Anda di halaman 1dari 404

Halaman 1

mmelin

ndelar

ibohm

Farmasi
Bioteknologi
Fundamental dan aPlikasi
Edisi ketiga
Diedit oleh
Daan JA Crommelin
Robert D. Sindelar
Bernd Meibohm
TE x TB dan ED ED T ion
Penting
Pertanyaan &
Jawaban
Termasuk
TBook
ITION
Ketiga
Edisi
Dana
ament
juga
dan APP
lic
Sebuah
tions
Pharm
Sebuah
ceutic
Al
Bio
teknologi
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 2

Farmasi
Bioteknologi
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 3
Diedit oleh
Daan JA Crommelin
Dutch Top Institute Pharma
Leiden, Belanda
Universitas Utrecht
Utrecht, Belanda
Robert D. Sindelar
Universitas British Columbia
Vancouver, British Columbia, Kanada
Bernd Meibohm
Pusat Ilmu Kesehatan Universitas Tennessee
Memphis, Tennessee, AS

Farmasi
Bioteknologi
Fundamental dan aPlikasi
Edisi ketiga
T ex TB ooke D i T ion
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 4
Informa Healthcare USA, Inc.
52 Vanderbilt Avenue
New York, NY 10017
ª 2008 oleh Informa Healthcare USA, Inc.
Informa Healthcare adalah bisnis Informa
Tidak ada klaim atas karya Pemerintah AS asli
Dicetak di Amerika Serikat pada kertas bebas asam
10 9 8 7 6 5 4 3 2 1
Buku Standar Internasional Nomor-10: 1-4200-4437-0 (Softcover)
Buku Standar Internasional Nomor-13: 978-1-4200-4437-9 (Softcover)
Buku ini berisi informasi yang diperoleh dari sumber-sumber otentik dan sangat dihormati. Bahan yang dicetak ulang dikutip dengan izin, dan
sumber ditunjukkan. Berbagai macam referensi terdaftar. Upaya yang wajar telah dilakukan untuk mempublikasikan data dan informasi yang dapat diandalkan, tetapi
penulis dan penerbit tidak dapat memikul tanggung jawab untuk keabsahan semua materi atau untuk konsekuensi penggunaannya.
Tidak ada bagian dari buku ini yang dapat dicetak ulang, direproduksi, ditransmisikan, atau digunakan dalam bentuk apa pun dengan cara elektronik, mekanis, atau
lainnya, sekarang
diketahui atau selanjutnya ditemukan, termasuk fotokopi, pembuatan film mikro, dan perekaman, atau dalam sistem penyimpanan atau pengambilan informasi apa
pun, tanpa
izin tertulis dari penerbit.
Untuk izin memfotokopi atau menggunakan materi secara elektronik dari karya ini, silakan akses www.copyright.com (http://www.copyright.com/) atau
hubungi Copyright Clearance Center, Inc. (CCC) 222 Rosewood Drive, Danvers, MA 01923, 978-750-8400. CCC adalah organisasi nirlaba itu
memberikan lisensi dan registrasi untuk berbagai pengguna. Untuk organisasi yang telah diberikan lisensi fotokopi oleh CCC, sistem yang terpisah dari
pembayaran telah diatur.
Pemberitahuan Merek Dagang: Produk atau nama perusahaan dapat berupa merek dagang atau merek dagang terdaftar, dan hanya digunakan untuk identifikasi dan
Penjelasan tanpa bermaksud untuk melanggar.
Perpustakaan Kongres Kataloging-in-Publication Data
Bioteknologi farmasi: dasar-dasar dan aplikasi / diedit oleh
Daan JA Crommelin, Robert D. Sindelar, Bernd Meibohm. — ed. Ke-3.
hal. ; cm.
Termasuk referensi dan indeks bibliografi.
ISBN-13: 978-1-4200-4437-9 (pb: kertas alk.)
ISBN-10: 1-4200-4437-0 (pb: kertas alk.) 1. Bioteknologi farmasi. I. Crommelin,
DJA (Daan JA) II. Sindelar, Robert D. III. Meibohm, Bernd.
RS380.P484 2007a
615'.19 — dc22
2007025744
Kunjungi situs web Informa di
www.informa.com
dan situs Web Informa Healthcare di
www.informahealthcare.com
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 5
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 6
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 7
Kata pengantar
Dalam beberapa tahun terakhir, produk-produk obat bioteknologi telah memperoleh porsi besar dari resep
obat-obatan. Produk obat ini termasuk peptida dan protein, termasuk
antibodi monoklonal dan fragmen antibodi, serta oligonukleotida antisense
dan persiapan DNA untuk terapi gen. Dari tahun 2000 hingga 2006, biologik menyumbang 33%
dari semua Zat Aktif Baru yang diluncurkan, dan tercermin pada derajat yang sama di
jalur pengembangan saat ini dari industri farmasi. Produk obat tersebut
sebagai epoetin-a (Epogen
HAI
, Eprex
HAI
, Procrit
HAI
), abciximab (ReoPro
HAI
), interferon-a (Intron
HAI
SEBUAH,
Roferon
HAI
A), interferon -b (Avonex
HAI
, Rebif
HAI
, Betaseron
HAI
), agen anti-TNF-a (Enbrel
HAI
,
Remicade
HAI
, Humira
HAI
), dan trastuzumab (Herceptin
HAI
) adalah semua contoh sangat
obat biotek yang sukses yang telah merevolusi farmakoterapi sebelumnya
kebutuhan medis yang tidak terpenuhi.
Teknik bioteknologi adalah kekuatan pendorong penemuan obat modern
baik. Karena pertumbuhan yang cepat dalam pentingnya biofarmasi dan
teknik bioteknologi untuk kedokteran modern dan ilmu kehidupan, bidang
bioteknologi farmasi telah menjadi komponen yang semakin penting dalam
pendidikan apoteker dan ilmuwan farmasi hari ini dan besok. Kita
percaya bahwa ada kebutuhan penting untuk buku teks pengantar tentang farmasi
bioteknologi yang menyediakan cakupan terperinci yang terintegrasi dengan baik dari keduanya
sains dan aplikasi klinis obat-obatan bioteknologi-produk.
Bioteknologi Farmasi edisi sebelumnya telah memberikan yang seimbang
kerangka kerja untuk pendidikan dalam berbagai aspek bioteknologi farmasi,
termasuk produksi, bentuk sediaan, administrasi, dan aplikasi terapeutik.
Pertumbuhan pesat dan kemajuan di bidang bioteknologi farmasi, bagaimanapun,
dibuat perlu untuk merevisi buku teks ini untuk memberikan informasi terkini
dan perkenalkan siswa dengan pengetahuan dan teknologi terdepan bidang ini.
Buku teks edisi ketiga ini dibangun berdasarkan konsep sukses yang digunakan dalam
edisi sebelumnya. Ini disusun menjadi tiga bagian utama. Ilmu dasar dasar awal
Bagian memperkenalkan pembaca pada konsep-konsep kunci di dasar teknologi yang relevan
untuk terapi protein termasuk biologi molekuler, produksi dan analisis
prosedur, pengembangan formulasi, farmakokinetik dan farmakodinamik,
dan mengembangkan teknologi dan aplikasi baru. Bagian selanjutnya membahas
berbagai kelas terapi biologi. Bagian terakhir diakhiri dengan bab-bab
termasuk pertimbangan praktik peraturan, ekonomi, dan farmasi.
Semua bab dari edisi sebelumnya direvisi dan dikelompokkan kembali sesuai dengan
aplikasi terapi. Secara khusus, bagian tentang antibodi monoklonal adalah
sepenuhnya direvisi dan terstruktur sesuai dengan aplikasi terapeutik untuk
memungkinkan untuk diskusi komprehensif tentang jumlah substansial yang baru-baru ini disetujui
obat antibodi. Selain itu, bab-bab baru tentang imunogenisitas protein terapeutik,
oligonukleotida, dan masalah regulasi dan persetujuan produk obat untuk biofarma
ceuticals telah ditambahkan.
Untuk mencapai integrasi yang lebih mudah dari buku teks ke dalam kurikulum
program pendidikan farmasi, semua bab tentang protein atau protein yang digunakan secara terapeutik
kelas direferensikan silang dengan edisi terbaru dari tiga farmasi utama
buku teks terapi yang membentuk landasan pembelajaran terapi terapan di sebagian besar
sekolah farmasi di Amerika Utara. Bioteknologi Farmasi, edisi ketiga adalah
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 8
dimaksudkan untuk melengkapi buku teks ini dalam pendidikan farmasi dengan spesifiknya
penekanan pada biofarmasi. Jadi, aspek farmasi dari obat biotek
disajikan dalam buku teks ini dihubungkan dengan aplikasi farmakoterapi dan
memungkinkan integrasi yang mudah dari buku teks ini ke dalam program farmasi yang ada.
Sesuai dengan edisi sebelumnya, edisi baru ini memiliki sebagai target utama
siswa dalam program sarjana dan farmasi profesional serta lulusan
siswa dalam ilmu farmasi. Audiens sekunder adalah farmasi
ilmuwan di industri dan akademisi, terutama yang belum menerima formal
pelatihan dalam bioteknologi farmasi dan tidak berpengalaman dalam bidang ini.
Kami yakin bahwa Bioteknologi Farmasi menjadikannya penting
kontribusi pada pendidikan ilmuwan farmasi, apoteker, dan lainnya
profesional kesehatan serta melayani sebagai sumber daya siap pakai di bidang bioteknologi. Oleh
meningkatkan pengetahuan dan keahlian dalam pengembangan, aplikasi dan
penggunaan terapi obat biotek, kami berharap dapat membantu memfasilitasi, rasional, luas,
dan aplikasi terapeutik protein yang aman.
Daan JA Crommelin
Robert D. Sindelar
Bernd Meibohm
iv
KATA PENGANTAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 9
Isi
Kata Pengantar iii
Kontributor vii
Singkatan ix
1. Bioteknologi Molekul 1
Wiel PM Hoekstra dan Sjef CM Smeekens
2. Analisis Biofisik dan Biokimia dari Protein Rekombinan 23
Tsutomu Arakawa dan John S. Philo
3. Produksi dan Pengolahan Hilir Senyawa Biotek 49
Farida Kadir, Mic Hamers, dan Paul Ives
4. Formulasi Produk Bioteknologi, Termasuk Biofarmasi
Pertimbangan 67
Daan JA Crommelin
5. Farmakokinetik dan Farmakodinamik Obat Peptida dan Protein 95
Bernd Meibohm dan Rene Braeckman
6. Imunogenisitas Protein Terapi 125
Huub Schellekens dan Wim Jiskoot
7. Genomik, Teknologi “Omics” Lainnya, Personalised Medicine,
dan Tambahan Teknik Terkait Bioteknologi 133
Robert D. Sindelar
8. Terapi Gen 175
Maria A. Croyle
9. Oligonukleotida 211
Raymond M. Schiffelers dan Enrico Mastrobattista
10. Faktor Pertumbuhan Hematopoietik 225
MaryAnn Foote
11. Interferon dan Interleukin 243
Jean-Charles Ryff, Ronald W. Bordens, dan Sidney Pestka
12. Insulin 265
John M. Beals, Michael R. DeFelippis, dan Paul M. Kovach
13. Hormon Pertumbuhan 281
Melinda Marian dan James Q. Oeswein
14. Faktor Koagulasi Rekombinan dan Agen Trombolitik 293
Nishit B. Modi
15. Antibodi Monoklonal: Dari Struktur hingga Aplikasi Terapi 309
Banmeet Anand, Rong Deng, Frank-Peter Theil, Jing Li, Shasha Jumbe,
Thomas Gelzleichter, Paul Fielder, Amita Joshi, dan Saraswati Kenkare-Mitra
16. Antibodi Monoklonal pada Kanker 339
John C. Kuth, Terreia S. Jones, Jennifer Hanje, dan Susannah E. Motl Moroney
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 10
17. Antibodi Monoklonal dalam Transplantasi Organ Padat 365
Nicole Weimert dan Rita R. Alloway
18. Antibodi Monoklonal dalam Terapi Antiinflamasi 377
Jeffrey M. Harris, Peter Kuebler, dan Michael A. Panzara
19. Deoksiribonuklease Manusia Rekombinan I 387
Robert A. Lazarus dan Jeffrey S. Wagener
20. Hormon Perangsang Folikel 399
Tom Sam
21. Vaksin 405
Wim Jiskoot, Gideon FA Kersten, dan Enrico Mastrobattista
22. Menyalurkan Produk Bioteknologi: Penanganan, Pendidikan Profesional, dan
Informasi Produk 429
Peggy Piascik
23. Pertimbangan Ekonomi dalam Bioteknologi Medis 439
Eugene M. Kolassa
24. Masalah Peraturan dan Persetujuan Produk Obat untuk Biofarmasi 447
Vinod P. Shah dan Daan JA Crommelin
Pertanyaan dan Jawaban 455
Indeks 479
vi
ISI
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 11
Kontributor
Rita R. Alloway Departemen Penyakit Dalam / Divisi Nephrology,
Universitas Cincinnati, Cincinnati, Ohio, AS
Banmeet Anand Genentech, Inc., San Francisco Selatan, California, AS
Tsutomu Arakawa
Laboratorium Aliansi Protein, Thousand Oaks, California, AS
John M. Beals Eli Lilly & Company, Lilly Research Laboratories, Indianapolis,
Indiana, AS
Ronald W. Bordens Schering-Plough Corporation, Kenilworth, New Jersey, AS
Rene Braeckman Reliance, Layanan Penelitian Klinis, Newtown, Pennsylvania,
Amerika Serikat
Daan JA Crommelin Utrecht University, Utrecht dan Dutch Top Institute Pharma,
Leiden, Belanda
Perguruan Tinggi Farmasi Maria A. Croyle , Universitas Texas di Austin, Austin,
Texas, AS
Michael R. DeFelippis Eli Lilly & Company, Lilly Research Laboratories,
Indianapolis, Indiana, AS
Rong Deng Genentech, Inc., San Francisco Selatan, California, AS
Paul Fielder Genentech, Inc., San Francisco Selatan, California, AS
MaryAnn Foote Associate MaryAnn Foote, Westlake Village, California, AS
Thomas Gelzleichter Genentech, Inc., San Francisco Selatan, California, AS
Mic Hamers, SynCo Bio Partners BV, Amsterdam, Belanda
Jennifer Hanje Pusat Medis Universitas Negeri Ohio dan James Cancer
Rumah Sakit, Columbus, Ohio, AS
Jeffrey M. Harris Genentech, Inc., San Francisco Selatan, California, AS
Wiel PM Hoekstra Departemen Biologi, Universitas Utrecht, Utrecht,
Belanda
Paul Ives SynCo Bio Partners BV, Amsterdam, Belanda
Wim Jiskoot Divisi Teknologi Pengiriman Obat, Leiden / Amsterdam Centre for
Penelitian Obat-Obatan, Universitas Leiden, Leiden, Belanda
Terreia S. Jones Departemen Farmasi Klinis, Universitas Tennessee College
Farmasi, Memphis, Tennessee, AS
Amita Joshi Genentech, Inc., San Francisco Selatan, California, AS
Shasha Jumbe Genentech, Inc., San Francisco Selatan, California, AS
Farida Kadir Apoteker Pendidikan Postacademic (POA), Bunnik, Belanda
Saraswati Kenkare-Mitra Genentech, Inc., San Francisco Selatan, California, AS
Gideon FA Kersten Institut Vaksin Belanda (NVI), Bilthoven,
Belanda
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 12
Eugene M. Kolassa Ekonomi Pemasaran Kedokteran, LLC, dan Departemen
Farmasi, Universitas Mississippi, Oxford, Mississippi, dan University of the
Ilmu Pengetahuan, Philadelphia, Pennsylvania, AS
Paul M. Kovach Eli Lilly & Company, Lilly Research Laboratories, Indianapolis,
Indiana, AS
Peter Kuebler
Genentech, Inc., San Francisco Selatan, California, AS
Perguruan Tinggi Medis John C. Kuth di Georgia Health, Inc., Augusta, Georgia, AS
Robert A. Lazarus
Genentech, Inc., San Francisco Selatan, California, AS
Jing Li
Genentech, Inc., San Francisco Selatan, California, AS
Melinda Marian
Schering-Plough Biopharma, Palo Alto, California, AS
Enrico Mastrobattista Departemen Ilmu Farmasi, Universitas Utrecht,
Utrecht, Belanda
Pusat Sains Kesehatan Universitas Bernd Meibohm , College of
Farmasi, Departemen Ilmu Farmasi, Memphis, Tennessee, AS
Nishit B. Modi ALZA Corporation, Mountain View, California, AS
Susannah E. Motl. Moroney Roche Laboratories Inc., Nutley, New Jersey, AS
James Q. Oeswein Genentech, Inc. (Pensiunan), San Francisco Selatan, California, AS
Michael A. Panzara Biogen-Idec, Inc., Cambridge, Massachusetts, AS
Sidney Pestka Departemen Genetika Molekuler, Mikrobiologi dan Imunologi,
Universitas Kedokteran dan Kedokteran Gigi New Jersey – Robert Wood Johnson Medical
Sekolah, Piscataway, New Jersey, AS
Laboratorium Protein Aliansi John S. Philo , Thousand Oaks, California, AS
Peggy Piascik Universitas Farmasi Kentucky, Lexington, Kentucky,
Amerika Serikat
Jean-Charles Ryff Jaringan Penelitian dan Inovasi Biotek, Basel, Swiss
Tom Sam Urusan Regulasi Global, NV Organon, Oss, Belanda
Huub Schellekens Departemen Ilmu Farmasi dan Inovasi
Studi, Universitas Utrecht, Utrecht, Belanda
Raymond M. Schiffelers Departemen Ilmu Farmasi, Utrecht
Universitas, Utrecht, Belanda
Vinod P. Shah Konsultan Farmasi, Potomac Utara, Maryland, AS
Robert D. Sindelar Universitas British Columbia, Vancouver, Inggris
Columbia, Kanada
Sjef CM Smeekens Departemen Biologi, Universitas Utrecht, Utrecht,
Belanda
Frank-Peter Theil Genentech, Inc., San Francisco Selatan, California, AS
Jeffrey S. Wagener Departemen Pediatri, Fakultas Kedokteran Universitas Colorado,
Denver, Colorado, AS
Nicole A. Weimert Departemen Layanan Farmasi, Universitas Kedokteran Selatan
Carolina, Charleston, Carolina Selatan, AS
viii
KONTRIBUTOR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 13
Singkatan
I-hGH
I25
yodium berlabel manusia
hormon pertumbuhan
5HT 2a
reseptor serotonergik
subtipe
SEBUAH
adenin
AA
ngstrom
AA
asam amino)
AAV
virus terkait adeno
Ab
antibodi
ABO
antigen golongan darah
BERTINDAK
waktu pembekuan diaktifkan
ADA
adenosine deaminase
ADCC
tergantung antibodi
sitotoksisitas seluler
ADME
penyerapan, distribusi,
metabolisme, ekskresi
ADP
adenosine difosfat
Ag
antigen
AG-LCR
ligasi celah asimetris
reaksi berantai
AHF
faktor antihemophiliac /
faktor VIII
ALS
lateral amyotrophic
sklerosis
AMI
miokard akut
infark
AML
myelogenous akut
leukemia
ANC
neutrofil absolut
menghitung
AP
alkaline phosphatase
APC
sel penyajian antigen
aPCC
protrombin yang diaktifkan
konsentrat kompleks
apoE
apolipoprotein E
APSAC
plasminogen terasilasi-
aktivator streptokinase
ARDS
kesulitan pernapasan orang dewasa
sindroma
Asn
asparagine
Asp
asam aspartat
ATP
adenosin
5
0
-fosfat
ATPase
adenosine triphosphatase
AUC
area di bawah kurva
B
biotin
BCG
bacille Calmette-Guérin
BCGFII
Faktor pertumbuhan sel-B
BDNF
diturunkan dari otak
faktor neurotropik
BHK
ginjal bayi hamster
BMD
kepadatan mineral tulang
BMT
sumsum tulang
transplantasi
bp
pasangan basa DNA
BRCA1
gen kanker payudara 1
BRM
respon biologis
pengubah
BSA
albumin serum sapi
C
sitosin
CAM
molekul adhesi sel
MOBIL
Coxsackie adenovirus
reseptor
CCK
cholecystokinin
CD
dikroisme melingkar
CDC
tergantung komplemen
sitotoksisitas
CDL
pelengkap litik
jalan
cDNA
menyalin DNA /
komplementer
asam deoksiribonukleat
(terkadang juga kloning
DNA ”)
CDR
komplementaritas
menentukan wilayah
CEA
efektivitas biaya
analisis
CETP
kolesterol (cholesteryl)
ester mentransfer protein
CF
cystic fibrosis
CFTR
cystic fibrosis
transmembran
regulator konduktansi
CFU
unit pembentuk koloni
CFU-GM
granulosit
leluhur makrofag
sel
CG
gionadotropin korionik
CGD
granulomatosa kronis
penyakit
C H (1,2,3)
wilayah konstan dari
rantai berat lgG
CHO
Ovarium hamster Cina
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 14
CL
izin eliminasi
dari pusat
kompartemen
CMI
imunitas yang dimediasi sel
CML
myelogenous kronis
leukemia
CMV
sitomegalovirus
CNS
sistem syaraf pusat
Con A
concanavalin A
COPD
obstruktif kronis
penyakit paru-paru
CRI
ginjal kronis
ketidakcukupan
CRS
pelepasan sitokin
sindroma
CSF
stimulasi koloni
faktor
cSNPs
SNP terjadi dalam gen
daerah pengkodean
CT
toksin kolera
CTCL
sel T kulit
limfoma
CTL
limfosit T sitotoksik
CTP
cytidine 5
0
-fosfat
CUA
analisis utilitas biaya
D2
Dopaminergik D2
reseptor
