Anda di halaman 1dari 106

No SOAL JAWABAN PEMBAHASAN

1 Seorang dokter di suatu rumah A. Metformin


sakit meminta rekomendasi B. Glibenklamid
pengobatan kepada apoteker C. Glimepirid
mengenai pilihan obat untuk D. Acarbosa
pasiennya ( laki-laki, usia 55 E. Plogitazon
tahun, penderita DM tipe -2),
karena saat ini pasien tersebut
juga baru terdiagnosa
mengalamigagal ginjal (CKD).
Apakah obat yang tepat di
rekomendasikan?

Sumber : National Kidney Foundation, Practice Guideline For diabetes


and CKD :2012. Am.J.kidney
2 Seorang pasien anak di rawat di A. Fenobarbital
IGD suatu rumah sakit karena B. Phenitoin
mengalami kejang dan di C. Asam valproat
diagnosis dokter mengalami D. Diazepam
pneumonia dan status E. Midazolam
epileptikus. Dokter meminta
rekomendasi kepada apoteker
yang bertugas di depo UGD
mengenai antikonvulsan yaang
tepat di berikan kepada pasien
pertama kalinya untuk
mengatasi kejang pasien.
Apakah obat yang tepat
direkomendasikan? Sumber :Penatalaksanaan status epileptikus. PIDAI 2016

No SOAL JAWABAN PEMBAHASAN


3. Seorangdokterdisuatuklinikakanmenggantio* a. Lantonoprost
*ptuntukpasiennya (laki – laki, usia 37 th, b. Pilokarpin
penderita glaucoma sudut terbuka) dan
meminta rekomendasi apoteker. Tiga hari c. Karbakol
dokter meresepkan tetes mata timolol maleat d. Brinzolamid
0,25% (2 kali sehari 1 tetes) dan pasien e. Brimonidine
mengeluhkan matanya terasa kering dan
terlihat ada tanda – tanda konjungtivitis
alergi. Apakah obat yang
tepatdirekomendasikan

4 Seorang bayi baru lahir, laki-laki usia 5 hari, a. Seftriaxoneinjeksi


belum di perbolehkan pulang dan masih b. Erythromycin
dirawat di suatu rumah sakit karena injeksi
mengalami konjungtivitis. Dokter berdiskusi
c. Acyclovir salep
dengan apoteker mengenai obat yang akan
diberikan karena hasil kultur bakteri d. Vidarabine salep
menyimpulkan bahwa pasien mengalami e. Clindamycin salep
gonococcal konjungtivitis. Apakah obat
yang tepat direkomendasikan?

No SOAL JAWABAN PEMBAHASAN


5 Seorang apoteker disuatu rumah a. 1 bulan
sakit memberikan informasi sisa b. 2bulan
durasi penggunaan OAT MDR-TB c. 3bulan
selama fase intensif kepada pasien d. 4bulan
(laki – laki, usia 48 tahun). Pasien e. 5bulan
telah menggunakankan amisin
injeksi, levofloksasin, etionamid,
sikloserin, pirazinamid dan
etambutolselama 2 bulan. Hasil
pemeriksaan laboratorium
menunjukan terjadinya konversi (Pedoman nasional pelayanan kedokteran tatalaksana tuberculosis,
biakan pada bakteri penyebab kemenkes)
MDR-TB pasien. Berapa lamakah
penggunaan OAT MDR tersebut
selama fase intensif?

6 Seorang laki-laki, usia 55 tahun A. Agonis


penderita glaucoma sudut terbuka kolinergik
dan telah diberikan obat oleh B. Antagonis
dokter berupa tetes mata timolol kolinergik
0,5 % ( S.1.dd.1.gtt) selama dua C. Agonis
minggu. Dokter meminta prostaglandin
pertimbangan obat pengganti alfa
kepada apoteker karena obat D. Agonis beta-
tersebut tidak mampu mengurangi adrenergik
gejal glaucoma yang dialami E. Antagonis
pasien. Selanjutnya, apoteker beta
menyarankan tetes mata adrenergik Sumber : medscape.com
Latanoprost 0,005 (1 tetes tiap
malam hari). Bagaimanakah
mekanisme aksi obat tersebut ?

No SOAL JAWABAN PEMBAHASAN


7 Seorang pasien asma menebus obat A. Rekonsiliasi Pelayanan Informasi Obat (PIO) Pelayanan Informasi Obat merupakan
di Apotek. Resep terdiri dari obat kegiatan yang dilakukan oleh Apoteker dalam pemberian informasi
Salbutamol MDI dan Ambroksol B. Pelayanan mengenai Obat yang tidak memihak, dievaluasi dengan kritis dan dengan
tablet. Apoteker memberikan informasi bukti terbaik dalam segala aspek penggunaan Obat kepada profesi
kesehatan lain, pasien atau masyarakat. Informasi mengenai Obat
penjelasan mengenai cara obat
termasuk Obat Resep, Obat bebas dan herbal. Informasi meliputi dosis,
menggunakan MDI kepada pasien. C. Konseling bentuk sediaan, formulasi khusus, rute dan metoda pemberian,
Apakah pelayanan farmasi klinik D. Edukasi farmakokinetik, farmakologi, terapeutik dan alternatif, efikasi, keamanan
yang dilakukan oleh apoteker obat penggunaan pada ibu hamil dan menyusui, efek samping, interaksi,
tersebut? E. Evaluasi stabilitas, ketersediaan, harga, sifat fisika atau kimia dari Obat dan lain-
penggunaan lain. ( Permenkes 73 tahun 2016)
obat
Konseling merupakan proses interaktif antara Apoteker dengan
pasien/keluarga untuk meningkatkan pengetahuan, pemahaman,
kesadaran dan kepatuhan sehingga terjadi perubahan perilaku dalam
penggunaan Obat dan menyelesaikan masalah yang dihadapi pasien.
( Permenkes 73 tahun 2016)

Rekonsiliasi Obat merupakan proses membandingkan instruksi


pengobatan dengan Obat yang telah didapat pasien. Rekonsiliasi
dilakukan untuk mencegah terjadinya kesalahan Obat (medication error)
seperti Obat tidak diberikan, duplikasi, kesalahan dosis atau interaksi
Obat. Kesalahan Obat (medication error) rentan terjadi pada pemindahan
pasien dari satu Rumah Sakit ke Rumah Sakit lain, antar ruang
perawatan, serta pada pasien yang keluar dari Rumah Sakit ke layanan
kesehatan primer dan sebaliknya. ( Permenkes 72 tahun 2016)

Evaluasi Penggunaan Obat (EPO) merupakan program evaluasi


penggunaan Obat yang terstruktur dan berkesinambungan secara
kualitatif dan kuantitatif. ( Permenkes 72 tahun 2016)

8. Seorang dokter di suatu rumah sakit a. mofiklosasin


berdiskusi dengan apoteker untuk b. para amino salisilat
penggantian kanamisin injeksi untuk c. terizidon
pengobatan pasien (lali-laki , usia d. streptomisin
48 tahun, penderita MDR-TB) pada e. kapreomisin
fase intensif. Hasil uji kepekaan
menunjukkan bakteri penyebab
telah resisten terhadap INH,
pirazinamid dan kanamisin. Apakah
OAT yang tepat direkomendasikan?
No SOAL JAWABAN PEMBAHASAN
9 Seorang apoteker di apotek menghitung harga pokok a. Rp. Seorang apoteker di apotek menghitung harga pokok penjualan
penjualan selama 1 tahun setelah apoteknya berdiri. 428.000.0 selama 1 tahun setelah apoteknya berdiri. Data data laporan
Data –data laporan keuangannya adalah sebagai 00 keuangannya adalah sebagai berikut :
berikut : b. Rp.
Penjualan : Rp. 1.300.000.000 Penjualan : Rp. 1.300.000.000
619.000.0
Pembelian : Rp. 650.000.000
Persediaan awal : Rp. 85.000.000 00
Pembelian : Rp. 650.000.000
Retur pembelian : Rp. 23.000.000 c. Rp.
Biaya operasional : Rp. 250.000.000 642.000.0 Persediaan awal : Rp. 85.000.000
Persediaan akhir : Rp. 70.000.000 00
Berapakah harga pokok penjualan apotek tersebut? d. Rp. Retur pembelian : Rp. 23.000.000
650.000.0
00 Biaya operasional : Rp. 250.000.000
e. Rp.
735.000.0 Persediaan akhir : Rp. 70.000.000
00
Jawab: HPP = [Stok Awal+ Pembelian - (Persediaan
akhir+ Retur pembelian)]

HPP = [85.000.000+650.000.000 –
(70.000.000+23.000.000)]

HPP = 735.000.000 – 93.000.000

HPP = 642.000.000 ( C )

10 Seorang apoteker disuatu rumah sakit a. A dan D


melakukan analisa pareto dengan data sebagai b. B dan C A = 0 – 75 % B = 76 – 95% C = 96 – 100%
berikut : c. C dan D
d. A dan B A. 100 x 30 = 3.000
Nama Jumlah Harga (Rp.) e. D dan E B. 50 x 10 = 500
C. 20 x 1000 = 20.000
Obat Penjualan D. 50 x 100 = 5.000
(Unit) E. 70 x 70 = 4.900
A 100 30 Total = 33.400
B 50 10
C 20 1000 1. 20.000 / 33.400 x 100% = 59,89 %
D 50 100 2. 5.000/33.400 x 100% = 14,97 %
3. 4.900/ 33.400 x 100% = 14,67 %
E 70 70
4. 3.000/ 33.400 x 100% = 8,98 %
Berdasarkan data tersebut, obat manakah yang 5. 500 / 33.400 x 100% = 1,49 %
termasuk kelas A ?
Persen kumulatif
1. 59,89 % (A)
2. 59,89 % + 14,97 % = 74,86 % (A)
3. 74,86 % + 14,67 % = 89,53% (B)
4. 89,53% + 8,98 % = 98,51% (C)
5. 98,51% + 1,49 % = 100 % (C)

No SOAL JAWABAN PEMBAHASAN


11 Seorang apoteker yang tergabung a. Konkuren  Review: dilakukanolehApotekerberdasarkanhasil monitoring
dalam tim audit internal sebuah b. Prospektif terhadappelayananfarmasiklinikdanseluruhsumberdaya yang
rumah sakit melakukan monitoring c. Retrospektif digunakan.
dan evaluasi pelayanan kefarmasian. d. Review Contoh: review terhadapkejadian medication error
Monitoring dan evaluasi e. Observasi  Observasi : pengamatanlangsungaktivitasatau proses
dilaksanakan secara langsung pada denganmenggunakancek list atauperekaman.
apoteker yang melakukan kegiatan Observasidilakukanolehberdasarkanhasil monitoring
konseling di depo rawat jalan. terhadapseluruh proses pelayananfarmasiklinik.
Apakah jenis monitoring dan Contoh :observasipelaksanaan SPO pelayanan
evaluasi yang dilakukan tim audit Sumber : PERMENKES RI NO. 35 TH 2014
internal berdasarkan waktu ttgstandarpelayanankefarmasian di apotek
pelaksannanya? Sumber : National Kidney Foundation, Practice Guideline For diabetes
and CKD :2012. Am.J.kidney
12 Seorang apoteker bagian R&D a. 0,91
suatu industri farmasi b. 1,48
melakukan pengembangan c. 2,71
metode HPLC untuk penetapan d. 14,82
kadar Naproxen dan e. e. 27,10
Esomperazole. Analit
Naproxen menghasilkan
kromatogram dengan waktu
retensi 8,36menit dan lebar
baseline 0,29 menit. Sedangkan
Esomeprazol menghasilkan
kromatogram pada waktu
2(9,54  8,36) 2,36
retensi 9,54 menit dengan R   2,54
baseline 0,64 menit. Berapakah 0,64  0,29 0,93
resolusi antar peak kedua analit
tersebut?

No SOAL JAWABAN PEMBAHASAN


13 Seorang apoteker di industry akan a. 3,00 Citric acid : 2%
memproduksi tablet sublingual b. 1,00 2% x 300 mg = 6 mg x 100.000 tablet = 600.000 mg = 0,6 kg
nifedipin 100 mg. dengan c. 0,30
komposisi bahan tambahan sebagai d. 0,60
berikut : ludiflash 52%, d. 0,15
crospovidon 10%, Sodium
accharine 1%, citric acid 2%, syloid
244FP 1% dan MG. Stearat 0,5%.
Bobot tablet yang akan diproduksi
adalah 300 mg. Kapasitas mesin
tablet yang digunakan adalah
100.000 tablet. Berapakah jumlah
citric acid (kg) yang dibutuhkan
untuk satu kali produksi?
14 Seorang apoteker bagian QC a. 1,2
disuatu industri memastikan kadar b. 4,8 Pembahasan :
kurkumin dari ekstrak rimpang c. 12 Y = 32.000x + 996,67
temulawak menggunakan KLT- d. 19,8 155.000= 32.000x + 996,67
Densitimetri. Kurva baku yang e. 48,0 32.000x= 155.000 - 996,67
didapatkan adalah Y=32.000x + X = 155.000 – 996,67 = 4,81 mg/ml x 25 =120,31 mg/ml
996,67 (Y= AUC, X=Kadar 32.000
kurkumin (mg/ml)). Pengenceran
ekstrak yang dilakukan adalah
sebesar 25x AUC sampel yang
didapatkan sebesae 155.000.
Berapakah kadar kurkumin (%)
yang terkandung dalam ekstrak
rimpang temulawak tersebut ?

No SOAL JAWABAN PEMBAHASAN


15 Seorang apteker di bagian R& D a. Tablte konvensional Sustained release : sediaan yang dirancang untuk melepaskan obatnya
suatu industry farmasi sedang b. Tablet salut film ke dalam tubuh secara perlahan –lahan untuk bertahap sehingga
melakukan pengembangan produk c. Tablet Sustained pelepasannya lebih lama dan memperpanjang aksi obat (Ansel, 1999)
Metformin tablet. Tujuan release Tablet salut gula : Tablet yang disalut dengan lapisan tipis larutan gula
pengembangan untuk memperoleh d. Tablet salut gula berwarna atau tidak berwarna. Gunanya untuk melindungi zat aktif,
tablet Metformin yang memiliki e. Tablet rapid realease menutupi zat aktif yang beraroma atau berasa tidak menyennagkan.
durasi kerja lebih panjang (long Tablet salut film (selaput) : tablet yang disalut dengan polimer yang
acting tablet) sehingga frekuensi larut air diberi warna atau tidak diberi warna yang terdesintegrasi
pemberian dapat diturunkan menjadi segera dalam saluran cerna.
1x sehari. Apakah jenis tablet yang Tablet rapid relase
tepat dikembangkan untuk produk
tersebut ?
16 Seorang apoteker di industry obat a. Pengisi Jawaban : C
traditional akan membuat sediaan b. Pengikat Ekstrak Phyllanti herba: zat aktif
tablet ekstrak Phyllanti herba c. Penghancur Laktosa : bahan pengisi
dengan formula per tablet sebagai d. Pelicin HPMC 10% : bahan pengikat
berikut : e. Penambah kerapatan Starch 1500 : bahan penghancur, biasa digunakan
R/ Ekstrak Phyllanti herba 50 5-10%
mg Mg stearat : sebagai lubricant
Laktosa 220 mg
HPMC 10% b/v qs
Starch 1500 200 mg (Handbook of pharmaceutical excipients
Mg stearat (9:1) 10 mg
Bobot tablet 500 mg
Apakah fungsi starch 1500 dalam
formula tersebut?

No SOAL JAWABAN PEMBAHASAN


17 Seorang apoteker di industry obat a. 13.04%
tradisional melakukan pengujian b. 23.30%
tentang bahan baku simplisia yang c. 30.40%
digunakan dalam kapsul jambu biji d. 32.80%
untuk diare. Daun jambu biji segar e. 76.67%
yang digunakan sebesar 30 kg.
setelah dikeringkan menghasilkan
serbuk sebesar 23 kg. Berapa susut
pengeringan daun jambu biji?
18 Seorang apoteker pada bagian QC a. Akurasi
suatu industri farmasi sedang b. LOQ Akurasi : Merupakan kedekatan hasil yang diterima dengan
menetapkan parameter validasi c. Presisi nilai yang diperoleh dari hasil pengukuran.
metode analisa amoxicillin untuk d. LOD LOQ : Limite of Quantification atau batas kuantitas
digunakan pada proses cleaning e. Selektifitas menunjukkan jumlah terkecil analit dalam sampel
validation mesin mixing. Salah satu yang sama dan mampu memenuhi kriteria cermat dan
parameter validasi yang diuji adalah seksama dengan respon analitnya 10 kali lebih besar
kepekaan metode anlisa sehingga dibanding respon blanko.
mampu mendeteksi residu Presisi : Merupakan kedekatan hasil dari sederet pengukuran
amoxicillin pada sampel air bilasan yang diperoleh dari contoh yang homogen pada
terakhir mesin mixing tersebut. kondisi tertentu.
Apakah parameter validasi yang LOD : Limite of Detection atau batas deteksi merupakan
dimaksud? konsentrasi terkecil yang dapat dianalisis dengan suatu
metode analisis, dapat digunakan untuk melihat
apakah masih ada residu yang tertinggal dalam
konsentrasi LOD.
Selektifitas: Merupakan kemampuannya yang hanya mengukur
zat tertentu saja secara cermat dan seksama dengan
adanya komponen lain yang mungkin ada dalam
matriks sampel.
Sumber : Majalah Ilmu Kefarmasian, Vol. I, No.3, Desember
2004.

No SOAL JAWABAN PEMBAHASAN


19 Seorang apoteker pada bagian R & D suatu industri
farmasi sedang mengembangkan suspensi azitromisin a. Natrium Suspensi yang ideal adalah suspensi yang memenuhi
dengan formula sebagai berikut : sitrat
No Nama Material Jumlah/ L persyaratan. Menurut Farmakope Indonesia Edisi III (1979),
item (g) b. Asam sitrat persyaratan suspensi adalah:
1 Azitromisin dihidrat 50
2 Natrium sitrat 50 c. Kollidon 1. Zat yang terdispersi harus halus dan tidak boleh mengendap
3 Asam sitrat 20 CL-M 2. Jika dikocok perlahan-lahan, endapan harus segera terdispersi
4 Sukrosa 600
5 Kollidon CL-M 90 d. Cremophor kembali
6 Cremophor RH 40 5 RH-40
7 Perasa coklat 2 3. Dapat mengandung zat tambahan untuk menjamin stabilitas
8 Air QS ad 1 L e. sukrosa
Hasil uji coba pembuatan menghasilkan sediaan Sukrosa suspensi
suspensi yang kental dan sukar dituang. Apakah
bahan yang perlu di evaluasi dan disesuaikan
jumlahnya 4. Kekentalan suspensi tidak boleh terlalu tinggi agar sedimen
mudak dikocok dan dituang

Fungsi masing-masing bahan :


1. Natrium sitrat :
Sebagai zat alkali; agen penyangga.
2. Asam sitrat :
Sebagai zat pengasam; antioksidan; agen penyangga;
agen kelat; penambah rasa; pengawet.
3. Kollidon CL-M :
Sinonim : Crospovidonum; Crospopharm; crosslinked
povidone
Kollidon digunakan sebagai penambah kelarutan dengan
teknik co-evaporation, crospovidone dapat digunakan untuk
meningkatkan kelarutan obat yang buruk.
4. Cremophor RH-40 :
Sinonim : Polyoxyethylene Castor Oil Derivatives,
macrogolglyceroli hydroxystearas.
Sebagai agen pengemulsi; zat pelarut; agen pembasah.
5. Sukrosa :
Sebagai Basis gula; agen pelapis; membantu granulasi;
zat pemanis; pengikat tablet; pengencer kapsul; pengisi
tablet; agen penambah viskositas.
Sumber : Handbook of pharmaceutical exipients, 2009

20
Seorang apoteker bagian QC melakukan uji a. 40
angka lempeng total pada produk body lotion
dengan cara tuang. Dilakukan pengenceran b. 480
sampel 10-1.Volume inokulum yang digunakan
adalah 1 mL. Jumlah koloni yang diperoleh pada c. 500 N= 50 = 50 = 500
dua cawan petri adalah 48 dan 52. Berapakah
jumlah bakteri (cfu bakteri /mL) pada sampel ? d. 520 1x 10-1 0,1
e. 1000

No SOAL JAWABAN PEMBAHASAN


21 Seorang apoteker dibagian a. HAM dan LASA Siklofosfamid termasuk di daftar obat List of High Alert
logistik IFRS menerima tablet Medications in Ambulatory Healtcare. siklofosfamid
obat dari PBF yaitu b. HAM dan LASA1 merupakan kelas atau golongan obat kemoterapi oral. Obat
Sikofosfamid tablet 25 mg dan c. HAM dan LASA2 kemoterapi oral seperti cyclophosphamide, mercaptopurine,
50 mg. Sebelum didistribusikan d. . HAM temozolomide
ke depo-depo farmasi, apoteker e. LASA
memberikan penandaan pada
kemasan sekunder kedua obat
tersebut. Apakah penandaan
yang tepat diberikan pada
siklofosfamid tablet 25 mg ?

22 Seorang apoteker di potek a. 1,15 Harga beli : (1500 x 10%) + 1500= 1650
membeli obat anti nyeri yang
berisi Asam mefenamat dari b. 1,22 Indeks penjualan : 2100/1650 = 1,27
sebuah PBF seharga Rp
1.500/tablet (belum termasuk c. 1,27
ppn) dan menjual dengan harga
Rp 2100/tablet. Berapa indeks d. 1,30
penjualan yang ditetapkan
apotek ? e. 1,37

N SOAL JAWABAN PEMBAHASAN


o
23 Seorang apoteker di suatu apotek sedang a. 2 tahun
membuat laporan keuangan apotek tahun Pembahasan :
2018 dengan data sebagai berikut : b. 3 tahun PBP = Modal Awal
- Modal awal = 200 juta c. 4 tahun Laba bersih
- Pendapatan resep= 150 juta Laba bersih = Penjualan – (HPP + Pengeluaran)
- Pendapatan non resep= 200 juta d. 5 tahun 350 juta – ( 270 juta + 40 juta)
- HPP= 270 juta 40 juta
- Biaya Operasional termasuk pajak = 40 juta e. 6 tahun PBP = 200 juta
Berapakah Pay Bcak Periode (PBP) apotek 40 juta
tersebut? = 5 tahun

24 Seorang pasien (perempuan, 56 tahun) a. Dapagliflozin


penderita DM tipe 2 mendatangi poli
rumah sakit untuk memeriksakan diri. b. Akarbose
Seain itu, seama ini pasien mendapatkan c. Glimepirid
metformin untuk mengontrol kadar gula
darahnya. Saat ini HbA1C pasien 8,5%. d. Sitagliptin
Dokter berdiskusi dengan apoteker e. Nateglinid
untuk menambahkan obat DM yang
dapat menghambat reabsorbsi glukosa.
Apakah obat yang dapat disarankan ?

