i x i o o= : l j j

2. konpp pnpp - 0,4 (bnpp*PnPP)


- i3,57)=
13,57- 0,4{17,54 :l!E

3. nt # " 1 0 0 d a nm t = f f i * n n t
Bnt Bt dan anggdpanbnt = bnPP

NT x Bt=*& x 7 6 4 4 ,=2 4 3 5 8 1 , 5
"iF
nt = **+€*f. roo= 93!J

4 . P s t l K n m / n p=p# * ioo
. Lor
sHKnm=-6#xloo=Wxloo
= 1 " 4H K n m - 4 0

SHKnpp = 1,4 HKnPP- 40

PSHKnm/npp x roo= ffi$x loo


= ffi# = 95,92

s. HpBr = ry- =ryffix NPP


1oo, Bnpp
Karena NM = lgpp + NFL
Bnm = BnPP + BnPl, maka:
1s7

N P P = 9nm - hnpl
l{M' bnpp - bnpl

NPP = Pry-?nPl x NM
Dnpp- Dnpr
= ll'19-- l'^q ^x 5oG54,2
L7,54 9,63
NPL
=
bnpl ffi x 50654,2
= l
29 905,8

Bnpp
1 7 . s 4^ 2 9 9 0 5 ,8= 5 2 45,5
v
100
5v2 4 5 .5
HPBI = -
^ ]00 69,62
7 644,2
Bnm t00 t o o= 9 4 , 7 6
Bt
w
W"
I Vaat{- ====

Lh Ph - FM (Bh - Ph}
R W = s x l 0 0 = x i00
Konm Pnm - 0,4 {Bnm- Pnm)

Konm = W x NM = pnm- 0,4 (Bnm- pnm)


oh - FM (bh - ph)
K h = I.--T06::-:- x H = Ph-f'M(Bh-Ph)

H = H tertirnbang * H perkiraan (maslh dalam proses)

Pada masa (periode) ke-n,

Hperk n-l * Tn # Hn + Hperk n


- Hperk
Tn ---".;' Hn + Hperk o n-l

Dalam haLn = masa inl, maka n*l = masa lalu.

Pperk masa 1nl - masa lalu = BI7,?,- 890,4 = - 73,2


Bperk rnasaini - masalalu = I 208,4- I 320,9= - i12,5

Fr\n = i{Km._ = f f i29,41


q41 = o'4'16631
loo-IiKm
Kperk= Pperk - f'M (Bperk- Pperk)

= - 7 3,2- 0 ,4 i 6 6 3 t(- 1 i 2 ,5+ 73,2)= - 56,8


158

Flperk F FK x Kperk
100
_. =_xiiperk
ph - FM (bh- Ph)
i00 x - 56' 8

1 , 0 0 3 3 4x4 - 5 6 , 8 = - 5 7 , 0
H 4 8 1 9,8+ {- 5 7 ,0 } = 4 7 6 2 ,8
kh , , - P h - F M ( b h - P h )x H
. - x 1 1 = -
Kh rvv 100

+ffi x4762,8=4746,e
- 5 4 6 0,5}= 4747,3
5 4 6 0 ,5- 0 ,4{7 2 ,4 3 ,6
Konm

RW =
ffi" I00= 99,99

7. FR s nt x PSHKnmlnpp x HPB x RW : 1004


= 82,A7x 95,92x 94,i6 x 99,99 : 1004
= 0 , 7 45 8 9 i

s. Rt = tkh= EL . ioo= ffix 1oo= jdt

Rt = konppx FR =' 11,98x 0,74589I= !:11

Rt = (1,4 HPG x Pt - CI,4HPB x bt) RW : 1002

HP G = ff.-too=ffi"loo=
95,21

Rt = { 1 , 4. 9 5 , 2 1. 1 0 , 8 -0 0 , 4. 9 4 , 7 6' i4,40)99,99: 1002


= ( 1 4 3 9 ,5-85 4 5 ,8 29) 9 ,9 9: 1 0 02= 3:11
Rt = H P B x b t (1 ,4H K n m- 4 0 )RW: 1003
= g 4 , 7 6 x1 4 ,4 0{1 ,4' 7 5 ,3 8- 4 0)99,99: 1003= 3:11