D5W
dekstrosa 5% dalam air
DATP
deoksiadenosin
5
0
-fosfat
dCTP
deoxycytidine
5
0
-fosfat
DDA
dioctadecyldimethyl-
ammoniumbromide
DDBJ
Bank Data DNA Jepang
ddNTP
dideoksiribonukleotida
trifosfat
DF
diafiltrasi
dGTP
deoksiguanosin
5
0
-fosfat
DG U
energi bebas
DLS
hamburan cahaya dinamis
DNA
asam deoksiribonukleat
DNase
deoxyribonuclease (I)
dNTP
deoksiribonukleotida
trifosfat
DSC
pemindaian diferensial
kalorimetri
DTP
difteri-tetanus-
pertusis
dTTP
Deoxythymidine-
5
0
-fosfat
E
enzim
Eo
efek dasar
EBV
Virus Epstein-Barr
EC 50
konsentrasi itu
menghasilkan 50% dari
penghambatan maksimum atau
stimulasi
ECD
domain ekstraseluler
EDF
eosinofil
faktor diferensiasi
EDTA
ethylenediaminetetra-
asam asetat
EGF
faktor pertumbuhan epidermis
EGFR
faktor pertumbuhan epidermis
reseptor
Ei
ionisasi electrospray
ELISA
terkait enzim
uji imunosorben
E maks
penghambatan maksimum atau
stimulasi
EMBL
Molekul Eropa
Laboratorium Biologi
EMEA
Kedokteran Eropa
Badan Evaluasi
EPO
erythropoietin
ERK / PETA
sinyal ekstraseluler-
kinase teregulasi /
mitogen diaktifkan
protein kinase
ES
sel induk embrionik
EU
unit endotoksin
FACS
fluoresensi diaktifkan
penyortir sel
Fc
fragmen konstan
(dari imunoglobulin)
FcRN
Reseptor Brambell / F c
reseptor penyelamatan
FDA
Makanan dan Obat-obatan
Administrasi
FEV 1
berarti ekspirasi paksa
volume dalam satu detik
FGF
pertumbuhan fibroblast
faktor
FH
kekeluargaan
hiperkolesterolemia
fMLP
formil-metionil-
leucyl-phenylalanine
FPLC
cairan protein cepat
kromarografi
FSH
merangsang folikel
hormon
FTIR
Transformasi Fourier
spektroskopi inframerah
Fv
domain variabel cahaya
dan rantai berat
FVC
kapasitas vital paksa
G
guanin
G-CSF
koloni granulosit
faktor perangsang
G-LCR
rantai ligasi kesenjangan
reaksi
Ga-DF
desalum galium
x
SINGKATAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 15
GCV
gancyclovir
GDNF
turunan glial
pertumbuhan neurotropik
faktor
GEMM
granulosit, eritrosit,
monosit dan
megakaryocyte
GERD
refluks gastroesofagus
penyakit
GF
faktor pertumbuhan
GFR
laju filtrasi glomerulus
GH
hormon pertumbuhan
GHBP
hormon pertumbuhan
protein pengikat
GHD
hormon pertumbuhan
kekurangan
GHRH
hormon pertumbuhan
melepaskan hormon
HADIAH
gamete infra-fallopian
transfer
GIcNAc
N-asetil-glukosamin
GLP
praktik laboratorium yang baik
GM-CSF
granulosit
koloni makrofag
faktor perangsang
GMP
manufaktur yang baik
praktek
GnRH
melepaskan gonadotropin
hormon
PERGI
glukosa-oksidase
Dokter umum
glikoprotein
GRF
hormon pertumbuhan
faktor pelepasan
GTP
guanosin
5
0
-fosfat
GvHD
penyakit graft versus host
h
manusia
HACA
manusia anti-chimeric
antibodi
HAMA
anti-mouse manusiawi
antibodi
HB (sAg)
hepatitis B (permukaan
antigen)
Hct
hematokrit
HEPA
efisiensi tinggi
filter udara partikulat
HER2
epidermis manusia
reseptor faktor pertumbuhan
gen
HGF
pertumbuhan hematopoietik
faktor
HIC
interaksi hidrofobik
kromatografi
Nya
histidin
HIV
manusia
virus imunodefisiensi
HLA
leukosit manusiawi
antigen
HMWP
berat molekul tinggi
protein
HPLC
cairan kinerja tinggi
kromatografi
HPRT
hipoksantin
fosforibosil
transferase
HRP
peroxidase lobak
HSA
albumin serum manusia
HSC
sel induk hematopoietik
HSV
virus herpes simpleks
HTS
throughput tinggi
penyaringan
IA
intra-arteri
IC
intrakoroner
ICAM-1
adhesi intraseluler
molekul-1
ICSI
sperma intracytoplasmic
injeksi
IEF
fokus iso-listrik
ya
titik isoelektrik
IFN
interferon
IG
imunoglobulin
IGF
pertumbuhan seperti insulin
faktor
IGFBP
Protein pengikat IGF
IL
interleukin
SAYA M
intramuskuler
IO
intra-orbital
AKU P
intraperitoneal
IPTG
iso-propil-b-
thiogalactoside
IPV
vaksin polio yang tidak aktif
ISS
bertubuh pendek idiopatik
ITP
idiopatik
trombositopenik
purpura
ITR
terminal repeat terbalik
IUGR
pertumbuhan intrauterin
penghambatan
IV
intravena
IVF
fertilisasi in vitro
Kb
ribu pasangan basa
DNA
Kd
tingkat disosiasi konstan
kDa
kilodalton
KGF
pertumbuhan keratinosit
faktor
Km
Michaelis Menten
konstan
LAF
mengaktifkan limfosit
faktor
LAK
pembunuh diaktifkan leukosit
(sel)
LAtTP
jaringan kerja panjang
aktivator plasminogen
SINGKATAN
xi
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 16
LCR
reaksi berantai ligasi
LDL
lipoprotein densitas rendah
LDLR
lipoprotein densitas rendah
reseptor
LH
hormon luteinizing
LHRH
hormon luteinizing
melepaskan hormon
LIF
penghambatan leukemia
faktor
LPD
limfoproliferatif
gangguan
LPS
lipopolysaccharide
LRP
(kepadatan rendah)
reseptor lipoprotein
protein terkait
LTR
pengulangan terminal yang panjang
LYZ
lisozim
M1
reseptor nauscarinic
subtipe
M3
reseptor muskarinik
subtipe
Sel M
sel microfold
MAb
antibodi monoklonal
MAC
serangan membran
kompleks
MALDI
laser yang dibantu matriks
ionisasi desorpsi
PETA
beberapa peptida antigen
Mb
juta pasangan basa
DNA
MCB
bank sel induk
M-CSF
koloni makrofag
faktor perangsang
MDR-1
resistensi beberapa obat
Meg
megakaryocyte
Met-GH
manusia metionin
hormon pertumbuhan
bertemu-rhGH
rekombinan metionil
pertumbuhan manusia
hormon, mengandung
N-terminal methionine
MGDF
pertumbuhan megakaryocyte
dan pengembangan
faktor
MHC
kompatibilitas utama
kompleks
MI
infark miokard
MMAD
berarti aerodinamika massa
diameter
MMR
campak-gondong-rubella
MPS
fagosit mononuklear
sistem
Mr
massa molekul relatif
mRNA
messenger ribonucleic
RNA asam / kurir
MTP-PE
muramyltripeptide-
phosphatidyl-
etanolamin
MuLV
virus leukemia murine
mUPA
murine urokinase-type
aktivator plasminogen
Mw
massa molekul relatif
NBP
blok non-ionik
kopolimer
NCBI
Pusat Nasional untuk
Bioteknologi
Informasi
NCS
neocarzinostatin
NESP
erythropoiesis novel
protein perangsang
NF
bentuk alami
NF-kB
faktor transkripsi dalam
Sel B dan sel T
NF
faktor neurotropik
NGF
faktor pertumbuhan saraf
NIH
Institut Nasional Indonesia
Kesehatan
NK
sel pembunuh alami
NMR
magnetik nuklir
spektroskopi resonansi
BANYAK
Overhauser nuklir 2-D
efek teknik NMR
NPH
protamin netral
Hagedorn
NPL
lispro protamin netral
NSAID
non-steroid anti-
obat peradangan
NZS
neocarzinostatin
ODNs
oligodeoksinukleotida
OLA
ligasi oligonukleotida
pengujian kadar logam
OMP
protein membran luar
DI
oligonukleotida
ori
asal replikasi
HALAMAN
gel poliakrilamida
elektroforesis
PAI
aktivator plasminogen
inhibitor
PBPC
darah tepi
sel nenek moyang
PCI
koroner perkutan
intervensi
PCR
rantai polimerase
reaksi
PCTA
perkutan
koroner transluminal
angioplasry
PD
farmakodinamik
PDGF
pertumbuhan turunan trombosit
faktor
PASAK
polyoxyethylene ylene
polyethyleneglycol
xii
SINGKATAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 17
PEG IL-2
PEGylated interleukin-2
(polietilen glikol
modifikasi interleukin-2)
PEG-rhMGDF pegilasi-rekombinan
megakaryocyte manusia
pertumbuhan dan
faktor perkembangan
PEI
polietilena imina
PG
peptidoglikan
P1
titik isoelektrik,
logaritma negatif
pit-hGH
manusia yang berasal dari hipofisis
hormon pertumbuhan
PK
farmakokinetik
PLGA
polylactic-coglycolic
AC id
PNA
asam nukleat peptida
PP
polypropylene
PT
waktu protrombin
PTCA
perkutan
koroner transluminal
angioplasti
PTH
hormon paratiroid
PTT
tromboplastin parsial
waktu
PVC
polivinil klorida
PVDF
polivinilidin difluorida
QALY
tahun kehidupan yang disesuaikan kualitas
r
rekombinan
rAT
rekombinan
a1-antitrypsin
RAC
DNA Rekombinan AS
Komite Penasihat
RAHF
anti-rekombinan
faktor hemofilia
Sel darah merah
sel darah merah
rBPI
bakteri rekombinan /
meningkatkan permeabilitas
protein
rDNA
rekombinan
asam deoksiribonukleat/
rekombinan-DNA
rG-CSF
granulosit rekombinan
merangsang koloni
faktor (filgrastim)
RGD
urutan asam amino
Arg-Gly-Asp (arginine-
glycine-aspartic acid)
rhGM-CSF
rekombinan
granulosit
koloni makrofag
faktor perangsang
rhDNase
manusia rekombinan
deoxyribonuclease I
rh-EPO
manusia rekombinan
erythropoietin
rhG-CSF
manusia rekombinan
koloni granulosit
faktor perangsang
rhGH
manusia rekombinan
hormon pertumbuhan,
urutan alami
RIA
radioimmunoassay
rBPI
rekombinan
bakterisida /
permeabilitas meningkat
protein
RME
reseptor dimediasi
endositosis
RMS
root mean square
RNA
asam ribonukleat
RNase P
ribonuclease P
RNase H
ribonuclease H
RP-HPLC
fase terbalik tinggi
cair kinerja
kromatografi
rRNA
RNA ribosom
RSV
syncytial pernapasan
virus
RT
membalikkan transkriptase
rt-PA
rekombinan
tipe jaringan
aktivator plasminogen
RT-PCR
membalikkan transkripsi
rantai polimerase
reaksi
RTU
solusi siap pakai
SA
streptavidin
SBS
sindrom usus pendek
SC
budaya suspensi atau
subkutan
SCF
faktor sel induk (juga
dikenal sebagai ligan c-kit
dan faktor baja)
ScF v
variabel rantai tunggal
fragmen
SCI
infus subkutan
SCN
kronis parah
neutropenia
scu PA
rantai tunggal urokinase
aktivator plasminogen
SDS-PAGE
sodium dodesil sulfat
gel poliakrilamid
elektroforesis
DETIK
ukuran-pengecualian
kromatografi
Ser
serin
SLE
lupus sistemik
erythematosus
SNP
nukleotida tunggal
polimorfisme
MERUMPUT
superoksida dismutase
SINGKATAN
xiii
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 18
SSC
suspensi skala besar
proses budaya
IMS
kacang kedelai trypsin
inhibitor
T / dTTP
deoxythymidine 5
0
-
trifosfat
T
timin
t-PA
plasminogen jaringan
penggerak
T3, T4
hormon tiroid
TAC
Antigen pengaktif sel-T
TAS
berbasis transkripsi
sistem amplifikasi
TCGF
Faktor pertumbuhan sel-T
TDTH
tipe tertunda
T-sel hipersensitivitas
Te
suhu eutektik
TFF
filtrasi aliran tangensial
TFPI
jalur faktor jaringan
inhibitor
Tg
transisi kaca
suhu
TGF
faktor pertumbuhan jaringan
T h -cell
Sel T-helper
TH 1,2
Tipe 1 atau 2 sel T-helper
TIL
tumor menginfiltrasi
limfosit
TIMI
trombolisis dalam
pelanggaran miokard
TNF-a
faktor nekrosis tumor a
tPA
plasminogen tipe jaringan
penggerak
TPMT
tiopurin
methyltransferase
TPO
trombopoietin
TR
terminal berulang
PERANGKAP
reseptor trombin
mengaktifkan peptida
TRF
Penggantian sel T
faktor
tRNA
mentransfer RNA
TSE
menular
spongiphormous
radang otak
TSH
stimulasi tiroid
hormon
TSP
trombospondin
U
urasil
UF
ultrafiltrasi
uPA
tipe urokinase
aktivator plasminogen
UTP
uridine 5
0
-fosfat
UV
ultraungu
VEGF
endotel pembuluh darah
faktor pertumbuhan
VLP
virus seperti partikel
VSV
stomatitis vesikular
virus
W
berat
WCB
bank sel yang bekerja
SIAPA
Kesehatan Dunia
Organisasi
SIAPA-IUIS
Kesehatan Dunia
Organisasi-
Serikat Internasional
Masyarakat Imunologi
X-FEL
elektron bebas x-ray
laser
xiv
SINGKATAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 19

1
Bioteknologi Molekuler
Wiel PM Hoekstra dan Sjef CM Smeekens
Departemen Biologi, Universitas Utrecht, Utrecht, Belanda
PENGANTAR
Bioteknologi telah didefinisikan dalam banyak perbedaan
cara. Definisi spesifik untuk bioteknologi farmasi
nology dapat disimpulkan langsung dari definisi ini.
Secara umum bioteknologi menyiratkan penggunaan mikro-
organisme, tumbuhan, dan hewan atau bagiannya untuk
produksi senyawa yang bermanfaat. Karena itu,
bioteknologi farmasi harus dipertimbangkan
sebagai manufaktur bioteknologi farmasi
produk.
Berbagai bentuk bioteknologi sudah ada
dahulu kala. Alkitab mendokumentasikan ini kuno
asal bioteknologi, memberi tahu kami tentang Nuh
yang tampaknya tahu cara membuat anggur dari anggur.
Didasarkan hanya pada pengalaman tetapi tanpa pemahaman-
Dengan prinsip yang mendasari, bioproduk adalah untuk
banyak usia buatan sendiri dalam mode tradisional.
Wawasan ke dalam sifat proses tradisional
dicapai sekitar 1870 ketika Pasteur menjelaskan hal itu
konversi kimia dalam proses ini dilakukan
oleh sel-sel hidup dan karenanya harus dianggap sebagai
konversi biokimia. Bioteknologi menjadi
ilmu! Dalam beberapa dekade setelah pengetahuan Pasteur
berkerut ketika peran enzim sebagai katalis untuk sebagian besar
konversi biokimia menjadi jelas. Berdasarkan
pengetahuan itu, alat menjadi tersedia untuk mengontrol dan
mengoptimalkan proses tradisional sampai batas tertentu.
Terobosan lebih lanjut dan sangat penting terjadi
tempat setelah pengembangan biologi molekuler. Itu
Gagasan, diajukan oleh para perintis dalam molekul
biologi sekitar tahun 1950, bahwa DNA mengkode protein dan
dengan cara ini mengontrol semua proses seluler adalah
dorongan untuk periode baru dalam bioteknologi. Yang cepat
mengembangkan teknologi DNA, setelah pengembangan
teknologi DNA rekombinan pada tahun tujuh puluhan,
memungkinkan ahli bioteknologi untuk mengontrol ekspresi gen di
organisme yang digunakan untuk manufaktur bioteknologi
ing. Selain itu, teknologi yang dikembangkan dibuka
cara untuk memperkenalkan DNA asing ke dalam semua jenis
organisme Seperti yang akan ditunjukkan nanti, secara genetik
organisme hasil modifikasi yang dibangun dengan cara itu dibuka
melengkapi kemungkinan baru untuk bioteknologi. Itu
bentuk baru bioteknologi, berdasarkan yang mendalam
pengetahuan tentang molekul DNA dan ketersediaannya
teknologi manipulasi DNA, sering
digambarkan sebagai "bioteknologi molekuler."
berbagai pendekatan molekuler untuk pengembangan lebih lanjut
opment bioteknologi segera terlihat,
meskipun harapan kadang-kadang berlebihan
diperkirakan. Pada saat yang sama bioteknologi menjadi
subjek debat publik. Sebuah pertanyaan penting dalam
debat berkaitan dengan risiko potensial: Lakukan secara genetik
organisme hasil modifikasi seperti yang digunakan dalam fasilitas produksi
menimbulkan risiko yang tidak diketahui untuk suatu ekosistem dan untuk
ras manusia itu sendiri? Apalagi etis yang mendalam
pertanyaan diajukan: Apakah benar untuk memodifikasi
struktur genetik organisme hidup?
Dalam bab ini kita akan fokus terutama pada yang baru
bioteknologi dengan menjelaskan cara dan tujuannya. Sebagai
untuk pertanyaan tentang risiko potensial dari
teknologi, kami akan membatasi diri untuk menyatakan itu
semua jenis pengukuran dilakukan untuk menghindari risiko
saat menggunakan organisme yang dimodifikasi secara genetik. Itu
aspek etis, menarik seperti apa adanya, berada di luar
ruang lingkup bab ini.
SEL
Meskipun bioteknologi tidak secara eksklusif memanfaatkannya
sel tetapi juga organisme lengkap atau sel
konstituen, pengetahuan biologi sel dasar adalah
quired untuk memahami bioteknologi sepenuhnya.
Sel dari semua jenis organisme digunakan di
bioteknologi. Tidak hanya sel prokariotik yang suka sederhana
bakteri uniseluler digunakan, tetapi juga sel eukariotik,
seperti sel-sel mikroorganisme yang lebih tinggi, tanaman, dan
binatang, dieksploitasi. Jenis sel itu tidak dibagikan
dengan detail. Konsep pemersatu dalam biologi sel
dan diversifikasi sejauh yang relevan untuk farmasi
bioteknologi ceutical akan menjadi topik utama
diskusi dalam bab ini.
n Sel Prokariotik
Prokariota, tempat bakteri itu berada,
mewakili sel paling sederhana di alam. Skematis
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 20
ilustrasi (Gambar 1) menggambarkan sel prokariotik. Misalnya
sel sebenarnya tidak lebih dari sitoplasma yang dikelilingi oleh
beberapa lapisan permukaan, umumnya digambarkan sebagai sel
amplop. Dalam dunia bakteri orang membedakan
dua jenis utama organisme. Mereka disebut Gram-
positif atau Gram-negatif berdasarkan berbagai perilaku
vior dalam teknik pewarnaan sel klasik. Itu
perbedaan mendasar antara kedua pro
jenis yotic terutama terlihat pada struktur
amplop sel.
Amplop sel bakteri terdiri dari sitoplasma.
membran plasmik dan dinding yang sangat khas
struktur yang disebut lapisan peptidoglikan. Sel-sel dari
Organisme Gram-positif berlapis-lapis dengan pep-
tidoglikan sementara hanya satu atau dua lapisan tersebut
ditemukan dalam sel organisme Gram-negatif. Namun,
perbedaan paling jelas antara kedua jenis
sel bakteri adalah bahwa dalam organisme Gram-negatif
sel dikelilingi oleh membran ekstra yang sangat spesifik
lapisan, yang disebut membran luar (OM) (Gbr. 2). Di samping
membran sitoplasma, juga disebut bagian dalam
membran (IM), OM adalah penghalang permeasi untuk
zat yang diangkut ke dalam atau ke luar sel.
Bahan kimia yang menonjol dan sangat khusus
konstituen dari OM adalah senyawa bernama
lipopolysaccharide (LPS). Program biofarmasi
saluran yang didapat dari organisme Gram-negatif harus
dimurnikan secara ekstensif terutama ketika digunakan
sebagai obat untuk manusia atau hewan (Bab 3
dan 4), karena LPS dibebaskan selama isolasi
produk memiliki, bahkan dalam konsentrasi yang sangat rendah sekalipun
efek toksik pada manusia dan hewan.
Dalam sel bakteri, DNA umumnya diatur
dalam satu molekul lingkaran besar. DNA bakteri adalah
tidak dikelilingi oleh membran nuklir dan tidak sama
kompleks dalam organisasi seperti DNA dalam sel eukariotik.
Satu umumnya mengacu pada DNA bakteri sebagai kromosom
mal DNA, analog dengan nomenklatur dalam eukar-
sel yotic. Bakteri dapat, terlepas dari kromosom
DNA, menampung replikasi DNA kecil secara mandiri
molekul, yang disebut plasmid. Fungsi yang penting
untuk sel bakteri biasanya dikodekan oleh
kromosom, sedangkan fungsinya disandikan oleh plasmid
pada umumnya sama sekali tidak esensial. Namun,
Plasmid memberkahi sel bakteri dengan sifat-sifat itu
mungkin sangat penting untuk kelangsungan hidup bakteri.
Resistensi antibiotik dan produksi racun
teins, misalnya, dikenal sebagai plasmid yang dikodekan
sifat-sifat. Seperti yang akan kita lihat nanti, plasmid digunakan di
bioteknologi sebagai alat penting dan dasar untuk
teknologi DNA rekombinan.
Ketika kita menyebut plasmid sebagai DNA kecil
molekul, ini tentu saja dibandingkan dengan ukurannya
DNA kromosom. Selain itu, orang harus sadar
bahwa ukuran plasmid bervariasi. Plasmid kecil, umumnya
yang relevan untuk bioteknologi, tentang pelabuhan
6000 unit bangunan DNA, disebut nukleotida.
DNA kromosom bakteri setidaknya mengandung
1000 kali lebih banyak nukleotida. Isi DNA suatu
sel hewan atau tumbuhan melebihi beberapa
seratus kali lipat dari sel bakteri. Apalagi itu
DNA dari sel sebelumnya tidak lagi terorganisir di
satu molekul, tetapi dalam beberapa kromosom linier.