No SOAL JAWABAN PEMBAHASAN


25 Seorang Apoteker menyerahkan obat atas a.Mengikat Pembahasan :
resep dokter kepada seorang (laki-laki, usia fosfat Mekanisme kalsium karbonas
55 tahun, penderita gagal ginjal) pada saat b. Antasida - Sebagai antasida : menetralkan keasaman lambung
visite di ruang rawat inap. Data c.Meningkatkan - Sebagai suplemen makanan : menjaga keseimbangan Ca,
laboratorium pasien adalah GFR 35 kadar kalsium suplemen CA oral dapat melindungi terhadap pembentukan
mL/menit/1,73 m2, kadar fosfat 7 mg/dL d. Menstabilkan batu ginjal dengan kelat dengan oksalat dalam usus dan
kadar kalium 8,5 mEq/L, dan detak jantung detak jantung mecegah penyerapannya
100x/menit. Pasien juga memiliki riwayat e. Menghindari - Pengikat fosfat : dengan mengikat fosfat makanan untuk
gangguan lambung. Salah satu obat yang asidosis membentuk kalsium fosfat yang tidak larut, yang dieksresikan
diserahkan adalah kalsium karbonas 500 dalam feses. (Medscape)
mg (S 3 dd). Apakah tujuan pemberian
obat tersebut ?

26 Seorang pasien laki-laki usia 47 tahun, a. Karbimazol Pengobatan menggunakan larutan lugol pra operasi dapat
penderita tirotoksikosis, tidak mengalami b. Dobutamin mengurangi laju aliran darah, sehingga dapat memperkecil
perbaikan gejala dengan antihipertiroid c.Larutan Lugol resiko pendarahan pada operasi tiroidektomi.
yang diresepkan dokter untuknya. Saat ini, d. Metamizol
pasien akan menjalani tiroidektomi. Dokter e. Propanolol
meminta pertimbangan apoteker mengenai
obat yang dapat diberikan untuk
memperkecil risiko pendarahan sebelum
operasi. Apakah obat yang tepat di
rekomendasikan ?
No SOAL JAWABAN PEMBAHASAN
27 Seorang apoteker melakukan a. Zidovudin +
evaluasi keberhasilan/kegagalan lamivudin +
terapi pasien pasien HIV-AIDS ( lopinavir-Ritonavir
laki-laki, usia 40 tahun ) hasil b. Zidovudin +
evaluasi menyimpulkan pengobatan lamivudune +
dengan KDT ARV Tenovovir
(AZT+3TC+EVP) adalah gagal c. Tenofovir + Zidovudin
terapi. Nilai CD4 pasien sebelum + Evafirenz
terapi adlah 200 sel/mm3 dan saat ini d. Zidovudin +
adalah 60 sel/mm3. Apoteker Nevirapine +
merekomendasikan ARV lanjutan Tenofovir
untuk pengobatan pasien. Apakah e. Tenofovir +
ARV yang tepat direkomendasikan? Nevirapine +
Emtricitabin

sumber: peraturan menteri kesehatan republik indonesia nomor 87


tahun 2014 tentang pedoman pengobatan antiretroviral
28 Seorang apoteker disuatu rumah a. Azitromisin
sakit melakukan evalusi terapi b. Doksisiklin
obat pada pasien (perempuan, usia c. Levofloksasin
25 tahun, penderita jerawat d. seftriakson
moderat popular postular). Pasien e. vankomisin
telah menggunakan kombinasi
klindamisin 1,2%-tretinoin
0,025% gel selama 3 bulan, dan
pengobatan tersebut tidak efektif.
Apoteker mngusulkan
penambahan antibiotik oral
kepada dokter. Apakah obat yang
tepat direkomendasikan?

DIPIRO 9
No SOAL JAWABAN PEMBAHASAN
29 Seorang apoteker di sutu rumah sakit a. menambahkan
melakukan MESO pada seorang pasien sumplemen vitamin A
TBC (Perempuan, usia 37 tahun, b.menurunkan dosis
penderita TB). Setelah menggunakan etambutol
obat TB (INH, Rifampisin,
c. mengganti etambutol
pirazinamid dan etambutol) selama 1
bulan. Pasien mengatakan kepada dengan streptomisin
apoteker bahwa dia mengalami d. menghentikan
gangguan penglihatan / pandangan penggunaan etambutol
kabur . Apoteker mengatakan bahwa e.etambutol diminum
hal tersebut adalah efek samping sebelum tidur
etambutol dan selanjutnya
menyampaikan rekomendasi tindak
lanjut pada dokter. Apakah
rekomendasi yang tepat disampaikan?
30. Seorang dokter disuatu rumah sakit a. Mofiklosasin
berdiskusi dengan apoteker untuk b. Para amino salisilat
penggantian sikloserin untuk c. Terzidon
pengobatan pasien (laki-laki usia 48 d. Streptomisin
tahun, penderita MDR-TB) pada fase
e. Kapreamisin
intensif. Dokter mengatakan bahwa
pasien menunjukkan gangguan kejiwaan
setelah menggunakan obat tersebut
selama 3 bulan. Apoteker mengusulkan
penggantian sikloserin dengan OAT
lainya. apakah Oat yang tepat
direkomendasikan?

Berdasarkan jurnal dari Faizah U, 2016 “Gangguan Psikiatri Pasien TB-MDR


(Multi Drug Resistant) dan Stres Psikososial” , Department of Psychiatry,
University of Indonesia/Cipto Mangunkusumo Hospital, Jakarta, J Indon
Med Assoc, Volum: 66, Nomor: 10,
No SOAL JAWABAN PEMBAHASAN
31 Seorang apoteker dirumah sakit Formulasi
melakukan pencampuran injeksi b. Rekonsiliasi
cefazolin dengan SWFI. c. Rekonstitusi
Pencampurandilakukan dalam d. Compounding
biological safety cabinet. Apakah e. Dispensing
kegiatan pelayanan kefarmasian yang
dilakukan apoteker

Berdasarkan pedoman pencampuran obat suntik dan penanganan sediaan


sitostatika, direktorat bina farmasi komunitas dan klinik ditjen bina
kefarmasian dan alat kesehatan departemen kesehatan RI, tahun 2009

32 Seorang dokter di suatu rumah sakit a.Betametason


meminta rekomendasi pengobatan dipropionat 0,05%
lanjutan untuk mengobati dermatitis b.Betametason valerat
atopik pasien anak (laki-laki,usia 7 0,1%
tahun). Pasien telah mendapatkan c.Klobetason propionat
pengobatan dengan krim 0,05%
hidrokortison 1% selama 2 bulan dan d.Salep takrolimus
1 minggu terakhir pasien 0,03%
mengeluhkan kulit terasa panas dan e.Salep takrolimus 0,1%
terbakar setelah menggunakan krim
tersebut.Apoteker merekomendasikan
penggantian obat. Apakah obat yang
tepat direkomendasikan ?

Sumber : Dipiro Edisi 9, halaman 145


No SOAL JAWABAN PEMBAHASAN
33 Seorang pasien (perempuan, usia 46 a. Dopamin
tahun) dirawat di IGD suatu rumah sakit b. Dobutamin Syok Kardiogenik
dengan kondisi hipotensi (TD 80mmHg) c. Nor-epinefrin 1. Dobutamin: hipotensi (70-110 mmHg) tanpa tanda syok
dan low cardiac output, tidak terlhat d. Metoprolol kardiogenik (-)
tanda tanda syok kardiogenik pada e. Atropin Sulfat
2. Dopamin : hipotensi (70-110 mmHg) dengan tanda syok
pasien. Dokter berdiskusi dengan
apoteker untuk menentukan obat yang kardiogenik (+)
mampu meningkatkan tekanan darah 3. NE : Hipotensi < 70 mmHg
pasien. Apakah obat yang tepat
direkomendasikan ?

34 Seorang Perempuan 27 tahun, hamil a. Tiamin OAT Kategori1 :2(RHZE)/4(HR)3


7 bulan, pengidap TB mendatangi
Puskesmas untuk kontrol. Pasien saat b. Asam askorbat Pengobatan TB Pada Kehamilan
ini sedang menjalani pengobatan c. Asam Folat 1. prinsip pengobatan TB Pada kehamilan sama dengan
dengan OAT kategori 1pada tahap pengobatan TB biasa.
intesif. Dokter berdiskusi dengan d. Fero Sulfat 2. Hampir semua OAT aman untuk kehamilan, kecuali golongan
apoteker mengenai penambahan e. Vitamin K Aminoglikosida seperti streptomycin atau kanamycin karena
suplemen untuk pasien. Apakah dapat menimbulkan ototoksik pada bayi dan dapat menembus
suplemen yang tepat disarankan ? barier placenta.
3. Pemberian piridoksin 50 mg/hari dianjurkan untuk ibu hamil
yang mendapatkan pengobatan TB, sedangkan pemberian
Vitamin K 10 MG/HARI JUGA DIANJURKAN APABILA
Rifampici digunakan pada trimester 3 kehamilan menjelang
persalinan

Sumber : Kemenkes RI, Pedoman nasional pengendalian


tuberkolosis,2014
No SOAL JAWABAN PEMBAHASAN
35 Seorang apoteker diapotek sedang a. 40,50% RoE = Penghasilan bersih x 100%
melakukan analisis keuangan yang b. 49,50% Modal
digunakan untuk c. 52,25% Modal awal = 600.000.000
pengadaan sediaan antineoplastik . d. 58,25% Laba bersih = Laba kotor – oajak
Laba kotor sebelum pajak dari e. 60,00% = 300.000.000 – 3.000.000
penjualan sediaan tersebut adalah = 297.000.000
300 juta. Pajak yang harus RoE = 297.000.000 x 100%
dibayarkan atas penjualan obat 600.000.000
tersebut adalah 3 juta. Modal awal = 49,5%
yang
disediakan adalah 600 juta .
Berapakah nilai Return of Equity
(RoE) dari hasil penjualan sediaan
antineoplastik tersebut?
36 Seorang apoteker di gudang rumah Penyimpanan sediaan farmasi, alat kesehatan dan bahan medis habis
sakit menerima obat glimepiride A. Menyimpan pakai yang penampilan dan penamaan yang mirip (LASA, Kook Alike
tablet 1 mg, glimepiride 2 mg dan glimepiride 1 mg dan 2 Sound Alike ) tidak ditem[patkan berdekatan dan harus diberi
ergotamin tablet dari PBF. Apoteker mg berdekatan penandaan khusus mencegah terjadinya kesalahan pengambilan.
akan menyimpan obat dalam rak B. Menyimpan
yang sesuai agar mudah dalam glimepiride 1 mg dan (Peemenkes RI Nomor 72 Tahun 2016 tentang Standar Pelayanan
pengambilan. Bagaimanakah cara glimepiride 2 mg Kefarmasian Di Rumah Sakit)
menyimpan obat tersebut ? dengan jeda
C. Menyimpan
ergotamin pada rak obat
obat tertentu
D. Menyimpan
ergotamine pada lemari
psikotropik
E. Memberikan
tanda HAM pada
ergotamin.

No SOAL JAWABAN PEMBAHASAN


37 Seorang Apoteker di suatu a. 7.150 tablet
puskesmas akan membuat b. 7.450 tablet
perencanaan kebutuhan captopril c. 8.160 tablet
untuk tahun 2019. Rata-rata d. 8.220 tablet
pemakaian obat pada tahun 2018 e. 9.520 tablet
adalah 680 tablet/bulan, sisa stok
pada bulan Desember 2018 adalah A = (12x680) +(2x30x680:30) – 1300
1.300 tablet dan waktu tunggu = 8160 + 1360 – 1300
pemesanan adalah selama 2 bulan. = 8220 tablet
Berapakah kebutuhan captopril yang Binfar.depkes.go.id
tepat diadakan untuk tahun 2019 ?

38 Seorang apoteker pada bagian R&D a. Laktosa


suatu industri farmasi b. Amylum  Amilum dan laktosa dapat digunaka sebagai pengisi
mengembangkan tablet nifedipin c. Etil selulosa  Etilselulosa merupakan polimer turunan selulosa yang netral,
lepas lambat. Bahan tambahan yang d. Primogel tidak larut dalam air, sehingga dapat menghalangi lepasnya
digunakan adalah laktosa, amilum, e. Mg stearat obat dari sediaan. Kecepatan pelepasan obat dari matriks
etilselulosa, Mg stearat dan etilselulosa dapat dikendalikan melalui proses difusi dan /
primogel. Apakah bahan yang atau proses erosi. Sumber : (Wallace, 1990)
berfungsi untuk mengatur pelepasan
 Primogel sebagai disintegran (penghancur)Mg stearat sebagai
obat pada formula tablet tersebut ?
pelicin

No SOAL JAWABAN PEMBAHASAN


39 Seorang apoteker di bagian R&D a. Prospective a. Pengertian Validasi
sedang melakukan validasi validation Validasi Proses diartikan sebagai tindakan pembuktian yang
didokumentasikan bahwa proses yang dilakukan dalam batas parameter
proses produksi tablet Bisoprolol b. Retrospective yang ditetapkan dapat bekerja secara efektif dan memberi hasil yang dapat
sebagai salah satu persyaratan validation terulang untuk menghasilkan produk jadi yang memenuhi spesifikasi dan
pengajuan produk baru ke c. Analytical atribut mutu yang ditetapkan sebelumnya.
BPOM. Validasi apakah yang validation Pendekatan Validasi Proses Secara “Tradisional”
tepat dilakukan ? d. Concurtent Pada umumnya validasi proses dilakukan dengan pendekatan sebagai
berikut :
validation 1. Sebelum produk dipasarkan (validasi prospektif).
e. Cleaning 2. Dalam keadaan tertentu, jika hal di atas tidak memungkinkan, validasi
validation dapat juga dilakukan selama proses produksi rutin dilakukan (validasi
konkuren).
Proses yg sudah berjalan hendaklah juga divalidasi (validasi retrospektif
b. Jenis validasi
1) Prospective Validation (Validasi Prospektif)
Validasi yang dilakukan sebelum pelaksanaan produksi rutin dari produk
yang akan dipasarkan. Validasi Prospektif dilakukan sebelum produk
diedarkan dan berlaku untuk :
 Produk baru,
 Modifikasi pada proses produksi yang dapat berdampak pada
karakteristik produk tersebut.Prasyarat lain adalah Laporan produk
transfer dari bagian R&D ke bagian Produksi.
2) Concurrent Validation (Validasi Konkuren)
Validasi yang dilakukan pada saat pembuatan rutin produk untuk dijual.
Persyaratan pelaksanaan Validasi konkuren, antara lain ;
 Dalam kondisi khusus, dimungkinkan tidak menyelesaikan program
validasi sebelum produksi rutin dilaksanakan misal : produk yang
ditransfer ke pihak toll manufacturer.
 Dapat juga dilakukan untuk produk yang :
– diproduksi sesekali (orphan drug atau produk yang sangat jarang
diproduksi),
– mempunyai kekuatan berbeda dari produk yang sudah tervalidasi,
perubahan bentuk tablet atau bilaprosesnya sudah dimengerti
 Keputusan untuk melakukan validasi konkuren harus dijustifikasi,
didokumentasikan dan disetujui oleh kepala bagian Manajemen Mutu
(Pemastian Mutu).
Prasyarat dan persyaratan dokumentasi utk validasi konkuren sama
seperti validasi prospektif.
 Untuk Produk yang sudah berjalan (sudah diproduksi) tetapi oleh
karena satu dan lain hal, belum dilakukan validasi prospective.
 Terjadi perubahan pada parameter kritis, seperti peralatan yang
digunakan, prosedur (cara) pembuatan, spesifikasi bahan baku, cara
pengujian, dll yang dapat mempengaruhi mutu dan spesifikasi
produk.
 Validasi dilakukan pada batch produksi yang sedang berjalan,
sebanyak min. 3 batch berturut-turut
3) Retrospective Validation (Validasi Retrospektif)
Validasi dari suatu proses untuk suatu produk yang telah dipasarkan
berdasarkan akumulasi data produksi, pengujian dan pengendalian
bets.
Persyaratan Validasi Retrospektif :
 Bukan metoda pilihan untuk validasi proses, dan dipakai hanya untuk
proses yang well‐established (mapan).
 Review data sejarah catatan bets secara komprihensif
 Jumlah data yang cukup untuk mendapatkan kesimpulanyang
signifikan secara statistik
 Biasanya memerlukan data dari 10 (sepuluh) sampai 30 (tiga puluh)
bets berurutan untuk menilai konsistensi proses.
 Bets yang dipilih seluruh bets yang dibuat selama periodepengamatan,
termasuk yang tidak memenuhi spesifikasi
 Tidak bisa bila ada perubahan ( mis. peralatan, bahan awal, formula,
proses, metode).
 Untuk Produk-produk yang sudah lama diproduksi yang belum di-
validasi, namun memerlukan data validasi (mis.Utk keperluan
registrasi ulang dsb)
 Penelusuran dari data produksi yang sedang berjalan
 Data berasal dari batch record (minimum 10 – 20 batch)
 Penelusuran sejarah (riwayat) produk yang bersangkutan
Analitycal Validation (Validasi Metode Analisis)
 Untuk membuktikan bahwa semua Metoda Analisa yang digunakan
dalam pengujian maupun pengawasan mutu, senantiasa mencapai
hasil yang diinginkan secara konsisten (terus-menerus)
Cakupan (Ruang Lingkup) :
 Dilakukan untuk semua Metoda Analisa yang digunakan untuk
Pengawasan Kegiatan Produksi
 Dilakukan dgn Semua Peralatan yang telah dikalibrasi dan diuji
Kesesuaian sistemnya (Alat & Sistem sudah dikualifikasi)
 Menggunakan Bahan Baku Pembanding yg Sudah Dibakukan dan
Disimpan ditempat yg sesuai
 Untuk Metode Analisa Adopsi (prosedur sudah ada dari dokumen
resmi, misalnya FI, USP, BP, NF, dll), parameter yang diuji hanya
Akurasi & Presisi (verifikasi)
 Untuk Metode Analisa Modifikasi atau eksplorasi (Prosedur belum
ada), semua parameter harus diuji (validasi), yaitu
Spesifitas/Selektifitas, Linearitas, Akurasi, Presisi, Limit of
Detection, Limit of Quantitation, dan Robustness
Parameter Validasi Metode Analisa
1. Spesifitas/Selektifitas
 Kemampuan suatu metode analisa untuk membedakan senyawa yang
diuji dengan derivat/metabolitnya
 Digunakan placebo dan zat yang memiliki struktur yang mirip
(related substance)
 Misal HPLC  peak harus terpisah sempurna (Rs 1,2 – 1,5)
 Untuk Spektrofotometer  jarak antar 2 puncak, min. 10 nm

2. Linearitas (linearity)
 Kemampuan suatu metode analisa untuk menunjukkan hubungan
secara langsung atau proporsional antara respons detektor dengan
perubahan konsentrasi analit
 Diuji melalui Statistik : Linear Regrassion ( y = mx + b) & Koefisien
korelasi (r2 ≥ 0,99)
 Biasanya digunakan minimum 5 sample
40 Seorang apoteker pada bagian QC a. Akurasi Akurasi adalah ukuran yang menunjukkan derajat kedekatan
suatu industri farmasi menetapkan b. Presisi hasilanalis dengan kadar analit yang sebenarnya.
parameter validasi metode analisis c. Selektivitas Presisi adalah ukuran yang menunjukkan derajat kesesuaian antara
kadar progesterone dalam pil KB. d. Linieritas hasil uji individual, diukur melalui penyebaran hasil individual dari
Sejumlah pembanding kimia CRM e. Ketangguhan rata-rata jika prosedur diterapkan secara berulang pada sampel-sampel
(Certified Reference Material) yang diambil dari campuran yang homogen.
ditambahkan ke dalam campuran Selektivitas atau spesifisitas suatu metode adalah kemampuannya yang
bahan pembawa sediaan farmasi hanya mengukur zat tertentu saja secara cermat dan seksama dengan
(plasebo) lalu campuran tersebut adanya komponen lain yang mungkin ada dalam matriks sampel.
dianalisis dan hasilnya dibandingkan Linearitas adalah kemampuan metode analisis yang memberikan
dengan kadar analit yang respon yang secara langsung atau dengan bantuan transformasi
ditambahkan tersebut (kadar yang matematik yang baik, proporsional terhadap konsentrasi analit dalam
sebenernya). Apakah parameter sampel.
validasi yang dimaksud ? Ketangguhan metode adalah derajat ketertiruan hasil uji yang
diperoleh dari analisis sampel yang sama dalam berbagai kondisi uji
normal, seperti laboratorium, analisis, instrumen, bahan pereaksi, suhu,
hari yang berbeda, dll.

No SOAL JAWABAN PEMBAHASAN


41 Seorang apoteker di bagian QC suatu a. 0,71 %
industri farmasi melakukan uji
b. 0,73 %
kerapuhan tablet bisakodil 5 mg.
Sebanyak 20 tablet dibebasdebukan, c. 0,75 %
kemudian ditimbang, diperoleh data
d. 0,77 %
bobot total 1.605,81 mg. Keduapuluh
tablet dimasukkan ke dalam e. 0,79 %
friabilator, dan pengujian dilakukan
selama 4 menit dengan kecepatan 25
rpm. Setelah tablet dikeluarkan dan
dibebasdebukan, kemudian
ditimbang lagi dan diperoleh data
bobot total 1593,12 mg. Berapakah
kerapuhan tablet bisacodil tersebut ?
42 seorang apoteker di rumah sakit a.mengkonfirmasi
melakukan pemesanan injeksi kekurangan obat pada
dioazepam10 mg/ 2 ml sebanyak PBF
20 mampul. Setelah berselang 3 b. membuat SP baru
hari, ternyata PBH hanya sesuai barang yang
mengirimkan 10 ampul saja datang
karena kehabisan stok. Pada c. menolaknya karena
fraktur pembelian, jumlah fraktur tidak sesuai dengan SP
diazepam 10 mg/ 2ml yang d. melaporkan kepada
dikirim juga tercantum 10 ampul. kepala instalasi farmasi
Apakah tindakan pertama yang RS
dilakukan? e. menerima obat
tersebut dan menerima
fraktur
Sumber : peraturan bpom tentang pengawasan pengelolaan obat ,
bahan obat narkotik , psikotropika, dan prekusor farmasi di
fasilitas pelayanan kefarmasian tahun 218

No SOAL JAWABAN PEMBAHASAN


43 seorang dokter di puskesmas a. 1 kaplet
berdiskusi dengan apoteker b. 2 kaplet
mengenai penetapan aturan pakai c. 3 kaplet
obat 4 KD- OAT kategori 1 d. 4 kaplet
(RHZE (150/ 75/ 400/ 275))
e. 5 kaplet
sediaan kaplet yang akan
diberikan kepada pasien TB
perempuan usia 35 tahun BB 49
kg , baru terdiagnosa TB paru .
obat tersebut di berikan satu kali
sehari dan jumlah obat untuk satu
kali minum disesuaikan dengan
berat badan pasien. Berapakah
jumlah obat untuk satu kali
minum yang tepat
direkomendasi?
44 seorang pasien laki – laki usia a. Nistatin
47 tahun dirawat di suatu b. Metronidazol
rumah sakit dengan diagnosa c. ciprofloksasin
rinosinusitis. Tanda klinis d. Cefadroxil
yang teramati pada pasiaen e. azitromisin
adalah keluartnya nanah pda
hidung. Dokter berdiskusi
dengan apoteker pada saat
visite awal pasien di ruang
rawat inap . untuk
menentukan terapi untuk
pasien. Apakah antobiotik
yang direkomendasikan
kepada dokter?