0ihat rumusI"1 - 4)"

9, fwor = W" l o o= € - loo


= = Fa*}
{denganmenganggapFnmk 0, maka Ft
= xA
tffix A #
Ft=Fa=
=n?f0e
= %L9-g x ts lzz,e x ls rvz,e= 7377,1
* perhltungan Praktek lnl sebenarnya tidak sesual dengan definlsl
= + = 14,0Q.
seharusnyaFt = Fa + F n m k , f t 1 3 , 8 9 0 , 1 6
159

ft =
**loo=ffixloo=lg,g9
wot = 100- nt - ft - tfnmk

tfnmk= ry x 100= OTfh' x 100= 0,16


wot = 1 0 0- 8 2 , 0 7- 1 3 , 8 9- 0 , 1 6 = 3 , 8 8

= =
fwot
t8*8 x too 27,s3*=gg=
Dalam bulletln 4 dlsebutkan bahwa alr tebu bebas brlx dlgunakan untuk
menelltl kebenaran angka-angka pengawasan glllngan dl mana angka-angka
antara 10 dan 30. Inilah salah satu diantara sekian banyak pengertlan yang
menyesatkandalam sistem pengawasanHommes.

1 0 . fnta = IA1 " 100


nta = ,bu * loo =
onpp #*l0o=1s,05
J.
Ig
= zka-ba = 5I,26-2,64=48,62

fnta = # # x r o o =30,95 t g:

11. Faktor campur (FC) merupakan derajad percampuran alr imblbtst dan
nira dalam ampas. ffta percampurannya td"ul (FC = 100), maka secara
teori susunannira yang terperah {nga} = susunannira yang tertlnggal dalam
ampas.

pateorltis = T#rg x na = +ffi x {100- fa}


= * =
+# x {100 48,62) 0,91
pa teoritis -_ ,00 = 0.,?1 .100
FC * = S0
pffi i ffi _ a {^ ' ,,or ==

Angka tnt kurang mendapat perhatian dalam praktek. Pol ampas hasll
anallsis cara ekstraksi panas (pendidihan I jam) ternyata leblh rendah
darlpada cara ekstraksi dlngin dengan pembukaan se]. Darl slni, angka-angka
HPG, HPB dan FC sebenarnya ieblh rendah daripada yang dthitung pada
A.5, A.ll" 8.5, 8.6. Masih banyak lagi angka-angka yang dtpengaruhi pol
ampas.
160

= o'6pengaslnganbukan gula
n. Efek pemurnian
BGnr!-BGne x 100
- ---Fdnm

= i 783'1
BGnrn = Bnm - Pnm = 7 243'6- 5 460'5
BGne = Bne-Pne

Bne = ffixUn
pne s ffixNn

NE = " Pne= # - (Pnrn-Pbl)


#*
Pbl = ffixnl =1fi9*les7'4--!7'2
Pne = 5 4 6 0 , 5 - ! 7 ' Z= 5 4 4 3 ' 3
tS
NE = * 5 4 4 3 , 3= 4 8 3 4 i , 9
Tr,ro

Bne = ft3x48341'9=6908'1
- =
BGne = 6908.1 5443'3 tr464'8
I 783'-l-:*L364'8x 100 =
Efekpemurnlan= Li'll=

= -
13. A1r diuapkan NE NP
= BnP' maka
DengananggapanBne
-- bne NE
loo
NP= ffi x Bnn
- = l o o x Bne= l o o o 6;6- m
ffi
= NE tffi NE= xr tllffif
Airdiuapkan
= 48341,e
,g{"ti3l$ = 37350,55e
ton
yang bekerla
giung = 352' dan luas pemanas (LP) penguapan
Iika Jam
5000 m2, maka
559 - ,1 t2
/ ) . -352;5.6[t
= 37 350
kg atr diuaPkan/(iam mL) ::::=

14.Rumussug(ff'luiceardmolcsses(sIM)NoelDeerrmendasarislstempeng
awasanlsscT,yangberlakuuntuksemuabahanbergula.Dllndonesla'
rumussrMditerapkanuntukpemerahanmasakandanrendemenkrista
161