Cara populer untuk menggambarkan pertumbuhan yang cepat ini
DNA kromosom
Amplop sel
Ribosom
Plasmid
Flagella
Fimbriae
Gambar 1 n Penampang
(Buatan) melalui bakteri
sel. Struktur permukaan
(Fimbriae dan flagela) adalah
bukan struktur esensial tetapi
biarkan sel menempel dan
untuk bergerak.
2
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 21
kompleksitas molekul DNA di alam didasarkan pada
halaman dan buku. Satu dapat dengan mudah menulis di satu halaman
komposisi DNA dari sebuah plasmid kecil olehnya
komposisi nukleotida, menggunakan simbol A, C, G,
dan T untuk berbagai nukleotida dalam DNA. Melakukan
sama untuk kromosom bakteri, sebuah buku dengan
dibutuhkan sekitar 1000 halaman. Untuk sel hewan atau a
sel tanaman itu membutuhkan beberapa ratus buku, masing-masing
berisi sekitar 1000 halaman untuk menggambarkan DNA.
Sel-sel bakteri, seperti semua sel, memiliki sel
sitoplasma ribosom sebagai struktur penting untuk
sintesis protein, serta berbagai macam enzim
dan molekul (makro) lainnya yang diperlukan untuk yang tepat
fisiologi sel. Namun yang paling penting adalah
bahwa, terlepas dari kromosom, ribosom dan beberapa
kali plasmid, umumnya tidak ada struktur lain yang berbeda
terlihat di sitoplasma sel bakteri, bahkan
ketika dipelajari dengan mikroskop elektron.
Selain itu, tidak ada kompartemen yang tersedia di
sitoplasma sel prokariotik.
n Sel Eukariotik
Gambar 3 menyajikan gambar skematik sel tanaman sebagai
contoh sel eukariotik. Sel eukariotik
memiliki struktur yang sangat kompleks, tidak hanya dengan keberadaannya
organel sel seperti nukleus, mitokondria, dan
kloroplas (secara eksklusif ditemukan dalam sel tanaman), tetapi juga
dengan adanya membran internal spesifik dan
vakuola. Struktur yang kompleks dan terkotak ini
Masa depan menyiratkan perilaku fungsional yang rumit dan
salah satu alasan yang ada pada fase awal modern
bioteknologi sel bakteri sederhana, lebih mudah ditangani
dan lebih mudah dimodifikasi, digunakan secara jelas.
Saat ini, para bioteknologi molekuler menggunakan segala macam
sel eukariotik, mengeksploitasi wawasan yang tumbuh cepat
dalam biologi sel.
EKSPRESI GEN
Informasi genetik, secara kimia ditentukan oleh
Struktur DNA, ditransfer selama pembelahan sel ke
sel anak melalui replikasi DNA dan diekspresikan
dengan transkripsi (konversi DNA menjadi RNA)
diikuti oleh terjemahan (konversi RNA menjadi
protein). Serangkaian proses ini ditemukan di semua sel
dan hasil umumnya dengan cara yang sama. Itu adalah salah satu
konsep pemersatu utama dalam biologi sel. Pelopor dari
biologi molekuler menyebut rangkaian peristiwa itu
"Dogma sentral" biologi. Ditemukan kemudian bahwa
retrovirus, kelas khusus virus RNA hewan,
menyandikan enzim yang mengkatalisis konversi
RNA menjadi DNA komplementer. Enzim ini, disebut
reverse transcriptase karena mengarahkan, jadi bisa dikatakan, the
kebalikan dari transkripsi, oleh karena itu memungkinkan suatu
arus informasi dari RNA ke dalam DNA. Membalikkan
transcriptase menjadi, seperti yang akan ditunjukkan nanti, sangat
alat penting untuk teknologi DNA.
Berbagai proses terkait DNA adalah skema-
tically digambarkan di bawah ini:
DNA $ RNA! protein
"Dogma pusat" didasarkan pada investigasi
dilakukan dengan bakteri dan virus. Kemudian ditemukan itu
pada organisme eukariotik banyak gen diekspresikan
berbeda dari apa yang diprediksi oleh dogma di
arti yang ketat. Dalam beberapa kasus RNA diturunkan oleh
transkripsi segmen DNA eukariotik adalah subjek
untuk proses yang disebut splicing sebelum meninggalkan nukleus.
Selama proses ini bagian-bagian tertentu, yang disebut intron,
molekul RNA yang baru lahir dihilangkan, setelah itu
bagian lain (ekson) dihubungkan bersama dan terbentuk
RNA efektif untuk sintesis protein (Gbr. 4).
Lebih lanjut, penting untuk menyadari bahwa a
protein baru lahir, hasil langsung dari terjemahan, adalah
OM
PG
PG
LPS
SAYA M
SAYA M
Gambar 2 n Amplop sel G
þ
sel (kiri) dan G
SEBUAH
sel (kanan). Singkatan: G
þ
, Gram positif; G
SEBUAH
, Gram negatif; PG, peptido-glikans;
LPS, lipopolysaccharide; OM, membran luar; IM, membran bagian dalam.
BIOTEKNOLOGI MOLEKULER
3
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 22
belum tentu identik dengan protein fungsional dalam
sel sebagai enzim atau protein struktural. Sebagian besar protein
seperti yang kita temukan di dalam sel dimodifikasi oleh post-
acara terjemahan. Polipeptida yang baru lahir adalah untuk
contoh, dipangkas oleh peptidase; dalam beberapa kasus lipid
kelompok terkait dengan protein, sedangkan eukariotik
modifikasi sel melalui penghubungan gula
kelompok (glikosilasi) adalah peristiwa umum. Seperti post-
modifikasi translasi adalah fitur penting dengan
berkaitan dengan fungsi spesifik dari protein.
Pengetahuan yang tepat tentang arus informasi di Internet
sel sangat penting untuk bioteknologi, karena ia menawarkan
kemungkinan untuk mengendalikan proses seluler di tingkat
ekspresi gen. Karena itu, esensi elemen
dan proses yang terlibat dalam aliran genetik
informasi akan dijelaskan di bawah ini.
n Replikasi DNA
Meskipun DNA dapat diatur secara berbeda di
berbagai organisme satu atau lebih rantai ganda
Tonoplast
Vakuola
nuklir
amplop
kromatin
nukleolus
Inti
Kasar
endoplasma
retikulum
Halus
endoplasma
retikulum
Peroxisome
(microbody)
Dinding sel
Membran plasma
Golgi
aparat
Plasmodesmata
Kloroplas
Mikrofilamen
Mitokondria
Mikrotubulus
Ribosom
Gambar 3 n Sel tanaman, tampilan skematis.
4
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 23
Molekul DNA dalam konformasi heliks adalah
struktur dominan. Helai DNA adalah gabungan
berpose dari empat elemen bangunan spesifik (segera)
ditulis sebagai A, C, G, dan T), deoksiribonukleotida
deoksiadenosin 5
0
-triphosphate, (dATP) deoxy-
cytidine 5
0
-triphosphate (dCTP), deoxyguanosine
5
0
-Triphosphate (dGTP), dan deoxythymidine 5
0
-tri-
fosfat (dTTP) dihubungkan oleh ikatan fosfodiester.
Dua untai dalam heliks DNA disatukan
melalui ikatan hidrogen antara nukleotida di
berbagai helai. Untai DNA dalam heliks adalah
komplementer dalam komposisi nukleotida mereka: a
di satu untai selalu menghadapi T di yang lain,
sementara C selalu menghadap ke G (Gbr. 5). Apalagi itu
helai dalam DNA untai ganda menjalankan antiparalel:
5
0
-P ujung untai satu menghadap ke 3
0
-OH akhir
untai komplementer dan sebaliknya.
Selama pembelahan sel, informasi genetik dalam a
sel induk ditransfer ke sel anak oleh
Replikasi DNA. Penting dalam DNA yang sangat kompleks
proses replikasi adalah aksi DNA polimerase.
Selama replikasi, setiap untai DNA disalin ke a
untai komplementer yang berjalan antiparalel. Itu
kendala topologi untuk replikasi karena
struktur heliks ganda dari DNA dipecahkan oleh
melepaskan heliks, dikatalisis oleh enzim
helicase. Dalam satu set acara biokimia deoxyribonu-
monomer cleotide ditambahkan satu per satu ke akhir
untai DNA yang tumbuh dalam 5
0
ke 3
0
arah.
Replikasi DNA dimulai dari situs tertentu, yang disebut
asal usul replikasi (ori). Kromosom bakteri
dan banyak plasmid hanya memiliki satu situs semacam itu. Dalam
genom eukariotik yang jauh lebih besar mungkin ada banyak
kerikil oris hadir. Untuk molekul DNA sirkuler suka
kromosom bakteri dan plasmid ada dua
kemungkinan cara untuk replikasi. Semi konservatif
replikasi (Gbr. 6A) melanjutkan dalam lingkaran tertutup sebagai
Sebuah
b
c
d
e
f
g
DNA
Intron
Intron
Transkripsi
Penyambungan
Sebuah
c
e
g
mRNA
Utama
transkrip
Intron
Gambar 4 n Penyambungan RNA.
3'
T
ikatan hidrogen
SEBUAH
G
C
SEBUAH
T
G
C
3'
3'
3'
5'
5'
5'
5'
Gula-fosfat
tulang punggung
(5 '
3 ') obligasi
hal
hal
hal
hal
hal
hal
hal
hal
hal
hal
(3 '
5 ') obligasi
Gambar 5 n Struktur DNA skematis menunjukkan polaritas dan
komplementaritas.
BIOTEKNOLOGI MOLEKULER
5
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 24
seperti itu (Gbr. 6B) adalah satu arah. Kendala membawa
maju oleh rotasi sebagai akibat dari
unwinding (tidak ada ujung gratis!) diselesaikan oleh
aktivitas kelas khusus enzim, topoisome-
wahana. Atau, replikasi dilakukan melalui penggulungan
model lingkaran. Dalam hal replikasi dimulai oleh
memotong salah satu untai DNA di wilayah ori dan
kemudian hasil seperti yang ditunjukkan pada Gambar 6C.
Plasmid bakteri didefinisikan secara otonom
mereplikasi molekul DNA. Dasar untuk keadaan itu-
adalah keberadaan situs ori di dalam plasmid. Itu
kualifikasi otonom, bagaimanapun, tidak menyiratkan
bahwa plasmid tidak tergantung pada faktor inang
replikasi dan ekspresi. Beberapa plasmid tergantung padanya
faktor tuan rumah sangat spesifik dan akibatnya mereka dapat
hanya mereplikasi di host tertentu. Plasmid lain lebih sedikit
spesifik untuk persyaratan faktor host mereka dan
mampu mereplikasi dalam serangkaian host yang luas. Seperti yang akan terjadi
ditunjukkan kemudian, perbedaan dalam kisaran inang adalah
bermakna ketika plasmid dieksploitasi di
bioteknologi.
n Transkripsi
Informasi genetik terletak di gen yang dibentuk oleh
segmen diskrit dari DNA seluler. Dalam suatu proses
disebut transkripsi (disajikan secara skematis dalam bahasa Indonesia)
Gambar 7), gen disalin menjadi panjang komplementer
asam ribonukleat (RNA) oleh enzim RNA
polimerase. Sebagian besar molekul RNA,
ger RNAs (mRNAs), tentukan komposisi asam amino
protein seluler. Molekul RNA lainnya
berasal dari transkripsi, RNA ribosom (rRNA) dan
transfer RNA (tRNA), berpartisipasi sebagai mole- tambahan
cules untuk terjemahan. Baru-baru ini, transkrip micro-RNA
ditemukan di semua jenis sel. Molekul kecil ini
digambarkan sebagai siRNA memainkan peran penting dalam
regulasi sintesis protein.
Penemuan bagaimana pengaturan khusus
nukleotida dalam gen mengkode urutan
asam amino dalam polipeptida, penguraian
kode genetik, adalah salah satu tonggak dari DNA
époque. Ditemukan bahwa kembar tiga nukleotida di
DNA, dan akibatnya dalam mRNA, kode untuk
komposisi asam amino protein. Yang terpenting
menemukan bahwa kode genetik (hampir)
bersifat universal. Triplet nukleotida yang diberikan, a
disebut kodon, dalam kode mRNA untuk amino yang sama
asam di hampir semua organisme.
Dalam molekul mRNA ada lebih banyak informasi
lebih dari sekadar kembar tiga yang diperlukan untuk yang disandikan
protein. Informasi pengkodean protein didahului
oleh sepotong RNA yang memungkinkan mengikat ke
ribosom, sementara setelah triplet mengkodekan
Asam amino C-terminal ada beberapa RNA itu
berfungsi dalam penghentian transkripsi
proses. Dengan demikian, sinyal diperlukan untuk menjamin di dalam
molekul mRNA ini merupakan awal dan akhir yang tepat untuk
sintesis polipeptida. Dekat 5
0
-akhir dari mRNA a
triplet spesifik, pengkodean untuk asam amino metionin,
menentukan awal yang tepat dari sintesis polipeptida
dan dekat 3
0
-mengakhiri triplet tertentu (kodon stop)
menentukan penyelesaian yang tepat dari sintesis polipeptida.
Kode genetik, berdasarkan si kembar tiga di
mRNA, disajikan pada Tabel 1. Seseorang dapat melihat bahwa ada
ada tiga kodon stop yang berbeda. Apalagi jelas
dari Tabel 1 ini kode ini sangat redundan: untuk
asam amino tertentu ada beberapa kodon. Kapanpun
ada pilihan antara berbagai kodon untuk satu amino
Asam, organisme yang berbeda cenderung menunjukkan perbedaan
preferensi. Nanti akan menjadi jelas bahwa ini
preferensi kodon tergantung organisme memiliki konsekuensi
quences untuk proses bioteknologi tertentu.
Transkripsi dimulai dengan pengikatan
enzim RNA polimerase di situs tertentu, yang disebut
promotor, segera hulu dari gen atau dari a
set gen yang ditranskripsi sebagai unit operasional (an
operon). Promosi berbeda dalam efisiensinya untuk mengikat RNA
polimerase. Beberapa promotor, promotor yang kuat,
sangat efisien sementara yang lain lemah dan sering
membutuhkan faktor tambahan untuk pengikatan RNA yang efektif
polimerase. Struktur promotor, dalam prokariota sebagai
(A)
(B)
(C)
Gambar 6 n (A) replikasi DNA (gambaran umum). (B) Ditutup
replikasi lingkaran. (C) Model lingkaran bergulir.
6
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 25
seperti halnya pada eukariota, telah dipelajari dengan sangat rinci.
Berdasarkan studi tersebut sekarang layak dalam biotechnol-
ogy, seperti yang ditunjukkan kemudian, untuk memadukan promotor yang sangat efektif
struktur untuk gen mana pun yang ingin diekspresikan.
Setelah pengikatan RNA polimerase, DNA
sebagian helix dibatalkan dan selanjutnya
proses transkripsi dimulai. Sintesis RNA kemudian
hasil dengan ribonucleotides ATP, GTP, CTP
dan UTP (uridine 5
0
-triphosphate) sebagai unit bangunan.
Satu untai DNA dalam gen, yang disebut templat
strand, berfungsi sebagai matriks untuk sintesis RNA ini.
Seperti dalam sintesis DNA, sintesis RNA berjalan
antiparalel ke arah 5
0
ke 3
0
dan hasil dalam a
cara komplementer. Yang terakhir menyiratkan bahwa G dalam
matriks DNA mengarah ke C dalam RNA, C mengarah ke G, a
T ke A sedangkan A di dalam DNA muncul sebagai U di
RNA. Transkripsi dapat berhenti di
dasar fitur struktural intrinsik dari RNA di
akhir gen atau operon atau dengan intervensi
faktor protein penghentian spesifik di situs ini.
Transkripsi dapat diatur pada berbagai tahap
dalam proses. Sifat intrinsik dari
Transkripsi
mulai
5'
5'
mRNA
UC GA
AGCT
Wilayah promotor
Gene
3'
RNA polimerase
Transkripsi
penghentian
Gambar 7 n Transkripsi.
Bagian atas menunjukkan sedang berlangsung
transkripsi. Bagian bawah
menggambarkan awal, melibatkan
pengikatan spesifik RNA poly-
menyerah kepada promotor
wilayah.
Posisi pertama
(5 0 -akhir)
Posisi kedua
Posisi ketiga
(3 0 -akhir)
U
C
SEBUAH
G
U
Phe
Ser
Tyr
Cys
U
Phe
Ser
Tyr
Cys
C
Leu
Ser
Berhenti
Berhenti
SEBUAH
Leu
Ser
Berhenti
Trp
G
C
Leu
Pro
Nya
Arg
U
Leu
Pro
Nya
Arg
C
Leu
Pro
Gln
Arg
SEBUAH
Leu
Pro
Gln
Arg
G
SEBUAH
Lle
Thr
Asn
Ser
U
Lle
Thr
Asn
Ser
C
Lle
Thr
Lys
Arg
SEBUAH
Bertemu
Thr
Lys
Arg
G
G
Val
Ala
Asp
Gly
U
Val
Ala
Asp
Gly
C
Val
Ala
Glu
Gly
SEBUAH
Val
Ala
Glu
Gly
G
Catatan: Kodon tebal digunakan untuk inisiasi.
Tabel 1 n Kode genetik "universal".
BIOTEKNOLOGI MOLEKULER
7
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 26
promotor, di sebelah berbagai macam protein yang bisa
baik menekan atau merangsang pengikatan RNA poly-
merase, mengatur awal transkripsi. Transkripsi
pemutusan hubungan kerja juga dapat diatur. Pengakhiran dapat,
di bawah pengaruh faktor fisiologis, terjadi pada a
tahap prematur. Atau, termina normal
sinyal tion dapat diabaikan (suatu proses yang disebut read-
melalui). Ini dapat menyebabkan berbagai panjang
transkrip dimulai dari promotor yang sama. Akhirnya
aktivitas gen juga dapat diatur pada tingkat
membentuk mRNA. Semua transkrip tunduk pada degradasi-
tetapi laju degradasi dapat sangat bervariasi: Beberapa
transkrip memiliki waktu paruh pendek sementara yang lain
sangat stabil. Ahli bioteknologi mencoba mempengaruhi
ekspresi gen yang mengkode biotekno- yang relevan
protein logis pada masing-masing level regulasi di Indonesia
untuk mencapai produksi yang optimal.
n Terjemahan
Terjemahan, disajikan secara skematis pada Gambar 8, adalah a
proses seluler kompleks di mana molekul mRNA,
ribosom, molekul tRNA, asam amino, aminoasil
synthetases dan sejumlah faktor terjemahan bertindak
bersama-sama dengan cara yang sangat terkoordinasi. Ribosom itu,
sebuah organel yang dibangun dari molekul rRNA dan protein,
adalah struktur seluler tempat berbagai senyawa
untuk merakit sintesis protein.
Elemen pembangun protein, amino
asam, digunakan dalam sintesis protein dalam suatu bentuk
diadaptasi untuk interaksi yang nyaman dengan mRNA.
Adaptasi asam amino dicapai oleh
menggandengnya dengan molekul tRNA tertentu melalui
aksi katalitik sintetase aminoasil spesifik. Itu
asam amino yang diadaptasi terkait dengan 3
0
-OH terminal dari
molekul tRNA tertentu. Setiap molekul tRNA
mengandung dalam loop karakteristik molekul a
triplet spesifik. Triplet ini saling melengkapi dan berjalan
antiparalel dengan kodon untuk asam amino terkait dan
karena itu ditunjuk sebagai antikodon. Kopel
melalui pasangan basa dari antikodon dalam tRNA ke
kodon dalam mRNA adalah cara asam amino
diposisikan sesuai dengan kode dalam mRNA.
Terjemahan dimulai dengan pembentukan spesifik
kompleks inisiasi. Dalam sel bakteri ini terdiri dari a
30S subunit ribosom, tRNA yang membawa amino
asam metionin, GTP dan berbagai faktor inisiasi semuanya
pada posisi AUG kodon mulai mRNA.
Untuk membentuk kompleks inisiasi ini, 5
0
-mengakhiri wilayah
pembawa bakteri penting. Wilayah ini, yang mana
itu sendiri tidak diterjemahkan, mengandung ribosom tertentu
situs yang mengikat. Untuk kompleks inisiasi, ribosom 50S
Subunit selanjutnya diikat, menciptakan fungsional
70S ribosom. Terjemahan kemudian dilanjutkan, dengan
bantuan faktor perpanjangan tertentu, sedemikian rupa
ribosom 70S diangkut di sepanjang mRNA
molekul bertahap lebih dari jarak satu triplet. Ini
transportasi bertahap menjamin sintesis protein tersebut
hasil dengan cara terkoordinasi yang ditentukan oleh (triplet)
kodon. Asam amino, disampaikan oleh spesifik
Molekul tRNA, dihubungkan bersama, satu demi satu
lainnya, dengan pembentukan ikatan peptida. Sementara itu
Pembawa tRNA dibebaskan lagi.
Pada akhir molekul mRNA ada satu atau
lebih banyak berhenti kodon. Kembar tiga ini tidak menerima apapun
molekul tRNA-aminoasil dan oleh karena itu terminat-
sinyal untuk sintesis protein. Setelah penghentian
protein dilepaskan dari ribosom 70S. Itu
ribosom kemudian hancur dalam 30S dan 50S subunit mereka
yang dapat digunakan dalam siklus terjemahan lebih lanjut.
Meskipun ada gambaran umum yang umum untuk
terjemahan dalam prokariota dan eukariota ada
Namun berbagai perbedaan berbeda, terutama di Indonesia
sifat faktor inisiasi dan perpanjangan. Sangat
perbedaan yang jelas adalah konsekuensi langsung dari
perbedaan dalam organisasi DNA antara pro dan
eukariota. Di dalam sel prokariotik, mRNA sudah ada
tersedia untuk ribosom saat masih dalam
proses transkripsi. Di sel eukariotik, pada
Sebaliknya, mRNA hanya tersedia untuk terjemahan
setelah itu sepenuhnya disintesis dan setelah itu
diangkut melalui membran nuklir.