No SOAL JAWABAN PEMBAHASAN


45 Seorang dokter di suatu rumah a. INH
sakit meminta informasi kepada
apoteker mengenai penyesuaian danRifampisin
dosis obat TB Paru untuk b. INH
pengobatan pasiennya (laki-laki,
usia 48 tahun, baru terdiagnosa danPirazinamid
mengalami TB paru ) karena
pasien mengalami penurunan c. Rifampisin dan
fungsi ginjal (klirens kreatinin Etambuthol
28 ml/menit). Apoteker
menyarankan 2 antibiotik dari d. Rifampicin
paket kombipak HRZE yang e.Pirazinamid dan
akan diberikan memerlukan Etambuthol Hampir semua pasien TB, isoniazid dan rifampisin tidak memerlukan
penyesuaian dosis. Apakah obat modifikasi dosis pada gagal ginjal. Pyrazinamide dan etambutol biasanya
yang dimaksud? membutuhkan pengurangan frekuensi dosis harian dari setiap hari menjadi
tiga kali dalam seminggu. Dipiro 9 hal 486.
46 Seorang dokter di suatu a. Asammefenamat
puskesmas akan meresepkan b. Ibuprofen
obat untuk meringankan rasa c. Natriumdiklofenak
nyeri pada pasien otitis media d. piroksikam
(laki-laki, usia 24tahun , e. kaliumdiklofenak
penderita otitis media). Dokter
tersebut meminta rekomendasi
pilihan obat yang efektif kepada
apoteker, karena penggunaan
parasetamol selama 5 hari
belum mampu menghilangkan
rasa nyeri pada telinga
pasien.Apakah obat yang tepat
direkomendasikan untuk
menggantikan parasetamol?

Nyeri ringan : acetaminophen, ibuprofen, naprofen

Nyeri sedang : acetaminophen+opioid

Nyeri berat : fentanyl/ morfin bisa ditambah NSAID lain,


antidepresan trisiklik.
No SOAL JAWABAN PEMBAHASAN
47 Seorang dokter di suatu A. Co-amoxiclav
rumah sakit meminta B. Azithromisin
rekomendasi pilihan C. Ciprofloxacin
antibiotik untuk pasiennya D. Seftriaxon
(laki-laki usia 24 tahun, E. Cotrimoxazole
penderita otitis media
tingkatan sedang) karena
pasien memiliki riwayat
alergi terhadap penggunaan
amoxicilin. Apakah
antibiotik yang dapat
direkomendasikan? Untuk pasien otitis media kategori sedang
dengan alergi amox dapat menggunakan azithromisin (diphiro, Ed 9)

48 Seorang dokter suatu rumah A. Co Amoxiclav


sakit berdiskusi dengan B. Azithromisin
apoteker untuk menentukan C. Sefuroxim
pilihan antibiotik yang D. Seftriaxon
lanjutan untuk pasiennya ( E. Kotrimoxazole
laki-laki, usia 12 tahun
menderita otitis media parah
) pasien sudah 7 hari dirawat
diruang rawat inap karena
gejala otitis media akut
belum berkurang walaupun
telah diterapi dengan
amoxicilin ( 3 hari )
azithromisin (3 hari).
Apakah antibiotik yang tepat
untuk direkomendasikan ?

No SOAL JAWABAN PEMBAHASAN


49 Seorang apoteker di suatu A. 1 kali seminggu
rumah sakit menyarankan B. 2 kali seminggu
perubahan frekuensi C. 3 kali seminggu
pemberian 2 obat paket D. 4 kali seminggu
kombipak HRZE kepada E. 5 kali seminggu
dokter untuk pengobatan
pasien (laki-laki usia 45 tahun, Hampir semua pasien TB, isoniazid dan rifampisin tidak memerlukan modifikasi
baru terdiagnosa mengalami dosis pada gagal ginjal. Pyrazinamide dan etambutol biasanya membutuhkan
TB paru). Hal ini dikarenakan pengurangan frekuensi dosis harian dari setiap hari menjadi tiga kali dalam
pasien mengalami penurunan seminggu.
fungsi ginjal (klirens kreatinin
28 ml/menit) kedua obat Dipiro 9 hal 486
tersebut tidak boeh diberikan 1
kali sehari kepada

50 Seorang dokter di suatu rumah a. 10


sakit berdiskusi dengan b. 20
apoteker untuk menentukan d. 40
sedian tabir surya dalam e. 50
rangka meminimalkan efek c. 30
samping penggunaan Salep
Takrolimus 0,1% pada
pengobatan dermatitis atoprik
yang dialami pasien
(perempuan, usia 27 tahun,
bercak dermatitis pada lengan
kanan). Apoteker
merekomendasikan
penggunaan tabir surya
dengan ukuran SPF tertentu.
Berapakah ukuran SPF
minimal tabir surya yang tepat
direkomentasikan?
No SOAL JAWABAN PEMBAHASAN
51 Seorang apoteker di a. Tween 80
bagian R&D suatu b. Span 80
industri farmasi akan c. Parafin cair
menggunakan emulgator d. Cera alba
hidrofilik untuk optimasi e. Kalsium stearat
formula krim
hirdokotison 2,5%. Bahan
baku emulgator yang
tersedia di industri adalah
Tween 80, Span 80,
parafin cair, cera alba dan Pharmaceutical Excipients edisi 6
kalsium stearat. Apakah
emulgator yang tepat
digunakan?

52 Suatu industri farmasi a. Bahanpenghancur


melakukan trial produksi b. Bahan penyalut
sediaan tablet piroksikam 20 c. Bahan pengisi
mg/tablet denganbobot tablet d. Bahan pengikat
200mg. Tablet yang
e. Bahan lubrikan
dihasilkan terjadi chipping
(breaking of tablet edges).
Untuk mengatasi
permasalahan terebut
apoteker menyarankan untuk
melakukan perubahan
formula dengan penambahan
salah satu bahan
tambahan.Apakah bahan
tambahan yang dimaksud?

Pharmaceutical Technology vol 40 no. 2 tahun 2016


N SOAL JAWABAN PEMBAHASAN
o
53 Seorang apotaker di bagian R&D suatu a. Putaranpancisaatpenyalut
industry farmasi sedang mengembangkan anterlalutinggi
formula sediaan tablet salut enterik b. Kecepatanpenyempr
natrium diklofenak. Setelah dilakukan otantelalutinggi
penyalutan, tablet yang didapatkan rusak c. Proses
seperti pada gambar berikut. pengeringanterlalucepat
d. Migrasipada proses
pengeringan
e. Konsentrasipolimert
erlalurendah

Apakah penyebabdarikerusakan tablet


saluttersebut (salut mengelupas)?

54 Seorang apoteker dibagian a. kelas A


produksi suatu Industri Farmasi b. kelas B
akan memimpin jalannya proses c. kelas C
d. kelas D
filling serbuk omeprazole inj
e. kelas E
kedalam vial, proses tersebut
dilakukan secara aseptis dibawah
LAF. Dikelas manakah proses
tersebut dilakukan ?
(Pedoman Cara Pembuatan Obat Yang Baik, 2006)
No SOAL JAWABAN PEMBAHASAN
55 Seorang apoteker disuatu apotek a. 30 tablet
sedang menghitung stok pengaman b. 40 tablet SS = Pemakaian rata-rata x lead time
tablet digoxin 0,25 mg. Rata-rata c. 50 tablet Pemakaian rata-rata = 900 tablet : 30hari = 30 tablet
tablet digoxin 0,25 mg yang d. . 60 tablet Lead time = 2hari
diresepkan dokter tiap bulannya e. 70 tablet Jadi SS = 30 x 2 = 60 tablet (D)
(30hari) adalah sebanyak 900 tablet.
Waktu tunggu yang dibutuhkan
untuk sekali pemesanan adalah 2
hari. Berapakah stok pengaman
tablet digoxin 0,25 mg tersebut ?

56 Seorang apoteker penanggung jawab a. Rp 60 juta/bula BEP = Biaya tetap : 1- ( biaya variabel : total omset )
disuatu PBF menyediakan obat-obat b. Rp 75 juta/bulan BEP = 30juta : 1- (90 juta : 150juta)
kardiovaskuler dan memiliki data c. Rp 90 juta/bulan = 30juta : 1- 0,6
biaya operasional sebagai berikut: d. Rp 120 = 30juta : 0,4
Biaya tetap : Rp 30juta/bulan juta/bulan = 75juta ( B)
-Biaya variabel : Rp 90juta/bulan e. Rp 150
Target omset penjualan adalah juta/bulan
sebesar 150 juta/bulan . Berapakah
BEP yang tepat ditetapkan oleh
apoteker tersebut?

No SOAL JAWABAN PEMBAHASAN


57 Seorang apoteker menerima resep a. Tidak
dari pasien (perempuan, usia 58 memberikan Pemberian bersamaan dengan suplemen kalsium, antasida, dan
tahun penderita osteoporosis) yang suplemen pengobatan oral lainnya dapat mempengaruhi absorbsi alendronat,
berisi alendronat dan suplemen kalsium oleh karen itu pasien harus menunggu sekurang-kurangnya setengah
kalsium. Apoteker menyadari b. Meminta paien jam setelah minum alendronat sebelum minum obat oral lainnya.
bahwa kedua obat tersebut dapat tidak meminum
berinteraksi jika digunakan secara alendronat (IONI, Bab 6 Sistem Endokrin)
bersamaan. Apakah tindakan yang c. Memberikan
tepat dilakukan? jeda waktu
pemberian
d. Memberikan
tambahan karsitol
e. Memberikan
tambahan
suplemen besi

58 Seorang dokter di suatu rumah sakit a. Silotazol Pasien penderita angina pektoris yang diresepkan obat untuk
meminta pertimbangan apoteker b. Klopidogrel mencegah komplikasi infark miokardial namun berkontraindikasi
mengenai pilihan obat untuk c. Tikagrelor dengan aspirin, dapat diberi obat klopidogrel 75 mg/hari
pengobatan pasiennya (laki-laki, d. Tirofiban
usia 55 tahun, penderita angina e. Dipyridamol
pektoris stabil). Dokter akan (Dipiro 9th, halaman 108)
meresepkan aspirin untuk
mencegah komplikasi infark
miokardial pada pasien. Akan
tetapi, pasien kontraindikasi dengan
apirin yang disebabkan karena
pasien memiliki riwayat penyakit
gagal ginjal kronis. Apakah obat
pengganti yang tepat
direkomendasikan?

No SOAL JAWABAN PEMBAHASAN


59 Seorang pasien DM tipe 2 a. Insulin
(perempuan, 53 tahun) mendatangi b. Exenatide Exenatide bekerja dengan meningkatkan pelepasan insulin (terutama
poli spesialis di rumah sakit. Pasien c. Empagliflozin setelah makan) dan mengurangi jumlah gula yang diproduksi oleh
mengalami obesitas.kadar HbA1C d. Glikuidon hati. Obat ini juga memperlambat pencernaan makanan di perut,
pasien saat ini 8.5%. Selama ini e. Pioglitazin mengurangi jumlah gula yang diserap dari makanan, dan dapat
paien menggunakan metformin membantu mengurangi nafsu makan.
untuk mengontrol kadar glukosa
darahnya. Dokter berdiskusi dengan (Dipiro 9th, halaman 164)
apoteker untuk menambahkan obat
DM ke dua yang dapat mengontrol
nafsu makan pasien. Apakah obat
yang disarankan?
60 Seorang pasien, perempuan, usia 15 a. Salep hidrokortison
tahun datang ke apotek untuk 1%
membeli obat tanpa resep dokter b. Gel aloe vera
dengan keluhan jerawat membandel c. Krim isotretinoin
yang membuat dirinya malu untuk d. Gel benzol peroksida
berkumpul dengan temanya. e. Salep oksitetrasiklin
Apoteker melakukan assesment dan
disimpulkan pasien mengalami
gangguan jerawat ringan dengan
beberapa komedo. Apoteker
selanjutnya memilihkan obat yang
sesuai untuk kondisi jerawat pasien.
Apakah obat yang tepat dipilihkan
untuk pasien?

(Dipiro 9)

No SOAL JAWABAN PEMBAHASAN


61 Pasien (perempuan), 45 tahun, a. 2HRZ
penderita TB mendapatkan terapi b. 4H3R3
OAT kategori 1. Pemeriksaan BTA c. 2HRZE
pada bulan ke lima menunjukan hasil d. 5H3R3E3
positif. Dokter berdiskusi dengan e. HRZ
apoteker mengenai pengobatan
f. 2hrzes
lanjutan. Apakah pengobatan lanjutan
yang tepat direkomendasikan?
Menurut Kemenkes (2011)
PedomannasionalPengendalianTuberkulosis, pasien dengan OAT
kategori 1 dengan BTA pada bulan kelima masih positif, pengobatan
diganti dengan OAT kategori 2 mulai dari awal, yaitu 2HRZES

62 Seorang pasien, laki-laki, usia 35 a. Menurunkan dosis


tahun,didiagnosa dokter di suatu eritrimisin menjadi
rumah sakit mengalami ISPA dan 250mg
mendapatkan resep dokter sebagai b. Penggunaan
berikut: eritromisin 2 jam
R/ Eritromisin 500mg No. XV setelah terfenadin
S3dd I (dihabiskan) c. Penggunaan
R/ Terfenadine No. XV terfenadin 2 jam
S3dd I setelah eritromisin
Apoteker melakukan skrining resep d. Terfenadine diganti
dan menemukan interaksi obat. dengan cetrizine
Eritromisin menghambat e. Eritromisin diganti
metabolisme terfenadine jika dengan amoxicillin
digunakan bersama dan
menyebabkan aritmia pada pasien.
Selain itu, pasien memiliki riwayat
alergi terhadap golongan penisilin.
Apakah rekomendasi yang
disarankan untuk meminimalkan
resiko interaksi obat tersebut?

Medscape)
Interaksi antara eritromisin dengan terfenadin menimbulkan efek yang
serius sehingga untuk meminimalkan resiko tersebut digunakan
alternatif lain, terfenadin diganti dengan cetrizine

No SOAL JAWABAN PEMBAHASAN


63 seorang dokter di suatu rumah a. INH dan
sakit berdiskusi dengan apotker pirazinamid
tentang alternatif antibiotik untuk b. levoloksasin dan
pengobatan pasienya 9 laki-laki, etambutol
usia 48 tahun penderita kusta c. Kloazimin dan
pausi basiler). Hasil uji sensiitas Pirazinammid
menyimpulkan bakteri penyebab d. Klaritomisin dan
kusta pada pasien telah resisten Minosiklin
terhadap Rifampisin. Apoteker e. INH dan oloksasinf
menyarankan kombinasi dua
antibiotik untuk menggantikan
riampisin. Apakah antibiotik yang
tepat direkomendasikan?
Sumber WHO 2018

64 seorang pasien anak didiagnosis a. Kloramenikol pembahasan : antibiotik lini pertama untuk salmonella typosa yaitu
dokter menderita demam tipus. b. Ampisilin kloramenikol 50 -75 mg/kg selama 14-21 hari, amoxicillin 75 – 100
Pasien anak tersebut juga c. Meropenem mg/kg selama 14 hari, dan kotrimoksazol 8 – 40mg/kg selama 14 hari.
memiliki riwayat alergi penisilin. d. Siproloksasin Sumber: Guidline or the management o typhoid.
Dokter berkomunikasi dengan e. Azitromisin
apoteker terkait pemilihan obat.
Apakah antibiotik lini pertama
yang dapat direkomendasikan?

No SOAL JAWABAN PEMBAHASAN


65 Seorang perempuan, a. Emulsi parain liquid pembahasan: konstipasi akut dapat dihilangkan dengan menggunakan enema air atau
usia 27 tahun, hamil b. Enema natrium supositoria gliserin. (dipiro 9)
usia 8 minggu, ke pikosulat
apotek dengan keluhan c. Garam magnesium
susah buang air besar d. Tablet ekstrak senna
sehingga perut merasa e. Tablet bisakodil
kembung dan penuh.
Apakah obat yang
tepat dipilihkan untuk
pasien tersebut?

66 Seorang pasien, laki- a. Alergiobat


laki, usia 65 tahun, b. Efektoksikobat
penderita depresi, c. Efeksampingobat
berkonsultasi dengan d. Gejalapenyakit yang
apoteker di ruang tidakberkurang
konseling suatu rumah e.Komplikasidaripeny
sakit mengenai gejala akit yang dialami
yang dialaminya
setelah seminggu
menggunakan
amitryptilin 25 mg.
Pasien mengeluhkan
dia mengalami susah
buang air besar, mulut
kering, mual dan
kebingungan. Apakah drug information handbook 17th edition, halaman 397)
problem terapi yang
dialami pasien tersebut
?

No SOAL JAWABAN PEMBAHASAN


67 Seorang apoteker di IFRS sedang a. 24 jam padasuhu .
melakukan pencampuran serbuk 25°C
injeksi seftriakson dengan infus b. 48 jam padasuhu
NaCL. Pencampuran dilakukan 25°C
dengan LAF.Apoteker c. 48 jam padasuhu
selanjutnya menuliskan 5°C
keterangan BUD tersebut pada d. 72 jam padasuhu
label obat. Berapakah BUD yang 5°C
tepatdituliskan? e. 24 haripadasuhu
10°C (Injectable Drugs Guide, halaman 137)
68. Seorang apoteker yang praktek di suatu rumah sakit akan melanjutkan Plan = perencanaan
studinya ke jenjang yang lebih tinggi. Dalam prakteknya, dia banyak Organize = pengorganisasian/mengatur
menangani pasien dengan penyakit kanker. Saat ini, apoteker tersebut Lead = memimpin
mencoba untuk memutuskan jurusan/minat yang sesuai sehingga dapat Control = pengawasan/pengendalian
meningkatkan ketrampilan praktek kefarmasiannya. Apakah aktivitas Documentation = pendokumentasian
manajemen yang dilakukan oleh apoteker tersebut?
a. Plan
b. Organize
c. Lead
d. Control
e. Documentation
69. Apoteker di sebuah apotek melaporkan bahwa apoteknya pada akhir tahun TOR = HPP
lalu memiliki stok opname sebesar Rp. 50.000.000. Sepanjang tahun ini, (Persediaan awal+Persediaan akhir):2
apoteknya melakukan pengadaan obat dan alat kesehatan sebesar Rp.
375.000.000 dan pada akhir tahun ini, hasil stok opname yang dilakukan TOR = Rp. 375.000.000
sebesar Rp. 70.000.000. Berapakah Turn Over Ratio (TOR) dari apotek yang (Rp. 50.000.000 + Rp. 70.000.000) : 2
dikelola oleh Apoteker tersebut?
a. 2,75 kali/tahun TOR = 6,25 kali/tahun
b. 3,00 kali/tahun
c. 4,50 kali/tahun
d. 5,75 kali/tahun
e. 6,25 kali/tahun
70. Seorang apoteker di PBF sedang merapikan terhadap dokumen penyaluran
injeksi cefotaxim. Dokumen tersebut dipilah dan ditentukan dokumen yang
akan dimusnahkan. Berapa lamakah dokumen tersebut dapat disimpan
sebelum dimusnahkan?
a. 1 tahun
b. 2 tahun
c. 3 tahun
d. 4 tahun
e. 5 tahun
71. Seorang apoteker di suatu apotek sedang melakukan penataan penyimpanan Diketahui :
obat-obatan ethical. Apoteker menemukan 2 obat yang masuk dalam kategori
LASA yang tidak ada penandaannya. Obat tersebut adalah fortibi dan santibi
yang sama-sama digunakan untuk terapi pasien TBC. Bagaimana penandaan
LASA yang benar pada obat tersebut?
a. Fortibi dan Santibi
b. ForTIBI dan sanTIBI
c. FORtibi dan SANtibi
d. FORTIBI dan SANTIBI
e. Fortibi dan santibi

(Health Quality and Safety Commission New Zealand, 2013)


72. Seorang apoteker pada bagian PPIC suatu industri farmasi sedang Diketahui :
merencanakan kebutuhan bahan untuk produksi tablet Metampyron sebanyak Bobot per tablet laktosa 700 mg/tablet
100.000 tablet/batch, dengan formula Metampyron 500 mg; Larutan Gelatin Untuk produksi 100.000 tablet/batch
10%; Amilum 2%; Talkum 1%; dan Laktosa sampai 700 mg/tablet. Tiap 3000 gram membutuhkan bahan pengikat sebanyak 290 mL.
Kebutuhan bahan pengikat untuk setiap 3000 gram total bahan adalah 290
mL. Berapakah jumlah (ml) bahan pengikat yang dibutuhkan? Bobot laktosa per batch
a. 0.6766 700 mg x 100.000 tablet = 70.000.000 mg
b. 6.766 = 70.000 g
c. 67.66 Jumlah bahan pengikat
d. 676.6 70.000 g/x = 3000 g/290 mL
e. 6.766 x = 6.766 mL
73. Seorang apoteker disuatu industri farmasi sedang merancang system tata
udara untuk ruang produksi produk baru, yang direncanakan untuk keperluan
produksi tablet asam mefenamat 500 mg. Apoteker akan menggunakan
penyaring pada bagian atas ruangan untuk aliran udara yang keluar dari ruang
produksi. Apakah jenis penyaring yang tepat digunakan ?
a. Fiberglass filter
b. Polyester and pleated filters
c. HEPA filters
d. Washable air filter
e. Corse dust filter

BPOM RI, 2013, Saranapenunjangkritis industry farmasi.