P msk = Pg + Pstr, atau


Bmsk {Hkmsk}= Bg (Fikg)+ Bstr (HKstr)
Bmsk
HKmsk
=k=ffi
fika kedua ruas dlkallkan dengan

ffin " loo,maka

#-xroo=ffixloo
Bg Bstr
HKg HKstr

=ffi
poldalamgulatiap 100po1masakan " 100

Inll.ahrumus SJM, yang secara umum ditulls:

Gutadapatdlperolehtiap i00 po1bahan= ?ffi * I00

Dengan contoh bahan masakanA, maka:


g = HK gula, untuk gula murni (kristal) = 100
E 82'.17
J = HKmasakanA
= 63,62
lyt = HK tetes (seterup)A

KristalTopolmasakanA= x loo = 62
(pemerahanmasakanA) ffi

kristalisast= *F
15. Rendemen * 100

Kne = hallni s = HKkristal= i00


x Pnedalarn
ffii
=ffiffiffix5443,3
= 4 833,2 atau

dalam Bultetin ll dlsebutkan: R r


= mrT T$f - ig!-lR-rl_
=EI]TT:TI
Faktor kristal (hablur) nlra encer _
lT0'=n
R=HKnedanr=HKm
Kne = faktor kristal ne x Pne
= 0 , 8 8 7 911x 5 4 4 3 ,3='4 8 3 3 ,2
162

=ffi*
Rencemenkristal(isasi) 100= lLzJ

(kehilangankristal tiap 100 pol nira encer = 1,79)'

t 6 , Kehltangan bukan gula menurut Hommes diperhltungkan darl nlra encer:


BGhiI = BGne- {BGh+ BGm + BGperk}
BGh = Bh - Ph diperhitungkan dari H tertimbang
qq qs
Bh = #},hi l x H = f f i . x 4 8 1 9 =, 84 8 1 7 , 4 ,

=#x H = ffi x4Bl9,=


B 4807,8
BGh = 4 8 1 7 , 4 -4 8 0 7 , 8= 9 o o

= f bf m
ix - d9 3
'. =
M r -, 0x72- -2 1 4 , 5 = 2 0 6 i , 0
Bm

rna' , r' -= 27137


= --Pm-' x M
iff x Z Z I 4 , 5= 606,1
100
B G m = 2 0 6 1 , 0 - 6 0 =6 I, 41 5 4 . 9
-39,3
B G p e r k =B p e r k - P p e r k = - 1 1 2 , 5 - ( - 7 g , Z I =
B c h i l = I 4 6 4 , 8 - 9 , 6 - I 4 5 4 , 9 - ( - 3 9 , 3 ) =+ 3 9 , 6
(tanda + nnenunjukkan kehilangan gula mekanlk mlsalnya
pemuncratan di penguapan dan masakan, bocoran, tumpah,
Pencuriangula).

17. Kehllangan gula (pol)


Phll = Pnm - Pbl - PPerk - Pm - Ph
= 5 4 6 0 , 5 ' ! 7 , 2 ' ( - 7 3 , 2 ) -6 0 6 , i - 4 8 0 7 ' 8
= i02,6
perhitungan kehilangan {tak diketahui) selalu merupakan pos penutu!
neraca.

Perhltungan menunrt dstem ISSCT

l. pt = 10,80(sama,lihat 1.a)

2. ft = 13,89 (Uhat A.9, Untuk perhitungan lni i$scT


menggunakan nira perahan, dua ro1 terakhir,
nira gilingan akhir).
= 14,05
Perhitungan berdasarkandeflnisi sabut, memberlkan ft
163

3. Nlra mutlak = tebu - sabut


= nira tak diencerkan + alr tebu bebasbrtrx2
Untuk mempertemukankedua persamaantersebut, maka
Fnmk tidak dapat diabaikan (ttOatrdapat dtanggap= Q).