Akibatnya, transkripsi dan terjemahan
proses digabungkan dalam sel prokariotik, sementara ini
proses terjadi secara terpisah di sel eukariotik.
TEKNOLOGI DNA REKOMBINAN
Setelah itu ditetapkan bahwa DNA adalah bahan kimia
konstituen untuk sifat herediter sel
dan setelah penemuan itu sel (bakteri) dapat
secara spontan mengambil DNA, peneliti segera
hanya mencoba untuk memanipulasi sifat genetik semua
Ribosome
tRNA
tRNA
Phe
Trp
Gly
3'
mRNA
tRNA
CCG
SEBUAH
UGG
UUU
AAA
CC
5'
Gambar 8 n Gambar skematis dari terjemahan yang sedang berlangsung. Itu
asam amino Phe terkait dengan rantai peptida yang sedang tumbuh. Itu
tRNA yang menghasilkan asam amino Trp sebelumnya pergi
kompleks ribosom. Asam amino berikutnya yang akan dihubungkan akan menjadi
Gly, sesuai dengan kode mRNA.
8
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 27
jenis sel. Untuk mencapai ini, mereka cukup menambahkan
DNA asing ke sel mikroba, sel tumbuhan atau hewan
sel. Semua upaya ini gagal. Ada dua alasan
untuk kurangnya kesuksesan ini. Pertama-tama, hanya terbatas
jumlah spesies bakteri dapat mengambil DNA
secara spontan; kebanyakan bakteri dan tentu saja hewan
dan spesies tanaman tidak dapat melakukan ini. Kedua,
DNA asing, jika diambil, pada umumnya tidak
dipertahankan dalam sel reseptor. DNA dibawa ke dalam a
sel dari luar hanya akan dipertahankan jika mampu
mereplikasi secara mandiri, atau jika terintegrasi dalam
genom penerima. Dalam semua kasus lain, DNA asing akan melakukannya
tidak diperbanyak dalam kultur sel dan kemauan
akhirnya menghilang oleh degradasi melalui
aktivitas nuklease seluler.
Modifikasi genetik organisme menjadi fitur
sible nanti ketika teknologi DNA rekombinan
dikembangkan. Ini memungkinkan penggabungan setiap DNA
fragmen molekul DNA yang mampu mempertahankannya-
diri dengan replikasi otonom (molekul tersebut adalah
disebut replika). Berbagai teknik spesifik
dikembangkan untuk memperkenalkan molekul DNA rekombinan
ke dalam segala macam sel biologis menyebabkan berhasil
strategi modifikasi genetik.
Replika digunakan sebagai pembawa untuk DNA asing
fragmen disebut vektor. Vektor dieksploitasi
dalam teknologi DNA termasuk terutama plasmid dari
bakteri atau ragi, atau DNA dari bacteriovirus,
virus hewan atau virus tanaman. Sangat kecil
mikroba plasmid sangat populer sebagai vektor dalam
bioteknologi, karena mereka dapat dengan mudah diisolasi sebagai
molekul beruntai ganda melingkar utuh. Plasmid
dengan kisaran host yang luas, yang disebutkan sebelumnya, sangat
menarik karena mereka dapat digunakan di berbagai host dan
akibatnya memungkinkan aplikasi DNA yang fleksibel
teknologi.
Untuk aplikasi plasmid dalam bioteknologi,
kita harus menggabungkan DNA asing ke plasmid yang terisolasi di
untuk membuat molekul DNA rekombinan. Itu
teknologi untuk ini, yang disebut DNA rekombinan
teknologi atau teknologi kloning DNA, menjadi
layak setelah ditemukannya kelas khusus
nuklease, yang disebut restriksi endonukleas.
Di samping nuklease dapat memecah fosfodiester apa pun
ikatan dalam DNA, nukleasi yang hanya memotong DNA
situs yang sangat spesifik hadir di alam. Ini
Enzim, enzim restriksi, ditemukan
sekitar tahun 1970 dalam mikroorganisme. Fungsi mereka adalah untuk
membedakan antara DNA asing dan DNA diri.
Sel mikroba mungkin dalam kehidupan nyata dihadapkan dengan
DNA dari sel yang tidak berhubungan melalui berbagai genetik
sistem transfer. Meskipun semua DNA dibangun juga,
DNA dapat ditandai secara spesifik di situs tertentu oleh
pola karakteristik dimetilasi atau glukosilasi
nukleotida. Penandaan DNA ini, yang tidak
mengganggu fungsi pengkodean dan replikasi,
khusus untuk host. Enzim restriksi memiliki komentar-
mampu mengenali DNA berdasarkan
tanda host spesifik. Ketika DNA ditransfer dan
tanda tidak cocok dengan sel penerima, misalnya
DNA akan dikenali dan dipotong di lokasi tertentu oleh
enzim restriksi. Begitu DNA dipotong itu akan menjadi
selanjutnya terdegradasi dalam sel. Seperti halnya dalam banyak hal
sistem biologis, segala sesuatu tidak pernah absolut: beberapa
Molekul DNA dapat lolos dari aksi
enzim restriksi dan dengan mendapatkan tanda yang tepat
mereka bisa diselamatkan.
Tindakan pembatasan sangat selektif
Enzim adalah dasar untuk aplikasi mereka di
teknologi DNA rekombinan. Penambahan batasan-
enzim tion ke plasmid tanpa tanda yang tepat
akan mengubah molekul lingkaran tertutup menjadi linier
fragmen, asalkan plasmid pelabuhan mengenali
situs nisi untuk enzim restriksi yang dipilih. Di
Gambar 9 ini digambarkan untuk khusus, tetapi mewakili
kasus tive. Plasmid dengan hanya satu situs pengakuan untuk
G
G
C
T
T
A AG
C
T
T
SEBUAH
AG
SEBUAH
SEBUAH
SEBUAH
T
T
C
SEBUAH
T
T
C
Eco R1
Gambar 9 n Perawatan a
dengan plasmid yang unik
Situs EcoR1. Pembatasan ini
Enzim akan membuka plasma
pertengahan dan membuatnya setuju
untuk manipulasi.
BIOTEKNOLOGI MOLEKULER
9
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 28
enzim restriksi EcoR1 diperlakukan dengan ini
enzim. DNA beruntai ganda kemudian diasimin
dipotong secara dramatis di situs pengakuan, yang mencakup enam
basa yaitu GAATTC, yang mengarah ke DNA linier
dengan ujung pendek untaian tunggal yang khas. Jika asing
DNA — diisolasi dari mikroba, tumbuhan, atau hewan
sel — dengan situs pengenalan untuk enzim EcoR1 adalah
juga dipotong dengan enzim ini, fragmen dengan tunggal
Karakter ujung terdampar untuk EcoR1 dalam vektor
terbentuk. Ketika vektor terbuka dan asing
Fragmen DNA disatukan di bawah persetujuan
kondisi fisikokimia priate, berbagai
ujung yang terdampar dapat bergabung kembali karena adanya
basis pelengkap. Produk reaksi yang mungkin
bisa menjadi plasmid dimana DNA asing spesifik
fragmen, sebagai penumpang, terkait. walaupun
Potongan-potongan DNA dalam konstruksi tersebut saling terkait oleh basis
berpasangan, mereka tidak membentuk molekul melingkar tertutup.
Enzim ligase DNA, ada di semua jenis sel
dan mampu mengkatalisasi pembentukan fosfodiester
obligasi, digunakan untuk membuat rekombinan melingkar tertutup
Molekul DNA. Meskipun fragmen DNA dengan
ujung untaian tunggal komplementer (disebut cohe-
akhir hidup) adalah yang paling menguntungkan untuk menghubungkan,
DNA ligase juga dapat menghubungkan fragmen dengan benda tumpul
berakhir.
Menurut teknologi yang disajikan skema-
pada Gambar 10, molekul DNA rekombinan
terdiri dari vektor dan DNA penumpang dapat
dibuat. Sejumlah besar enzim restriksi dengan
situs pengakuan yang sangat spesifik tersedia untuk memotong DNA
di situs tertentu. Beberapa enzim, seperti EcoR1, mengenali
urutan enam pasangan basa, enzim lain mengenali
hanya empat pangkalan. Beberapa, lagi-lagi seperti EcoR1, memotong DNA
asimetris sementara yang lain membuat ujung tumpul saat
memotong DNA. Dalam Tabel 2 beberapa pembatasan representatif-
Enzim terdaftar.
Molekul DNA rekombinan secara biologis
tidak ada minat selama mereka berada di tabung reaksi.
Namun, transfer konstruk ke sel hidup dapat
mengubah situasi secara drastis. Jika vektor itu
bertugas untuk membangun mampu mereplikasi di tuan rumah,
semua sel anak akan mewarisi salinan yang tepat (klon)
dari molekul DNA rekombinan. Karena itu istilahnya
"Kloning" sering digunakan untuk teknologi
dijelaskan di atas.
Teknik kloning sangat cocok untuk diperoleh
sejumlah besar fragmen DNA spesifik, dengan menggabungkan
sebuah fragmen ke vektor yang sesuai dan
mentransfer konstruk ke host yang dapat dengan mudah
dibudidayakan dengan kepadatan sel yang tinggi. Rekombinan
Molekul DNA, yang kemudian dapat diisolasi dari
massa sel, membentuk sumber berlimpah untuk spesifik
Fragmen DNA. Apalagi dan yang paling penting untuk
bioteknologi farmasi, jika bagian hasil kloning
DNA asing mengandung gen utuh dengan tepat
sinyal untuk ekspresi gen, sel inang yang dimodifikasi
mungkin, berdasarkan karakter universal gen
ekspresi, menghasilkan protein yang disandikan oleh orang asing
DNA. Ini adalah kekuatan DNA rekombinan
Singkatnya teknologi: cara yang efisien untuk memperkuat
Fragmen DNA dan cara untuk mendapatkan segala jenis gen
produk dari host yang dapat dipilih.
Larangan
Enzim
Buka lingkaran
DNA asing
pecahan
DNA rekombinan
tidak ditutup secara kovalen
DNA rekombinan
molekul
Pengenalan
DNA rekombinan
ke dalam sel inang
(transforman)
(E)
(D)
(C)
(B)
(A)
Perbanyakan
transforman
+ Ligase
+
Gambar 10 n Prinsip kloning fragmen DNA asing.
10
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 29
n Transfer DNA
Sebagaimana dinyatakan di atas, transfer DNA rekombinan
molekul ke sel adalah langkah penting dalam DNA
teknologi. Beberapa sel bakteri, seperti sel
spesies Bacillus subtilis yang sering digunakan di Indonesia
bioteknologi industri, mampu mengambil DNA
dalam kondisi fisiologis. Proses ini dirancang
digambarkan sebagai transformasi alami. Umumnya,
Namun, sel mikroba harus dipaksa oleh suatu
rejimen yang tidak biasa untuk mengambil DNA. Misalnya, dalam
kasus mikroorganisme seperti
parit dibuat dengan menerapkan kejutan panas ke
sel inang dengan jumlah Ca2 þ yang tinggi
ion. Teknik alternatif yang digunakan untuk memaksa DNA
serapan adalah elektroporasi. Untuk tujuan itu DNA dan
sel-sel disatukan dalam sebuah kuvet yang kemudian
mengalami pelepasan listrik yang kuat. Dibawah
kondisi buatan yang dipaksa sel amplop
membuka sendiri, setelah itu DNA dapat masuk melalui
"Lubang" yang dibuat. Kekuatan brutal dalam hal ini
teknik membunuh sebagian besar sel, tetapi
sel yang cukup bertahan hidup, di antaranya ada beberapa yang
mengambil DNA. Teknik elektroporasi adalah
banyak digunakan dan sering digunakan.
Selanjutnya untuk transfer langsung DNA rekombinan
molekul seperti itu, setidaknya ada untuk ditransfer ke
sel bakteri kemungkinan untuk mengemas DNA dalam a
bakteriofag kapsid dan kemudian meniru yang normal
prosedur infeksi bakteriofag (Gbr. 11). Transfer
untuk sel-sel bakteri juga dapat dicapai dengan memanfaatkan
konjugasi. Konjugasi adalah proses di mana
Pemindahan DNA terjadi melalui perkawinan sel-sel. Untuk
konjugasi diperlukan kelas khusus plasmid, jadi
disebut plasmid konjugatif. Jika sel dengan seperti itu
plasmid — donor — bertemu sel tanpa itu
plasmid — penerima — mereka bisa membentuk sel bersama
agregat. Dalam apa yang disebut perkawinan agregat
Enzim
Sumber
Urutan pemotongan a
EcoR1
Escherichia coli
G # AATT C
C TTAA "G
Pst1
Providencia stuartii
C TGCA # G
G "ACGT C
Taq1
Thermus aquaticus
T # CG A
A GC "T
Hinf1
Hemophilus influenzae
G # ANT C
C TNA "G
Msp1
Spesies Moraxella
C # CG G
G GC "C
HaeIII
Hemophilus aegyptus
GG # CC
CC "GG
aN, tidak ada preferensi basis.
Catatan: Ruang terbuka di situs pengenalan menunjukkan pemotongan endonukleolitik oleh enzim.
Tabel 2 n Beberapa enzim restriksi, asal usulnya, dan situs pengenalannya.
Capsage fag
menyembunyikan
DNA rekombinan
(A)
(B)
(C)
(D)
Adsorpsi fag menjadi
sel inang bakteri
Injeksi dari
DNA rekombinan
Perbanyakan
sel yang diubah
Gambar 11 n Fag sebagai mediator untuk transfer rekombinan
DNA.
BIOTEKNOLOGI MOLEKULER
11
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 30
plasmid dari donor memiliki kemampuan untuk mentransfer
sendiri, sebagai konsekuensi dari replikasi konjugatif
proses sesuai dengan model lingkaran bergulir, ke
sel penerima. Dengan memanipulasi plasma konjugatif
pertengahan satu dapat membuat donor menyimpan rekombinan
Molekul DNA yang kemudian bisa agak efisien
ditransfer melalui kontak sel.
Jika virus hewan atau virus tanaman digunakan sebagai
vektor untuk teknologi DNA rekombinan, orang mungkin
mengeksploitasi proses infeksi virus alami untuk ditransfer
DNA menjadi binatang atau sel tumbuhan (lihat Bab 8). Seperti
kasus di mikroorganisme, transfer DNA ke hewan
Sel-sel bisa dipaksa oleh perawatan dengan jumlah tinggi
ion Ca 2 atau dengan perlakuan kimia lainnya. Berikutnya
untuk itu, dimungkinkan untuk menyuntikkan DNA dengan jarum suntik ke dalamnya
inti sel. Teknik terakhir (satu bisa
berbicara tentang semacam bedah mikro) layak karena
dimensi relatif besar dari sel hewan
dikupas menjadi bakteri dan juga diterapkan pada sel-sel tanaman. Itu
teknik diilustrasikan pada Gambar 12. Sel adalah
membawa ujung tabung gelas tipis dan diperbaiki
ke tabung dengan penyedotan di ujung tabung yang lain. Oleh
sarana mikromipulator sebuah jarum suntik kecil diisi
dengan DNA diarahkan ke inti sel tetap
dan kemudian DNA disuntikkan ke dalam nukleus.
Cara yang sangat sukses untuk mentransfer DNA
sistem pembangkit didasarkan pada jenis konjugasi khusus
tion. Bakteri tanah, Agrobacterium tumefaciens,
pelabuhan plasmid konjugatif yang disebut Ti (akronim untuk
penginduksi tumor). Jika bakteri seperti itu menginfeksi terluka
jaringan tanaman tertentu, bagian dari Ti-plasmid
dipindahkan ke sel tanaman dalam bentuk konjugasi
proses. Transfer ini diikuti oleh integrasi
DNA yang ditransfer ke dalam genom tanaman. Itu
sel tanaman yang terinfeksi kehilangan kontrol pertumbuhan normal dan
mengembangkan tumor (penyakit tanaman yang disebut mahkota empedu).
Dengan memanipulasi Ti-plasmid, sedemikian rupa sehingga tumornya
sifat-sifat penginduksi hilang dan fragmen DNA asing
Jika dikaitkan dengan itu, DNA apa pun dapat ditransfer
cara yang nyaman dari Agrobacterium yang dimodifikasi
donor ke sel tanaman. Gambar 13 menggambarkan hal ini
proses luar biasa, di mana, pada kenyataannya, raja biologis
hambatan dom dilintasi secara alami.
Karena dinding sel tanaman adalah penghalang utama
untuk pengambilan DNA, seseorang telah mengeksploitasi protoplas dari
sel-sel tanaman (yaitu, sel-sel tanaman yang kekurangan dinding) untuk diperkenalkan
DNA. Protoplas dapat mengambil DNA dengan mudah. ini
layak untuk regenerasi dari rekayasa genetika
protoplas sel tanaman utuh. Akhirnya, sangat tiruan
metode untuk memperkenalkan DNA dalam jaringan tanaman telah
dikembangkan. Mikroproyek yang tertutup oleh DNA adalah
ditembak dengan pistol ke dalam sel tumbuhan. Padahal, banyak tanaman
spesies yang tidak mudah dimodifikasi secara genetis
dengan salah satu metode yang disebutkan di atas dapat
dimodifikasi menggunakan metode senjata yang agak aneh ini.
Berbagai teknik yang digunakan untuk mentransfer
DNA umumnya tidak terlalu efisien dan dapat menyebabkan,
seperti yang dinyatakan sebelumnya, pembunuhan sel secara luas. Bahkan,
nasib DNA yang ditransfer tidak selalu
bisa ditebak. Misalnya, dalam beberapa kasus
DNA yang dikurangi tunduk pada istirahat yang dimediasi nuclease
turun, sedangkan pada sel hewan atau tumbuhan diperkenalkan
DNA tidak selalu mencapai inti, juga tidak
selalu terintegrasi dengan cara yang tepat. Semua metode untuk
Mentransfer hasil DNA, secara umum, hanya beberapa sel saja
sangat penting dan stabil. Karena itu, teknik seleksi
sangat diinginkan untuk menemukan sel-sel langka ini. Paling
teknik seleksi menggunakan marker pada vektor itu
kode untuk properti selektif. Marker untuk kode mana
resistensi terhadap zat antibiotik tertentu
sering digunakan. Jika sel yang harus dimodifikasi adalah
sensitif terhadap antibiotik itu, sedikit yang dimodifikasi
sel dari percobaan transfer dapat dengan mudah dipilih oleh
membawa sampel sel yang dirawat (baik mikroba
sel, sel tumbuhan atau sel hewan) dalam suatu media
mengandung antibiotik yang relevan. Hanya sel-sel itu saja
mengambil DNA dan mempertahankan DNA itu di dalamnya
keturunan akan berkembang biak, semua sel lainnya terbunuh atau, pada
Setidaknya, jangan tumbuh. Metode pemilihan alternatif
menggunakan sel penerima dengan defisiensi pertumbuhan spesifik
Pro-nuklei
Sel yang dibuahi
Pipet hisap
Pipet injeksi, mengandung-
antara 50 dan
200 salinan gen
Gambar 12 n Injeksi DNA asing ke dalam sel yang dibuahi.
Ti-plasmid
Agrobacterium
tumefaciens
Sel tanaman
Inti
Gambar 13 n Modifikasi sel tumbuhan oleh Ti-plasmid. Bagian dari
Ti-plasmid (bertanda) ditransfer ke sel tanaman dan mungkin
terintegrasi secara stabil dalam DNA tanaman.
12
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 31
dan vektor yang membawa gen yang mengatasi hal tersebut
kekurangan.
n Sumber DNA
Seperti yang dinyatakan sebelumnya, DNA apa pun dapat digunakan untuk membangun
molekul DNA rekombinan. Dalam produksi protein
berdasarkan teknologi DNA rekombinan sangat berbeda
diperlukan potongan-potongan DNA. Mengacu pada
metafora yang dijelaskan sebelumnya dalam bab ini, hanya a
beberapa baris pada halaman tertentu di salah satu dari banyak buku
diperlukan. Isolasi potongan DNA tertentu
langsung dari DNA sel bakteri dan,
tentu saja, tanaman atau sel hewan menyiratkan sangat
pencarian yang membosankan. Dapatkah seseorang menemukan fragmen DNA
tertarik dengan cara yang lebih nyaman? Ada beberapa
strategi.
DNA sintetis
Layak untuk menggunakan DNA sintetis sebagai sumber untuk
urutan DNA rekombinan yang diinginkan. Jika seseorang mencari
DNA yang mengkode protein tertentu, asam amino
urutan protein itu terkadang diketahui. Dengan
kode genetik sebagai panduan yang dapat disintesis
mengkode DNA dengan sintesis organik dan menggunakan DNA itu
(Disebut oligonukleotida) untuk membangun yang sesuai
molekul DNA rekombinan. Meskipun tekniknya
untuk mengurai komposisi asam amino dari protein dan
kemungkinan sintesis DNA organik miliki
meningkat selama beberapa tahun terakhir, DNA organik
pendekatan sintesis hanya layak untuk mengkloning gen
mengkode protein kecil. Misalnya, sintetis
pendekatan telah berhasil digunakan untuk skala besar
produksi insulin manusia, seperti yang akan dijelaskan
kemudian.
Pendekatan DNA sintetis memungkinkan pilihan,
setiap kali ada lebih banyak kembar tiga yang tersedia untuk a
asam amino tertentu, dari triplet yang paling banyak digunakan
sering di host yang dipilih untuk
produksi. Dengan kata lain teknik ini memungkinkan
satu untuk menguasai masalah penggunaan kodon, disebutkan
sebelumnya dalam bab ini.
cDNA
Alternatif untuk isolasi langsung DNA seluler
pengkodean untuk protein tertentu adalah salinan DNA (cDNA)
pendekatan. Perkembangan penting ini dalam DNA
Teknologi menjadi jelas ketika enzim
reverse transcriptase dieksploitasi sebagai alat.