74. Seorang apoteker pada bagian R&N suatu industry farmasi sedang Butylene glycol
mengembangkan tablet simvastatin dengan menggunakan pendekatan formula adalahsinonimdaricarbitoldigunakansebagaicosolventdalamsalep, krim, lotion
mikroemulsi untuk meningkatkan kelarutan simvastatin dalam air bahan
daninjeksi.
tambahan yang digunakan adalah capryol 90 (37%), cremophor EL (28%) dan
carbitol (28%) Apakah fungsi dari carbitol dalam formula tersebut ?
( handbook of pharmaceutical excipients, edisi 9).
a. Minyak
b. Surfaktan
c. Cosurfaktan
d. Stabilizer
e. cosolvent
75. Seorang apoteker pada bagian R&D suatu industri farmasi melakukan studi Bioavailabilitas = X 100%
BA-BE pda sediaan baru kloramfenikol 250mg kapsul branded. Berdasarkan
hasil studi parameter farmakokinetik diperoleh data sebagai berikut : X 100%
Parameter Kloramfenikol Kapsul
bioekivalensi i.v kloramfenikol = 74,27%
branded
Dosis (mg) 250 250 (Shargel leon dkk.2012. biofarmasetika & farmakokinetia terapan, airlangga
Rata-rata AUC (D- 65,14 48,38 university press)
gif) (µg jam/mL)
C max (µg/mL) 6,88
T max (jam) 1,5
Berapakah bioavailabilitas absolut (F) kapsul kloramfenikol branded tersebut
?
a. 62,69%
b. 68,45%
c. 70,72%
d. 74,27%
e. 80,15%
76. Seorang apoteker pada bagian R&D suatu industri farmasi akan
mengembangkan tablet amoksisilin inhidrat sebagai antibiotik untuk
pengobatan tukak lambung. Umumnya amoksisilin memiliki waktu tinggal
yang pendek di lambung sehingga perlu dilkakukan rancangan sediaan yang
tepat agar amoksisilin dapat bertahan lama di dalam lambung. Apakah jenis
sediaan tablet yang tepat dikembangkan oleh apoteker tersebut?
a. Tablet bukal
b. Tablet floating
c. Tablet salut enteric
d. Tablet salut gula
e. Tablet sublingual

77. Seorang apoteker pada bagian R&D suatu industry farmasi sedang
mengembangkan formula klotrimazol krim dengan melakukan analisa
penetrasi klotrimazol ke dalam kulit kelinci. Hasil pengujian menyimpulkan
bahwa penetrasi klotrimazol ke dalam kulit kelinci mengikuti orde nol dengan
persamaan y=0,2078x – 0,036 (x: jam; y:%; r= 0,991). Berapakah tetapan
kecepatan laju penetrasi klotrimazol krim tersebut?
a. 0,036 %/jam Sama dengan persamaan Y=bX – a
b. 0,108 %/jam Tetapan kecepatan laju = k
c. 0,2087 %/jam K = b = 0,2078x
d. 0,4062 %/jam
e. 0,5416 %/jam
78. Seorang apoteker pada bagian R&D suatu industri farmasi melakukan Efisiensi penjerapan / Encapsulation Efficiency (EE) di peroleh dengan
pengembangan sediaan nano paclitaxel dengan menggunakan matriks PLGA menghitung jumlah obat yang digunakan di dalam sistem pembawa dengan
1 mg/100 mg nanopartikel. Untuk penentuan encapsulation efficiency jumlah obat yang tidak terperangkap system pembawa.
dilakukan analisis dengan HPLC, dengan melarutkan 100 mg nanopartikel
dalam 10 ml DCM. Hasil analisis dengan HPLC menunjukkan kadar Encapsulation Efficiency (%) = x 100
paclitaxel bebas adalah 0,01 mg/ml. Berapakah encapsulation efficiency dari
preparasi nanopartikel tersebut?
a. 9,0% = = 99,99%
b. 9,9%
c. 10,0%
d. 90,0%
e. 99,0% Sumber : Savitry,E,P. Wathoni,N.2018. Artikel Tinjauan: Karakterisasi
Efisiensi Penjerapan Pada Nanopartikel Natrium Diklofenak Dalam Sediaan
Topikal. Vol 16. N0.2.
79. Sebuah industri farmasi yang memproduksi tablet amlodipin menerima bahan Metode n-plan digunakan bila material seragam dan supplier telah dikenali
baku amlodipin sebanyak 9 drum. Bahan baku diperoleh dari pemasok yang (sudah sering memasok kita). Sampel dapat dilakukan pada bagian manapun
disetujui dan sudah lama menjadi pemasok bahan baku tersebut serta dari container. Sampel diambil dengan menggunakan rumus √N+1. Unit
diketahui bahan tersebut homogen. Untuk keperluan pemeriksaan oleh QC, sampling dipilih secara acak dan semua container harus disampling bila
maka perlu diambil sampel dari sejumlah drum bahan baku dengan metode n- jumlahnya 4 atau kurang dari 4.
plan. Berapakah jumlah drum yang harus diambil sampelnya?
a. 1 = 4 drum
b. 2
c. 3
d. 4
e. 9 Sumber : WHO Guidelines for Sampling of Pharmaceutical Products and
Related Material, No. 929.2005
80 Seorang apoteker pada bagian QC suatu industri farmasi akan melakukan uji Sediaan lepas lambat kaptopril menggunakan alat disolusi model apparatus II
disolusi sediaan tablet lepas lambat kaptopril yang baru saja selesai dicetak. USP yaitu model paddle.
Apakah alat uji disolusi yang tepat digunakan?
a. Tipe 1
b. Tipe 2 Sumber : Pratiwi, M., Hadisoewignyo, L. 2010. Optimasi Formula Tablet Lepas
c. Tipe 3 Lambat Kaptopril Menggunakan Metode Desain Faktorial. Majalah Farmasi
d. Tipe 4 Indonesia . Vol. 21. No.4.
e. Tipe 5
81. Seorang apoteker bagian R&D suatu Industri farmasi sedang mengembangkan KCKT(HPLC): pemisahan berdasarkan polaritas senyawa dan ikatan pada fase
penetapan kadar fenobarbital dalam sediaan tablet secara KCKT. Baku gerak
internal yang digunakan adalah kafein dan dilakukan uji kesesuaian system
pada tiga hari yang berbeda dengan data sebagai berikut:  Kriteria pemisahan yang baik yaitu 1<k’<10
Parameter Hari Hari Hari  Syarat %RSD= <2%
pertama kedua ketiga  Syarat simpangan Baku = <2%
Faktor kapasitas fenobarbital 5,64 5,70 5,63  Syarat plat teoritis >3000
(k+)  Syarat factor ikutan Tf=1
Simpangan baku relative 1,95 1,84 1,72 Faktor kapasitas 1-10
rasio luas puncak (% RSD)
Jumlah lempeng teoritis 43,725 30,900 28,200
fenobarbital (N)
Faktor ikutan 2,24 2,13 2,39
Simpangan baku relative 1,65 1,75 1,92 (Supriyanto., 2016)
retensi (%)
Parameter manakah yang memenuhi spesifikasi?
a. Factor kapasitas
b. Rasio luas puncak
c. Jumlah lempeng teoritis
d. Factor ikutan
e. Waktu retensi
82. Seorang apoteker pada bagian QC suatu industry farmasi menetapkan kadar 10 ppm----- 0,202
antalgin dalam sediaan injeksi dengan menggunakan metode spektro UV-VIS. X ppm-------0,505
Larutan sampel diencerkan sebanyak 20 kali. Absorbansi yang terbaca pada X= (0,505/0,202)*10
spektro adalah 0.505. sementara itu larutan baku antalgin 10 ppm =25 ppm* 20
menghasilkan absorbansi sebesar 0,202. Berapakah kadar antalgin dalam = 500 ppm
sediaan injeksi tersebut? Atau bis menggunakan rumus
a.25 ppm M1.V1=M2. V2
b.50 ppm
c.125 ppm
d.500 ppm
e.625 ppm
83. Seorang apoteker di suatu rumah sakit akan menetapkan Reorder Point untuk Penggunaan dalam 1 hari =
pemesanan sefadroksil kapsul, karenan obat ini termasuk obat fast moving. 300 box / 3 bulan / 25 hari = 4 box
Data pengeluaran sefadroksil kapsul 3 bulan terakhir adalah 300 box. Satu Selama lead time dibutuhkan =
bulan terdiri dari 25 hari kerja. Safety stock yang ditetapkan apotek adalah 10 4 box X 5 hari = 20 box
box. Lead time pemesanan obat adalah 5 hari. Berapakah Reorder Point obat Safety stock = 10 box
tersebut? Reorder Point =
a. 10 box 20 box + 10 box = 30 box
b. 20 box
c. 30 box
d. 40 box
e. 50 box
84. Seorang apoteker di suatu rumah sakit melakukan penelitian untuk pemilihan ICER = incremental cost effective ratio
obat gangguan pencernaan dengan mengukur Gastrointestinal Symptom Free Analisis Efektivitas biaya (CEA) merupakan metode farmakoekonomi yang
Days (GI SFDs) sebagai Clinical Outcome, dengan data sebagai berikut: digambarkan dalam rasio biaya-efektivitas agar dapat membantu pengambilan
keputusan dalam memilih obat yang efektif secara manfaat dan biaya.
Obat Biaya 1 tahun GI SFDs
Obat A 55.000.000 200
Obat B 75.000.000 250 PHARMACON Jurnal Ilmiah Farmasi – UNSRAT Vol. 7 No. 2 MEI 2018
ISSN 2302 - 2493
Apoteker selanjutnya menghitung nilai ICER data obat tersebut. Apakah
metode farmakoekonomi yang digunakan oleh apoteker tersebut?
a. Cost Benefit Analysis
b. Cost Efectiveness Analysis
c. Cost of Illness Analysis
d. Cost Minimization Analysis
e. Cost Utility Analiysis
85. Seorang apoteker di apotek menulis daftar obat yang akan dipesan di buku SP Psikotropika :
defecta diantaranya: Alprazolam
Diazepam
Nama Obat Jumlah yang dipesan PBF
Alprazolam 0,5 mg 1 box AAM SP Narkotika :
Sanmol tab 500 mg 2 box BSP Codein
Diazepam tab 2 mg 1 box BSP
Salbutamol tab 2 mg 1 box Kinariya SP Biasa :
Ibuprofen tab 400 mg 1 box Kinariya Sanmol
Codein tab 10 mg 1 box KF Salbutamol
Ibuprofen
Berapa jenis surat pesanan (SP) yang digunakan untuk pengadaan obat
tersebut? (3)Surat pesanan Narkotika hanya dapat digunakan untuk 1 (satu) jenis
a. 1 Narkotika.
b. 2 (4)Surat pesanan Psikotropika atau Prekursor Farmasi hanya dapat digunakan
c. 3 untuk 1 (satu) atau beberapa jenis Psikotropika atau Prekursor Farmasi.
d. 4
e. 5
Peraturan Menteri Kesehatan Republik Indonesia nomor 3 Tahun
2015tentang peredaran, Penyimpanan, Pemusnahan, Dan Pelaporan
Narkotika, Psikotropika, Dan Prekursor Farmasi
86. Seorang anak umur 5 tahun mendapatkan resep zinc sirup 20 mg/5 ml, karena Diket:
kasus diare yang dialaminya, dengan aturan minum 1 kali sehari 1 sendok teh. 20 mg/ 5 ml = 1 kali sehari 1 sendok teh
Resep tersebut ditebus disalah satu apotek. Persediaan obat di apotek adalah Sediaan di apotek 10 mg/5 ml
zinc sirup 10 mg/5 ml. atas persetujuan keluarga pasien, apoteker mengganti
obat tersebut. Berapakah dosis yang harus dituliskan pada etiket? Dosis etiket?
a. 1 x sehari ½ C 1 kali sehari 2 sendok teh
b. 1 x sehari ½ Cth
c. 1 x sehari 2 C
d. 1 x sehari 2 cth
e. 2 x sehari 1 C
87. Seorang pasien di ICU mendapatkan fentanil patch untuk nyeri kronik pasca Transdermal fentanyl comes as a patch to apply to the skin. The patch is usually
tindakan laparatomi. Apoteker menyiapkan obat tersebut dan menyampaikan applied to the skin once every 72 hours. Change your patch at abaout the
informasi aturan penggunaan obat pada perawat. Apakah informasi yang tepat sametime of day every time you change it. Apply fentanyl patchesexactly as
disampaikan? directed.
a. digunakan pada bagian yang nyeri
b. patch diganti 72 jam bila masih nyeri U.S Natinal Library of Medicine (MedlinePlus)
c. frekuensi penggunaan patch tiap 12 jam
d. patch yang sama dapat digunakan berulang
e. durasi penggunaan patch 3 jam
88. Seorang apoteker di ruang ICU suatu rumah sakit melakukan evaluasi rspone
terapi obat pada pasien asma (laki-laki, usia 30 tahun, penderita asma kronis)
setelah 1 jam mendapatkan pasien saat ini adalah 55%. Bagaimanakah hasil
respon terapi tersebut?
a. Sangat baik
b. Baik
c. Sedang
d. Buruk
e. Sangat buruk

89. Seorang apoteker melakukan evaluasi terapi obat pada seorang pasien BPH
(laki-laki, usia 40 tahun ). Pasien telah menggunakan tamsulosin 0,8mg 1 kali
sehari selama 6 bulan. Skor IPSS pasien saat ini adalah 15, ukuran prostat 50
g dan ada rasa nyeri pada saat buang air kecil. Selain menggunakan
tamsulosin, apoteker akan merekomendasikan penggunaan obat dari golongan
lain kepada dokter. Apakah obat yang tepat direkomendasikan?
a. Oksibutinin
b. Tadalafil
c. Dutaseride
d. Prazosin
e. Magestrol asetat
90. Seorang perempuan berusia 35 tahun, datang ke apotek ingin membeli obat
untuk keluhan nyeri perut, mual, muntah dan dada terasa terbakar. Diketahui
saat ini pasien hamil trisemester pertama dan memiliki riwayat dyspepsia
sejak 3 tahun yang lalu. Satu minggu yang pasien didiagnosa mengalami
GERD. Apakah obat yang tepat dipilihkan untuk mengatasi keluhan pasien
tersebut?
a. Antasida
b. Ranitidin
c. Omeprazole
d. Misoprostol
e. Surkralfat

91. seorang pasien laki-laki, usia 52 tahun dirawat disuatu rumah sakit mengalami
hipertensi (TD 170/110 mmhg). Pasien memiliki riwayat penyakit diabtes
meletus selama 5 tahun dan rutin meminum glibenklamid. Dokter dan
apoteker berdiskusi untuk menentukan pengobatan pasien pada saat
melakukan visite bersama. Apakah obat yang tepat direkomendasikan?
a. Hidrocloritiazide
b. Amlodipine
c. Furosemide
d. Lisinopril
e. Propranolol

Farmakoterapi handbook 9, hal 92


92. Seorang dokter meresepkan infus siprofloksasin 500 mg untuk Short-course therapy (3-day therapy) with trimethoprim–sulfamethoxazole or
mengobati pasien rawat inap (perempuan, usia 30 tahun, penderita ISK a fluoroquinolone (eg, ciprofloxacin or levofloxacin, but not moxifloxacin) is
non komplikasi). Apoteker diinstalasi farmasi mengatakan kepada superior to single dose therapy for uncomplicated infection. Fluoroquinolones
dokter bahwa obat tersebut sedang kosong. Apoteker should be reserved for patients with suspected or possible pyelonephritis due to
merekomendasikan antibiotic lain sebagai alternative pengobatan the collateral damage risk. Instead, a 3-day course of trimethoprim–
sulfamethoxazole, a 5-day course of nitrofurantoin, or a one-time dose of
pasien. Apakah alternative antibiotic yang tepat direkomendasikan? fosfomycin should be considered as first-line therapy. In areas where there is
a. Amoksisilin more than 20% resistance of E. coli to trimethoprim–sulfamethoxazole,
b. Kotrimoksazol nitrofurantoin or fosfomycin should be utilized. Amoxicillin or ampicillin is not
c. Tobramisin recommended because of the high incidence of resistant E. coli. Follow-up
d. Meropenam urine cultures are not necessary in patients who respond.
e. Gentamisin

farmakoterapi handbook ed. 9 hal 496


93. Seorang dokter disuatu rumah sakit berdiskusi dengan apoteker mengenai Kategori 1 (2HRZE/4H3R3) :
tindak lanjut pengobatan pasien (laki-laki, usia 30 tahun, penderita TBC). Tahap awal/intensif adalah 2HRZE : lama pengobatan 2 bulan, masing masing
Pasien sudah menjalani pengobatan TBC penuh dengan OAT kategori 1 OAT (HRZE) diberikan setiap hari.
selama 2 bulan. Hasil uji sputum menghasilkan BTA positif. Apakah tindak Tahap lanjutan adalah 4H3R3 : lama pengobatan 4 bulan, masing masing OAT
lanjut pengobatan yang tepat direkomendasikan? (HR) diberikan 3 kali seminggu.
a. HRZE Obat ini diberikan untuk:
b. 2HRZE Penderita baru TB Paru BTA Positif
c. 2HRZES Penderita baru TB Paru BTA negatif rontgen positif
d. 4H3R3 Penderita TB Ekstra Paru berat
e. 5H3R3E3
Sumber : Pharmaceutical Care Untuk Penyakit Tuberkulosis (2005)
94. Seorang pasien laki-laki, usia 40 tahun, dirawat disuatu rumah sakit karena
mengalami gejala parkinsonisme. Pasien adalah penderita schizofenia dan
telah rutin menggunakan haloperidol selama 8 bulan. Apoteker menyimpulkan
bahwa gejala tersebut berkaitan dengan efek samping obat dan selanjutnya
memberikan rekomendasi obat untuk mengatasi efek samping yang dialami
pasien. Apakah obat yang tepat rekomendasikan?
a. Triheksifenidil
b. Olanzopin
c. Risperidon
d. Klozapin
e. Quetiapin

• Benztropine memiliki waktu paruh yang memungkinkan pemberian dosis satu


hingga dua kali sehari. Dosis umumnya 1 hingga 2 mg dua kali sehari hingga
maksimum 8 mg setiap hari. Trihexyphenidyl, diphenhydramine, dan biperiden
biasanya memerlukan dosis tiga kali sehari (Tabel 69-4). Diphenhydramine
menghasilkan lebih banyak sedasi. Semua antikolinergik telah disalahgunakan
untuk efek euforia.
• Amantadine sama manjurnya dengan antikolinergik dengan efek memori yang
lebih sedikit.
• Berusahalah untuk mengurangi dan menghentikan agen-agen ini 6 minggu
sampai 3 bulan setelah gejala sembuh.
Dipiro 9 hal 740
95. Seorang pasien laki-laki, usia 28 tahun, didiagnosa dokter disuatu rumah sakit
mengalami gonorrhea. Dokter akan meresepkan antibiotik dan meminta
rekomendasi pilihan obat kepada apoteker karena informasi dari catatan medis
menyatakn pasien mempunyai riwayat alergi terhadap azithormisin. Apakah
antibiotik yang tepat untuk direkomdasikan?
a. Seftriakson dan doksisiklin
b. Gentamisin dan doksisiklin Ceftriaxone parenteral direkomendasikan untuk perawatan gonore. Infeksi
c. Amoksisilin dan tetrasiklin klamidia yang terjadi pada 50% wanita dan 20% pria dengan gonore,
d. Sefadrooksil dan peniisllin G merupakan penyebab utama uretritis postgonococcal, servisitis, dan salpingitis
e. Gemfloksasin dan penisllin G pada pasien yang dirawat karena gonore. Pengobatan dengan doksisiklin atau
azitromisin direkomendasikan pada semua pasien yang dirawat karena gonore.
Dosis tunggal azitromisin (2 g) sangat efektif melawan klamidia.
Dipiro 9 hal 433
96. Seorang apoteker di puskesmas melakukan skrining resep untuk pasien (laki- Obat yang dapat menurunkan kadar teofilin termasuk aminoglutetimida,
laki 25 tahun, penderita TB dan Asma). Pasie mendapatkan obat TB kategori barbiturat, hidantoin, ketokonazol, rifampin, perokok, sulfinperazon,
2 (RHZES) untuk penggunaan 1 bulan dan tablet teofilin untuk terapi simpatomimetik (β-agonis), tioamin, karbamazepin, isoniazida dan diuretik
profilaksis asma. Apoteker menemukan permasalahan interaksi obat dalam kuat.
resep tersebut. Bagaimana mekanisme interaksi obat yang ada dalam resep
tersebut ? Pharmaceutical Care Untuk Penyakit Asma
a. Rifampisin menurunkan kadar teofilin dalam darah melalui induksi Direktorat Bina Farmasi Komunitas Dan Klinik Ditjen Bina Kefarmasian Dan
enzim Alat Kesehatan Departemen Kesehatan RI
b. Isoniazid menurunkan kadar teofilin dalam darah melalui penghambatan
absorbsi
c. Pirazinamid menurunkan kadar teofilin dalam darah melalui induksi Isoniazid: May decrease the metabolism of Theophylline Derivatives. Risk D:
ekskresi Consider therapy modification.
d. Etambutol menurunkan kadar teofilin dalam darah melalui penghambatan
enzim Drug Information Handbook 17th Edition
e. Streptomisin menurunkan kadar teofilin dalam darah melalui peningkatan
volume distribusi
97. Seorang pasien didiagnosa oleh dokter menderita diabetes dan mendapatkan The DPP-4 inhibitor is a class of OAD that inhibits the DPP-4 enzyme.
resep metformin dan glibenklamid. Pasien mengeluhkan sakit kepala dan Sitagliptin, saxagliptin, vildagliptin and linagliptin are DPP-4 inhibitors
merasa lemas setelah minum obat tersebut. Dokter kemudian mengganti available for the treatment of T2DM in Indonesia and many other countries.
glibenklamid dengan sitagliptin. Bagaimana mekanisme aksi dari obat
penganti tersebut ? Penghambat DPP-4 inhibitor adalah golongan OAD yang bekerja menghambat
a. Mengurangi proses gluconeogenesis enzim DPP-4. Sitagliptin, saxagliptin, vildagliptin dan linagliptin termasuk
b. Memicu sekresi insulin golongan penghambat DPP-4 yang beredar di Indonesia dan beberapa negara
c. Menghambat enzim glucosidase lain.
d. Agonis pada reseptor PPARY
e. Menghambat DPP4 Kristin Erna. 2016. Dipeptidyl peptidase 4 (DPP-4) inhibitors for the treatment
of type 2 diabetes mellitus. J Med Sci, Volume 48, No.2 :119-130
98. Seorang pasien, laki-laki, usia 40 tahun, penderita bronchitis kronis, dirawat
di suatu rumah sakit karena positif terinfeksi H. Influenzae. Bakteri tersebut
sensitif terhadap antibiotik amoksiklav, ofloxacin, cefotaxim, sefepim, dan
seftazidim. Setelah dilakukan uji skin test, pasien ternyata alergi terhadap
semua golongan beta laktam. Dokter dan apoteker berdiskusi untuk
pengobatan pasien. Apakah antibiotik yang tepat disarankan?
a. Amoksilin-klavulanat
b. Ofloxacin
c. Cefotaxim
d. Ceftazidim
e. Cefepim

Karena pada soal pasien alergi terhadap antibiotik golongan beta laktam, maka
digunakan antibiotik golongan quinolon yaitu ofloxacin (sumber :
Pharmaceutical Care Untuk Penyakit Infeksi Saluran Pernapasan, 2005)
99. 99. Seorang dokter di IGD suatu rumah sakit meminta pertimbangan apoteker
mengenai pilihan obat untuk menormalkan detak jantung pasiennya (laki-laki,
usia 50 tahun, penderita stroke iskemik). Pasien baru saja pulih setelah
mendapatkan injeksi alteplase. Saat ini pasien mengalami atrial fibrilasi.
Apakah obat yang tepat direkomendasikan?
a. Warfarin
b. Propanolol
c. Aspirin
d. Simvastatin
e. Heparin