Ft = Fa + Fnmk (sebagalmanadefinisi sabuti

ft = ifa + tfnmk = l3,gg + 0,16 = 14,05

n m u t t= 1 0 0 * f t =Io0..t4,05 =ijllln ,
n m u t t= n t + w o t = B Z , 0+
T3 , 8 g = B S , g s
=====

4. Faktor pol (FP) = Jovc rgtio {trR}

F- p =+ L=*9#
pnpp
= :1::=-
o.7ese
13,57
(blasanya ISSCT menggunakannlra perahan dua roL pertama sebagai ganti
nppi.
FP digunakan untuk mengubah pol nprp atau npp menJadi pol tebu dari
tiap-tiap pemtllkan"
- I)a^^ t

5. HPGI ='*BPxI00
ft

PnPP = ffi x NPP= W x 29905,8= 4 058,2

H p G r= + H * 4 * l o o= T a , z 6 * n
o /JDr.[ =====

6. HPc =# x 100= *ffiffi n 100= es,zi


7. HPG12,5 ft = lZ,S)
(HIJGandalkata

Ada duaversi yaknl konsepNoel Deer dan Mittal.


HPGtz,s (rumus hroetDeerr) mendasarkan pada fllsafat kehil,angan
ttD
nira mutlak dalam ampas tlap 100. sabut adalah konstan
(tetap)untuk sembarangkadarsabuttebu. ,
, P G r ).(1 0-0ftr). =
(i 0 0 . -H -
fti 0 0 0 H p cz) ( 100- ft".l
-:--
f,tc

* dalam praktek perhitungan dldasarkan anggapan


Fnmk = 0 atau Ft = Fa,
sehingganrnutt = 100- 13,89= 86,ll.
** perhitunganpaling tepat dan resmi yakni
dengandata pa1 dan eka1"
164

DenganmemiUhkadarsabuttebu=12,5%sebagala4gkanormal,maka:

0 o o - H P g ) ( 1 o=o( l-of to) w


--ft i2,5 I
j
(1 -0i0H l -Ql
;) n00 - ft)
-(1 00: 1
HP G 1 2 ,N
5D = 1 0 0 - I
]
I

=1oo-W=95,76 |
a

berlaku'bagl HFG' tetapi


Menurut Noel Deerr, rumustersebut tldak hanya I
HPN (hastlgunapemerahan nlra)' Generasl selanJutnya'
Juga HPB dan I
Mitta],mengoreksirumusNoelDeerrdenganmenghapusanggapanb
poldanbrlxterbagimeratadalamniramutlak.Mlttalsekaligu
kehilangan
menyederhanakan rumus NoeI Deerr dan menyatakanbehwa I
sakarosetiapl00sakaroseda}amtebutiapl00sabutadalahkon
kadarsabuttebu'
untuk sembaranE I
I

f f i f f i |
-ffi=**
=lll |
Dulu isebelum t9B6), Hugot menyarankanHPG12.5Mittal"
I
=
8. HPG12,5, 12,5 (HPGandaikataft = 12'5 dan pt 12"5)
|
Mittal'
membetulkan rumus Noel Deerr dan I
TanpadisadarlNoelDeerrdanMittalmenggunakananggapano"l-:l
tebuyangdikerjakanrnemlllklpo}yangsam.a,danyangberbeda*Tiil
yaknl Ugaj'e dan Reln, menemuKan
kadar sabutnya" Generasi sesudahnya, l
kadar sabutnya sama' tetapl kadar sakarosenYa
bahwa tebu-tebu vang I
memberlkan ltPG berbeda pula' Tebu yang rnlskln n*
berbeda, akert I
yanE rendah" Darl stni muncul dua perumusan:
3[3r Iil€fnberikan HPG l
- (NDU) dan Mittal - Reln (MR)'
Noel Deerr Ugal.e
Dee*:
oer I

-Ji;i",ffii'fi':
,,-, I
rttz*#) L 2 , s*(f7f i )

|
165

H P G 1 2 , 5I 2, , 5 .N D U = 1 0 0
-
- \IOO HPG
7 f.t
,m,
, 7,I25 \

ND)( ffi'
- FIPG12,5
= i00- (100
/ *ToT-
= I00 - (i00- 95,76) =
17,!2517'108)
lgII

persamaanMlttal:
Rein memberifaktor pt0'6 kepada
- pto'6
tloo HP-9) t 1 0 0- H P G 1 2 ., 51 2 , 5l)2 ' 5 0 ' 6
=ffi