Gen tidak selalu diekspresikan dalam sel, juga tidak
apakah mereka diekspresikan di mana-mana dalam organisme. Beberapa
gen hanya diekspresikan dalam tahap sel tertentu
pertumbuhan, atau di bawah kondisi lingkungan yang sangat spesifik
atau hanya diekspresikan dalam jaringan yang sangat spesifik
organisme. Molekul mRNA dalam sel demikian
mewakili sebagian kecil dari semua gen yang tersedia, yaitu
mereka yang sebenarnya diungkapkan. Pengetahuan tentang
fisiologi sel atau pengetahuan biologi spesifik
tugas jaringan hewan dan tumbuhan, memungkinkan isolasi
dari set mRNA tertentu dan karakteristik
molekul. Konversi molekul mRNA ini oleh
enzim membalikkan transcriptase menjadi DNA
sintesis gen yang diekspresikan. Ini
Molekul DNA, yang disebut molekul cDNA, untuk membedakan
guish mereka dari molekul DNA alami, bisa jadi
digunakan untuk kloning gen. Asalkan pencarian dimulai
dengan kondisi kultur sel yang tepat atau dengan
jaringan yang tepat strategi cDNA bisa sangat
efisien. Diilustrasikan pada Gambar 14.
Kloning cDNA memiliki beberapa konsekuensi yang jelas.
Berbeda dengan gen yang langsung diisolasi dari
kromosom, cDNA tidak memiliki daerah promotor.
Selanjutnya, dalam kasus gen yang menyimpan ekson
dan intron, cDNA dibangun hanya dari ekson. Kurangnya
promotor otentik mensyaratkan bahwa dalam kloning
strategi seorang promotor harus menyatu dengan cDNA di
untuk mencapai ekspresi gen. Sebagian besar kuat
promotor yang dapat dinyalakan dan dimatikan, tergantung
pada kondisi lingkungan atau jaringan, menyatu
cDNA.
Kontrol atas ekspresi gen asing dengan menggunakan a
promotor yang cocok sangat penting sebagai protein asing
dapat mengganggu fisiologi sel inang dan penyebabnya
penghentian perkembangan sel secara prematur. Oleh karena itu, a
promotor seperti promotor lac terkenal dari
karya pelopor molekuler dengan Escherichia coli adalah
sering digunakan dalam sel bakteri untuk mengarahkan
sintesis protein asing. Promotor ini hanya
dinyalakan ketika induser yang tepat seperti iso-
propyl-b-thiogalactoside (IPTG) ditambahkan ke
mRNA
Membalik transkriptase
Sintesis DNA dengan
mRNA sebagai matriks
Hibrida RNA-DNA
Pengobatan alkali (kerusakan RNA)
DNA polimerase
cDNA
Gambar 14 n Sintesis cDNA.
BIOTEKNOLOGI MOLEKULER
13
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 32
medium. Kultivasi sel tanpa adanya
induser memungkinkan pertumbuhan sel yang optimal sejak memungkinkan
produk gen asing yang merusak tidak diproduksi.
Ketika jumlah sel tinggi hadir dalam kultur,
induser ditambahkan dan akibatnya gen asing
produk diproduksi. Kemungkinan efek negatif dari
protein asing pada sel minimal
konsekuensi karena jumlah sel yang tinggi, sering dekat
hasil maksimum, hadir saat berbahaya
produksi dimulai.
Pada hewan atau tanaman, gen asing seharusnya
sebaiknya hanya diekspresikan dalam jaringan tertentu untuk disimpan
hewan atau tumbuhan vital atau untuk dapat mengisolasi
protein secara efisien. Dalam aplikasi bioteknologi itu
di mana mamalia seperti domba, kambing atau sapi berada
digunakan sebagai inang untuk produk farmasi (aplikasi-
roach disebut "pertanian farmasi"), mam-
mary gland sering digunakan sebagai jaringan ekspresi.
Oleh karena itu cDNA untuk protein produk digabungkan menjadi a
promotor yang hanya diekspresikan dalam jaringan itu.
Mentransfer konstruksi DNA semacam itu ke dalam embrio
hewan inang dapat menyebabkan rekayasa genetika
hewan yang secara eksklusif mengirimkan obat-obatan
produk sebagai bagian dari susu mereka. Rute produksi ini
memungkinkan isolasi yang efisien dan memungkinkan relatif
strategi pemurnian sederhana (lihat Bab 7).
Kurangnya intron dalam cDNA memiliki
Keuntungan bahwa cDNA dapat menyebabkan gen fungsional
produk bahkan dalam organisme di mana splicing tidak
terjadi (seperti dalam sel prokariotik) atau di mana penyambungan terjadi
ambigu atau tidak dapat diandalkan.
Perpustakaan DNA
Pendekatan mRNA tidak layak jika pengetahuan yang tepat
ujung ekspresi gen kurang dan tidak memungkinkan
kloning DNA yang tidak diungkapkan. Seorang jenderal
untuk menguasai molekul DNA yang sangat kompleks
Teknologi DNA rekombinan adalah membuat DNA
Perpustakaan. Untuk melakukannya, fragmen DNA acak dari a
bakteri, sel tumbuhan atau hewan disatukan ke vektor dan
kemudian ditransfer ke host yang sesuai. Dengan mengisolasi
dari sel bakteri, misalnya, potongan DNA itu
jumlah rata-rata 1% dari total DNA dan menghubungkannya
fragmen secara individual ke vektor, orang dapat membuat
bersama beberapa ratus DNA rekombinan yang berbeda
molekul yang mewakili kromo bakteri total
beberapa. Menggunakan metafora "buku DNA" lagi: the
"buku DNA" bakteri asli dengan sekitar 1000 halaman
dibagi dalam sekitar 150 buku kecil misalkan 10
halaman masing-masing. Buklet ini memberi tahu, dengan beberapa tumpang tindih
dan tanpa pemesanan apriori, cerita yang sama dengan
diceritakan dalam buku lengkap. Keuntungan langsung
dari pendekatan ini adalah bahwa molekul besar terbelah
potongan-potongan kecil yang cocok dihubungkan ke sebuah replika.
Inang individu dengan rekombinan spesifik
Molekul DNA dengan demikian menyimpan fragmen total
DNA pada vektor replikasi. Dengan memilih dari
pustaka sel yang membawa gen atau DNA yang menarik, satu
dapat memperoleh molekul yang lebih kecil dengan sedikit lebih banyak
dari DNA yang menarik dengan memotong fragmen
diisolasi dari sel-sel ini. Dengan kloning selanjutnya seperti itu
fragmen yang lebih kecil dapat mencapai tujuan akhir: a
molekul DNA rekombinan dengan bagian yang sangat berbeda
DNA asing. Penting untuk disebutkan dalam hal ini
menghormati bahwa pustaka DNA tersedia dari banyak
organisme Demikian juga perpustakaan cDNA ada dari banyak
jaringan seperti otak manusia. Dengan analisis
berbagai fragmen, wawasan ke dalam struktur genetik
semua jenis organisme berkembang pesat. Dalam hal ini
terungkapnya genom manusia yang diungkapkan pada
dunia pada tahun 2000 layak disebut.
n Produksi oleh Teknologi DNA Rekombinan
Hanya dua dari banyak contoh yang tersedia
produksi biofarmasi oleh rekombinan
Teknologi DNA akan diperlakukan di sini: produksi
insulin manusia dan produksi manusia
hormon pertumbuhan (hGH). Aspek farmasi
dari kedua protein dibahas secara lebih rinci di
Bab 12 dan 13, masing-masing.
Produksi insulin manusia dalam skala besar
menggambarkan pendekatan DNA sintetis dengan baik.
Apalagi contoh ini menunjukkan dengan jelas bahwa selain itu
pengetahuan tentang gen pengkodean, pengetahuan terperinci dari
protein yang akan diproduksi diperlukan.
Gen struktural untuk insulin manusia adalah 1430
nukleotida panjang, sedangkan gen diintervensi oleh
urutan intron dari 179 dan 786 nukleotida. Itu
protein yang dikodekan oleh gen adalah 110 asam amino dalam
panjangnya. Namun, protein dewasa meliputi a
Sebanyak 51 asam amino. Terdiri dari dua terpisah
rantai: rantai A dari 21 asam amino dan rantai B dari
30 asam amino. Rantai A dan B disatukan oleh
Ikatan antara asam amino sistein pada
rantai yang berdekatan. Protein insulin manusia adalah
Ently diproses secara ekstensif setelah terjemahan.
Memproses hasil dalam dua langkah. Yang utama
produk, yang disebut preproinsulin, adalah 110 asam amino
sesuai dengan prediksi dari DNA
urutan. Selama translokasi membran
protein bagian "pra" dari protein, hamparan 24
asam amino berfungsi sebagai urutan pemimpin untuk
translokasi membran, dibelah. Yang tersisa
protein, 86 asam amino, disebut proinsulin. Ini
protein diproses lebih lanjut dalam sel pankreas, sementara
sebuah fragmen internal (disebut C atau menghubungkan
rantai) dari 33 asam amino bersama dengan beberapa macam
asam amino dihilangkan secara enzimatis. A dan B
rantai yang tersisa dihubungkan melalui ikatan S dan
membentuk insulin yang matang dan aktif secara biologis.
Strategi untuk kloning gen menurut
pengetahuan rinci tentang protein matang, adalah untuk
14
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 33
mengkloning dan memproduksi rantai A dan B secara terpisah. Itu
informasi untuk fragmen A dikumpulkan oleh
menghubungkan satu set oligonukleotida yang tepat. Ini
DNA kemudian dengan ligasi dipadukan ke ujung gen
LacZ, dikendalikan oleh promotor Lac, di plasmid
pBR322, vektor kloning E. coli yang sangat terkenal. Di
titik fusi antara lacZ dan informasi untuk
rantai A kodon untuk asam amino metionin adalah
built in, untuk alasan yang akan dijelaskan nanti.
Informasi untuk fragmen B adalah (untuk strategis
alasan) disintesis dalam dua langkah. Pertama,
Bagian pengkodean N-terminal disintesis dengan menghubungkan
oligonukleotida. Fragmen ini menyatu dengan
plasmid pBR322 dan diperbanyak dalam E. coli.
Kedua, bagian pengkodean terminal-C disintesis
dan juga diperbanyak setelah mengikatnya ke pBR322. Itu
dua fragmen DNA kemudian diisolasi dari
molekul DNA rekombinan masing-masing. Kedua bagian
dihubungkan bersama dan menyatu pada akhir lACZ
gen dalam pBR322 plasmid. Lagi-lagi kodon untuk
asam amino metionin dibangun di dalam fusi
titik.
Menghubungkan informasi untuk A dan B ke
Gen lacZ, bagian dari laktosa-operon yang terkenal, memiliki
dua keunggulan. Pertama-tama, kedua fragmen itu bergantung
untuk ekspresi mereka pada rejimen lac-
promotor dan gen lacZ, yang memungkinkan yang efektif
dan ekspresi terkontrol. Kedua, peptida
A dan B disintesis sebagai produk yang menyatu
b-galactosidase. Karena peptida asing sangat kecil
dalam sel bakteri sangat rentan terhadap proteolitik
pemecahan, strategi fusi adalah cara yang efektif untuk
mencegah kerusakan. Pengobatan fusi terisolasi
protein dengan agen cyanogen bromide memungkinkan
isolasi fragmen A dan B. Agen ini memiliki
kemampuan untuk membelah peptida setiap kali asam amino
metionin hadir dan membelah segera setelah
asam amino ini. Karena tidak ada fragmen A atau B dari
insulin mengandung metionin dan strategi kloning
dijamin kehadiran metionin pada fusi
titik, isolasi peptida A dan B seperti itu
relatif sederhana. Langkah terakhir terdiri dari pencampuran
A dan B dan memungkinkan ikatan S untuk membentuk spontan
dengan baik. Gambar 15 menyajikan prosedur insulin
produksi dengan bantuan DNA sintetis.
Strategi untuk mengkloning dan memproduksi pertunjukan hGH
beberapa fitur menarik lainnya. Pertama-tama, itu
produksi dimulai dengan membuat cDNA dari
kumpulan mRNA berasal dari hipofisis manusia, yaitu
jaringan tempat hormon peptida ini disintesis. Itu
Pengkodean molekul cDNA untuk hGH diisolasi dan,
karena mengandung informasi 24 asam amino itu
harus menjamin transportasi dalam sel manusia, itu
dikurangi dengan enzim restriksi yang sesuai.
Namun, dalam prosedur ini informasi pengkodean
untuk beberapa asam amino esensial untuk aktivitas
hormon dewasa hilang. Bagian yang hilang dari
informasi hilang dari molekul cDNA asli
secara kimia disintesis dan menyatu dengan fragmen
mentasikan molekul cDNA untuk mendapatkan yang penuh
informasi untuk hGH yang matang. Selanjutnya, konstruknya
dikaitkan dengan vektor bakteri sedemikian rupa
dipadukan dengan promotor yang kuat. Dalam beberapa konstruksi
pengkodean informasi untuk urutan pemimpin bakteri
dikaitkan dengan gen hGH. Kemudian, urutan pengkodean
untuk peptida pemimpin bakteri (urutan N-terminal
sekitar 20 asam amino) ditambahkan untuk menginduksi
translokasi protein di atas sitoplasma
selaput. Urutan translokasi tambahan ini
memiliki sifat fisikokimia yang agak spesifik. Itu
sinyal peptida pemimpin memungkinkan protein untuk melintas
penghalang membran sitoplasma di mana
peptida pemimpin terputus. Alasan melampirkan
sinyal tambahan dalam hal ini adalah sinyal tertentu
Promotor Lac
LacZ
pBR322
pBR322
E. coli
E. coli
Penanaman
Penanaman
Isolasi produk
Isolasi produk
-gal
Bertemu
Bertemu
Sianogen bromida
Pemurnian
Insulin
SEBUAH
SEBUAH
B
B
B
SEBUAH
SEBUAH
B
Gene
Gene
Gambar 15 n Sintesis insulin oleh DNA sintetis.
BIOTEKNOLOGI MOLEKULER
15
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 34
strategi produksi seseorang ingin mendapatkan produk
yang dilepaskan dari sitoplasma untuk dapat
pilih strategi pemurnian yang nyaman setelahnya. Jika
gen hGH terkait dengan pemimpin yang tepat
peptida dan diekspresikan dalam inang E. coli, hGH
molekul akan muncul di ruang antara IM
dan OM, yang disebut ruang periplasmik. ini
mungkin untuk merusak OM sedemikian rupa sehingga
isi periplasma dibebaskan. Kemudian,
HGH lebih mudah dan lebih murah daripada
pemurnian hGH sebagai produk dalam sitoplasma
E. coli. Strategi kloning yang menjamin membran
translokasi sering dipilih untuk
melepaskan protein dari sitoplasma.
TEKNIK DNA KHUSUS
n Urutan DNA
Pengembangan teknologi untuk nukleo- rinci
Penentuan urutan pasang surut molekul DNA miliki
telah menjadi sangat penting. Pengetahuan ini terbuka
cara untuk modifikasi DNA yang sangat tepat, seperti
mengubah nukleotida individu untuk mengubah suatu
asam amino individu dalam protein (lihat Bab 7).
Pada 1977 dua metode berbeda diterbitkan
untuk sekuensing DNA. Metode Maxam dan Gilbert
didasarkan pada degradasi kimia DNA, sedangkan
metode Sanger, juga disebut pemutusan rantai
metode, menggunakan enzim replikasi DNA. Itu
Metode Sanger adalah metode yang paling populer dan sedang
dijelaskan di sini. Ini menggunakan enzim DNA polimerase
biasanya terlibat dalam replikasi DNA. DNA poli-
merases bergantung pada templat, artinya mereka
membutuhkan molekul DNA beruntai tunggal yang mereka inginkan
salin sesuai dengan aturan pairing AT dan GC,
dan tergantung primer, artinya mereka membutuhkan a
gratis 3
0
- gugus hidroksil dari oligonukleotida sebagai
titik awal untuk penggabungan deoxyribonu-
trifosfat cleotide (dATP, dCTP, dTTP, dan
dGTP). Primer adalah pendek, disintesis secara kimia
molekul, sekitar 20 panjang nukleotida yang
komplementer dan antiparalel dengan segmen di
molekul DNA beruntai tunggal untuk diurutkan.
Di bawah kondisi yang tepat ia akan berhibridisasi dan karenanya
memberikan titik awal spesifik untuk perpanjangan
reaksi oleh polimerase.
Metode ini pada dasarnya tergantung pada inklusi
dalam campuran reaksi yang disebut dideoxyribonu-
cleotide trifosfat (ddNTP). Molekul-molekul ini tidak
hanya kekurangan 2
0
gugus hidroksil pada ribosa sebagaimana adanya
normal dalam DNA, tetapi juga 3
0
gugus hidroksil; karenanya
nama di-deoxy. Ini ddNTP dapat dimasukkan
menjadi untaian DNA oleh DNA polimerase. Namun,
karena kurang 3
0
Kelompok hidroksil diperlukan untuk
Perpanjangan DNA, molekul DNA yang dimiliki
memasukkan ddNTP seperti itu tidak lagi menjadi substrat untuk
perpanjangan rantai lebih lanjut: rantai berakhir dengan a
ddNTP dan prinsip ini digunakan untuk pengurutan
reaksi. Per reaksi empat tabung diatur yang
mengandung template, primer dan empat dNTP. Ke
empat tabung ddNTP ditambahkan. Untuk ddATP tabung pertama adalah
ditambahkan, ke ddTTP tabung kedua, ke tabung ketiga
ddCTP dan ke ddCTP tabung keempat. Rasio
dNTP versus ddNTP di setiap tabung dipilih sedemikian rupa
cara sejumlah kecil template di setiap tabung akan
menggabungkan ddNTP spesifik dan tidak akan lagi
substrat untuk perpanjangan (pemutusan rantai).
Oleh karena itu di setiap tabung sebagian kecil dari untaian akan
akhiri dengan ddNTP khusus yang ada di sana
tabung tertentu. Panjang helai yang diakhiri adalah
ditentukan oleh primer oligonukleotida, yang menetapkan a
titik awal tetap, dan ddNTP dimasukkan. Di
tabung reaksi pertama, misalnya, panjang fragmen
ditentukan oleh posisi berbagai
Nukleotida dalam template. Setelah sintesis
Reaksi isi dari empat urutan individu
tabung diterapkan pada poliakrilamida resolusi tinggi
sistem elektroforesis gel yang memisahkan individu
produk perpanjangan berdasarkan panjangnya. Tube 1
mengungkapkan posisi A, tabung 2 dari C, tabung 3 dari T dan
tabung 4 dari G. Produk-produk reaksi dapat divisualisasikan
baik dengan autoradiografi dalam kasus alikuot kecil
dNTP berlabel radioaktif telah tergabung dalam
semua reaksi (biasanya alpha- 32 P-dCTP) atau dengan fluoro-
grafik jika kelompok fluorescent telah secara kimia
ditambahkan ke primer sekuensing selama sintesisnya.
Metode yang terakhir ini sangat cocok untuk
otomatisasi. Saat ini mesin sequencing sudah terintegrasi.
tersedia secara gratis yang, dalam satu kali proses, dapat diurutkan
lebih dari 800 nukleotida. Dalam mesin seperti 20 hingga 40 berjalan
dapat dimuat dan dianalisis secara bersamaan
sangat meningkatkan produktivitas. Tak perlu dikatakan,
urutan ditangani, dianalisis dan disimpan elektro
secara alami. Tiga data urutan komputer yang saling terkait-
pangkalan beroperasi di dunia, yang bebas
dapat diakses melalui Internet.
n Urutan Genom
Dalam beberapa tahun terakhir seluruh genom berbagai organisme
telah diurutkan dan diurutkan dari semua jenis
organisme sedang terjadi di seluruh dunia. Proyek semacam itu
dimulai dengan mengurutkan genom mikroorganisme
isme, berbagai prokariota serta eukariota, tetapi
diperluas ke organisme yang lebih tinggi seperti nematoda
Caenorhabditis elegans, serangga Drosophila melanogaster,
tanaman Arabidopsis thaliana dan akhirnya, dianggap sebagai
pencapaian paling menonjol dalam hal ini, the
genom manusia, Homo sapiens.
Pengetahuan rinci tentang struktur genom
("Genomik") memiliki dampak besar pada bioteknologi, bukan
paling tidak pada bioteknologi farmasi.
Namun, mengetahui urutan genom hanya a
16
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 35
mulai. Tapi, itu memungkinkan peneliti untuk melakukan pendekatan secara langsung
aspek fungsional cara genom: kapan dan bagaimana
gen diekspresikan, dengan cara apa gen bekerja sama
selama ekspresi mereka yang memungkinkan kita untuk memahami
berdiri jaringan gen, dll. Genetika integratif
Pendekatan ini umumnya disebut "genom fungsional."
Genomik fungsional bersama dengan detail
studi tentang protein yang diproduksi sel (disebut
"Proteomics") akan memberikan bioteknologi farmasi
pandangan baru.
Sebagai contoh, masa depan baru untuk farmasi
bioteknologi dapat diilustrasikan oleh
ment antibiotik baru. Antibiotik klasik adalah
diisolasi dari alam sebagai metabolit sekunder
disebabkan oleh berbagai mikroorganisme. Antibiotik mereka
sifat didasarkan pada gangguan dengan vital
proses dalam mikroorganisme patogen. Nomor
molekul target dalam sel bakteri yang
dipengaruhi oleh antibiotik klasik yang agak terbatas
(Catat arti berbeda dari "target" dalam konteks ini
dibandingkan dengan "penargetan narkoba" yang dibahas dalam Bab
4.) Misalnya, Mycobacterium tuberculosis menyebabkan
TBC, suatu penyakit dengan dampak yang besar pada
dunia. Pengetahuan rinci tentang struktur genom
Bakteri patogen mungkin mengungkapkan semua jenis spesifik
molekul target vital dalam patogen ini. Terperinci
pengetahuan tentang molekul target baru akan memungkinkan
ilmuwan farmasi untuk mensintesis senyawa kimia
pound yang mengganggu (produk) vital
gen target. Masalah prevalensi
mikroorganisme patogen yang resisten terhadap klasik
antibiotik pada prinsipnya sekarang terbuka untuk suatu solusi
dengan mensintesis bahan kimia target-diarahkan baru
senyawa.