Kesimpulan : antikoagulan oral dianjurkan untuk atrial fibrilasi dan jantung


yang diduga sebagai sumber emboli. Antagonis vitamin K (warfarin) adalah lini
pertama yang dapat diberikan pada kondisi tersebut (sumber : Dipiro edisi 9)
100. Seorang dokter umum di puskesmas meminta pertimbangan apoteker
mengenai pengobatan lanjutan pasiennya (laki-laki, usia 55 tahun, penderita
hiperkolesterol). Pasien telah menjalani pengobatan selama 2 tahun. Target
kadar kolesterol total, LDL dan trigliserida telah tercapai. Akan tetapi pasien
memiliki kadar HDL yang rendah (28 mg/dl). Apakah obat yang tepat
direkomendasikan?
a. Simvastatin
b. Atorvastatin
c. Rosuvastatin
d. Ezetimibe
e. Gemfibrozil
Kesimpulan : yang dapat meningkatkan kadar HDL adalah obat golongan
fibrat, yaitu gemfibrosil (sumber : Dipiro edisi 9).
101. Seorang apoteker di apotek menerima resep dokter dari pasien (Laki-laki, usia Pembahasan:
48 tahun) untuk mengobati penyakit otitis yang dialaminya. Resep tersebut Obh  omni bihorio: tiap 2 jam
berisi:
R/ Gentamisin 0,3% ED fl No. I
S Obh gtt II ODS
Apoteker menyiapkan obat tersebut dan menyerahkan kepada pasien. apoteker
juga memberikan informasi kepada pasien mengenai kapan pasien harus
menggunakan obat tersebut tiap harinya. Apakah informasi yang tepat
disampaikan?
a. Tiap 1 jam
b. Tiap 2 jam
c. Tiap 4 jam
d. Tiap 6 jam
e. Tiap 8 jam
102. Hari ini tanggal 15 desember 2018, seorang pasien perempuan usia 23 tahun Pembahasan:
datang ke apotek menyerahkan resep racikan yang berisi lotio kumerfeldi
untuk pengobatan jerawat. Pasien mengatakan kepada apoteker akan
menggunakan sediaan tersebut pada hari ini. Apoteker menyiapkan obat
racikan tersebut, menyerahkan kepada pasien dan memberikan informasi Herawati, F., 2012. Beyond Use Date (BUD). RASIONAL, Vol. 10 No. 3, p.
batas akhir (tanggal) penggunaan sediaan tersebut. Apakah informasi yang 17-24.
disampaikan?
a. 6 Januari 2019
b. 11 Januari 2019
c. 13 Januari 2019
d. 14 Januari 2019
e. 15 Januari 201
103. Seorang apoteker di rumah sakit melakukan evaluasi terhadap stok obat di Metode konsumsi
instalasi farmas. Apoteker menemukan ke kosongan alendronat tablet. Setelah Metode berdasarkan pada data pemakaian obat di masa lampau. Data
di lakukan pengecekan data, obat tersebut termasuk obat dengan tingkat tersebut kemudian di pakai untuk menghitung jumlah kebutuhan obat.
peresepan yang rendah. Apoteker selanjutnya melakukan pengadaan obat Metode epidemologi/morbiditas
untuk priode bulan depan apakah metode pengadaan yang tepat untuk obat Metode berdasarkan pada data jumlah kasus (penyakit). Data ini digunakan
tersebut.? untuk menghitung jumlah obat.
a. Just in time Metode kombinasi
b. Konsiyansi Metode berdasarkan kombinasi anatara epidemologi dan pola konsumsi.
c. Konsumsi
d. Epidemologi
e. Kombinasi
104. Seorang apoteker di apotek membuat surat pesanan (SP) untuk pengadaan
sirup obat batuk untuk anak yang mengandung dektrometorfan. Obat tersebut Menurut Peraturan Mentri Kesehatan No. 35 tahun 2009 tepatnya pada
di pesan sebanyak 24 botol untuk stok obat bulan ini. Apakah jenih SP yang Lampiran 1 yang memuat daftar obat golongan Narkotik, dimana dicantumkan
di gunakan.? bahwa Dekstrometorfan merupakan Narkotik golongan ketiga. Namun pada
a. SP Reguler
tahun 2017, terdapat perubahan pada golongan Narkotik (Peraturan Mentri
b. SP Narkotik
c. SP Psikotropik Kesehatan No. 02 tahun 2017) dan di jelaskan bahwa dektrometorfan tidak lagi
d. SP Prekusor termasuk kedalam golongan obat Narkotik, melainkan Masuk kedalam
e. SP Obat-obat tertentu golongan OOT (PKBPOM No. 07 tahun 2016 tentang OOT). Dimana OOT
atau Obat-obat tertentu adalah Obat-Obat Tertentu yang Sering
Disalahgunakan, yang selanjutnya disebut dengan Obat-Obat Tertentu, adalah
obat-obat yang bekerja di sistem susunan syaraf pusat selain Narkotika dan
Psikotropika, yang pada penggunaan di atas dosis terapi dapat menyebabkan
ketergantungan dan perubahan khas pada aktivitas mental dan perilaku.

105. Seorang pasien, laki-laki, masuk UGD suatu rumah sakit karena terjatuh dari Sistem distribusi di unit pelayanan dapat dilakukan dengan cara:
motor. Perawat di depo UGD mengambil obat-obatan dan alat kesehatan yang Sistem Persediaan Lengkap di Ruangan (floor stock)
di butuhkan untuk pertolongan dan perawatan pasien tersebut dan selanjutnya Pendistribusian Sediaan Farmasi, Alat Kesehatan, dan Bahan Medis Habis
mencatat penggunaan obat-obatan tersebut dalam kartu rekam medis pasien. Pakai untuk persediaan di ruang rawat disiapkan dan dikelola oleh Instalasi
Apakah sistem distribusi obat yang dipakai pada depo UGD tersebut.? Farmasi.
a. Individual preascribing Sediaan Farmasi, Alat Kesehatan, dan Bahan Medis Habis Pakai yang disimpan
b. Ward floor stock di ruang rawat harus dalam jenis dan jumlah yang sangat dibutuhkan.
c. Automatic dispensing Dalam kondisi sementara dimana tidak ada petugas farmasi yang mengelola (di
d. Unit dose dispensing atas jam kerja) maka pendistribusiannya didelegasikan kepada penanggung
e. Once daily dose dispensing jawab ruangan.
Setiap hari dilakukan serah terima kembali pengelolaan obat floor stock kepada
petugas farmasi dari penanggung jawab ruangan.
Apoteker harus menyediakan informasi, peringatan dan kemungkinan interaksi
Obat pada setiap jenis Obat yang disediakan di floor stock.
Sistem Resep Perorangan
Pendistribusian Sediaan Farmasi, Alat Kesehatan, dan Bahan Medis Habis
Pakai berdasarkan Resep perorangan/pasien rawat jalan dan rawat inap melalui
Instalasi Farmasi.
Sistem Unit Dosis
Pendistribusian Sediaan Farmasi, Alat Kesehatan, dan Bahan Medis Habis
Pakai berdasarkan Resep perorangan yang disiapkan dalam unit dosis tunggal
atau ganda, untuk penggunaan satu kali dosis/pasien. Sistem unit dosis ini
digunakan untuk pasien rawat inap.
Sistem Kombinasi
Sistem pendistribusian Sediaan Farmasi, Alat Kesehatan, dan Bahan Medis
Habis Pakai bagi pasien rawat inap dengan menggunakan kombinasi a + b atau
b + c atau a + c.
106. Sebuah industri melakukan perubahan rasa pada produk ibuprofensirup yang
telah rutin diprouksi sebelumnya, yaitu dari rasa jeruk menjadi rasa pisang.
Apoteker pada bagian registration departement melakukan registrasi produk
ibuprofen rasa pisang tersebut ke BPOM, apakah jenis registrasi yang tepat
untuk diajukan ?
a. Reistrasi ariasi mayor
b. Reistrasi variasi minor
c. Registrasi variasi notifikasi
d. Registrasi ulang
e. registrasi produk biosimilar
107. Seorang Apoteker dibagian pengawasan kosmetik BPOM meelakukan analisis
terhadap pewarna dalam lipstik. Analisa dilakukan dengan menggunakan
HPLC dan ditemukan kandungan pewarna yaitu pigmen orange 5, pigmen red
5, FD&C red 3, natural brown 5, dan pimen red 102, dari temuan tersebut
apakah pewarna yang dilarang diunakan
a. pigmen orange 5
b. Pigmen red 5
c. FD&C red 3
d. Natural brown 5
e. pigmen red 102

108. Seorang apoteker pada bagian R&D suatu industri farmasi akan menggunakan Tween 40 = x
kombinasi dua emulgator dengan HLB 15 untuk pengembangan formulasi Span 40= 5 – x
emulsi ekstrak temulawak. Emulgator yang digunakan untuk emulsi tersebut
adalah tween 40 (HLB 12,2) dan span 40 (HLB 19,2). Total emulgator yang
digunakan adalah 5 gram. Berapakah perbandingan jumlah tweem dan span
yang tepat digunakan ?
a. 1:2
b. 3:2
c. 3:4
d. 4:5
Jika Tween 40 = 3, maka
e. 6:7

Perbandingan : 3:2

Syamsuni, H. A., 2007, Ilmu resep, Penerbit Buku Kedokteran EGC, Jakarta
109. Seorang apoteker pada bagian QC suatu industri farmasi akan mengevaluasi
sifat alir granul tablet ibuprofen berupa granul. Sebanyak 100 gram granul
dituang pada volumenometer 100 ml dan didapatkan volume sebesar 50 ml.
Setelah 500 kali pengempaan selama 5 menit, volume granul menjadi 46 ml.
Berapakah kerapatan nyata (g/ml) granul tersebut ? Aulton, M.E. 2002. Pharmaceutics. The Science Of Dosage Form Design,
a. 8,69 Churchill Livingstone, New York, pp. 360-368.
b. 4,00
c. 4,34
d. 2,17
e. 2,00
110. Seorang apoteker pada bagian QC suatu industri farmasi sedang melakukan Menurut Farmakope Indonesia edisi 4, jika terdapat kebocoran pada satu tube
evaluasi isi minimum salep mata tetrasiklin HCl dengan menggunakan 10 salep mata, ulangi pengujian dengan tambahan 20 tube salep.
tube sampel dan didapatkan hasil bahwa 1 tube mengalami kebocoran.
Apoteker tersebut melakukan pengujian ulang dengan menggunakan sejumlah
sampel tertentu. Berapa jumlah sampel yang tepat digunakan ?
a. 25 tube
b. 20 tube
c. 15 tube
d. 10 tube
e. 5 tube
111. Seorang apoteker di bagian R&D suatu industri farmasi melakukan
pemeriksaan pada sampel yang mengandung tiramin, dopamine, epinefrin dan
levodopa. Sampel diperiksa dengan menggunakan HPLC dengan data sebagai
berikut:

Peak levodopa melebar/tidak terlalu ramping. Masalah tersebut dapat diatasi


tanpa mengubah komposisi fase gerak. Apakah solusi yang tepat dilakukan
untuk mengatasi permasalah tersebut?
a. Menurunkan kecepatan laju alir fase gerak
b. Meningkatkan kecepatan alir fase gerak
c. Menambah volume injeksi
d. Meingkatkan panjang gelombang
e. Memperbesar diameter kolom
112. Seorang apoteker di bagian QC suatu industry Farmasi melakukan penetapan Y = bx+a
kadar bahan baku kondroitin sulfat dengan menggunakan KCKT. Pada
pengukuran kurva baku diperoleh data sebagai berikut: intersep -9,776 ppm; Ket :
slope 29,385; koefisien korelaso 0,9980. Pada pengukuran sampel bahan baku Y = luas area di bawah kurva
didapatkan luas area di bawah kurva = 58,5758. Berapakah kadar (ppm) b = slope
kondroitin dalam sampel tersebut? x = kadar sampel (ppm)
a. 17,60 a = intersep
b. 18,60
c. 19,60 Y = bx+a
d. 20,60 58,5758 = 29,385x+ (-0,9776)
e. 21,60 58,5758 + 0,9776 = 29,385x
X = 2,326 ppm

113. Seorang apoteker di bagian R&D suatu industry farmasi sedang melakukan uji Dosis : 300mg/kgBB dan 0,5 mL
farmakokinetika suatu antibiotic pada tikus ( bobot badan = 250 g). Dosis dan 300 x 0,25 = 75mg/0,5mL
volume larutan obat yang akan diberikan adalah 300mg/kgBB dan 0,5mL. Berat obat yg harus di timbang :
Berapakah berat (mg) obat yang harus ditimbang bila larutan obat dibuat
sebanyak 10 mL?
a. 500
b. 600
c. 1.500 =1.500mg
d. 2.500
e. 3.000
114. Seorang apoteker di bagian R&D hendak membuat 50 ovula metronidazole Diket : membuat 50 ovula @ 2 gr
500mg dengan basis oleum cacao. Berat masing – masing ovula adalah 2 g. Zat aktif metronidazole 500 mg
Nilai tukar metronidazole terhadap oleum cacao adalah 1,7. Berapakah berat Nilai tukar metronidazole 1,7
(g) oleum cacao yang dibutuhkan? Dit : berat oleum cacao yang di butuhkan?
a. 87,5 Jawab
b. 75,0 Berat ovula : 50x 2g = 100 g
c. 62,5 Metronidazole 500mg x 50= 25.000 mg x 1,7= 42.500mg = 42,5 g
d. 57,5 Maka oleum cacao yang diperlukan =100 g – 42,5 g= 57,5 g
e. 50,0
115. Seorang apoteker di bagian R&D suatu industry farmasi sedang Penutupan atau sealing Untuk mencegah pemasukan air kedalam inti, perlu
mengembangkan tablet salut gula multivitamin. Proses penyalutan salut gula diberikan lapisan penutup. Tanpa lapisan penutup, tablet-tablet yang terlalu
dilakukan dalam beberapa tahap. Tahap pertama adalah tahap sealing. Apakah lembab, menyerap air secara berlebihan, sehingga tablet menjadi lunak dan
tujuan tahap tersebut? pecah serta mempengaruhi stabilitas fisika dan kimia dari produk akhir.
a. mencegah tablet inti pecah
b. mencegah penetrasi air pada saat subcoating http://lib.ui.ac.id/file?file=digital/20278167-T%2029037-Formulasi%20tablet-
c. menjaga agar permukaan tablet tetap halus full%20text.pdf
d. mencegah zat aktif berdifusi keluar
e. menjaga agar tablet tidak higroskopis
116. Seorang apoteker dibagian produksi suatu farmasi akan memimpin jalannya Black Area
pengemasan sekunder sediaan Omeprazole serbuk injeksi, yaitu berupa Area ini disebut juga area kelas E. Ruangan ataupun area yang termasuk dalam
pengemasan vial ke dalam dus. Di kelas kebersihan manakah tersebut kelas ini adalah koridor yang menghubungkan ruang ganti dengan area
berlangsung ? produksi, area staging bahan kemas dan ruang kemas sekunder.
a. Kelas a
b. Kelas b (CPOB, 2012).
c. Kelas c
d. Kelas d
e. Kelas e
117. Seorang apoteker dibagian IPC suatu industry farmasi menemukan Kuning : penandaan pada bahan-bahan atau produk yang statusnya menunggu
penyimpangan deviasi hasil pengujian. Volume terpindahkan untuk produksi untuk diproses lebih lanjut.
jadi suspense Paraetamol tidak memenuhi syarat (TMS). Produk tersebut Hijau : Penandaan pada bahan-bahan atau produk yang diterima atau siap untuk
dikarantina selama investasi penyimpangan berlangsung. Apakah warna label di distribusikan
yang digunakan. Merah : Penandaan pada bahan-bahan atau produk yang ditolak atau tidak lulus
a. Putih pengujian.
b. Kuning
c. Merah (PerBPOM 13 tahun 2018)
d. Hitam
e. Hijau
118. Seorang Apoteker pada bagian R&D suatu industri farmasi swdang Macam-macam kerusakan pada pembuatan tablet
melakukan pengembangan formulasi teblet natrium diklofenak. Pada Binding : kerusakan tablet akibat massa yang akan dicetak melekat pada
penelitian pendahuluan, didapatkan tabletdengan distribusi twarna yang tidak dinding ruang cetakan.1
merata pada permukaan tablet. Apakah kerusakan yang terjadi pada tablet Sticking/Picking : pelekatan yang terjadi pada punch atas dan bawah karena
tersebut? permukaan punch tidak licin, pencetak masih ada lemaknya, zat pelicinnya
a. Capping kurang atau massanya basah. 1
b. Laminating Whiskering : terjadi karena pencetak tidak pas dengan ruang cetakan sehingga
c. Double Impreesion terjadi pelelehan zat aktif saat pencetakan pada tekanan tinggi. Akibatnya pada
d. Mottling penyimpanan dalam botol-botol, sisi-sisi tablet yang berlebihan akan lepas dan
e. Stinking menghasilkan bubuk.1
Splitting/Capping : Splitting adalah lepasnya lapisan tipis dari permukaan
tablet, tertutama pada bagian tengah; Capping adalah bagian atas tablet terpisah
dari bagian sutamanya,
Mottling : terjadi karena zat warna tersebar tidak merata pada permukaan
tablet.1
Crumbling : tablet menjadi retak dan rapuh, penyebabnya adalah kurangnya
tekanan pada pencetakan tablet dan kurangnya zat pengikat. 1
Laminating : pemisahan tablet menjadi dua atau lebih lapisan karena udara
terjebak dalam massa granul.2
Chipping :keadaan dimana bagian bawah tablet terpotong. Penyebabnya ujung
punch bawah tidak rata dengan permukaan atas die. 2
SUMBER :
Syamsuni, 2005, Farmasetika Dasar dan Hitungan Farmasi, EGC, Jakarta, 84-
85
Rana A. S., dan Kumar S. L. H., 2013, Manufacturing Defect of Tablets : A
Review, Journal of Drug Delivery&Therapeutics, 3(6), 200-206
119. Seorang apoteker yang bekerja dibagian R&D sebuah industri farmasi
merancang formula tablet lepas lambat ketoprofen dengan matrix HPMC
K100M. Hasil disolusi menunjukkan bahwa ternyata metrix tersebut
menghambat pelepasan ketoprofen secara total, sehingga menyebabkan kadar
disolusi obat tersebut menjadi rendah. Apakah bahan yang tepat ditambahkan
untuk mengatasi permasalahan tersebut?
a. PVP K-30
b. Pectin
c. CMC
d. Gelatin
e. Tragakan

120. Seorang apoteker pada bagian QC suatu industri farmasi melakukan uji waktu Pada akhir batas waktu seperti tertera dalam monografi, angakat keranjang dan
hancur pada sampel tablet ketoprofen 50 mg. Setelah 45 menit dalam cairan amati semua tablet: semua tablet harus hancur sempurna. Bila 1 tablet atau 2
usus buatan, masih terdapat 3 tablet yang belum hancur sempurna, sehingga lebih tablet tidak hancur sempurna, ulangi pengujian dengan 12 tablet
perlu dilakukan pengujian ulang. Berapkah jumlah tablet yang digunakan lainnya; tidak kurang 16 dari 18 tablet yang di uji harus hancur sempurna (FI
pada uji ulang tersebut? IV, 1995)
a. 10
b. 12
c. 14
d. 16
e. 18
121. Seorang apoteker dibagian R&D disuatu industri farmasi sedang Dik : Konstanta dielektrik air = 80,4
mengembangkan formula sediaan elixir paracetamol menggunakan pelarut Konstanta dielektrik propilen glikol = 33,0
campur air, etanol dan propilen glikol. Tahap awal yang dilakukan apoteker Konstanta dielektrik etanol = 25,7
tersebut ialah menghitung konstanta dielektrik dari campuran pelarut. Dit : Konstanta dielketrik campuran pelarut ?
Konstanta dielektrik air diketahui sebesar 80,4 sedangkan propilen glikol = 57,61
sebesar 33 dan pelarut etanol sebesar 25,7. Apoteker ingin campuran dengan
perbandingan pelarut air 55% etanol 20% dan propilen glikol 25%. Berapakah
konstanta dielektrik campuran pelarut tersebut.
a. 44,22
b. 46,37
c. 49,36
d. 52,47
e. 57,61
122. Seorang apoteker di puskesmas sedang menghitung kebutuhan tahunan oralit Pemakaian 3 hari x 5 sachet = 15 sachet
200 mg/sachet untuk terapi diare menggunakan metode epidemiologi. Kasus 15 sachet x 600 kasus = 9000 sachet
diare pada tahun lalu adalah sebanyak 600 kasus. Standar terapi penggunaan 9000/360 hari = 25
oralit pada tiap pasien 5 x sehari 1 sachet selama 3 hari. Sisa stok oralit pada LD =5 x 25 = 125
akhir tahun adalah 1000 sachet. Lead time pengadaan dari dinas kesehatan Pengadaan = (Pemakaian rata-rata + Lead time) - Sisa
untuk puskesmas tersebut adalah 5 hari. Berapa jumlah (sachet) oralit yang = (9000 + 125) – 1000
tepat diadakan untuk tahun depan? = 8125 sachet
a. 8.000
b. 8.125
c. 9.000
d. 9.125
e. 9.250
123. Seorang apoteker disuatu rumah sakit sedang melakukan analisis Perhitungan:
farmakoekonomi untuk penggunaan obat A dan obat B sebagai antikanker QALY’s =
yang akan dipilih oleh Panitia Farmasi dan Terapi untuk dimasukkan kedalam (Years of live saved x Utility)
formularium rumah sakit dengan data sebagai berikut:
Jumlah Tahun QALY’ B :
Utilitas
yang 7 x 0,8 = 5,6
Biaya tiap tahun
Obat bertambah
Perawatan dari Live
(Years of Live Jawaban: D
Saved
Saved)
A 25.000.000 5 0,7 (Buku Farmakoekonomi: Prinsip & Metodologi, hal 111)
B 35.000.000 7 0,8
Berapakah nilai QALY untuk obat B?
a. 3,0
b. 3,5
c. 5,0
d. 5,6
e. 7,0
124. Seorang apoteker di apotek menerima pesanan sirup peningkat daya tahan Jawaban: C
tubuh yang baru dipesan dari sebuah PBF. Apoteker mengecek beberapa data
yang ada pada faktur pesanan obat tersebut. Apakah data yang harus dicek Cukup Jelas
pertaman kali?
a. Nama sediaan
b. Kekuatan sediaan
c. Nama apotek pemesan
d. kandungan zat aktif
e. Waktu kadaluarsa
125. Seorang apoteker disuatu rumah sakit memberikan konseling pada saat Pengobatan kusta pausi basiler dilakukan selama 6
menyerahkan paket blister obat kusta yang berisi rifampisin kapsul, dapson
tablet, dan klofazimin tablet atas resep dokter untuk pengobatan pasien ( laki- Jawaban: C
laki, usia 50 tahun, penderita kusta pausi basiler). Apoteker memberikan
informasi total durasi penggunaan obat tersebut kepada pasien. Apakah
informasi yang tepat disampaikan?
a. 3 bulan
b. 4 bulan
c. 6 bulan
d. 9 bulan
e. 12 bulan

126. Seorang apoteker menerima resep dari seorang pasien yang berisi amlodipin Pembahasan
10 mg sebanyak 10 tablet. Apoteker melihat pada tanda iter 2 x dibagian atas Iter 2 x : boleh diulang 3 kali
resep. Berapakah jumlah obat yang dapat dilayani sampai iterasi selesai? Dalam resep amlodipin 10 mg = 10 tablet
a. 10 tablet Jumlah obat = 3x10 = 30 tablet
b. 20 tablet
c. 30 tablet
d. 40 tablet
e. 50 tablet
127. Seorang dokter di rumah sakit meminta pertimbangan apoteker
mengenai pilihan obat untuk mengatasi anemia
pasiennya(perempuan, usia 55 tahun, pasien rawat inap). Pasien
mempunyai riwayat penyakit gagal ginjal kronis dengan nilai
Hb 8 g/dL dan kadar ferritin 150 ng/mL. Apakah terapi yang
tepat direkomendasikan?
a. Zat besi
b. Asam folat
c. Vitamin B12
d. Tranfusi PRC
e. Eritroprotein
128. 1. Seorang dokter di suatu rumah sakit meminta rekomendasi
terapi kepada apoteker mengenai tindak lanjut pengobatan
pasiennya (laki-laki, usia 40 tahun, penderita PPOK ) selama 2
minggu. Pasien telah menggunakan salbutamol inhaler 0,1
mg/dose ( 2 kali sehari) selama 2 minggu. Saat ini pasien masuk
rumah sakit karena mengalami exacerbasi akut. Apoteker
menyarankan penggantian obat. Apakah obat yang tepat
direkomendasikan ?
a. Ipratropium bromida inhaler
b. Fenoterol HBr inhaler
c. Budenoside inhaler
d. Salbutamol-ipratropium inhaler
e. Fluticasone-salmotelor nebulizer