= loo- r lLslioit-ilPAfi=to'6 i
H P G 1 2 , 5 I. 2 , 5 M R

= i 0 0- t ( 1 0 0' H P G T ZM
, S)# , 0 ' u ,

loo- (ioo- e5,6e)


tl,o# 10'6
1 0 0 - 3 , 9 5= =====
96,05
-
rumusHPG12,5. rz,s Mittal Rein'
penggunaan
Hugotmenyarankan

9, Ph dalam Perkiraan{Phpgri(}
'"'L
-= P P ^ - ' '* 100= :i=lz,s ^
x ioo = 65,07
HKperk
. ffi
uperk
berlalnan tandanya' HKprerk
(da'am kasus demikian bii.a Pperk dan Bperk
adalah negatif )"
HK sakarogg= $$,77 dan
HK pol tetes* = 29,4I tbandlngkandengan
HK sejati = 43,75)

HK hasil = 99.80
'
Iadi ton Pol hasll dalam Perkfaan'
Phperk =##lx Pperk
J r v

=ffi1 xPperk
=ffix-73'2 ==-=19'i=
rata-rata dari buku Jumlah
. *"r"tt "*"- perlode I, seharusnyadiambll angka
{hingga masa lnl}"
166

I0. nP =ffi * loo


Ph = Phtertlmbang + Phperk
= 4 9 0 7 , 8 + ( - 5 6 , 9 )= 4 7 5 0 , 9

n P= f { 3 3 * * } o o = i l : 9 1
mencakup pertang-
Eflslensl pengolahan(nP atau BHR) demiklan lnl belum
jawaban mutu gula.

n. RP=$f* * roo= g=gi#S x 100

Phtl,4 -
= ---ffifrj.- &n) x 100

4750,e
0,4: g-ffii
----"ryJ- x ioo
= 4 7 4 7 , r't- rvv
roo = g6,94
54mF =====
yang sudah nnellbatkan
RP tBFIResg) merupakan efisiensl pengolahan
i
ESG), narnun bel'urn
mutu hasl1 (dengan konsep setara krlstal {SK} atau j
perbedaan mutu
dapat dlgunakan untuk tujuan perbandingan berkenaan
bahan baku (HK nira mentatr)'

mentah 85) ada dua versl


12, RPgs (rendemen pengolahanandaikata HK nira
yakni perumusanNoeI Deerr dan Gundu Rao'
MenurutNoelDeerr,tlapl00poldalarnnlramentah(HK])akan
HK kl' Dengan
menghasllkan n pol dalam gula (HK S), dan tetes dengan
dan semua kehtlangan
menganggap tak ada kehllangan tak diketahui
dltamPung tetes'
s(I_M)
n atau nP = iffif x 100, atau
R setara krlstal (ESG' HK
tiap 100 Pol nlra mentah akan menghasilkan
100)dan tetes (tlK Mv).

R atauRP= ##H x loo


punty)' Dlsebut deml-
Mv adalah HK tetes hakiki/lmaJlner (vdrfucl nolasses
gul'a) diandalkan ditampung
kian karena semua kehilangan (gula dan bukan
dalam tetes" Darl persamaan tersebut diperoleh:
167

r , - - -_ 1 0 0I ( 1 0 0 - R )
rvlv -- ' f=75,38, R=86,94
1 0 0 2- l R
= 28,56

Darl arah sebaliknya, rumus di atas membertkan pengertian bahwa jlka


nira mentah HK .l-Oiolatr menJadi gula pasir murnl (setara kristal), dan
dlperoleh tetes dengan HK Mv, maka dari 100 pol nlra mentah akan dldapat
R setara kristal.
Berdasarkananalogl inl, Jika HK ntra mentah = 85, HK gula = 100, dan
HK tetes = Mv, makadarl 100po1nlra mentahakan diperoleh gula murni
sebesarRg5.

Rs5atauRPssNn = t9=9!e*; IYt:l


B s(1 0 0- M;) - x 100
g ##3F#3i . roo=g3,=rl=
DenganmemasukkanMv = lg0 r-(100; R) ke dalam
l 0 0 z_ J R
-
}t85 ND = 100{BI UvI *x- rvul diperolehpersamaan:
100. uJ.;
E;.m' _ Mu)
R e s u=o r 0 0- t ? i i l B t # ' , I = z s , s e d a n R = B G , e 4
RPASND = 100- 7,06 = 12_,_99
Kehllangan gula terJadi dalam tetes dan di luar tetes {blotorg,
tak diketahui dan pada perhitlrngan mutu gula).