Selain itu, pengetahuan genom manusia adalah
dasar untuk pengakuan semua jenis
morfisme yang membedakan masing-masing orang. Dalam
waktu dekat, wawasan dalam gen individu dari a
pasien membuka jalan untuk terapi yang lebih efektif
pada karakteristik dan kebutuhan individu pasien.
Bidang ini muncul dalam ilmu farmasi
dengan implikasi langsung bagi praktisi disebut
"Farmakogenetika."
Industri farmasi sangat tertarik
dalam kemungkinan yang timbul dari genom yang lebih rinci
pengetahuan dan berinvestasi dalam genomik fungsional,
proteomik dan farmakogenetik. Dalam Bab 7 the
latar belakang teknologi dan implikasi fungsi
genomik nasional, proteomik, dan farmakogenetika
akan dibahas lebih detail.
n Hibridisasi DNA
Untuk mendapatkan wawasan dalam komposisi DNA, sekuensing
adalah pendekatan terakhir. Namun, ada kemungkinan
untuk memperoleh informasi tentang struktur DNA oleh
hibridisasi dengan bantuan yang disebut probe DNA.
Intinya, probe adalah DNA untai tunggal spesifik
pecahan. Probe seperti itu akan membentuk untai ganda
DNA (dengan kata lain akan berhibridisasi) kapan pun itu
menemukan sepotong pelengkap untai tunggal
DNA dalam kondisi yang sesuai. Ada banyak
aplikasi untuk probe DNA.
Misalnya, jika seseorang ingin melihat yang mana
molekul DNA rekombinan dalam DNA yang luas
perpustakaan menyimpan gen yang diinginkan, orang dapat menggunakan a
Probe DNA. DNA dari perpustakaan dikonversi menjadi
DNA beruntai tunggal dan kemudian dihadapkan dengan a
Probe yang mencerminkan segmen karakteristik yang sangat
gen yang diinginkan. Hibridisasi akan, asalkan
Probe memiliki spesifisitas yang diperlukan, hanya terjadi dengan
target molekul DNA yang menyimpan gen yang diinginkan.
Penggunaan probe hibridisasi DNA dalam mendiagnosis
pengujian nostik pada manusia dapat diilustrasikan dengan menggunakan
cystic fibrosis (CF) sebagai contoh. Frekuensi ini
penyakit yang diwariskan dan mematikan sekitar satu kali dalam
2.000 kelahiran hidup membuatnya menjadi genetik yang paling sering
gangguan di antara bule. Kloning gen di
1989 berdasarkan posisinya di peta genetik manusia
adalah tour de force yang melibatkan beberapa laboratorium. Saya t
memungkinkan analisis molekuler dari cacat genetik,
mengungkapkan bahwa sekitar 70% dari yang sakit
gen mengandung mutasi yang identik: pasangan tiga basa
penghapusan gen pengkode protein yang menyebabkan hilangnya
dari asam amino fenilalanin pada posisi 508 dari
1480 protein asam amino panjang. Mutasi ini adalah
bernama CFdel 508 dan pengetahuan yang diperoleh digunakan
untuk merancang probe oligonukleotida untuk skrining cepat
tujuan.
Probe DNA untai tunggal ini lengkap
ke wilayah normal dan CFdel 508 dari
Gen CF ditunjukkan di bawah ini. Simbol L, E, dll.
mewakili berbagai asam amino (lihat Bab 2);
F, misalnya, singkatan dari phenylalanine.
Normal:
L.
E
N
saya
saya
F
G
V
5
0
-AAA GAA AAT ATC ATC TTT GGT GTT-3
0
Mutant (CFdel508):
L.
E
N
saya
saya
G
V
5
0
-AAA GAA AAT ATC AT --- T GGT GTT-3
0
DNA, terisolasi, misalnya, dari sel darah putih
diduga pembawa atau cairan amnion tempat embrio
ditangguhkan, direbus untuk membuatnya terdampar tunggal
dan kemudian diimobilisasi pada kertas saring. Selanjutnya,
zasi dengan probe spesifik normal dan CFdel 508
mengklarifikasi apakah seseorang memiliki penyakit tersebut, dalam hal ini
baik gen ibu dan ayah terpengaruh,
atau apakah salah satu adalah pembawa penyakit di mana satu
dari dua gen terpengaruh (heterozigot) dan
yang lain normal pada posisi genomik ini.
BIOTEKNOLOGI MOLEKULER
17
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.
Halaman 36
Variasi pada teknologi ini memungkinkan untuk
skrining otomatis dan simultan bagi banyak orang
penyakit genetik yang merupakan lesi molekuler
dikenal. Kit yang berisi semua reagen yang diperlukan
untuk tes tertentu tersedia secara komersial.
n Teknologi PCR
Untuk deteksi DNA atau untuk menguji keberadaan
mutasi pada DNA metode penyelidikan yang dijelaskan di atas
sangat kuat. Dalam teknik penyelidikan saat ini,
Namun, sejumlah besar DNA diperlukan untuk itu
memungkinkan deteksi DNA target. PCR (polimer
ase chain reaction) teknologi menjadi sangat populer di Indonesia
beberapa tahun terakhir untuk mendapatkan DNA dalam jumlah besar.
Dalam teknologi PCR target DNA diperkuat
oleh sintesis DNA in vitro, terjadi di sejumlah
langkah berulang cepat. Reaksi dimulai dengan
konversi target DNA untai ganda
DNA beruntai tunggal dan menggunakan oligonukleo spesifik
pasang sebagai primer untuk memungkinkan DNA polimerase untuk melakukan itu
pekerjaan. Pilihan primer oligonukleotida,
hibridisasi dengan masing-masing dari kedua helai target, akan
tentukan batas kiri dan kanan DNA menjadi
diperkuat.
Setiap siklus PCR (diilustrasikan pada Gambar. 16) terdiri dari
tiga langkah masing-masing hanya membutuhkan 1 hingga 3 menit. Dalam
langkah pertama target DNA harus dibuat tunggal
terdampar dan ini dilakukan dengan memanaskan sampel ke
92 ° C. Langkah kedua melibatkan hibridisasi spesifik.
tion dari dua primer ke single- pelengkap
DNA terdampar. Suhu optimal untuk ini
Prosesnya sekitar 55 ° C. Pada langkah ketiga DNA
polimerase akan memperpanjang urutan primer menggunakan
DNA untai tunggal sebagai templat. Yang optimal
suhu ekstensi sekitar 72 ° C sejak DNA
Polimerase yang dipilih berasal dari termofilik
bakteri, Thermus aquaticus, yang biasanya tumbuh
di sumber air panas pada suhu di atas 80 ° C. DNA ini
polimerase sangat tahan terhadap panas
turing dan selamat dari langkah denaturasi DNA 92 ° C.
Semua reagen (DNA target, primer, dNTPs dan
polimerase) dimasukkan ke dalam tabung yang disegel dan
biasanya 20 hingga 30 siklus PCR dilakukan. Itu
prosedur dapat diotomatisasi dan mesin PCR
tersedia yang mengontrol suhu untuk masing-masing
tiga langkah terpisah dari siklus PCR. Mesin seperti itu
dapat memproses ratusan tabung secara bersamaan dan
membuahkan hasil dalam waktu 2 hingga 4 jam.
Idealnya setiap siklus replikasi DNA berlipat ganda
jumlah DNA yang terletak di antara
primer terpilih. Tiga puluh siklus PCR akan memberikan
amplifikasi 2 30 kali. Ini berarti menit itu
jumlah DNA dapat diamplifikasi dengan spesifik
primer ke tingkat yang mudah dideteksi. Harus
menyadari bahwa kekhasan reaksi sepenuhnya
ditentukan oleh primer PCR dan primer ini
juga akan menentukan panjang amplifikasi
pecahan. Sensitivitas luar biasa dari teknik ini
telah memicu perkembangan sejumlah besar
aplikasi yang sensitivitasnya sangat penting
pentingnya. Juga, dibandingkan dengan banyak deteksi lainnya
metode, prosedur PCR sangat cepat.
Misalnya, keberadaan mikroba patogen
gens dalam produk makanan mentah dan olahan bisa
dengan tegas ditentukan menggunakan teknologi ini.
DNA diekstraksi dari bahan ini dan PCR
Reaksi dilakukan dengan menggunakan primer yang
spesifik untuk patogen yang dicurigai. Terperinci
pengetahuan tentang sekuens DNA dari semua jenis gen
dalam semua jenis organisme memungkinkan pengembangan
primer spesifik seperti itu, prasyarat utama untuk
teknologi PCR diagnostik. Jika spesifik diperkuat
Produk DNA dapat dideteksi, ini adalah bukti bahwa
Patogen hadir dalam materi. Juga secara klinis
bahan (darah, urin, dll.) teknik yang digunakan
Temperatur (˚C)
Denaturasi
Hybrization
Perpaduan
110
90
70
50
0
4
8
12
Waktu (min)
5'
5'
5'
5'
5'
5'
3'
3'
3'DNA
Denaturasi
Cat dasar
Sintesis DNA
Setelah n siklus
Banyak DNA
fragmen
dibatasi oleh
primer yang dipilih
urutan
3'
3'
3'
Gambar 16 n Metode PCR. Panel atas: Urutan pemanasan,
hidridisasi, sintesis. Panel bawah: Peristiwa sintesis.
18
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 37
secara ekstensif sebagai tes cepat dan sensitif untuk
adanya bakteri dan virus patogen. Ketiga
area di mana PCR telah menjadi teknologi standar
ilmu forensik. Di TKP sering beberapa menit
jumlah bukti penting yang potensial ditemukan
(rambut tunggal, tetesan darah, noda semen, dll.) dan PCR
teknologi dapat digunakan untuk mendapatkan DNA yang cukup untuk ditampilkan
asal materi ini. Ini hanya beberapa
contoh penggunaan teknologi PCR. PCR sering
langkah penting dalam diagnostik dan deteksi yang rumit
prosedur dan aplikasi baru terus menerus
sedang dikembangkan.
Adapun aplikasi teknologi PCR untuk
diagnosis patogen, kita harus menyadari itu untuk sebagian besar
tujuannya adalah untuk mendeteksi patogen yang hidup. Itu
Teknologi PCR jelas tidak dapat membedakan DNA
dari bahan vital atau mati dan dalam hal itu tidak
selalu merupakan teknik yang memadai. Teknik PCR adalah a
sangat sensitif karena jumlah DNA yang kecil
sangat diperkuat. Sensitivitas tinggi ini dapat membatasi
kekuatan diskriminatif dari teknik ketika diterapkan
untuk tujuan diagnostik. Misalnya, mungkin mendeteksi
kontaminan kecil dalam sampel. Apalagi DNA
kontaminan dapat dimasukkan selama
tes. Oleh karena itu perhatian utama dalam
aplikasi PCR untuk menghindari kontaminasi DNA itu
dapat menyebabkan reaksi positif palsu.
Teknik PCR yang dimodifikasi dan metodologi terkait
ogies dibahas di Bab 7.
BUDAYA SEL
Bioteknologi sangat bergantung pada teknik
menumbuhkan sel pro dan eukariotik, karena sel-sel ini
adalah sumber bioproduk atau mediator dari
berbagai biokonversi. Skala budidaya adalah a
masalah penting dalam bioteknologi. Pengalaman dari
budaya skala kecil tidak dapat langsung ditransfer ke besar
skala budidaya di industri manufaktur. Apa yang bisa
dibudidayakan dalam labu kecil di laboratorium penelitian
tidak dapat selalu diolah secara efisien di industri
skala percobaan. Cukup perbesar perangkat kultur
labu kecil ke tangki yang berisi ribuan liter
tidak cukup. Budidaya pada tingkat industri
membutuhkan proses yang sangat canggih dan rumit
teknologi (lihat Bab 3).
n Budidaya Mikroba
Beberapa spesies mikroba sangat populer di bidang bioteknologi.
karena mereka dapat dibudidayakan dengan mudah dan aman
cara. Untuk spesies mikroba dengan tradisi yang tahan lama
dalam bioteknologi termasuk spesies bakteri seperti
Clostridium acetobutyricum, Corynebacterium sp.,
Xanthomonas sp., Bacillus sp., Lactobacillus sp. demikian juga
sebagai jamur Saccharomyces cerevisiae (ragi roti),
Penicillium sp. dan Aspergillus sp.
Secara umum, mikroba dapat dibudidayakan di Indonesia
kapal atau tangki diisi dengan cairan yang sesuai
media pertumbuhan atau di piring yang mengandung pertumbuhan
medium dipadatkan dengan agar (lihat Bab 3).
Kultur dengan cara ini menyiratkan bahwa kondisi untuk
sel-sel yang tumbuh secara bertahap berkurang, karena nutrisi
habis oleh sel-sel yang tumbuh dan pertumbuhan
menghambat metabolit yang berakumulasi secara bertahap.
Akibatnya, pertumbuhan mikroba di bawah kondisi ini
tions akan berhenti setelah beberapa saat. Namun ada
perangkat budaya, alat budaya berkelanjutan,
yang memungkinkan pertumbuhan mikroorganisme yang tidak terbatas.
Ini dicapai dengan terus menambahkan segar
menengah ke budaya, sementara menghilangkan tumbuh
sel dan metabolit oleh perangkat meluap. Di bawah a
rejimen penambahan dan pemindahan yang tepat, “mantap
Keadaan "situasi di mana sel terus tumbuh adalah
dibuat. Nama sugestif untuk budaya tersebut adalah
"Budaya berkelanjutan." Kebanyakan bioteknologi industri,
Namun, didasarkan pada budidaya dalam tangki tanpa a
pasokan dan perangkat meluap. Perangkat budaya seperti itu
disebut "budaya batch."
Gambar 17 menyajikan gambaran khas bakteri
pertumbuhan dalam budaya batch. Ada beberapa karakter
fase acteristic dalam pertumbuhan bakteri yang disebut
melengkung. Bakteri umumnya tidak segera mulai
mengalikan ketika mereka diinokulasi dalam bentuk segar
medium. Suatu fase, disebut fase lag, tempat sel
jangan membagi tetapi secara bertahap beradaptasi dengan spesifik
kondisi pertumbuhan dalam medium mendahului fase
di mana semua sel mulai membelah. Fase ini, sebenarnya
fase pertumbuhan, disebut logaritmik atau eksponensial
tahap. Fase pertumbuhan eksponensial bagi banyak orang
aplikasi bioteknologi sangat relevan karena sebagian besar
gen kemudian diekspresikan secara optimal. Itu
fase eksponensial diikuti oleh fase stasioner,
di mana pertumbuhan aktif berakhir karena penipisan
dan pembusukan medium.
Tahap di mana pertumbuhan eksponensial terjadi
sampai akhir adalah menarik untuk beberapa tujuan bioteknologi.
Pada tahap itu, karena alasan yang tidak sepenuhnya
dipahami, beberapa mikroorganisme memulai sintesis
disebut metabolit sekunder. Metabolisme ini
produk, sesuai dengan namanya, tidak penting untuk
metabolisme seluler dasar, tetapi mungkin sangat relevan
sebagai bioproduk. Metabolit sekunder relevan untuk
bioteknologi farmasi misalnya anti-
biotik yang diproduksi oleh beberapa mikroorganisme.
Setelah beberapa waktu fase diam diikuti
oleh fase di mana bakteri mati. Tahap ini adalah
jelas bukan minat besar untuk bioteknologi.
Kurva pertumbuhan bakteri tidak secara langsung
berlaku untuk mikroba yang tidak bereproduksi
pembelahan biner. Namun, fase lag sebelum a
fase pertumbuhan aktif dan diikuti oleh stasioner
fase umumnya ditemukan.
BIOTEKNOLOGI MOLEKULER
19
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 38
Juga dalam waktu bioteknologi adalah uang dan
Oleh karena itu, hasil sel maksimum diperlukan. Demikian
seseorang mencoba untuk menjaga fase lag sesingkat mungkin dan
untuk menunda dimulainya fase diam. Pertama
tujuan dicapai dengan menginokulasi tangki dengan sel
bahwa, dengan prakultur yang tepat, diadaptasi secara optimal
media dalam tangki. Tujuan kedua tercapai
dengan berbagai cara. Pendekatan yang sukses, khususnya
ketika sel-sel terbatas dalam pertumbuhan oleh media
deplesi, terdiri dari menambahkan media segar di dekat
akhir fase eksponensial. Teknik ini disebut
"Makan budaya batch."
Untuk mencapai pertumbuhan mikroorganisme yang optimal itu
tidak hanya penting untuk menyediakan media dengan
nutrisi yang tepat, tetapi juga kondisi seperti pH, oksigen
Ketegangan dan suhu harus dipilih.
secara prima dan harus dikontrol saat bercocok tanam.
Terakhir, infeksi dengan mikroorganisme lainnya
isme harus dicegah. Ini membutuhkan kemandulan yang ketat
tindakan dan protokol kerja.
Untuk memberikan ide tentang kinerja yang mengesankan
Dengan sel mikroba yang tumbuh cepat, sel tersebut dapat
tumbuh dengan waktu penggandaan sekitar 30 menit dan
biakan dapat dengan mudah mencapai kepadatan 10 9 sel per mL.
Jika seseorang mengolah sel bakteri di piring, sebuah koloni di
piring seperti itu, muncul setelah satu hari atau lebih, mungkin dengan mudah
menampung jutaan sel.
n Kultur Sel Hewan
Sel-sel hewan dapat diisolasi dari jaringan tertentu
setelah pengobatan protease (trypsin). Ketika sel-sel tersebut
dipindahkan ke gelas atau plastik yang akan mereka patuhi dan
mulai tumbuh, jika disuplai dengan cairan yang cocok
media pertumbuhan. Kultur sel jenis ini disebut
budaya "primer". Budaya seperti itu akan mati setelah a
sementara dan karenanya tidak terlalu berguna untuk bioteknologi.
Namun, beberapa tipe sel hewan menjadi pengecualian
nasional dalam karakteristik pertumbuhan mereka ketika mereka
dibudidayakan. Karakteristik utamanya adalah sel
menjadi abadi. Sel-sel seperti itu digunakan untuk persiapan
Garis sel "terus menerus". Mereka mungkin bertahan hidup selama berbulan-bulan
atau bahkan bertahun-tahun, asalkan dicairkan dan diolah kembali
pada interval yang sering. Beberapa sel asal ganas
atau berasal dari sel normal yang ditransformasikan oleh virus
seperti virus Epstein Barr yang abadi dan tumbuh
kepadatan sel yang tinggi. Untuk bioteknologi farmasi
garis sel yang terakhir mungkin memiliki nilai terbatas karena mereka
bersifat ganas dan dapat melepaskan transformasi
virus sebagai kontaminan untuk farmasi
produk. Paling bermanfaat adalah non-ganas yang diabadikan
garis sel, misalnya fibroblas 3T3.
Beberapa garis sel bergantung pada dukungan solid untuk
pertumbuhan mereka; yang lain bisa diolah dalam suspensi
yang mungkin bermanfaat bagi bioteknologi.
Budidaya sel hewan yang berhasil secara in vitro membutuhkan
media pertumbuhan yang cocok, secara umum sangat kompleks
tidak hanya menyediakan semua persyaratan gizi untuk
sel tetapi juga sejumlah faktor pertumbuhan spesifik dan
hormon. PH harus buffer sekitar 7,0 dan
kondisi osmotik yang tepat isotonik dengan sel
Diperlukan sitoplasma (lihat Bab 3).
Budidaya sel hewan tentu jauh lebih banyak
rumit dari budidaya mikroorganisme umum
isme. Untuk bioteknologi farmasi ada
berbagai jalur sel aman tersedia, masing-masing dengan
karakteristik khusus.
Log
jumlah
sel
Fase lag
Fase eksponensial
Fase kematian
Waktu
Fase diam
Gambar 17 n Kurva pertumbuhan bakteri.
20
HOEKSTRA DAN SMEEKENS
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 39
n Kultur Sel Tanaman
Tanaman selalu menjadi sumber penting
senyawa aktif secara farmakologis. Kompleks
struktur banyak senyawa ini menghalangi mereka
sintesis kimia, tentu saja dalam skala komersial.
Banyak senyawa aktif diekstraksi dari utuh
tanaman atau bagian tanaman. Senyawa seperti itu biasanya
hadir dalam jumlah yang sangat rendah dan ini telah dipicu
penelitian tentang penggunaan produksi alternatif
metode.
Ahli biologi sel telah berusaha memproduksi tingkat tinggi
senyawa aktif dalam kultur sel tanaman tetapi ini memiliki
bukan tugas yang mudah. Di samping masalah yang terkait
dengan kultur sel skala besar, masalah utama dengan
sel tanaman adalah bahwa mereka tidak dapat disimpan di
keadaan dibedakan. Ketika tanaman sepenuhnya dibedakan
jaringan dipotong untuk memulai kultur sel ini
keadaan terdiferensiasi biasanya hilang. Seringkali
Satu pon bunga hanya dibuat di jaringan khusus
di tanaman utuh. Gunakan jaringan ini untuk kultur sel
inisiasi menghasilkan penurunan yang signifikan dalam
produksi senyawa bunga. Tambahan
hormon tanaman (misalnya, auksin dan sitokinin) mungkin
meringankan masalah ini, tetapi sampai sekarang efisien
produksi com- farmasi menarik
Pound dalam sistem kultur sel tanaman jarang terjadi. Sistem
yang tersedia biasanya berdasarkan prosedur
melibatkan pemilihan garis sel berulang dengan
potensi produksi tertinggi.
Kapasitas produksi garis sel dapat lebih jauh
ditingkatkan dengan memberi makan budaya secara strategis
memilih prekursor yang tersedia dengan harga murah untuk
satu pon bunga. Sel-sel kemudian melakukan final dan
langkah-langkah biosintesis kimiawi yang paling menuntut.
Pemahaman yang lebih baik tentang diferensiasi seluler
proses yang dikombinasikan dengan teknologi modifikasi genetik
nologi sel tanaman dapat membantu mengatasi ini
masalah dan memungkinkan penggunaan tanaman yang lebih efisien
kultur sel dalam bioteknologi farmasi. Untuk
menghindari masalah budidaya tanaman yang satu mungkin
mengeksploitasi teknologi DNA rekombinan, dijelaskan
sebelum. Beberapa gen tanaman yang mengkode
Enzim yang terlibat dalam biosintesis secara farmasi
senyawa aktif telah dikloning. Ekspresi dari
gen seperti itu dalam sistem host heterolog membuka ex
cara planta untuk sintesis enzimatik aktif
senyawa.