129. Seorang dokter di puskesmas meminta pertimbangan apoteker mengenai


antiinflamasi yang tepat diberikan untuk pasiennya (perempuan, usia 51
tahun, penderita gout arthritis) karena pasien memiliki riwayat gastritis.
Apakah obat yng tepat diberikan?
A. Piroksiakam
B. Asam mefenamat
C. Diklofenac
D . Celecoxib
E. Ibuprofen
Dipir
oX
130. Seorang apoteker di suatu rumah sakit sedang melakukan MESO pada
seorang pasien (laki-laki, usia 52 tahun, penderita TBC, telah menggunakan
isoniazid, rifampisin, piridoksin, etambuthol, asam folat selama 1 bulan).
Pasien sering mengeluhkan nyeri ada malam hari dan bengkak pada pangkal
ibu jari. Hasil pemeriksaan data laboratorium menunjukkan hasil kadar asam
urat nya 10 mg/dl. Apakah obat yang menyebabkan efek samping tersebu?
A. Isoniazid
B. Rifampisin
C. Etambuthol
D. Pirazinamid
E. Asam folat
131. Seorang aoteker di suatu rumah sakit menunjukkan sediaan kanamisin injeksi
(OAT MDR TB) kepada seorang perempuan untuk pengobatan suaminya
(usia 48 tahun) yang baru terdiagnosa MDR TB. Apoteker meminta
perempuan tersebut mengantarkan suami nya ke rumah sakit untuk
penggunaan kanamisin injeksi tersebut selama beberapa hari dalam seminggu
pada fase intensif. Berapa hari kah yang dimaksud apoteker tersebut?
A. 7
B. 6
C. 5
D. 4
E. 3

132. Seorang pasien laki laki berusia 22 tahun, didiagnosa dokter mengalami acute
pharyngitis. Dokter meminta rekomendasi kepadaapoteker mengenai
antibiotik yang tepat untuk diresepkanpada pasien, karena berdasarkan data
rekam medis, pasien memiliki riwayat alergi obat golongan penisilin. Apakah
antibiotika yang tepat direkomendasikan?
a. Amoksisilin
b. Sulfametoksazol
c. Ampisilin
d. Metronidazol
e. Sefadroksil

Sumber : Dipiro Edisi 9


133. Seorang dokter di suatu rumah sakit berdiskusi dengan apoteker mengenai
rencana pengobatan kepada seorang pasien MDR-TB (laki-laki, usia 48 tahun,
penderita MDR-TB) pada fase intensif. Apoteker mengatakan bahwa pasien
juga harus mendapatkan vitamin B6 untuk mencegah salah satu efek samping
obat (kanamisin injeksi, Levofloksasin, Etionamid, Sikloserin, Pirazinamid
dan Etambutol). Apakah obat yang dimaksud?
a. Kanamisin injeksi
b. Levofloksasin
c. Etionamid
d. Sikloserin
e. Pirazinamid

Sumber : Permenkes No 13 tahun 2013 Tentang Pengendalian TB-RO


134. Seorang pasien laki-laki usia 40 tahun, didiagnosis dokter di rumah sakit
mengalami infeksi Hepatitis B kronik. Dokter selanjutnya meresepkan
tenofovir untuk pengobatan pasien dan meminta pasien untuk menebus obat
tersebutdi instalasi rawat jalan. Bagaimanakah mekanisme aksi obat tersebut?
a. Menghambat reverse transcriptase
b. Menghambat polymerase virus
c. Meningkatkan aktivasi sel NK
d. Menghambat sintesis RNA Virus
e. Menghambat enzim protease virus

Sumber : Medscape
135 Seorang ODHA, perempuan 25 tahun, sedang menjalani terapi dengan ARV. PEMBAHASAN :
Pasien mengalami infeksi oportunistik berupa kandidiasis oral dan diterapi Beberapa infeksi oportunisitik (IO) pada ODHA dapat di cegah dengan
dengan flukonazol. Setelah kandidiasis oral sembuh, dokter meresepkan pemberian pengobata profilaksis.
kotrimoksasol. Apoteker melakukan KIE saat menyerahkan obat pada pasien. Pengobatan pencegahan kotrimoksazol (PPK), PPK di anjurkan bagi :
Apakah tujuan pengunaan kotrimoksasol tersebut?  ODHA yang bergejala (stadium klinik 2, 3, 4) termasuk perempuan hamil
a. Memperkuat efek terapi ARV d. Mencegah penularan HIV dan menyusui, walaupun secara teori kotrimoksazol dapat menimbulkan
b. Sebagai profilaksis sekunder e. Meningkatkan kelainan kongenital, tetapi karena resiko yang mengancam jiwa pada ibu
imunitas pasien hamil dengan jumlah CD4 (<200) atau gejala klinis supresi imun (stadium
c. Meningkatkan CD4 klinis 2, 3, 4), maka perempuan yang memerlukan kotrimoksazol dan
kemudian hamil harus melanjukan profilaksis kotrimoksazol.
(kementrian kesehatan RI direktorat pengendalian penyakit dan penyehatan
lingkungan 2011 “tatalaksana klinis infeksi HIV dan terapi ART”).

136 Seorang apoteker merencanakan evaluasi keberhasilan/kegagalan terapi


penggunaan ARV lini pertama KDT (AZT+3TC+EVP) pada pasien HIV-
AIDS ko-infeksi TB (laki-laki usia 30 tahun). Pasien mulai menggunakan
ARV pada bulan Januari 2019. Kapankah evaluasi keberhasilan/kegagalan
terapi tersebut tepat dilakukan?
a. Maret 2019 d. Oktober 2019
b. Mei 2019 e. Januari 2020
c. Juli 2019

137 Seorang pria dengan riwayat hipertensi datang ke apotek membawa obat batik Sumber : Gilad, Segev, et al. 2015. Changes In Blood Pressure Following
pilek dan salesma dengan komposisi : parasetamol, asetilsistein, Escalating Doses Of Phenylpropalamine and A Suggested Protocol For
fenilpropanolamin, dekstrometorfan dan kloramfeniramin maleat. Pasien Monitoring Article CVJ Vol 56.
mengeluhkan mengalami peningkatan tekanan darah setelah meminum obat
tersebut. Apakah obat yang menyebabkan munculnya keluhan tersebut?
a. Parasetamol c. Dekstrometorfan
b. Asetilsistein e. Kloramfeniramin maleat
c. Fenilpropanolamin
138 Seorang pasien berumur 45 tahun mengalami migrain selama 2 kali
dalam seminggu. Dokter berdiskusi dengan apoteker untuk memberi
terapi profilaksis untuk pasien tersebut. Apoteker menyarankan
pemberian beta bloker untuk pencegahan serangan migrain pada pasien.
Apakah obat yang direkomendasikan?

a. Propanolol d. Nadolol
b. Atenolol e. Timolol
c. Metoprolol

Sumber : Dipiro 9 hal 554

139 Seorang pasien, laki-laki, usia 26 tahun, dibawa ke IGD rumah sakit Keracunan pestisida golongan organophspat (methyl parathion)
setelah mencoba bunuh diri dengan menelan 500 ml produk pembunuh menggunakan antidotum Atropin Sulfat dengan dosis 1-2 mg i.v dan
serangga yang berisi methyl parathion. Apoteker langsung menyiapkan dierikan 25-50mg setiap jam.
kebutuhan obatemergensi dan antidote untuk membatasi efek toksik
racun dalam tubuh pasien tersebut. Apakah antidote yang tepat MK = Atropin Sulfat memblok efek muskarinik dan beberapa pusat
disiapkan apoteker untuk pasien tersebut? reseptor muskarinik.

a.Atropin sulfat d.Epinefrin


b.N-asetil sistein e.Kalsium glukonat
c.Nalokson
140 Seorang apoteker di suatu deporawat jalan suatu rumah sakitPembahasan :
melakukan repackage resep racikan kapsul karena resep tersebutBerdasarkan USP/ United States Pharmacopeia
telah sering diresepkan dokter, dengan informasi sebagai
berikut:
Tanggal repackage: 1 januari 2019
Ibuprofen 400 mg: ED 1 Desember 2019
Vitamin B Complex: ED 1 Nopember 2019
Berapa lamakah produk kapsul repackage tersebut masih bisa
digunakan?
a. 1 bulan
b. 2,5 bulan
c. 3 bulan
d. 4,5 bulan
e. 5 bulan
Cara perhitungan dilihat ED yang paling singkat yaitu vitamin B
complex November 2019. Batas yang didapatkan dari Repackage
Januari 2019 sampai ED bulan November 2019 adalah 10 bulan.
Sehingga > 6 bulan, maka dihitung 25% dari ED.
BUD = 25/100 x 10 bulan = 2,5 bulan. Sehingga BUD hasil dari
perhitungan tersebut.

141 Seorang apoteker di suatu rumah sakit memberikan konseling


penggunaan tablet levotiroksin 50 µg atas resep dokter kepada
pasien (perempuan, usia 20 tahun, baru terdiagnosa mengalami
hipertiroid). Apoteker mengatakan bahwa pasien minum obat
tersebut 1 kali sehari 1 tablet selama 14 hari. Selanjutnya, dosis
ditingkatkan dengan cara pasien minum 1 kali sehari 1,5 tablet
pada hari ke 15-28. Apakah tujuan peningkatan dosis tersebut?
a. a. Mencegah efek toksik obat d. Mencegah efek samping
obat https://internis.files.wordpress.com/2011/01/penatalaksanaan-
b. b. Mencegah T3 dan T4 e. Menormalkan kadar perioperatifhipotiroid.pdf
TSH
c. c. Mencegah terjadinya efek iatrogenic

142 Seorang dokter meresepkan ceftriakson injeksi untuk pasiennya yang


didiagnosis otitis media. Dokter menghendaki ceftriakson injeksi
diberikan secara intravena, namun apoteker menuliskan
pemberian injeksi tersebut secara intramuscular. Perawat
memberikan ceftriakson injeksi secara intramuscular. Apakah
jenis medication error yang telah dilakukan apoteker berdasarkan
alur proses pengobatan?
a. a. Unauthorized drug
b. omission error
c. wrong administration technique
d. wrong dose preparation method
e. inproper dose

Sumber : Uhing Antonio LBEP, 2015, Medication Error dalam Fase


Dispensing dan Fase Administration pada Resep Racikan (Studi Kasus)
Di Empat Apotek di Kabupaten Sleman Periode Februari dan Maret
2014, Skripsi: Fakultas Farmasi Universitas Sanata Darma Yogyakarta.

Contoh

Sumber : Enggarani RS, 2017, Medication Error pada Penggunaan Antibiotik


Intravena untuk Pasein Dewasa Rawat Inap di Rumah Sakit “X” (Fase
Administrasi), Skripsi: Fakultas Farmasi Universitas Sanata Darma
Yogyakarta.

143 Seorang apoteker penganggung jawab apotek yang berpraktek kota A


mendapatkan resep codein 10 mg sebanyak 10 tablet, dengan signa 1
x sehari 10 mg untuk pasien dengan keluhan nyeri dada karena batuk
kerig. Resep tersebut dikeluarkan oleh dokter yang berpraktek di kota
B. Apakah tindakan yang dilakukan terkait dengan pelayanan resep
tersebut?
a. Memberikan obat sesuai dengan resep
b. Memberikan obat setengah dari resep
c. Tidak memberikan obat
d. Meyarankan pasien menebus resep di kota B
Menelpon dokter pembuat resep
144 Kepala instalasi disebuah rumah sakit melakukan perhitungan kebutuhan Pembahasan :
apoteker untuk bangsal rawat inap. Diketahui total jumlah bed di Berdasarkan PMK no 72 tahun 2016 tentang Standar Pelayanan
rumah saki tersebut adalah 600 bed dan rata-rata bed occupancy rate Kefarmasian di Rumah Sakit menyebutkan bahwa :
75%. Berapakah kebutuha apoteker di bangsal rawai inap tersebut?
a. 10 b. 15 c. 20 d. 25 e. 30

Perhitungan :
75/100 x 600 bed = 450 bed
Berdasarkan PMK diatas, 1 apoteker untuk 30 pasien sehingga 450 : 30
pasien = 15 apoteker

145 seorang apoteker disuatu apotek melakukan evaluasi tahunan Pemahasan


menggunakan analisis SWOT. Apoteker menemukan bahwa apotek
memiliki kekuatan internal berupa permodalan yang kuat, namun di
sekitar apotek berdiri apotek waralaba baru. Apakah strategi
pengembangan yang tepat dilakukan oleh apotek tersebut?
a. meningkatkan harga obat. d. Memperbaiki
manajemen apotek.
b. melakukan diversifikasi usaha. e. Mengurangi jumlah
apoteker.
c. melakukan reorganisasi SDM apotek.
Kuadran 2 menggambarkan apotek yang menghadapi berbagai ancaman,
namun masih memiliki kekuatan dari segi internal. Strategi yang harus
diterapkan adalah menggunakan kekuatan untuk memanfaatkan peluang
jangka panjang dengan cara diversifikasi produk dan layanan apotek
Diagram analisis SWOT (Rangkuti, 2006)

146 seorang apoteker di bagian QC suatu industri farmasi sedang Pembahasan : (Berat piknometer dan isi-berat piknometer
melakukan uji kemurnian bahan baku minyak ikan akan digunakan kosong)
dalam pembuatan sediaan emulsi penambah nafsu makan. Pengujian Volume piknometer
yang dilakukan adalah menentukan kerapatan menggunkan piknometer. Jadi : (83,473-37,402)g/ 50,078mL = 0,92 g/mL
Berdasarkan hasil pengujian, diperoleh data sebagai berikut :
Berat piknometer kosong 37,402 g
Berat piknometer+ minyak ikan 83,473 g
Volume piknometer 50,078
Berapakah kerapatan bahan baku tersebut?
a. 1,67 g/ml d. 0,92g/ml

b. 1,33 g/ml e. 0,75 g/ml

c. 1,08 g/ml

147 seorang apoteker dibagian RnD suatu industri farmasi mengembangkan pembahasan
kapsul ekstrak pagagan. Pada proses pengisian, kecepatan pengisian 0,2g / detik,butuh waktu 2 detik
campuran serbuk ke dalam cangkang gelatin adalah 0,2 gram/detik Jadi serbuknya 0,2X2 =0,4 gram
dengan waktu pengisian 2 detikuntuk setiap cangkang kapsul. Pada Metode rule of seven
saat uji kerapatan, diperoleh data tapped density serbuk sebesar 1 g/mL. Serbuk =400mg/65 grain= 6,1 grain-6 grain
Apoteker tersebut akan menetapkan ukuran cangkang kapsul gelatin Jadi 7-6 = 1. Ukuran cangkang kapsul terpilih no 1
yang sesuai. Berapakah nomor cangkang kapsul yang tepat digunakan?
a. 0 d. 3
b. 1 e. 4
c. 2

148 Seorang apoteker pada bagian R&D suatu industri farmasi Diketahui :
mengembangkan formula sediaan emulsi minyak ikan. Sediaan emulsi
Tween 80 25% HLB= 15
minyak ikan yang akan dibuat menggunakan kombinasi emulgator yang Span 80 75% HLB= 4,8
terdiri dari tween 80 (HLB 15) sebesar 25% dan Span 80 (HLB 4,8)
Tween 80 =
sebesar 75%. Berapakah nilai HLB campuran emulsi tersebut?
a. 5,35 d. 8,35 Span 80 =
b. 6,35 e. 9,35
c. 7,35
HLB Campuran = 3,75 + 3,6
= 7,35
149 Seorang apoteker pada bagian PPIC suatu industri farmasi sedang Diketahui :
- Krim gentamisin 5 gram mengandung gentamisin sulfat 0,1%
merencanakan kebutuhan bahan untuk membuat krim gentamisin. Krim
- Sekali produksi 10 bets
gentamisin sulfat 5 gram mengandung gentamisin sulfat 0,1% dan basis - Setiap bets 1200 tube
ad 100%. Dalam sekali produksi dibuat 10 bets, dan setiap bets
Gentamisin sulfat 0,1% x 5 gram = 0,005 g
menghasilkan 1200 tube. Berapakah jumlah gentamisin sulfat yang Sekali produksi = 1200 tube x 0,005 g
=6g
dibutuhkan dalam sekali produksi?
a. 3 g d. 90 g Jika sekali produksi dibuat 10 bets, maka jumlah gentamisin sulfat = 6 g
x 10
b. 6 g e. 900 g
= 60 g
c. 60 g
150 suatu industri obt tradisional memproduksi sediaan kapsul ekstrak kulit
manggis. Sebelum dipasarkan, industri tersebuut melakukan registrasi
produk kapsul ekstrak kulit manggis ke BPOM untuk memperoleh ijin
edar. Berapa lamakah masa berlaku izin edar sediaan tersebut ?
a. 2 tahun d. 5 tahun
b. 3 tahun e. 6 tahun
c. 4 tahun

lama masa berlaku izin edar sediaan kapsul ekstrak kulit manggis yaitu 5 tahun
151 seorang apoteker di bagian QC melaukan uji disolusi kapsul azitromisin
dengan data sebagai berikut :
Replikasi 1 2 3 4 5 6
DE 45 74,74% 72,38% 73,91% 71,73% 74,61% 71,39%
Nilai Q untuk obat tersebut dalam FI indonesia V adalah 75%. Apakah
kesimpulan hasil uji disolusi obat tersebut ?
a. Memenuhi syarat
b. Tidak memenuhi syarat dan dinyatakan gagal
c. Belum memenuhri syarat dan di anjurkan dengan menggunakan 6
kapsul
d. Belum memenuhi syarat dan dianjurkan dengan menggunakan 12
kapsul
e. Belum memenuhi syarat dan dianjurkan dengan menggunakan 16
kapsul

Kesimpulan : hasil uji disolusi obat kapsul azitromicin tidak memenuhi


persyaratan dan dinyatakan digagal dikarenakan sesuai dengan FI IV
tabel penerimaan, nilai disolusi ke-6 sampel yang di uji kurang dari nilai
Q obat kapsul azitromicin.
152 Seorang apoteker pada bagian QC suatu industri farmasi melakukan uji
volume terpindahkan injeksi ranitidin 2 mL/ampul. Rata-rata volume
dari 10 ampul pada uji tersebut adalah 2,08 mL, sehingga diperlu
dilihat volume terpindahkan masing-masing ampul yang diuji. Berapa
syarat rentang volume (mL) yang harus dipenuhi dalam uji tersebut ?
a. 1,70 – 2,00 d. 2,00 – 2,30
b. 1,80 – 2,10 e. 2,10 – 2,20
c. 1,90 – 2,20

Dari 10 wadah tidak kurang dari 100% dan tidak satupun volume wadah yang
kurang dari 95% dari volume yang dinyatakan pada etiket.
95% dari 100% adalah 5 %
5% = 5 : 100 x 2 = 0,1
Rentang volume :
 2 – 0,1 = 1,90
 2 + 0,1 = 2,10

153 Seorang apoteker di bagian R&D suatu industri farmasi sedang Caking dapat diatasi dengan flokulasi, yaitu apabila partikel bergabung dengan
mengembangkan sediaan suspensi Kloramfenikol Palmitat. Selama ikatan yang lemah dan longgar. Partikel yang terflokulasi cepat mengendap,
masa penyimpanan, partikel kloramfenikol terlihat mengendap dan membentuk volume endapan yang besar tetapi mudah diredispersi.
membentuk agregat yang saling terikat sangat kuat sehingga sulit
terdispersi saat digojok (caking). Apakah tindakan yang tepat dilakukan http://ladytulipe.wordpress.com/2009/01/04/suspensi/suspensi.htm
untuk mengatasi permasalahan tersebut?
a. Memperkecil ukuran partikel
b. Menurunkan konsentrasi kloramfenikol
c. Mengurangi jumlah suspending agent
d. Membuat sistem flokulasi
Menurunkan viskositas pembawa
154 Seorang apoteker pada bagian R&D suatu industri farmasi melakukan At= -kt + A0
uji stabilitas tablet isoniazid. Reaksi degradasi isoniazid diketahui 93% = -0,1% x t + 100%
mengikuti orde 0 dan memiliki laju reaksi sebesar 0,1%/bulan. Syarat -100 + 93% = -0,1% x t
kadar isoniazid pada sediaan tersebut adalah tidak kurang dari 93% dan -7% = -0,1% x t
tidak lebih dari 100%. Rumus yang digunakan untuk perhitungan orde t = 70 bulan
0 adalah At= -kt + A0. Berapa lamakah waktu kadaluarsa sediaan
tersebut?
60
65
70
75
80
155 Seorang apoteker bagian R & D suatu industri farmasi akan Sirup kering adalah suatu campuran padat yang ditambahkan air pada
mengembangkan bentuk sediaan cefixime untuk pengobatan pada anak- saat digunakan, sediaan tersebut dibuat pada umumnya untuk bahan obat
anak. Cefixime merupakan senyawa tidak larut air. Senyawa ini bisa yang tidak stabil dan tidak larut dalam pembawa air.
terdegradasi dalam air, pH 7-9 mengikuti kinetika orde 0. Apakah Pembuatan sediaan sirup kering bertujuan agar penyimpanannya lebih
bentuk sediaan yang dikembangkan ? stabil. Setelah obat direkonstitusi, obat akan bertahan selama 7-14 hari.
a. Tablet (Farmakope Indonesia Edisi V).
b. Kapsul Stabilitas kimia zat aktif dalam suspensi :
c. Elixir - Hidrolisis : zat rentan teroksidasi, turunkan suhu penyimpanan,
d. Suspensi buat dalam suspensi kering.
e. Suspensi kering - Oksidasi : mudah teroksidasi, dibuat dalam kemasan yang lebih
protektif.
- Fotodegrasi : dikemas dalam wadah yang tahan cahaya.
Cefime tidak larut air. Jika dibuat suspensi, sediaan ini mempunyai
expired date selama 18 bulan dari waktu pengemasan dan harus disimpan
pada suhu 2-8°C sampai akan dipakai dan setelah kemasan dibuka,
suspensi ini hanya stabil 14 hari pada suhu kamar. Untuk itu dipilih
bentuk sediaan dry syrup daripada suspensi langsung sebab
kestabilannya lebih lama.
(AHSF Drug Information 2002 Book I, American Society of Health
System Pharmacist)

156 Suatu industri farmasi memproduksi sediaan suspensi asam mefenamat Dik : Sediaan suspensi Asam Mefenamat 60 ml
60 ml, formula terdiri dari asam mefenamat 125 mg/5 ml, sorbitol 30%, Formula Asam Mefenamat 125 mg/5 ml
Gliserin 2%, Propilen glikol 3%, CMC Na 1%, Benzil Alkohol 2% dan Dit : Berapa yang akan ditimbang jika Batch Size 1000 Botol ?
Aquades ad 100%. Berapakah jumlah (kg) asam mefenamat yang harus Penyelesaian :
ditimbang jika Batch Size 1000 botol ? Asam Mefenamat 1 botol 60 ml
a. 0,42 125 mg/5 ml =
b. 1,5
c. 2,4 Asam mefenamat = 125 mg x 12 = 1.500 mg/1 botol
d. 10,4 Untuk 1.000 botol = 1.500 mg x 1.000
37,5 = 1.500.000 mg (1,5 kg)

157 Seorang pasien, laki-laki usia 28 tahun penderita Gonorrhea dirawat Dik : Ceftriaxone 250 mg
disuatu RS dan mendapatkan Ceftriaxone 250 mg atas resep Dokter. Nilai tukar 1 g Ceftriaxone terhadap Lidocain
Sediaan yang ada diinstalasi farmasi adalah serbuk kering injeksi 1 1% = 0,5 ml
g/vial yang selanjutnya dilarutkan kedalam Lidocain 1%. Nilai tukar 1 Dit : Berapa Lidocain yang dibutuhkan untuk
g Ceftriaxone terhadap Lidocain 1% adalah 0,5 ml. Berpakah jumlah Ceftriaxone 250 ml ?
Lidocain yang dibutuhkan untuk membuat larutan injeksi Ceftriaxone Penyelesaian :
250 mg/ml ? 1% = x 250 mg = 2,5
a. 3,0 ml
b. 3,5 ml
c. 4,0 ml
d. 4,5 ml
e. 5,0 ml
158 Seorang apoteker di industry obat tradisional merencanakan kebutuhan Dik: 1 Kapsul : 360 mg ekstrak
bahan baku untuk produksi kapsul ekstrak rimpang temulawak yang 1 kali produksi : 10.000 kapsul
digunakan untuk pemeliharaan fungsi hati. Dalam satu kapsul Rendemen ekstrak 18 %
mengandung 360 mg ekstrak rimpang temulawak. Rendemen ekstrak
diketahui sebesar 18%. Dalam sekali produksi dibuat 10.000 kapsul. Jawab:
Berapa jumlah serbuk simplisia yang dibutuhkan dalam satu kali
produksi?
a. 2 Kg
b. 5 Kg
c. 20 Kg
d. 50 Kg 18 x = 36.000 mg
e. 200 Kg x=
x = 2000 mg
= 20.000.000
x = 20 kg
159 Seorang apoteker di suatu rumah sakit sedang merekonstitusi serbuk Low-Risk Conditions
injeksi seftriakson 1 gr menjadi larutan 10 mL dalam laminar air flow
workbench (LAFW) untuk digunakan pada dua orang pasien. The CSPs are compounded with aseptic ma-nipulations entirely within ISO Cl
Bagaimanakah tingkatan risiko kontaminasi obat injeksi tersebut? Table 1) or better air quality using only sterile ingredients, products, compon
a. High risk devices.
b. Low risk The compounding involves only transfer, measuring, and mixing manipulations
c. Medium risk more than three commercially manufac- tured packages of sterile products and
d. No risk than two entries into any one sterile container or package (e.g., bag, vial)
Immediate use risk product or administration container/device to in the prepare the CSP.