Kehilangan gula = Kehllangan gula + Kehilangan lain


dalam tetes di luar tetes
RP nyata = RF teori - Kehllangan
di luar tetes

RP nyata atau R = lgo(.r- M)loo - V


I ( i 0 0- M )
RP3S atau RAS = I 0 0 ( 8 5- M ) 1 0 0
ErnT0.ft)-
l- berubah -**--7*oerubah --_--{ l_-tetap --1
Kelemahan Noel Deierr (1932) ialah digunakannyaanggapan bahwa semua
jenis kehilangan adalah tetap. Gundu Rao (1950) hanya menggunakan
168

anggapan kecil, V konstan untuk sembarang HK nira mentah.* Karena:

,,=j!L!I:14)S
' - .p. '
I000-M)
maica:
i 0 0 ( 8 s- M ) 1 0 0 190,{{;Ivl.),100
R B sG R= -Tillm:m- - M)
t (100
+ R

cR = RP+ r qffif
R65atauRPes 100e#)
Harga 85 - I dapat positif, nol atau negatlf. FaktorI I berasatrdarl
BGne/BGnm,untuk pabrlk gula merah (defekasl)nilalnya mendekatl l.
Untuk cara kerJasulfitasi dan karbonatasl:

cR = RP
RPes +Pse-rffir ,fiffi,
D e n g a nd a t a R P 8 6 , 9 4 ;B G n e l 4 6 4 , 8 ;B G n m I 7 8 3 , 1 ;M 2 9 , 4 1 ;d a n I 7 5 , 3 8 .

cR = 86,e4
Rpss . +ffi. iouoo''=%lu,
3!#,#
= i3.99
Faktor BGnelBGnmdlturunkandarl anggapanbahwaBGne= BGm; tahun
1986Hugot membuatfaktor baru BGm/BGnm;yang merupakankomponen
faktor tetes ISSCT.

RP+,83fr,
RPsscRH= ffi)',ffi,
1 0 0P m , $ 1 ,
p p *- -EGi;-
== r(r [T;EF ,
Menurut terminologi Indonesla,
= = , #KT,oo
= -Pffi- = = M
faktor tetes IS
BGm bdfr- 166ry; T0-0:-M l

MenurutISSCT,
= 1 0 0P m , 1 0 0M '
, B G m. \Ton::1il,
= tEcilm/
faktor tetes TG;;n-
RurnusGunduRao - Hugot (GRH) tersebut Jelaslebth bermaknadaripada
rumus asli Gundu Rao. SebenarnyaHugot menyarankanpenggunaanM
dan BGSm= ZKm- Sm.
= HK seJatitetes (= 1,2HK sakarose)

* Susantadan Sartono (LPP) telah mencoba meniadakananggapen ltu.


169

a. BGm BGmtertimbang+ BGmperklraan


BGmperk BGperk- BGhperk
BGhperk BHprerk- Phperk
- 5 7 ,0 - (- 5 6 ,9 ) = - 0,i
BGmperk - 3 9 ,3 ' (- 0 ,1 ) = - 39,2
BG m 1 4 5 4 ,9+ {- 3 9 ,2 )= 1 415,7
b: Pm Pm tertimbang + Pm perklraan
pmperk Pperk - Phperk
' 7 3 , 2 - ( - 5 6 , 9 )= - 1 6 , 3
Pm 6 0 6 ,1+ (- 1 6 ,3 } = 589,8
c. BGnm Bnm - Pnm
7 2 4 3 , 6- 5 4 6 0 , 5 =1 7 8 3 , 1
Dari data a, b dan c dlperoleh:

= -Uff*
Faktortetes(ISSCT) . 100

=
#3# ,, loo= 33'08%
u*uu,ffi)rffiq$)=
+## ffi#fr
,5 a,7940,41,66
=
11,jj3
CnH = RP + faktortetesISSCrffif
RPSS