KESIMPULAN
Menumbuhkan pengetahuan dalam fisiologi mikroba,
sel hewan dan tumbuhan bersama dengan wawasan terperinci
dalam struktur dan fungsi gen telah membuka cara-cara baru
untuk bioteknologi farmasi. Bab ini adalah
hanya ilustrasi pengantar pendekatan baru
berdasarkan teknologi DNA. Untuk menghargai dan
mengeksploitasi pencapaian biologi sel dan rekombinasi
Tanpa teknologi DNA, bacaan lebih lanjut diperlukan.
Buku-buku yang tercantum di bawah ini hanya beberapa dari yang besar
jumlah buku bagus yang tersedia.
BACAAN LEBIH LANJUT
Alberts B, Johnson HA, Lewis J, Raff M ,. Roberts K, Walter P
(2002). Biologi Molekuler Sel. Edisi ke-4 Baru
York: Garland Publ. Inc.
Alcamo IE (1999). Teknologi DNA: Keterampilan Luar Biasa.
2nd edn. Harcourt-Academic Press.
Bourgaize D, Jewell TR, Buiser RG (2000). Bioteknologi:
Demistifying the Concepts. Addison Wesley-
Longman Inc.
Brown TA (2002). Genom. 2nd ed. Oxford, UK: Wisley-
Liss
Watson J, Gilman M, Wikowski J, Zolle M (1992).
DNA rekombinan. 2nd ed. New York: Freeman dan
Perusahaan.
BIOTEKNOLOGI MOLEKULER
21
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 40
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 41

2
Analisis Biofisik dan Biokimiawi
Protein Rekombinan
Tsutomu Arakawa dan John S. Philo
Laboratorium Aliansi Protein, Thousand Oaks, California, AS
PENGANTAR
Untuk protein rekombinan menjadi manusia
terapi, karakteristik biofisik dan biokimia
teristics harus dipahami dengan baik. Sifat-sifat ini
berfungsi sebagai dasar untuk perbandingan reproduksi banyak-ke-banyak
Cibility, untuk menetapkan berbagai kondisi untuk
menstabilkan protein selama produksi, penyimpanan dan
pengiriman, dan untuk mengidentifikasi karakteristik yang berguna untuk
memantau stabilitas selama penyimpanan jangka panjang.
Sejumlah teknik dapat digunakan untuk
menentukan sifat biofisik protein dan
untuk memeriksa integritas biokimia dan biologis mereka.
Jika memungkinkan, hasil percobaan ini adalah
dibandingkan dengan yang diperoleh secara alami
cincin protein agar yakin bahwa
protein rekombinan memiliki karakteristik yang diinginkan
dari yang terjadi secara alami.
STRUKTUR PROTEIN
n Struktur Utama
Sebagian besar protein yang dikembangkan untuk terapi
melakukan fungsi tertentu dengan berinteraksi dengan yang lain
molekul kecil dan besar, misalnya, reseptor permukaan sel,
mengikat protein, asam nukleat, karbohidrat dan
lemak. Sifat fungsional protein adalah
berasal dari lipat mereka menjadi tiga
struktur dimensi. Setiap lipatan protein didasarkan
pada urutan polipeptida spesifik di mana berbeda-
Ent asam amino terhubung melalui ikatan peptida
dengan cara tertentu. Penjajaran dari 20 amino ini
asam, yang disebut urutan primer, secara umum memiliki semua
informasi yang diperlukan untuk melipat menjadi berbeda
struktur tersier terdiri dari sekunder yang berbeda
struktur seperti heliks dan lembar-b (lihat di bawah).
Karena 20 asam amino memiliki sisi yang berbeda
rantai, polipeptida dengan sifat yang sangat beragam
diperoleh.
Semua 20 asam amino terdiri dari karbon C a
dimana gugus amino, gugus karboksil, a
hidrogen, dan ikatan rantai samping dalam konfigurasi L.
(Gbr. 1). Asam amino ini bergabung dengan kondensasi
untuk menghasilkan ikatan peptida yang terdiri dari gugus karboksil
asam amino bergabung dengan gugus amino dari
asam amino berikutnya (Gbr. 2).
Kondensasi memberikan gugus amida, NH, di
sisi N-terminal C a , dan gugus karbonil,
C = O, di sisi terminal-C. Kelompok-kelompok ini, juga
rantai samping amino asil, memainkan peran penting dalam
lipatan protein. Karena kemampuannya membentuk hidrogen
obligasi, mereka membuat kontribusi energik utama ke Internet
pembentukan dua struktur sekunder yang penting,
a-heliks dan b-sheet. Ikatan peptida antara
berbagai asam amino sangat setara,
Namun, sehingga mereka tidak menentukan bagian mana
dari suatu urutan harus membentuk a-helix atau b-sheet.
Formasi struktur sekunder yang bergantung pada urutan adalah
ditentukan oleh rantai samping.
Dua puluh asam amino yang biasa ditemukan di
protein ditunjukkan pada Gambar 3. Mereka dijelaskan oleh
nama lengkap mereka dan kode tiga dan satu huruf. Mereka
rantai samping secara struktural berbeda sedemikian rupa
bahwa pada pH netral, asam aspartat dan glutamat adalah
bermuatan negatif dan lisin dan arginin
bermuatan positif. Histidin dibebankan secara positif
tingkat yang tergantung pada pH. Pada pH 7,0, aktif
rata-rata sekitar setengah dari rantai samping histidin
bermuatan positif. Tirosin dan sistein adalah proto-
nated dan tidak diisi pada pH netral, tetapi menjadi
masing-masing bermuatan negatif di atas pH 10 dan 8.
Asam amino polar terdiri dari serin, treonin,
asparagin, dan glutamin, serta sistein, sementara
asam amino nonpolar terdiri dari alanin, valin,
fenilalanin, prolin, metionin, leusin, dan iso-
leusin. Glycine berperilaku netral saat sistin
bentuk teroksidasi sistein, ditandai sebagai hidro-
fobia. Meskipun tirosin dan triptofan sering masuk
ke dalam interaksi kutub, mereka lebih baik ditandai sebagai
nonpolar, atau hidrofobik, seperti dijelaskan nanti.
Dua puluh asam amino ini dimasukkan ke dalam
urutan unik berdasarkan kode genetik, sebagai
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 42
contoh pada Gambar 4 menunjukkan. Ini adalah asam amino
urutan faktor stimulasi granulosit-koloni
(G-CSF), yang secara selektif mengatur proliferasi
dan pematangan neutrofil. Meski tepat
sifat protein ini tergantung pada lokasi
setiap asam amino dan karenanya lokasi masing-masing sisi
rantai dalam struktur tiga dimensi, rata-rata
sifat-sifatnya dapat diperkirakan hanya dari amino
komposisi asam, seperti yang ditunjukkan pada Tabel 1; yaitu, daftar
jumlah total setiap jenis asam amino yang terkandung dalam
molekul protein ini.
Menggunakan pK a nilai-nilai rantai samping tersebut dan satu
terminal amino dan karboksil, orang dapat menghitung total
biaya (positif plus biaya negatif) dan bersih
muatan (muatan positif dikurangi muatan negatif) dari suatu protein
sebagai fungsi dari pH, yaitu kurva titrasi. Sejak sistein
dapat dioksidasi untuk membentuk ikatan disulfida atau dapat dalam bentuk
bentuk bebas, perhitungan akurat di atas membutuhkan pH 8
pengetahuan tentang status residu sisteinil dalam
protein. Kurva titrasi yang diperoleh hanya sebuah
perkiraan, karena beberapa residu yang dibebankan mungkin
terkubur dan nilai pKa yang efektif tergantung pada lokal
lingkungan dari setiap residu. Namun demikian, perhitungan
kurva titrasi lated memberikan perkiraan pertama
keadaan keseluruhan protein yang dibebankan pada pH tertentu dan
karenanya properti solusinya. Paragraf molekul lainnya
meter, seperti titik isoelektrik (pI; di mana jaring
muatan protein menjadi nol), berat molekul,
koefisien kepunahan, volume spesifik parsial dan
Hidrofobisitas, juga dapat diperkirakan dari amino
komposisi asam, seperti yang ditunjukkan pada Tabel 1.
Struktur utama protein, yaitu,
urutan asam amino dua puluh, dapat menyebabkan
struktur tiga dimensi karena asam amino
memiliki sifat fisik yang beragam. Pertama, masing-masing jenis
asam amino memiliki kecenderungan lebih istimewa
dimasukkan ke dalam struktur sekunder tertentu.
Frekuensi ditemukannya masing-masing asam amino
dalam a-helix, b-sheet dan b-turn, struktur sekunder
Struktur asam L-amino
R
MENDEKUT-
H
R: rantai samping
H3N +
C
Gambar 1 n Struktur asam L-amino.
HAI
HAI
C
C
R
N
N
H
H
Ikatan peptida
Struktur ikatan peptida
R: rantai samping
H
C
C
C
Gambar 2 n Struktur ikatan peptida.
24
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 43
yang akan dibahas nanti dalam bab ini, bisa
dihitung sebagai rata-rata dari sejumlah protein
struktur tiga dimensi yang telah dipecahkan.
Frekuensi ini tercantum dalam Tabel 2. B-turn memiliki a
konfigurasi berbeda yang terdiri dari empat urutan
asam amino dan ada preferensi kuat untuk spesifik
asam amino dalam empat posisi ini. Sebagai contoh,
asparagine memiliki frekuensi kejadian keseluruhan tinggi
dalam b-turn dan paling sering diamati pada yang pertama
dan posisi ketiga dari b-turn. Karakteristik ini dari
asparagine konsisten dengan rantai sampingnya menjadi a
situs potensial glikosilasi terkait-N. Efek dari
glikosilasi pada biologis dan fisikokimia
sifat-sifat protein sangat penting; bagaimana-
pernah, kontribusi mereka pada struktur tidak mudah
dapat diprediksi berdasarkan komposisi asam amino.
Berdasarkan frekuensi ini, seseorang dapat memprediksi
segmen polipeptida tertentu yang jenisnya
struktur sekunder yang cenderung terbentuk. Seperti yang ditunjukkan
pada Gambar 5A, ada sejumlah metode
dikembangkan untuk memprediksi struktur sekunder dari
urutan utama protein. Menggunakan G-CSF
(Gbr. 5B) sebagai contoh, daerah a-helix, b-sheets,
belokan, hidrofilisitas, dan situs antigen bisa
disarankan.
Properti lain dari asam amino, yang
berdampak pada lipatan protein, adalah hidrofobisitas
rantai sisi mereka. Meskipun asam amino nonpolar
pada dasarnya hidrofobik, penting untuk diketahui
betapa hidrofobinya mereka. Properti ini telah
ditentukan dengan mengukur koefisien partisi atau
kelarutan asam amino dalam air dan organik
pelarut dan normalisasi parameter tersebut relatif
untuk glisin. Relatif terhadap rantai samping glisin, a
hidrogen tunggal, normalisasi seperti itu menunjukkan caranya
sangat rantai samping asam amino nonpolar
Struktur 20 asam amino
H
CH
3
CH
2
CH
2
CH
2
CH
2
CH
2
CH
2
CH
2
CH
2
C=N+H
2
CH
2
CH
2
CH
2
NH
2
NH
N+H
3
CH
2
CH
2
CH
3
CH
2
CH
2
S
C
CH
2
CH
3
CH
3
CH
3
CH
3
H
3
C
H
3
C
H
2
C
H
2
C
CH
CH
HC
HC
CH
H
C
CH
CH
C
C
C
C
H
H
H
H
Glycine, Gly, G
Leucine, Leu, L
Asam aspartat, Asp, D
Asam glutamat, Glu, E
Lisin, Lis, K
Arginine, Arg, R
Phenylalanine, Phe, F
Proline, Pro, P
Metionin, Met, M
Alanine, Ala, A
Valine, Val, A
Isoleusin, lle, l
H
3
N+
H
3
N+
H
3
N+
H
3
N+
MENDEKUT-
MENDEKUT-
C
H
H
H
H
H
3
N+
H
3
N+
MENDEKUT-
C
H
(A)
H
3
N+
MENDEKUT-
C
H
H
3
N+
MENDEKUT-
C
H
H
3
N+
MENDEKUT-
C
H
H
3
N+
MENDEKUT-
C
C
MENDEKUT-
H
3
N+
C
MENDEKUT-
H
3
N+
MENDEKUT-
MENDEKUT
-
MENDEKUT-
HAI-
HAI
C
HAI-
HAI
C
Gambar 3A n Struktur 20 asam amino.
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
25
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 44
lebih suka fase organik daripada fase berair. SEBUAH
representasi dari pengukuran tersebut ditunjukkan dalam
Tabel 3. Nilai menunjukkan energi bebas
meningkat seiring rantai samping triptofan dan
tirosin dipindahkan dari pelarut organik ke
air dan transfer semacam itu secara termodinamika
tidak menguntungkan. Meskipun tidak jelas seberapa sebanding
properti hidrofobik adalah antara organik
pelarut dan bagian dalam molekul protein,
rantai samping hidrofobik menyukai pengelompokan bersama,
menghasilkan struktur inti dengan sifat yang serupa
untuk pelarut organik. Ini karakter hidrofobik
istics dari asam amino nonpolar dan hidrofilik
karakteristik asam amino polar menghasilkan a
partisi residu amino asil menjadi hidrofobik
inti dan permukaan hidrofilik, menghasilkan keseluruhan
Melipat.
n Struktur Sekunder
a-Helix
Segera terbukti dalam struktur utama a
protein adalah bahwa setiap asam amino dihubungkan oleh peptida
obligasi. Amida, NH, adalah donor hidrogen dan
karbonil, C = O, adalah akseptor hidrogen, dan mereka dapat
membentuk ikatan hidrogen yang stabil ketika mereka
C
H
H
H
(B)
H
H
H
H
H
H
3
N+
MENDEKUT-
C
H
3
N+
MENDEKUT-
C
H
3
N+
H
3
N+
MENDEKUT-
MENDEKUT-
C
H
3
N+
MENDEKUT-
C
H
3
N+
H
3
N+
MENDEKUT-
MENDEKUT-
CH
2
CH
2
CH
2
CH
3
CH
2
OH
HN
HC
HAI
C
C
C
H
3
N+
MENDEKUT-
C
C
C
C
CH
C
C
HC
HC
H
H
H
N
N+H
CH
C
NH
2
HAI
NH
2
CH
2
CH
2
CH
2
CH
2
SH
HO
OH
CH
HC
HC
CH
CH
C
C
C
Struktur 20 asam amino ( lanjutan )
Serine, Ser, S
Threonine, Thr, T
Tyrosine, Tyr, Y
Histidine, Miliknya, H
Asparagine, Asn, N
Glutamin, Gln, Q
Typtophan, Trp, W
Sistein, Cys, C
Gambar 3B n Struktur 20
asam amino.
LCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHS
GLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQ
MEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSF
LEVSYRVLRHLAQP
40
80
120
160
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYK
Gambar 4 n Urutan asam amino G-CSF.
26
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 45
diposisikan dalam konfigurasi yang sesuai
rantai polipeptida. Seperti struktur polipeptida
rantai disebut struktur sekunder. Dua utama
struktur, a-heliks dan b-sheet, mengakomodasi seperti itu
ikatan hidrogen yang stabil. Rantai utama membentuk
menyerahkan helix, karena hanya L-bentuk asam amino
dalam protein, dan membuat satu putaran per 3,6 residu.
Panjang keseluruhan heliks dapat sangat bervariasi.
Gambar 6 menunjukkan contoh a-helix pendek. Di dalam
kasus, kelompok C = O residu 1 membentuk hidrogen
ikatan ke grup NH residu 5 dan C = O grup
residu 2 membentuk ikatan hidrogen dengan gugus NH
residu 6. Dengan demikian, pada awal heliks-a, empat
kelompok amida selalu bebas dan pada akhir suatu
a-helix empat gugus karboksil juga gratis. Hasil dari,
kedua ujung a-helix sangat polar.
Selain itu, semua ikatan hidrogen selaras
sepanjang sumbu heliks. Karena keduanya peptida NH dan
C = O kelompok memiliki momen dipol listrik menunjuk
arah yang sama, mereka akan menambah substansial
momen dipol di seluruh a-helix, dengan
muatan parsial negatif pada sisi terminal-C dan
muatan parsial positif di sisi terminal-N.
Rantai samping keluar dari proyek
a-heliks. Proyeksi ini berarti semua rantai samping
mengelilingi permukaan luar a-helix dan berinteraksi
baik satu sama lain dan dengan rantai samping yang lain
daerah yang bersentuhan dengan rantai samping ini.
Interaksi ini, yang disebut interaksi jarak jauh,
dapat menstabilkan struktur heliks dan membantunya bertindak sebagai
unit lipat. Seringkali a-helix berfungsi sebagai bangunan
blok untuk struktur tiga dimensi globular
protein dengan membawa rantai samping hidrofobik menjadi satu
sisi heliks dan rantai samping hidrofilik ke
sisi berlawanan dari heliks yang sama. Distribusi sisi
rantai di sepanjang sumbu heliks dapat dilihat menggunakan
roda heliks. Karena satu belokan dalam a-helix adalah 3,6
residu lama, setiap residu dapat diplot setiap 360 ° /
3,6 = 100 ° di sekitar lingkaran (dilihat dari atas
a-helix), seperti yang ditunjukkan pada Gambar 7. Plot tersebut menunjukkan
proyeksi posisi residu ke pesawat
tegak lurus terhadap sumbu heliks. Salah satu yang diprediksi
heliks dalam erythropoietin ditunjukkan pada Gambar 7, menggunakan
lingkaran terbuka untuk rantai samping hidrofobik dan terbuka
persegi panjang untuk rantai samping hidrofilik. Menjadi
segera jelas bahwa satu sisi a-helix adalah
sangat hidrofobik, menunjukkan bahwa sisi ini membentuk suatu
inti internal, sedangkan sisi lain relatif hidro
philic dan karenanya kemungkinan besar terkena permukaan.
Karena banyak protein penting secara biologis berfungsi oleh
berinteraksi dengan makromolekul lain, informasinya
Diperoleh dari roda heliks sangat berguna. Untuk
Misalnya, mutasi asam amino dalam pelarut-
sisi yang terbuka dapat menyebabkan identifikasi daerah
bertanggung jawab atas aktivitas biologis, sementara mutasi pada
inti internal dapat menyebabkan perubahan stabilitas protein.
b-Sheet
Unsur struktural sekunder utama kedua ditemukan
dalam protein adalah b-sheet. Berbeda dengan a-helix,
Parameter
Nilai
Berat molekul
18673
Jumlah total amino
asam
174
1 mikrogram
53,5 picomoles
Koefisien kepunahan molar
15820
1 A (280)
1,18 mg / ml
Titik isoelektrik
5.86
Isi daya pada pH 7
–3,39
Tabel 1A n komposisi asam amino dan parameter struktural
Asam amino
Jumlah
% oleh
berat
% oleh
frekuensi
A Ala
19
7.23
10.92
C Cys
5
2.76
2.87
D Asp
4
2.47
2.30
E Glu
9
6.22
5.17
F Phe
6
4.73
3.45
G Gly
14
4.28
8.05
H miliknya
5
3.67
2.87
1 saya
4
2.42
2.30
K Lys
4
2.75
2.30
L Leu
33
20.00
18.97
M Met
3
2.11
1.72
N Asn
0
0,00
0,00
P Pro
13
6.76
7.47
Q Gin
17
11.66
9.77
R Arg
5
4.18
2.87
S Ser
14
6.53
8.05
TRh
7
3.79
4.02
V Val
7
3.71
4.02
W Trp
2
1.99
1.15
Y Tyr
3
2.62
1.72
Tabel 1B n Komposisi asam amino dan parameter struktural
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
27
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 46
yang dibangun dari wilayah kontinu dengan a
Ikatan hidrogen peptida yang menghubungkan setiap amino keempat
asam, b-sheet terdiri dari peptida hidrogen
ikatan antara berbagai daerah polipeptida
yang mungkin berjauhan secara berurutan. b-helai bisa
berinteraksi satu sama lain dalam salah satu dari dua cara yang ditunjukkan
pada Gambar 8, yaitu, baik paralel atau antiparalel. Di sebuah
sejajar b-sheet, setiap untai diorientasikan sama
arah dengan ikatan hidrogen peptida terbentuk menjadi-
tween untai, sementara di b-lembar antiparalel, yang
urutan polipeptida berorientasi sebaliknya
arah. Dalam kedua struktur, kelompok C = O dan NH
memproyeksikan ke sisi yang berlawanan dari rantai polipeptida,
dan karenanya b-untai dapat berinteraksi dari kedua sisi
rantai tertentu untuk membentuk ikatan hidrogen peptida
dengan helai yang berdekatan. Jadi, lebih dari dua b-helai
dapat saling menghubungi baik secara paralel maupun dalam
cara antiparalel, atau bahkan dalam kombinasi. Seperti itu
pengelompokan dapat menghasilkan semua b-helai yang tergeletak di pesawat
sebagai lembar. B-helai yang ada di tepi
lembar memiliki pasangan C = O dan NH yang tidak berpasangan.
Rantai samping diproyeksikan tegak lurus ke bidang ini
dalam arah yang berlawanan dan dapat berinteraksi dengan pihak lain
rantai dalam b-sheet yang sama atau dengan wilayah lain
molekul, atau dapat terpapar pelarut.
Di hampir semua struktur protein yang dikenal, b-helai
diputar dengan tangan kanan. Dengan cara ini, b-helai
beradaptasi menjadi konformasi yang sangat berbeda. Tergantung
tentang bagaimana mereka diputar, semua rantai samping di
untai yang sama atau untai yang berbeda belum tentu
memproyeksikan ke arah yang sama.
Loop dan Berputar
Loop dan belokan membentuk struktur linear yang kurang lebih,
dan berinteraksi satu sama lain untuk membentuk tiga
struktur dimensi. Mereka terdiri dari seorang
urutan asam amino yang biasanya hidrofilik
dan terkena pelarut. Wilayah ini terdiri dari
b-putaran (membalikkan terbalik), loop jepit rambut pendek, dan panjang
loop. Banyak loop jepit rambut dibentuk untuk menghubungkan dua
b-helai antiparalel.