Manipulations are limited to aseptically open- ing ampuls, penetrating d


stoppers on vials with sterile needles and syringes, tatransferring sterile liquids
syringes to sterile administration devices, package con- tainers of other sterile
and con- tainers for storage and dispensing.

For a low-risk level preparation, in the ab sence of passing a sterility test (se
〈71〉), the storage periods cannot exceed the following time period
administration, the CSPs are properly stored and are ex- posed for not more than
at controlled room temperature (see General Notices and Requirements), for
than 14 days at a cold temperature (see General Notices and Requirements), a
days in solid frozen state between −25° and −10°.

Examples of Low-Risk Compounding


Single-volume transfers of sterile dosage forms from ampuls, bottles, bags,
using sterile syringes with sterile needles, other sterile containers. The solution
ampuls should be passed through a sterile filter to re- move any particles.

Simple aseptic measuring and transferring with not more than three pac
manufactured sterile products, including an infusion or diluent solution to c
drug admixtures and nutritional solutions.

Sumber ; USP 〈797〉 Pharmaceutical Compounding—Sterile Preparations


160 Seorang Apoteker di apotek menerima produk sirup peningkat daya - Harga + ppn
tahan tubuh dari yang baru dipesan dari sebuah PBF. Harga yang tertera Rp.27.500 + 10% = Rp.30.250
difaktur adalah Rp.27.500 (belum termasuk ppn 10%). PBF
memberikan discount 5% dan dianggap sebagai keuntungan apotek. - (Harga + ppn) + margin
Apotek menetapkan margin keuntungan untuk produk tersebuh sebesar Rp.30.250 + 20% = Rp.36.300
20%. Berapakah harga jual produk tersebut ?
a. Rp.26.300
b. Rp.36.300
c. Rp.46.300
d. Rp.56.300
Rp.66.000
161 Seorang Apoteker diApotek melakukan stock opname pada tanggal 30
Maret 2019 dan didapatkan obat yang ED dan rusak sebagai berikut :
N Nama Obat Jumlah Keterangan
O
1 Alprazolam tab 0,5 20 tablet Expired (1 Agustus
mg 2018)
2 Sanmol tab 500 mg 10 tablet Expired (3 September
2018)
3 Salbutamol tab 10 tablet Kemasan primer rusak
4 Amoksan dry sirup 1 botol Serbuk basah
5 Codein tab. 10 mg 10 tablet Expired 1 Januari 2019

Apoteker akan melakukan pemusnahan obat-oba tersebut. Berapakah


jenis berita acara pemusnahan yang tepat disiapkan ?
a. 1
b. 2
c. 3
d. 4
e. 5
162 Seorang apoteker disuatu apotek sedang melakukan pengecekan stok
obat dan ditemukan beberapa obat yang hampir habis. Salah satunya
adalah cefadroxil 500 mg. Apoteker selanjutnya mencatat data obat
tersebut dalam sebuah dokumen. Apakah dokumen yang dimaksud ?
a. Kartu stok
b. Buku defekta
c. Surat pesanan
d. Kartu stelling
e. Buku out stock

163 Seorang pasien menelpon apoteker yang ada di apotek untuk menanyakan
batas kadaluarsa dari resep salep yang di tebusnya 5 hari yang lalu. Resep
yang di tebus adalah sebagai berikut.
R/ neomicyn 1%
Hidrocortison acetat 1%
M f l a ungt
SUE
Berapa lamakah salep tersebut masih dapat digunakan pasien?
A. 9 hari
B. 15 hari
C. 25 hari
D. 30 hari Sumber: (Media informasi peresepan rasional bagi tenaga kesehatan indonesia,
E. 85 hari Volume 10, Nomor 3, ISSN 1411-8742)
164 Seorang apoteker di suatu rumah sakit melakukan meso pada seseorang
pasien (perempuan, usia 50 tahun, penderita hipertensi, DM tipe-2 dan
hiperkolestrol). Pasien rutin minum obat kaptopril, HCT, glimepiride, Sumber (medscape)
metformin, simvastatin. Saat ini pasien mengalami hiperusemia(kadar
asam urat 7,5 mg/dl) dengan keluhan nyeri pada ibu jari kaki. Apoteker
mengatkan kepada pasien hal tersebut di sebabkan efek samping salah
satu obat. Apakah obat yang dimaksud?
A. aptopril
B. HCT
C. Glimepiride
D. Metformin
E. Simvastatin

165 Seorang perempuan usia, 69 tahun, dibawa ke Instalasi Gawat Darurat Pembahasan : (Dipiro, 9)
RS. Riwayat penyakit Diabetes Mellitus sejak 14 tahun yang lalu.
Riwayat obat: OHO kombinasi glibenklamid dan acarbose. Setelah Ketoasisdosis adalah sebuah komplikasi DM yang dapat mengancam
dilakukan pemeriksaan pasien dinyatakan mengalami hiperglikemi jiwa bila tidak ditangani secara tepat. Ketoasidosis disebabkan oleh
ketoasidosis kemudian dokter memutuskan untuk memberikan injeksi tingginya produksi asam darah tubuh yang disebut keton, sehingga perlu
insulin. Apakah jenis insulin yang tepat direkomendasikan kepada insulin dengan kerja cepat. Rapid acting memiliki onset lebih cepat
dokter tersebut ? dibanding insulin lain.
a. Glargin insulin d. Long acting
insulin
b. Rapid acting insulin e. Premixed
insulin
c. Intermediate acting insulin

166 Seorang pasien, perempuan usia 24 tahun didiagnosa dokter pada suatu klinik Jerawat noninflamasi komedon: Pilihan agen topikal yang menargetkan
mengalami jerawat komedial non inflamasi. Riwayat pengobatan pasien peningkatan keratinisasi dengan menghasilkan pengelupasan kulit. Retinoid
adalah krim benzoil peroksida 5% (3 bulan) dan kombinasi krim topikal (terutama adapalene) adalah obat pilihan. Benzoil peroksida atau asam
benzoilperoksida 5%-klindamisin 1,2% (3bulan). Pengobatan tersebut tidak azelaic dapat dipertimbangkan(Dipiro 9, 136)
efektif untuk pasien dan saat ini dokter meminta pertimbangan apoteker untuk
pengobatan lanjutan pasien. Apakah obat yang tepat disarankan ?
a. Hidrokortison asetat 1% krim d. klindamisin 1,2%-
adepalene 0,01% gel
b. asam azelaic 20% krim e. klindamisin 1,2%-
tretinoin 0,025% gel
c. adepalene 0,1% gel
167 seorang pasien, wanita usia 24 tahun, didiagnosa dokter mengalami gastric
ulcer karena infeksi H. pylory. Dokter meresepkan omeprazole 20 mg 2 kali
sehari, clarithromycin 500 mg 2 kali sehari dan amoxicillin 1 g 2 kali sehari
selama 14 hari. Pada saat menebus resep pasien mengatakan kepada apoteker
bahwa dia alergi terhadap amoksisilin. Apakah antibiotic yang tepat untuk
disarankan kepada Dokter penulis resep untuk mengganti amoksisilin ?
a. Metronidazol d. Doksisiklin
b. Cotrimoksazol e. Azythromycin
c. Ciprofloksasin

168 seorang dokter di suatu rumah sakit berdiskusi dengan apoteker untuk
pergantian seftriakson injeksi dengan antibiotik lain untuk seorang pasien
CAP (laki-laki, usia 23 tahun selesai di rawat di ICU selama 3 hari). Saat ini,
pasien telah dipindahkan ke ruang rawat inap. Kondisi pasien sudah stabil dan
telah bisa mengkonsumsi obat secara oral. Apakah antibiotik yang tepat
direkomendasikan ?
a. doksisiklin d. seftadizim
b. siprofloksasin e. carbepenem
c. amoksisilin
169 seorang dokter di suatu rumah sakit melakukan visit bersama apoteker untuk
melihat keadaan dan menentukan tindakan pengobatan pasiennya (laki-laki,
usia 53 tahun, penderita rheumatoid arthritis (RA) aktivitas rendah). Selain
itu, prognosis penyakit pasien terlihat buruk karena terlihat adanya erosi pada
tulang rawan. Dokter meminta pertimbangan apoteker terkait pilihan obat
yang akan diberikan kepada pasien. Apakah obat yang tepat untuk
direkomendasikan?

a. hidroksi klorokuin + prednison

b. minosiklin + natrium diklofenak

c. metrotreksat + piroksikam

d. Siklosporin + prednisolon

e. Metotreksat + hidroksi kloroquin

170 Seorang pasien perempuan, usia 66 tahun penderita parkinson telah


menggunakan rasagline 1 mg selama 2 bulan atas resep dokter. Sampai saat Amantadin dapat bermanfaat untuk mengatasi tremor, rigiditas, dan
ini pasien masih menunjukkan gejala tremor yang cukup parah, sedangkan bradikinesia serta dapat mengurangi diskinesia. Dosis amantadin yang
gejala ridigitas dan bradikenasia sudah berkurang. Apoteker dan berdiskusi digunakan yaitu 100mg/hari.
untuk menentukan penambahan obat pada pasien. Apakah obat yang tepat (Dipiro edisi 9)
direkomendasikan?
a. Triheksifenidil
b. Levodopa/ karbidopa
c. Bromokriptin
d. Pramipexole
e. Amantadin

171 Seorang apoteker di suatu rumah sakit memberikan konseling pada saat Penyakit kusta adalah penyakit menular, menahun dan disebabkan oleh
menyerahkan paket obat kusta di bawah ini atas resep dokter untuk kuman kusta (Mycobacterium Leprae) yang bersifat intraseluler obligat.
pengobatan pasien (laki-laki, usia 50 tahun, penderita kusta pausi basiler). Kemoterapi kusta dimulai tahun 1949 dengan DDS sebagai obat tunggal
Apoteker memberikan informasi nama obat, aturan pakai dan durasi (monoterapi DDS). DDS harus diminum selama 3-5 tahun untuk PB, sedangkan
pengobatan kepada pasien. untuk MB 5-10 tahun, bahkan seumurhidup. Kekurangan monoterapi DDS
adalah terjadinya resistensi, timbulnya kuman persister serta terjadinya pasien
Apakah nama obat yang berupa tablet berwarna putih ? defaulter. Pada tahun 1964 ditemukan resistensi terhadap DDS. Oleh sebab itu
a. Dapson pada tahun 1982 WHO merekomendasikan pengobatan kusta dengan Multi
b. Rifampisin Drug Therapy (MDT) untuk tipe PB maupun MB
c. Klofazimin Obat MDT terdiri dari :
d. Ofloksasin a. DDS (dapson) = Diamino Diphenyl Sulphone adalah sediaan berbentuk
Minosiklin tablet warna putih 50 mg dan 100 mg bersifat bakteriostatik
b. Lampren (B663) juga di sebut klofazim yaitu sediaan berbentuk kapsul
lunak 50 mg dan 100 mg berwarna coklat, bersifat bakteriostatik
c. Rifampisin yaitu sediaan berbentuk kapsul 150 mg, 300 mg, 450 mg dan
600 mg bersifat bakterisidal
(Kemenkes RI, 2012, Pedoman Nasional Program Pengendalian Penyakit
Kusta)
172 Seorang apoteker di rumah sakit memberikan jawaban atas pertanyaan Menurut PMK 72 Tahun 2016 tentang Standar Pelayanan Kefarmasian di
seorang perawat mengenai stabilitas sefazolin yang telah dicampur dengan RS.
SWFI. Apakah pelayanan farmasi klinik yang dilakukan oleh apoteker ? a. Rekonsiliasi obat
a. Rekonsiliasi obat Rekonsiliasi Obat merupakan proses membandingkan instruksi pengobatan
b. Pelayanan informasi obat dengan Obat yang telah didapat pasien. Rekonsiliasi dilakukan untuk
c. Konseling mencegah terjadinya kesalahan Obat (medication error) seperti Obat tidak
d. Pemantauan terapi obat diberikan, duplikasi, kesalahan dosis atau interaksi Obat.
Pengkajian resep b. Pelayanan Informasi Obat
Pelayanan Informasi Obat (PIO) merupakan kegiatan penyediaan dan
pemberian informasi, rekomendasi Obat yang independen, akurat, tidak
bias, terkini dan komprehensif yang dilakukan oleh Apoteker kepada dokter,
Apoteker, perawat, profesi kesehatan lainnya serta pasien dan pihak lain di
luar Rumah Sakit.
c. Konseling
Konseling Obat adalah suatu aktivitas pemberian nasihat atau saran terkait
terapi Obat dari Apoteker (konselor) kepada pasien dan/atau keluarganya.
d. Pemantauan terapi obat
Pemantauan Terapi Obat (PTO) merupakan suatu proses yang mencakup
kegiatan untuk memastikan terapi Obat yang aman, efektif dan rasional bagi
pasien.
e. Pengkajian resep
Pengkajian Resep dilakukan untuk menganalisa adanya masalah terkait Obat,
bila ditemukan masalah terkait Obat harus dikonsultasikan kepada dokter
penulis Resep.
173 pasien perempuan, 17 tahun, penderita hipertensi, diarawat bangsal Pembahasan :
dirumah sakit mendapatkan infus dopamine untuk meningkatkan Diket ;
cardiac output. Dokter meresepkan 400 mg dopamine yang dicampur konsentrasi dopamine 400 mg /500 ml D5%
dengan 500 cc D5%. Dopamine diberikan 5 mcg/menit. Apoteker Dosis yang diberikan 5 mcg/menit
menghitung kecepatan syringe pump. Berapa kecepatan syringe pump Jika 500 ml = 400 mg
(cc/jam) yang tepat diatur pada alat? Maka 5 mcg = 0,00625 ml
a. 4,00 d. 26,25
b. 5,00 e. 52,5 Maka kecepatan syring pump yaitu 0.00625 cc/menit
c. 18,85 0.00625 cc/menit X 60 = 0,375 cc/jam

174 seorang pasien (laki-laki, usai 48 tahun) di ruang rawat inap suatu pembahasan:
rumah sakit mendapatkan infus metronidazole 500 mg setelah operasi dik.
kolorektal. Sediaan yang tersedia infus 500 mg/100 ml. cairan infus Volume sediaan 100 ml
harus habis dalam waktu 1 jam. Dokter meminta bantuan apoteker waktu pemberian 1 jam = 60 menit
untuk menghitung kecepatan tetes infus dengan mengunakan infus set faktor tetesan 20 tetes/menit
20 tetes/ml. berapa kecepatan tetes infus yang tepat ditetatapkan? kecepatan tetes infus =
a. 20 tetes/menit d. 33 tetes/menit
b. 23 tetes/menit e. 60 tetes/menit kecepatan tetes infus = = 33,33 tetes/ menit
c. 30 tetes/menit

175 Seorang dokter di suatu rumah sakit meminta rekomendasi obat yang Pembahasan :
aman kepada apoteker untuk pasiennya (perempuan, usia 32
tahun) yang sedang dirawat di bangsal rawat inap dengan Sumber : Dipiro edisi 9 hal 218
diagnosa hepatitis B kronis (HbeAg+ danHBVDNA 24.000
IU/ml). Saat ini pasien tengah hamil usia 2 minggu. Apakah
obat yang tepat direkomendasikan?
a. Adenovir
b. Lamivudin
c. Telbivudin
d. Entecavir
e. Tenovovir

176 Seorang apoteker di apotek menyerahkan obat atas resep dokter kepada Pembahasan: :
pasien (laki-laki, usia 38 tahun, penderita perennial rhinitis Sumber : Dipiro Edisi 9 hal 833
alergi parah). Salah satu obat yang diserahkan adalah
montelukast. Apoteker mengatakan kepada pasien bahwa obat
tersebut mampu meringankan gejala peradangan pada hidung
pasien. Apakah target aksi obat tersebut?
a. Reseptor H1
b. Reseptor α1- adrenergik
c. Reseptor Leukotrin
d. Sel mast
e. Reseptor asetilkolin
177 Seorang pasien (perempuan, usia 30 tahun), baru saja didiagnosa dokter Pembahasan :
di suatu rumah sakit mengalami hipertiroid. Dokter meminta
pertimbangan apoteker mengenai pilihan obat yang aman untuk Sumber : Dipiro Edisi 9 hal 179
pasiennya karena saat ini pasien sedang hamil usia 8 minggu.
Apakah obat yang tepat direkomendasikan?
a. Larutan lugol
b. Methimazol
c. Propiltiourasil
d. Levotiroksin
e. Tiamazol

178 Seorang ibu datang ke apotek untuk membeli obat tanpa resep dokter Jawaban : C. Zink
untuk mencegah diare yang dialami anaknya. Ibu tersebut mengatakan Pembahasan:
kepada apoteker bahwa anaknya sangat mudah sekali mengalami diare. Zinc merupakan salah satu mikronutrien yang penting dalam
Dalam 2 bulan terakhir, anaknya telah mengalami diare sebanyak 4 tubuh. Zinc dapat menghambat enzim INOS (Inducible Nitric
kali. Selain memberika antidiare, apoteker juga memilihkan obat untuk
Oxide Synthase), dimana ekskresi enzim ini meningkat selama
mencegah kekambuhan diare yang dialami pasien. Apakah obat yang
tepat dipilih untuk tujuan tersebut? diare dan mengakibatkan hipersekresi epitel usus. Zinc juga
a. Oralit d. Norit berperan dalam epitelisasi dinding usus yang mengalami kerusakan
b. loperamid e. Prebiotik morfologi dan fungsi selama kejadian diare.
c. Zink Pemberian Zinc selama diare terbukti mampu mengurangi
lama dan tingkat keparahan diare, mengurangi frekuensi
buang air besar, mengurangi volume tinja, serta menurunkan
kekambuhan kejadian diare pada 3 bulan berikutnya.(Black,
2003). Penelitian di Indonesia menunjukkan bahwa Zinc
mempunyai efek protektif terhadap diare sebanyak 11 % dan
menurut hasil pilot study menunjukkan bahwa Zinc mempunyai
tingkat hasil guna sebesar 67 % (Hidayat 1998 dan Soenarto 2007).
Berdasarkan bukti ini semua anak diare harus diberi Zinc segera
saat anak mengalami diare.
Dosis pemberian Zinc pada balita:
- Umur < 6 bulan : ½ tablet ( 10 Mg ) per hari selama 10 hari
- Umur > 6 bulan : 1 tablet ( 20 mg) per hari selama 10 hari.
Zinc tetap diberikan selama 10-14 hari walaupun diare sudah
berhenti. Cara pemberian tablet zinc : Larutkan tablet dalam 1
sendok makan air matang atau ASI, sesudah larut berikan pada
anak diare.
179 seorang apoteker diapotek menerima resep dari seorang perempuan Jawaban: C. Tiap 12 jam sebelum makan
(usia 47 tahun) yang berisi amoxicillin 12 tablet (S.3.d.d 1 tab. Pembahasan:
pc) dan omeprazol 10 tablet (S.2.d.d 1 tab.ac). Apoteker omeprazol 10 tablet (S.2.d.d 1 tab.ac)
menyiapkan obat tersebut dan memberikan informasi aturan pakai S.2.d.d 1 tab.ac : signa bis de die 1 tablet ante coenam
obat kepada pasien. Kapankah pasien harus meminum : tandai 2x sehari 1 tablet sebelum makan
omeprazol? Dalam Sehari 24 jam dibagi 2x minum: setiap 12 jam
a. Tiap 6 jam setelah makan d. Tiap 8 jam sebelum sebelum makan
makan
b. Tiap 8 jam saat makan e. Tiap 12 jam setelah
makan
c. Tiap 12 jam sebelum makan

180 Apoteker disuatu rumah sakit menemukan 13 item obat mengalami kadaluarsa -Distribusi merupakan suatu rangkaian kegiatan dalam rangka
dengan nilai kerugian sebesar Rp. 10.000.000,- Salah satu obat yang menyalurkan/menyerahkan Sediaan Farmasi, Alat Kesehatan, dan Bahan
kadaluarsa adalah injeksi furosemid. Setelah ditelusuri diketahui bahwa Medis Habis Pakai dari tempat penyimpanan sampai kepada unit
obat-obatan tersebut banyak tersimpan di bangsal-bangsal rawat inap, pelayanan/pasien dengan tetap menjamin mutu, stabilitas, jenis, jumlah, dan
sehingga lost monitoring. Apakah tahap manajemen pengelolaan obat ketepatan waktu.
yang harus diperbaiki oleh instalasi farmasi? Sistem distribusi di unit pelayanan dapat dilakukan dengan cara:
a. Sistem Persediaan Lengkap di Ruangan (floor stock)
a. Seleksi
b. Perencanaan 1) Pendistribusian Sediaan Farmasi, Alat Kesehatan, dan Bahan Medis
c. Pengadaan Habis Pakai untuk persediaan di ruang rawat disiapkan dan dikelola oleh
d. Distribusi Instalasi Farmasi.
e. Penggunaan 2) Sediaan Farmasi, Alat Kesehatan, dan Bahan Medis Habis Pakai yang
disimpan di ruang rawat harus dalam jenis dan jumlah yang sangat
dibutuhkan.