= 86,e4
+ s3,08
,fuli*u#' =
3jl_gl
= $*" roo=
i3. nPG
##i x loo= !g:g
HPGx nP : 100= 95,21x 87,01: I00 =
i3:91
sKh n 7a7 1
i4. RPG =
ffr [ x i00 = idfff
C /Jorl
x 100 = =82,77
====

HPGx RP : 100= 95,21x 86,94: 100= g?JJ_

1 5 . R P G d l r e d u k s i : a , R P G 1 2 , 5 .g S N D c. RpGi2,5, gSM.GR
b - R P G 1 2 , 5. l z , s . g s N D U d . R P G 1 2 , 5, l z , s . g s
MR.GRH
170

R PG 1 2 , 5 .g551 p = R P G12,5
ND x RPg5gP
= 95,76 x 92,94 : 100= 89,00

R I r G 1 2 , 5 " 1 z . sN. B = H P G l 2 , 5 , ] 2 ,N5D u x R P g sN p


DsU
= 95,75 x 92,94 : '100= 88,99

R P G 1 2 , 5 .S S F {P G12,5
14 x RPg56' P
M:GR
95,96 x92'98:100=88'97

d. R PG 1 2 , 5 .l z,s;B
MRs .GR H= H P Gl2,5.l2,5
MR x RPg56g11
= 96,05 x 91,91 : 100 = !9:|8-

a dan c sudahdirekomendasikanISSCT l97l


d disarankanoLehHugot (perkembanganterakhir' 1986)'

16, Rtp (rendernentebu atas dasar pol, yreld)


.
= tph = ^ n -= 4 7 5 0 , 9 -x 1 0 0
- P h * ,IUU = g,g5
T= .5f-ffi,2 _==

= pt x nPG : 100= 10,80 x 0,8284= gf=l

yield esg)
17, Rtrl {rendementebu atas dasar setara kristal'
= i s k h = $ ! o l o o= f f i x l o o = g!r=1
= pt x RPG : i00 = 1 0' , 8 0 x A ' 8 2 7 7 = ====
.8'94

Perhitungan.perhitunganyangmenyangkutHKtetessemudanseJat
diperbandingkanPadaTabel IV'
f
C. Penyusunan Neraca Eahan Pabrlk GuIa i
(massa), didasarkan ut"t
Neraca bahan, tepatnya disebut neraca bobot II
hukumkekekalanmassadalamsuatuslstem:
I
Masukan(fnput) = keluaran (output) |
walaurun manusn
Massatak dapat diciptakanatau dihancurkanoleh manusia' I
makhluk yang berderaJad tertinggl'
.adalah I
neracabahanuerturuan:
seperti stolklornetripadaumumnya'penyusunan

I
171

yang dibutuhkan
l. Menaksir jumlah bahan baku dan bahan-bahan pembantu
untuk mendapatkanseJumlahhasil yang dikehendaki'
2. MenakBir hasil gula dan hasl]-hasil samplng yang dapat diperoleh'
keluaran
3. Memluh proses yang paling efisien, Dari rinclan masukan dan
akan dapat dilacak pos-poskehllangan gula beserta kriterlanya, selanJutnya
disusunskala priorltas dan cara pengatasannya'
4" Pentolokan pre$tasl dan peningkatan eftsiensi $ecara terus menerus dengan
wawasannasional dan lnternasional':
6., yang ldeal (semPurna)
b. yang terbaik yang pernah dlcapai
c. yang sekarang dlcapal, dan pentargetan yang reaUstls'
Dari sinl disusun konsep-konsepstandar eflslensi dan kapasltas untuk tuJuan
perbandingan,denganmenghindari penggunaananggapan'
5. Perancangandan modifikasi prosesdan peralatan pabrik gutra.
"15
Gambar rnenyaJikan contoh neraca bahan pabrik gula sulfitasl,
perklraan
menggunakan data pragraf A dan B. Hasit gula dan tetes dalam
fizcovery on stock) dlhitung denganrumus SfM'
172

rTt
100,000
p 10,800
bs 3,595
w 71,553
f .14,052

L24,123 # 28,573
0,517
0,237
13,927
13,892
NMK = 95,550
p 10,283
bg 3,358
w 8 1 , 74 9
f 0,160