181 Seorang pasien mendatangi apotek untuk membeli Allopurinol 300 mg KEPUTUSAN MENTERI KESEHATAN REPUBLIK INDONESIA
sebanyak 20 tablet. Pasien mengaku mengkonsumsi obat tersebut setiap Nomor : 1176/Menkes/SKX/1999
TENTANG
hari untuk menurunkan asam uratnya atas resep dokter. Apakah tindakan DAFTAR OBAT WAJIB APOTIK NO. 3
yang tepat dilakukan untuk menanggapi permintaan pasien?

a. Memberikan permintaan pasien


b. Memberikan allopurinol 300 mg 10 tablet
c. Memberikan allopurinol 100 mg 20 tablet
d. Tidak memberikan permintaan pasien
Pasien diminta kontrol ke dokter
182 . Seorang apoteker pada bagian registration department sebuah industri BAB XI
farmasi menetapkan jumlah parasetamol 500 mg tablet yang akan
dikemas dalam botol, untuk selanjutnya dilakukan registrasi produk KETENTUAN LAIN-LAIN
kepada badan POM. Berapakah jumlah maksimal yang diperbolehkan?
Pasal 64
a. 25 tablet
b. 50 tablet (1) Untuk menjamin kestabilan Obat dalam bentuk sediaan
c. 100 tablet oral padat, registrasi Obat dengan kemasan botol berisi paling
d. 200 tablet
banyak 100 (seratus) butir.
300 tablet
(2) Registrasi Obat dengan kemasan botol sebagaimana
dimaksud pada ayat (1) hanya dapat dilakukan untuk Obat
dengan Zat Aktif yang stabil

BPOM, Peraturan badan pengawas obat dan makanan

Nomor 24 tahun 2017


183 Seorang apoteker yang bekerja pada bagian R&D suatu industri farmasi Talet salut gula, adalah tablet kempa yang disalut dengan
sedang melakukan pengembangan produk Ranitidin tablet.Berdasarkan beberapa lapisan gula baik berwarna maupun tidak. lapisan
studi literatur diketahui Ranitidin bersifat tidak stabil terhadap cahaya. gula berasal dari suspensi dalam air mengandung serbuk
Apakah jenis tablet yang tepat dikembangkan untuk ranitidin tersebut yang tidak larut seperti pati, kalsium karbonat, talk atau
a. Tablet konvensional
titanium dioksida yang disusupensikan dengan gom akasia
b. Tablet salut film
c. Tablet sustained release atau gelatin
d. Tablet salut gula
Tablet konvensional, tablet yang dibuat atau dikempa
e. Tablet rapid release
dengan siklus kompressi tunggal yang biasanya terdiri dari
zat aktif sendiri atau kombinasi dengan bahan eksipien

Tablet lepas lambat, tablet yang pelepasan zat aktifnya


dimodifikasi sehingga tablet tersebut melepaskan dosis awal
yang cukup untuk efek terapi yang kemudian disusun dengan
dosis pemeliharaan sehingga jumlah zat aktifd atau
konsentrasi zat aktif dalam darah cukup untuk beberapa
waktu tertentu (misalnya tablet lepas lambat 6 jam, 12 jam
dsb)

Tablet salut film, tablet kempa yang disalut dengan salut


tipis, berwarna atau tidak dari bahan polimeryang larut
dalam air yang hancur cepat didalam saluran cerna.

(Farmakope edisi III)


184 Seorang apoteker di bagian QC suatu industri farmasi melakukan V1.N1 = V2. N2
penetapan kadar warfarin dalam sediaan tablet menggunakan HPLC.
Warfarin 8µg/mL digunakan sebagai larutan baku dan diperoleh luas 120.000.8 = 150.000. N2
puncak sebesar 120.000. Hasil pengujian sampel diperoleh luas puncak
sebesar 150.000. berapakah konsentrasi warfarin natrium (µg/mL) 960.000 = 6,4
dalam sampel ? 150.000
a. 5,97

b. 6,86

c. 8,57

d. 9,33

e. 10,71
185 Seorang apoteker pada bagian R&D suatu industri farmasi melakukan
pengembangan metode analisis untuk penetapan kadar sediaan lepas lambat
salbutamol. Diketahui salbutamol memiliki campuran resemis bentuk R (aktif)
dan S (inaktif). Penetapan kadar dilakukan dengan HPLC dengan detektor
RID (refractive index detector).

Bagaimanakah prinsip penetapan kadar dengan detektor tersebut?


a. Gugus kromofor d. Gugus hidroksi
b. Karbon kiral e. Senyawa etil alkohol
c. Gugus amina

186 seorang apoteker di suatu industri obat tradisional sedang melakukan optimasi jawaban
formula FDT ekstrak daun jambu biji. Bahan-bahan yang terdapat dalam Kegunaan dlm formula: super disintergran
formula tersebut adalah ekstrak daun jambu biji, sodium croscalmallose, sodium croscarmellose digunakan untuk kempa langsung dan proses
manitol, magnesium stearat, orange flavor, aerosil dan lactose. Apakah granulasi basah.
fungsi dari sodium croscalmallose dalam formula tersebut? croscarmellose sodium digunakan sebagai bahan penghancur dengan
a. bahan pengisi d. Bahan pelicin konsentrasi 0,5 – 5%,tetapi umumnya digunakan pada konsentrasi 2%
b. bahan pengikat e. Bahan pemanis b/b bagi tablet yang dibuat menggunakanmetode kempa langsung dan
c. bahan penghancur konsentrasi 3% b/b digunakan pada tablet yang dibuat menggunakan
metode granulasi basah.

Guest, R.T., 2009, Croscarmellose Sodium, dalam Rowe, R.C., Sheskey


P.J. danQuin, M.E.,
Handbook of Pharmaceutical Excipients,6 th Ed., PharmaceuticalPress,
Washington D.C, 206-208.

187 . Seorang apoteker di bagian R&D suatu industri farmasi sedang melakukan
optimasi formula tablet metformin 500 mg yang dibuat dengan metode
granulasi basah. Hasil pengujian granul didapatkan data kadar air granul: Chemical Engineering in the Pharmaceutical Industry, book. page 254
5% dan waktu alir granul: 7 g/detik. Pada saat dicetak, tablet mengalami
sticking. Apakah penyebab masalah tersebut?
a. kadar air terlalu tinggi d. Kecepatan pencetakan
tablet terlalu tinggi
b. kadar air terlalu rendah e. Ukuran granul tidak rata
c. kompresibilitas rendah

188 Seorang apoteker penanggungjawab QCsuatu industry obat tradisional pembahasan


melakukan pengecekan bahan baku simplisia rimpang Ruangan karantina pada ruangan ini disimpan produk ruahan untuk
temulawak.pengecekan terhadap simplisia tersebut belum selesai dan menunggu hasil pemeriksaan laboratorium. Produk ruahan yang telah
apoteker selanjutnya menginstruksikan petugas untuk meletakkan selesai diperiksa, kemudian dilakukan pengemasan primer di grey area
simplisia tersebut pada suatu ruangan. Apakah area yang di maksud? dan pengemasan sekunder di black area oleh bagian pengemasan. Bahan
a. area pemusnahan d. area sampling awal atau ruahan yang diterima hendaklah dikarantina sampai disetujui
b. area release e. area karantina
dan diluluskan untuk pemakaian oleh kepala bagian pengawasan mutu.
c. area reject
Area Sampling merupakan salah satu ruangan penting dalam CPOB
yang dapat berdampak pada hampir semua produk farmasi. Sampling
diterapkan pada:
 Bahan mentah, Label
 Validasi Proses
 Produk selama produksi
 Produk jadi yang akan rilis

189 seoraang apoteker sedang menyiapkanapoitin alfa yang akan diberikan pembahasan
dosis yang tertera 50IU/KgBB
kepada pasien anemia (pasien laki-laki, usia 58 tahun, BB 55kgpasien
epoitin alfa yang tersedia 300 IU/mL
memiliki riwayat gagal ginjal kronik stage 3. Dosis yang tertera pada 50 IU x55kg = 2750
2750 : 3000 IU = 0,917
leaflet obat adalah 50 IU/Kg BB diberikan 3 kali seminggu. Sediaan
yang ada di instalasi farmasiadalah epotin alfa 3000 IU/mL. berapakan
volume pemberian obat (ml)yang tepat di siapkan untuk satu kali
pemakaian?
a. 0,827 mL d. 0,971 mL
b. 0.872 mL e. 1,000 mL
c. 0,917 mL

190 suatu apoteker di bagian R&D industry farmasi sedang melakukan pembahasan
pemngembang metode uji disolusi tablet asam mefenamat. Berdasarkan
kualifikasi metode analisis untuk mesin, peralatan produksi dan sarana
studi literature Farmakope Indonesia Edisi V hanya terdapat metode uji
penunjang disebut kualifikasi. Kualifikasi tersebut adalah langkah
disolusi unruk sediaan kapsul. Apoteker akan menggunakan metode Uji
pertama dalam melaksanakan validasi di industry farmasi ( Manajemen
Disolusi sediaan kapsul tersebut untuk diterapkan terhadap sediaan
Industri Farmasi, 2007).
tablet. Apakah langkah awal yang harus dilakukan?
a. kualifikasi metode analisis d. Verifikasi Kualifikasi terdiri dari empat tingkatan, yaitu:
metode analisi
b. Validasi metode analisi e. replikasi metode
1. Kualifikasi Desain/ Design Qualification (DQ)
analisis
c. repetisi metode analisis
Kualifikasi desain adalah unsur pertama dalam melakukan validasi
terhadapfasilitas, sistem atau peralatan baru.

2. Kualifikasi Instalasi/ Instalation Qualification (IQ)

Kualifikasi dilakukan terhadap fasilitas, sistem dan peralatan baru atau


yang dimodifikasi, mencakup:

 Instalasi peralatan, pipa dan sarana penunjang hendaklah sesuai


dengan spesifikasi dan gambar teknik yang didesain.
 Pengumpulan dan penyusunan dokumen pengoperasian dan
perawatan peralatan dari pemasok.
 Ketentuan dan persyaratan kalibrasi.
 Verifikasi bahan konstruksi.

3. Kualifikasi Operasional/ Operational Qualification (OQ)

Kualifikasi operasional dilakukan setelah kualifikasi instalasi selesai


dilaksanakan, dikaji dan disetujui. Kualifikasi operasional hendaklah
mencakup:

 Kalibrasi
 Prosedur pengoperasian dan pembersihan
 Pelatihan operator dan ketentuan perawatan preventif.

4. Kualifikasi Kinerja/ Performance Qualification (PQ)

Performance Qualification (PQ) dilakukan untuk menjamin dan


mendokumentasikan bahwa sistem atau peralatan yang telah
diinstalasi beroperasi sesuai dengan spesifikasi yang diinginkan.
Meskipun PQ diuraikan sebagai kegiatan terpisah, dalam bberapa kasus
pelaksanaannya dapat dilakukan dengan kualifikasi operasional. PQ
hendaknya mencakup :

 Pengujian dengan menggunakan bahan baku, bahan pengganti


yang memenuhi spesifikasi atau produk simulasi yang dilakukan
berdasadrkan pengetahuan tentang proses, fasilitas, sistem dan
peralatan;
 Uji yang meliputi satu atau beberapa kondisi yang mencakup
batas operasional atas dan bawah.

Validasi metode analisis adalah suatu tindakan penilaian terhadap


parameter tertentu berdasarkan percobaan laboratorium, untuk
membuktikan bahwa parameter tersebut memenuhi persyaratan untuk
penggunaannya,validasimerupakan suatu proses evaluasi kecermatan dan
keseksamaan yang dihasilkan oleh suatu prosedur dengan nilai yang
dapat diterima. Sebagai tambahan, validasi memastikan bahwa suatu
prosedur tertulis memiliki detail yang cukup jelas sehingga dapat
dilaksanakan oleh analis atau laboratorium yang berbeda dengan hasil
yang sebanding.
Verifikasi metode adalah suatu tindakan validasi metode tetapi hanya
pada beberapa beberapa karakteristik performa saja. Laboratorium harus
menentukan karakteristik performa yang dibutuhkan. Spesifikasi analisis
dapat menjadi acuan untuk merancang proses verifikasi. Rancangan yang
baik akan menghasilkan informasi yang dibutuhkan serta meminimalisir
tenaga, waktu, serta biaya. Pemilihan parameter validasi atau verifikasi
tergantung pada beberapa faktor seperti aplikasi, sampel uji, tujuan
metode, dan peraturan lokal atau internasional.Verifikasi
dilakukanterhadap suatu metode baku sebelum diterapkan di
laboratorium. Verifikasi sebuah metode bermaksud untuk membuktikan
bahwa laboratorium yang bersangkutan mampu melakukan pengujian
dengan metode tersebut dengan hasil yang valid. Disamping itu
verifikasi juga bertujuan untuk membuktikan bahwa laboratorium
memiliki data kinerja. Hal ini dikarenakan laboratorium yang berbeda
memiliki kondisi dan kompetensi personil serta kemampuan peralatan
yang berbeda, sehingga kinerja antara satu laboratorium dengan
laboratorium lainnya tidaklah sama.
Repetisi metode Repetisi berarti mengulang kembali gagasan yang
sudah disampaikan secara verbal. Repetisi juga diartikan sebagai gaya
bahasa yang menggunakan kata kunci yang terdapat di awal kalimat
untuk mencapai maksud tertentu dalam penyampaian 2 makna. Selain
itu, repetisi dapat memberikan kejelasan sebuah ide karena pengulangan
yang sama beberapa kali.
191 seorang apoteker pada bagian Rnd suatu industri farmasi melakukan validasi
metode analisa KCKT untuk penetapan sefiksim dalam sediaan kapsul.
Apoteker menyuntikan larutan blanko, larutan placebo, larutan baku sefiksim
dan larutan sampel kapsul sefiksim ke dalam alat dan diperoleh data sebagai
berikut :
Nama larutan Waktu retensi (tr) (menit)
Larutan blanko Tidak ada peak
Larutan plasebo Tidak ada peak
Larutan baku 3,473
Larutan sampel 3,473
Apakah parameter validasi metode analisis yang dapat diuji dengan data
tersebut
a. Presisi
b. Akurasi
c. Linearitas
d. Spesifitas
e. Sensitivitas

pengukuran. Direktori. Fmipa-ui


192 seorang apoteker dibagian produksi suatu industri farmasi akan memproduksi Jawab =
kaplet asam mefenamat. Komposisi formula dalam dokumen produksi induk Fungsi masing masing bahan
adalah sebagai berikut : - Avicel pH 101 = disentegran, bahan pengisi
Asam mefenamat 500mg - Gelatin = bahan pengikat
Avicel Ph 101 20% - Talk = lubricant
Gelatin 2% - Mg stearat = glidant
Talk 1% - Amylum = bahan pengisi
Mg stearat 2% Pada pembuatan granulasi awal, zat akti + bahan pengisi, bahan pengikat dan ½
Amilum secukupnya bahan penghancur. Untuk bahan lubricant di tambahkan setelah granul
Tablet dibuat dengan metode granulasi basah dengan bobot 750 mg. Dalam terbentuk dan siap untuk di cetak.
proses granulasi apakah eksipien yang dicampur secara persamaan dengan
asam mefenamat
a. Avicel PH 101, gelatin dan talk
b. Avicel PH 101, gelatin dan mg stearat
c. Avicel PH 101, gelatin dan amilum
d. Gelatin, talk dan mg stearat
e. Gelatin, amilum dan talk

193 Seorang apoteker di industri obat tradisional memproduksi obat herbal Kadar abu total = { (berat krus dan ekstrak setelah diabukan+
terstandar kapsul ekstrak rimpang jahe untuk memelihara kesehatan tubuh. Berat krus kosong) – berat ekstrak} / 2 x100%
Untuk menjamin kualitas ekstrak, maka dilakukan pengukuran kadar abu
total ekstrak, sebanyak 2 gram ekstrak dimasukan ke dalam krus silikat.
Berat krus kosong sebesar 21;17 gram, serta berat krus dan ekstrak setelah Cara: = (21,4 - 21,17)/2 x 100%
diabukn adalah sebesar 21,4 gram. Berapa kadar abu total daam ekstrak =11,5%
tersebut?
A. 9,2 % D. 11,5%
B. 20,2%. E. 23,0%
C. 19,7%

194 Seorang pasien laki-laki, usia 58 tahun ke apotek dengan membawa resep Cara: = (5000 x 1,25 x1,1x 30) + 10.000
dokter yang berisi glucobay tablet no. XXX . Harga netto glucobay Rp.
5000/tablet dan apotek mengambil keuntungan 25%. Apotek menetapkan = Rp 216.250
harga embalase dan pelayanan resep adlah Rp. 10000. Berpkah resep yang
harus dibayar oleh pasien??
A. Rp. 150.000. D. Rp. 197.500
B. Rp. 166.500. E. Rp. 206.250
C. Rp. 187.500

195 seorang apoteker di apotek sedang membuat laporan keuangan bulanan. Total jawaban : D
omset penjualan obat dan perbekalan farmasi pada bulan tersebut adalah Rp. laba kotor = 0,25/1,25 x 100.000.000 = 20.000.000
100.000.000 dengan rata rata margin sebesar 1,25. Total biaya tetap yang laba bersih = laba kotor – biaya tetap
dikeluarkan pada bulan tersebut adalah sebesar Rp. 10.000.000 berapa laba = 20.000.000 – 10.000.000
bersih apotek yang diperoleh pada bulan tersebut? = 10.000.000
a. 25.000.000 d. 10.000.0000
b. 20.000.000 e. 5.000.000
c. 15.000.000

196 seorang apoteker di apotek melakukan stock opname dan menemukan sediaan jawaban = E
sirup antasida sudah melewati tanggal kadaluarsa. Apoteker selanjutnya akan metode pemusnahan obat berdasarkan bentuk sediaan
melakukan pemusnahan sediaan tersebut. Bagaimana cara pemusnahan yang 1. sediaan padat, setengah padat, seperti tablet dibakar atau dihancurkan.
tepat untuk sediaan tersebut? Dimana sebelumnya dikeluarkan dari wadah dan pembungkusnya
a. langsung dibuang ke saluran pembuangan 2. 2. Sediaan cair, dikeluarkan dari wadahnya diencerkan lalu dicampur
b. dikubur dalam tanah bersama dengan kemasan dengan sejumlah air dan dibuang ke pembuangan
c. dibakar dengan insenerator 3. rusli,2010
d. dibuang ke tempat sampah biasa
e. diencerkan lalu dan dibuang ke saluran pembuangan
197 . seorang apoteker disuatu puskesmas akan mengadakan penyuluhan jawaban : B
kesehatan didesa sebagai upaya menghindari wabah demam berdarah. promotif = suatu kegiatan dan/atau serangkaian kegitan pelayanan kesehatan
Apoteker juga membagikan serbuk abate untuk mencegah perkembangan yang lebih mengutakan kegitan yang berisfat promotif
nyamuk aedes aegypti. Apakah bentuk kegiatan yang dilaukan oleh apoteker preventif = suatu kegiatan pencegahan terhadap suatu masalah
tersebut? kesehatan/penyakit
a. promotif d. rehabilitatif kuratif = suatu kegiatan dan/atau serangkaian kegitan pengobatan yang
b. preventif e. konseling ditunjukan untuk penyembuhan penyakit, pengurangan penderitaan akibat
c. kuratif penyakit,pengendalia penyakit, atau pengendalian kecacatan agar kualitas
penderita dapat terjaga seoptimal mungkin
rehabilitatif = suatu kegiatan dan/atau serangkaian kegitan untuk
mengembalikan bekas penderita ke dalam masyarakat sehingga dapat berfungsi
lagi sebagai anggota masyarakat yang berguna untuk dirinya dan masyakat
semaksimal mungkin sesuai dengan kemampuan
konseling = proses pemberian bantuan ysng dilakukan oleh seorang ahli
(Konselor) kepada individu yang mengalami masalah
sumber = UU no 26 th 2009

198 seorang dokter disuatu rumah sakit meminta pertimbangan apoteker terkait
pemilihan obat untuk pasien (perempuan, usia 50 tahun, penderita angina
pektoris stabil). Pasien telah menggunakan propanolol selama 1 tahun unutk
mencegah serangan angina dan saat ini obat sudah tidak efektif lagi. Dokter
juga mengatakan kepada apoteker bahwa saat ini obat mengalami disfungsi
ventrikel kiri. Apakah obat yang tepat direkomendasikan?
a. Verampamil
b. Amlodipin
c.Diltiazem
d.Gliseril Trinitrat
e.Isosorbit dinitrat
199 seorang dokter akan meresepkan alpazolam 0,5 (3 kali sehari 1 tablet) untuk
seorang pasien (laki-laki, usia 55 tahun, baru saja terdiagnosa mengalami
serangan anxiety akut). Dokter menguhubungi apoteker diinstalasi farmasi
rawat inap untuk menanyakan durasi penggunaan obat tersebut untuk periode
pertama (awal) sebelum dilakukan evaluasi efek terapi obat. Apakah
informasi durasi pengobatan awal yang tepat disampaikan kepada dokter
tersebut?
a. 1 minggu
b. 2 minggu
c. 3 minggu
d. 4 minggu
e. 5 minggu
Benzodiazepin adalah obat yang paling efektif dan sering diresepkan
untuk pengobatan kecemasan akut. Sekitar 65% hingga 75% pasien
dengan GAD ditandai hingga respon sedang, dan sebagian besar
perbaikan terjadi pada 2 minggu pertama terapi. Benzodiazepine di
mulai dengan dosis rendah, dan sesuaikan setiap minggu. Pengobatan
kecemasan akut biasanya tidak melebihi 4 minggu. (Pharmacotherapy
Handbook/Dipiro, 9th Edition, halaman 683)

200 seorang dokter disuatu rumah sakit berdiskusi dengan apoteker pada saat
visite di ruang rawat inap untuk penentuan antibiotik yang akan digunakan
dalam pengobatan pasien diare infeksi sedang (laki-laki usia 4- tahun). Kadar
Alpha-1 antitrypsin pasien 166 mg/dL dan hasil kultur bakteri dari feses
pasien adalah bakteri Clostridium deficille. Saat ini pasien baru mendapatkan
terapi cairan. Apakah antibiotik yang tepat direkomendasikan?
a. metronidazol
b. vankomicin
c. Siprofloxacin
d. Azytromicin
e. Eritromisin

kadar Alpha-1 antitrypsin pasien 166 mg/dL masuk dalam kategori sedang