CaO 0 , 15 0
I
Staslun pernurnlan .. >BL 3,686
soe 0 , 1 7 1 I
I
p 0,032
W 2,650 I bg 0 , 0 1I
I zktl 1,090
+ w 2,585
NE = 91,036
p 10,251
bs 2,758 1,790
w 78,027
I ;
Staslun pbnguapan-.--------+ W 70,340

Perkiraan NP = 20,698 Kehilangan


pperk = -0,i38 p 10,251 p + 0,194
ph perk - 0,107 bg 2,759 + 0,074
bg
pm perk - 0,031 w 7,689

bg perk = - 4,a74
bgh perk - 0,000
bgm perk - 0,074

H = 9,076 M = 4,174
p 9,054' p l,l4i
bg 0,018 bg 2,749
w 0,004 w 0,289

Gambar 4. Contoh neraca bahanpabrtk Eufasulfltnst


{dasar100tebu}
173

D. Kehllangan gula (poD

Terbagi menJadidua kelompok:


1. Kehllangan diketahui, darl yang terbesar hlngga yang terkectl berturut-turut
yakni dalam tetes, ampas dan blotong.

2. Kehilangananu (tak diketahui):


B. Kehilangan kLmta (lnversi/pengasaman,yang Juga menampungkesalahan
pengambuancontoh, analtsls dan perhitungan).
b. Kehllangan mekanlk (bocor, tumpah, muncrdt, kesalahan pentmbangan,
perklraan dan pencurian gula).

PoI dalam hastl tiap I00 pol dalam nira mentah:

(1) nP teorl (andaikata kehilangan tak diketahul = 0, dan semua kehllangan


diketahui terJadi dalam tetes)
-
(I I 6M) (71,3=8=-
_ ^99,80
-_TsI S x r v i .i^ri
r-@ ?14,11 u = 86,46
. r100

(2) nP didapat = - 100

tPh tertlmbang + tPh perkira.an


= x 100
tPnm
9,0!a.l(:&107)
= * 100 = 82,01
10,283

Pol hllang tlap 100 pol nm seharusnya = (1) - (2) = - 0,55

Pol hilang ttap i00 pol nm kenyataan = !t%i*q x 100 = + 2 , 2 0-

$eUsih, = ' 2,75

Sebelum mencarl sebab-sebabLain, selisih-selisihtersebut lazlmnya terJadl


karenakekeliruanperkiraan (apparentlosses)'
174

Karena pabrlk gr.r1aadalah pabrlk sakarosa (mengambll sakarose dalam


tebu), maka neraca bahan ylng terpentlng ialah neraca sakarose yang
'10)
dlnyatakan dengan pot (Tabel Neraca-neraca bahan lainnya (brix, bukan
gutra dan gula reduksi termasuk faktor gula reduksl/sakarose) dlsusun untuk
menetapkanmacam kehilangan tak diketahul"

Tabel 10. Neraca pol pabrik gula sulfltasl


i

Masukan Keluaran

(a) (b) (a) (b)


PoI tebu I 0,800 100 Pol hasll* 8,947 BZ,B4

Pol ampas 0,517 4,79


Pol blotong 0,a32 0,30
PoLtetes* l,ii0 10,28

PoI hilang anu 0,i 94 1,79

fumlah I 0 ,8 0 0 100 Iumlah 10,800 i00

(a) tlap loo tebu (b) tlap 100pol tebu


* termasukperkiraan

Nerasa semapam itulah yang dipraktekkan, yang dalam bahasa aslng


disebut po| batancedue cone (neraca pol asal tebu). Dalam hal ada pemasukan
pol dari batranlain (fn tronsitJ misalnya gula sisa tahun lalu, Eula dari pabrik la-
ln, gula mangkok, nira pekat dan sebagainya,.maka pengawasannyadilakukan
secara terpisah. Karena kekhawatiran pengambllan contoh tebu yang tidak
rnewaktli (irrepresentative) maka anallsls tebu secara langsung umumnya ttdak
dllakukan, sehingga terpaksa menggunakananggapan, kehllangan tak diketahul
dl staslun glllngan = 0.