Seperti yang ditunjukkan pada Gambar 5A, asam amino
urutan yang membentuk b-belokan relatif mudah
memprediksi, sejak belokan harus hadir secara berkala ke
lipat urutan linear menjadi struktur globular.
Asam amino yang paling sering ditemukan pada b-turn adalah
sebuah -helix
b- sheet
b- berbalik
b - putar posisi 1
b - putar posisi 2
b - putar posisi 3
b - putar posisi 4
Glu
1.51
Val
1.70
Asn
1.56
Asn
0,161
Pro
0,301
Asn
0,191
Trp
0,167
Bertemu
1.45
Berbohong
1,60
Gly
1.56
Cys
0,149
Ser
0,139
Gly
0,190
Gly
0,152
Ala
1.42
Tyr
1.47
Pro
1,52
Asp
0,147
Lys
0,115
Asp
0,179
Cys
0,128
Leu
1.21
Phe
1.38
Asp
1.46
Nya
0,140
Asp
0,110
Ser
0,125
Tyr
0,125
Lys
1.16
Trp
1.37
Ser
1.43
Ser
0,120
Thr
0,108
Cys
0,117
Ser
0,106
Phe
1.13
Leu
1.30
Cys
1.19
Pro
0,102
Arg
0,106
Tyr
0,114
Gin
0,098
Gin
1.11
Cys
1.19
Tyr
1.14
Gly
0,102
Gin
0,098
Arg
0,099
Lys
0,095
Trp
1,08
Thr
1.19
Lys
1.01
Thr
0,086
Gly
0,085
Nya
0,093
Asn
0,091
IIe
1,08
Gin
1.10
Gin
0,98
Tyr
0,082
Asn
0,083
Glu
0,077
Arg
0,085
Val
1.06
Bertemu
1,05
Thr
0,96
Trp
0,077
Bertemu
0,082
Lys
0,072
Asp
0,081
Asp
1.01
Arg
0,93
Trp
0,96
Gin
0,074
Ala
0,076
Tyr
0,065
Thr
0,079
Nya
1,00
Asn
0,89
Arg
0,95
Arg
0,070
Tyr
0,065
Phe
0,065
Leu
0,070
Arg
0,98
Nya
0,87
Nya
0,95
Bertemu
0,068
Glu
0,060
Trp
0,064
Pro
0,068
Thr
0,83
Ala
0,83
Glu
0,74
Val
0,062
Cys
0,053
Gin
0,037
Phe
0,065
Ser
0,77
Ser
0,75
Ala
0,66
Leu
0,061
Val
0,048
Leu
0,036
Glu
0,064
Cys
0,70
Gly
0,75
Bertemu
0,60
Ala
0,060
Nya
0,047
Ala
0,035
Ala
0,058
Tyr
0,69
Lys
0,74
Phe
0,60
Phe
0,059
Phe
0,041
Pro
0,034
IIe
0,056
Asn
0,67
Pro
0,55
Leu
0,59
Glu
0,056
IIe
0,034
Val
0,028
Bertemu
0,055
Pro
0,57
Asp
0,54
Val
0,50
Lys
0,055
Leu
0,025
Bertemu
0,014
Nya
0,054
Gly
0,57
Glu
0,37
IIe
0,47
IIe
0,043
Trp
0,013
IIe
0,013
Val
0,053
Sumber: Diambil dan diedit dari Chou PY dan Fasman GD, (1978), Ann. Pdt. Biochem. 47, 251-276 dengan izin dari Ulasan Tahunan, Inc.
Tabel 2 n Frekuensi terjadinya 20 asam amino dalam a-helix, b-sheet, dan b-turn.
28
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 47
biasanya tidak ditemukan dalam struktur heliks atau b-sheet.
Jadi, prolin dan glisin merupakan yang paling sedikit diamati
asam amino dalam struktur sekunder yang khas ini.
Namun, prolin memiliki frekuensi yang sangat tinggi
terjadi pada posisi kedua di b-turn while
glisin memiliki preferensi yang tinggi pada yang ketiga dan keempat
posisi b-turn.
Meskipun loop tidak dapat diprediksi seperti b-turns,
asam amino dengan frekuensi tinggi untuk b-ternyata juga bisa
membentuk lingkaran panjang. Meski sulit diprediksi,
loop adalah struktur sekunder yang penting, karena mereka
membentuk daerah yang sangat terpapar protein
molekul dan memungkinkan protein untuk melipat ke dirinya sendiri.
n Struktur Tersier
Kombinasi berbagai struktur sekunder dalam a
protein menghasilkan struktur tiga dimensi. Banyak
protein terlipat menjadi struktur globular yang cukup kompak.
Lipatan molekul protein menjadi berbeda
struktur tiga dimensi menentukan fungsinya.
Aktivitas enzim membutuhkan koordinasi yang tepat
residu yang secara katalitik penting dalam tiga dimensi
ruang sional. Ikatan antibodi dengan antigen dan
mengikat faktor pertumbuhan dan sitokin pada mereka
semua reseptor membutuhkan permukaan khusus yang berbeda untuk
mengikat afinitas tinggi. Interaksi ini tidak terjadi
jika struktur antibodi tersier, faktor pertumbuhan
dan sitokin diubah.
Struktur tersier protein yang unik seringkali dapat terjadi
menghasilkan perakitan protein menjadi berbeda
struktur kuaterner yang terdiri dari stoikiometri tetap
rantai protein dalam kompleks. Majelis bisa
terjadi antara protein yang sama atau antara yang berbeda
rantai polipeptida. Setiap molekul dalam kompleks adalah
disebut subunit. Aktin dan tubulin mengasosiasikan diri ke dalam
F-aktin dan mikrotubulus, sedangkan hemoglobin adalah tetra
mer terdiri dari dua a dan dua b subunit. Diantara
sitokin dan faktor pertumbuhan, interferon-g adalah homo-
dimer, sedangkan faktor pertumbuhan turunan trombosit adalah homo-
dimer dari rantai A atau B atau heterodimer dari
170
160
150
140
130
120
110
100
90
80
70
60
50
40
30
20
Chou - Fasman
Chou - Fasman
Chou - Fasman
Kyte - Doolittle
Garnier - Robson
Garnier - Robson
Garnier - Robson
Garnier - Robson
Plot - Emini
Probabilitas Permukaan
Indeks Antigenik-
Daerah Fleksibel-
Beta, Amphipathic
Alpha, Amphipathic
Daerah - Eisenberg
Jameson - Wolf
Karplus - Schulz
Daerah - Eisenberg
Plot Hidrofilisitas-
Coil, Wilayah-
Belok, Daerah-
Belok, Daerah-
Beta, Wilayah-
Beta, Wilayah-
Alpha, Wilayah-
Alpha, Wilayah-
170
160
150
140
130
120
110
100
90
80
70
60
50
40
30
20
10
(A)
1
6
0
3.1
F
*
*
-1.7
0
1.57
C
T
T
B
B
SEBUAH
SEBUAH
10
Gambar 5A n Prediksi struktur sekunder G-CSF. Diperoleh menggunakan program DNA Star (DNA Star Inc., Madison, Wl, USA).
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
29
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 48
Rantai A dan B. Pembentukan struktur kuaterner
terjadi melalui interaksi non-kovalen atau melalui dis-
ikatan ulfide antar subunit.
n Pasukan
Interaksi yang terjadi antara kelompok kimia di
protein bertanggung jawab untuk pembentukan spesifik mereka
struktur sekunder, tersier dan kuaterner. Antara
interaksi yang menjijikkan atau menarik dapat terjadi di antaranya
kelompok yang berbeda. Interaksi menjijikkan terdiri dari
hambatan sterik dan efek elektrostatik. Suka-biaya
saling tolak dan rantai samping besar, meskipun mereka
jangan saling tolak, tidak bisa menempati yang sama
ruang. Lipat juga bertentangan dengan kecenderungan alami
bergerak menuju keacakan, yaitu, meningkatkan entropi.
Lipat mengarah ke posisi tetap masing-masing atom dan
karenanya terjadi penurunan entropi. Untuk melipat terjadi ini
penurunan entropi, serta interaksi menjijikkan
tions, harus diatasi dengan interaksi yang menarik, yaitu,
interaksi hidrofobik, ikatan hidrogen, elektro-
tarik statis, dan interaksi van der Waals.
Hidrasi protein, dibahas pada bagian selanjutnya,
juga berperan penting dalam pelipatan protein.
Semua interaksi ini relatif lemah dan
dapat dengan mudah rusak dan dibentuk. Karenanya, masing-masing dilipat
struktur protein muncul dari keseimbangan yang baik antara
interaksi yang menjijikkan dan menarik ini. Stabi-
lity struktur terlipat merupakan masalah mendasar di
mengembangkan terapi protein.
Interaksi Hidrofobik
Interaksi hidrofobik mencerminkan penjumlahan dari
van der Waals menarik kekuatan di antara nonpolar
kelompok dalam interior protein, yang mengubah
struktur air di sekitarnya diperlukan untuk mengakomodasi
beri tanggal pada kelompok-kelompok ini jika mereka diketahui. Itu
perpindahan kelompok nonpolar dari interior ke
permukaan membutuhkan penurunan besar dalam entropi sehingga
interaksi hidrofobik pada dasarnya bersifat entropis
didorong. Menghasilkan energi bebas positif yang besar
perubahan mencegah transfer grup nonpolar dari
interior sebagian besar terlindung ke pelarut lebih
bagian luar molekul protein yang terpapar. Demikian,
kelompok nonpolar lebih disukai berada dalam protein
interior sementara kelompok yang lebih polar terkena
permukaan dan lingkungan sekitarnya. Bagian-
pembuatan residu amino asil yang berbeda antara
di dalam dan di luar protein berkorelasi baik dengan
energi hidrasi rantai samping mereka, yaitu
afinitas relatif terhadap air.
D
3 10


L.
C
SEBUAH
B
(B)
N-terminus
Gula
rantai
Gambar 5B n Struktur sekunder filgrastim (rekombinan G-
CSF). Filgrastim adalah polipeptida asam amino-175. Empat anti-
heliks alfa paralel ( A , B , C , dan D ) dan tipe pendek 3 hingga 10
helix (3 10 ) membentuk bundel heliks. Dua situs yang aktif secara biologis
(a dan L ) yang jauh dari modifikasi pada ujung N dari
Heliks dan rantai gula yang melekat pada loop C – D. catatan:
Filgrastim tidak glikosilasi; rantai gula disertakan untuk
menggambarkan lokasinya dalam G-CSF endogen.
Rantai samping asam amino
cal / mol
Triptofan
3400
Norleucine
2600
Fenilalanin
2500
Tirosin
2300
Dihydroxyphenylalanine
1800
Leusin
1800
Valine
1500
Metionin
1300
Histidin
500
Alanine
500
Threonine
400
Serine
–300
Sumber: Diambil dari Nozaki Y, Tanford C. (1971). J. Biol. Chem 246,
2211–2217 dengan izin dari American Society of Biological
Ahli kimia.
Tabel 3 n Skala hidrofobik: mentransfer energi bebas dari
rantai samping asam amino dari pelarut organik ke air.
30
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 49
Ikatan Hidrogen
Ikatan hidrogen bersifat ionik sejak itu
sangat bergantung pada pembagian proton di antara keduanya
dua atom elektronegatif (umumnya oksigen dan
atom nitrogen). Ikatan hidrogen dapat terbentuk
antara atom protein dan molekul air atau
secara eksklusif sebagai protein hidrogen intramolekul
obligasi. Interaksi intramolekul dapat terjadi
C
C
C
C
C
C
C
C
C
C
C
C
C
C
N
N
N
N
3,6 residu
N
N
N
N
C
C
Gambar 6 n Skema ilus-
trasi struktur
a-heliks.
108
101
G
H
97
104
111
100
107
96
103
110
99
106
K
S
SEBUAH
S
T
D
R
R
V
T
V
L.
L.
L.
SEBUAH
102
109
98
105
94
Helix C
Terkubur
Permukaan
95
L.
Gambar 7 n Roda heliks
analisis erythropoietin
berurutan, dari His94 ke
Ala111. Sumber: Elliott S, per-
komunikasi sonal.
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
31
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 50
energi gratis yang secara signifikan lebih menguntungkan (karena
pertimbangan entropik) dibandingkan hidro antarmolekul
ikatan gen, jadi kontribusi semua ikatan hidrogen
dalam molekul protein untuk stabilitas protein
struktur dapat menjadi substansial. Selain itu, ketika
Ikatan hidrogen terjadi di bagian dalam protein
molekul, ikatan menjadi lebih kuat karena
lingkungan hidrofobik.
Interaksi Elektrostatik
Interaksi elektrostatik terjadi di antara keduanya
grup yang dibebankan. Menurut hukum Coulomb, jika
biaya adalah dari tanda yang sama, interaksinya adalah
menjijikkan dengan peningkatan energi, tetapi jika mereka
sebaliknya itu menarik, dengan penurunan
energi. Interaksi elektrostatik sangat tergantung
penyok pada jarak, menurut hukum Coulomb, dan
berbanding terbalik dengan konstanta dielektrik dari
medium. Interaksi elektrostatik jauh lebih kuat
di bagian dalam molekul protein karena a
konstanta dielektrik yang lebih rendah. Banyak yang ditagih
kelompok yang ada pada molekul protein dapat menyediakan
stabilitas keseluruhan oleh tarikan elektrostatik dari
biaya yang berlawanan, misalnya, antara negatif
kelompok karboksil bermuatan dan bermuatan positif
gugus amino. Namun, efek bersih dari semua kemungkinan
pasangan kelompok yang dibebankan harus dipertimbangkan. Jadi, itu
energi bebas yang berasal dari interaksi elektrostatik adalah
sebenarnya milik seluruh struktur, bukan hanya dari
residu atau gugus asam amino tunggal.
Interaksi van der Waals
Interaksi van der Waals yang lemah ada di antara atom-atom
(Kecuali proton telanjang), apakah mereka polar atau
nonpolar. Mereka muncul dari interaksi menarik neto
antara dipol permanen dan / atau diinduksi (sementara
dan dipol yang fluktuatif. Namun ketika dua
atom saling mendekati terlalu dekat, tolakan
antara awan elektron mereka menjadi kuat dan
mengimbangi kekuatan yang menarik. Menjijikkan
kekuatan bahkan lebih sensitif terhadap jarak antara
dua atom.
n Hidrasi
Molekul air terikat dengan protein secara internal dan
secara eksternal. Beberapa molekul air sesekali menempati
rongga internal kecil dalam struktur protein, dan sedang
Ikatan hidrogen untuk ikatan peptida dan rantai samping
protein dan sering ke kelompok prostetik, atau
kofaktor, di dalam protein. Permukaan protein adalah
H
HAI
N
N
N
C
N
N
N
N
N
C
C
C
C
C
C
C
C
C
C
C
C
C
C
C
C
C
C
N
N
N
N
N
H
Antiparalel
Paralel
H
H
H
H
H
H
H
N
N
N
N
N
N
N
N
N
N
H
HAI
HAI
H
HAI
HAI
H
HAI
HAI
HAI
HAI
H
H
HAI
HAI
H
HAI
HAI
H
H
HAI
HAI
HAI
H
H
H
H
H
H
HAI
HAI
HAI
C
C
C
C
C
C
C
C
C
C
C
C
C
C
C
C
C
C
Gambar 8 n Skema ilus-
trasi struktur
antiparalel (kiri) dan paralel
(kanan) b-sheet. Panah
menunjukkan arah amino
urutan asam dari
N-terminus ke C-terminus.
32
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 51
besar dan terdiri dari mosaik polar dan nonpolar
asam amino, dan mengikat sejumlah besar air
molekul, yaitu terhidrasi, dari sekitarnya
lingkungan Hidup. Seperti yang dijelaskan di bagian sebelumnya,
molekul air terperangkap di bagian dalam protein
molekul terikat lebih erat pada ikatan hidrogen
donor dan akseptor karena dielektrik yang lebih rendah
konstan.
Pelarut di sekitar permukaan protein jelas memiliki a
peran umum dalam menghidrasi peptida dan rantai samping tetapi
mungkin diharapkan agak mobile dan non-
spesifik dalam interaksinya. Mol air yang tertata dengan baik
kapsul dapat memberikan kontribusi yang signifikan terhadap protein
stabilitas. Satu molekul air dapat berikatan dengan hidrogen
dua kelompok yang jauh dalam struktur primer pada a
molekul protein, bertindak sebagai jembatan di antara ini
kelompok. Molekul air seperti itu mungkin sangat tinggi
terbatas dalam gerak, dan dapat berkontribusi pada
stabilitas, setidaknya secara lokal, dari protein, sejak itu
Ikatan yang ketat mungkin ada hanya ketika kelompok-kelompok ini
menganggap konfigurasi yang tepat untuk mengakomodasi a
molekul air yang hanya ada di negara bagian asli
protein. Hidrasi seperti itu juga dapat mengurangi
fleksibilitas kelompok yang terlibat.
Ada juga bukti untuk solvasi terhadap hidro
kelompok fobia pada permukaan protein. Disebut demikian
hidrasi hidrofobik terjadi karena
sifat interaksi antara air yang tak terlihat
molekul dan permukaan hidrofobik, menghasilkan
pengelompokan molekul air. Karena pengelompokan ini
sangat tidak menguntungkan, seperti hidrofobik hidrofobik
tion tidak berkontribusi terhadap stabilitas protein.
Namun, hidrasi hidrofobik ini memfasilitasi
interaksi drophobic. Hidrasi yang tidak menguntungkan ini
berkurang ketika berbagai kelompok hidrofobik datang
dalam kontak baik secara intramolekul maupun intermolekul,
mengarah ke lipat struktur intrachain atau ke
interaksi protein-protein.
Baik air yang longgar dan sangat terikat
Molekul dapat memiliki dampak penting, tidak hanya
pada stabilitas protein tetapi juga pada fungsi protein. Untuk
Misalnya, enzim tertentu berfungsi dalam non-air
pelarut asalkan sedikit air, adil
cukup untuk menutupi permukaan protein, hadir. Terikat
air dapat memodulasi dinamika kelompok permukaan,
dan dinamika seperti itu mungkin penting untuk enzim
fungsi. Enzim kering, secara umum, tidak aktif dan
menjadi aktif setelah mereka menyerap 0,2 g air per g
protein. Jumlah air ini hanya cukup untuk
tutupi kelompok kutub permukaan, namun mungkin cukup
fleksibilitas untuk fungsi.
Bukti air terikat pada molekul protein
memiliki sifat yang berbeda dari air curah dapat
ditunjukkan oleh keberadaan air yang tidak dapat dibekukan.
Jadi, ketika larutan protein didinginkan di bawah -40 ° C,
sebagian kecil air, ~ 0,3 g air / g protein, tidak
membeku dan dapat dideteksi oleh NMR resolusi tinggi.
Beberapa teknik lain juga mendeteksi jumlah yang serupa
air terikat. Air yang tidak dapat disentuh ini mencerminkan air
properti unik dari air terikat yang mencegahnya
mengadopsi struktur es.
PROTEIN FOLDING
Protein menjadi fungsional hanya ketika mereka mengasumsikan a
struktur tersier yang berbeda. Banyak secara fisiologis dan
protein-protein yang penting secara terapi memberikan jaminan
hadapi pengakuan dengan berinteraksi dengan molekul
seperti substrat, reseptor, protein pemberi sinyal dan
makromolekul adhesi sel-permukaan. Ketika merekomendasikan
protein binant diproduksi di Escherichia coli, mereka
sering membentuk badan inklusi di mana mereka berada
diendapkan sebagai protein yang tidak larut. Formasi seperti itu
Keadaan tidak larut tidak secara alami terjadi pada sel di mana
mereka biasanya disintesis dan diangkut.
Oleh karena itu, proses in vitro diperlukan untuk melipat kembali
protein rekombinan tidak larut ke dalam asalnya,
keadaan aktif secara fisiologis. Ini biasanya
dipoles dengan melarutkan protein yang tidak larut dengan
deterjen atau denaturants, diikuti oleh
tion dan penghapusan reagen ini bersamaan dengan
refolding protein (lihat Bab 3).
Status protein yang tidak dilipat biasanya sangat tinggi
stabil dan larut dengan adanya denaturasi
agen. Setelah protein terlipat dengan benar, mereka
juga relatif stabil. Selama masa transisi dari
bentuk yang tidak dilipat ke keadaan asli, protein harus pergi
melalui banyak negara transisi lainnya di mana
itu tidak sepenuhnya dilipat dan denaturants atau larut
agen berada pada konsentrasi rendah atau bahkan tidak ada.
Pengisian ulang protein dapat dicapai di
berbagai cara. Pengenceran protein pada tingkat tinggi
konsentrasi denaturant ke dalam buffer air akan
mengurangi konsentrasi makanan dan protein
serentak. Penambahan buffer berair ke a
solusi protein-denaturant juga menyebabkan penurunan
konsentrasi baik denaturant dan protein. Itu
Perbedaan dalam prosedur ini adalah bahwa, dalam kasus pertama,
baik konsentrasi makanan dan protein adalah
terendah pada awal pengenceran dan secara bertahap
meningkat saat proses berlanjut. Dalam kasus kedua,
baik konsentrasi makanan dan protein tinggi
est pada awal pengenceran dan secara bertahap
berkurang saat pengenceran berlangsung. Dialisis atau
diafiltrasi protein dalam denaturant terhadap suatu
buffer berair menyerupai kasus kedua, karena
konsentrasi denaturant berkurang sesuai prosedur
berlanjut. Dalam hal ini, bagaimanapun, konsentrasi protein
trasi tetap tidak berubah. Pengisian ulang juga bisa
dicapai dengan mengikat protein terlebih dahulu di denaturants ke
fase padat, yaitu ke matriks kolom, dan kemudian
menyeimbangkannya dengan buffer berair. Pada kasus ini,
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
33
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 52
konsentrasi protein tidak didefinisikan dengan baik. Setiap
prosedur memiliki kelebihan dan kekurangan dan
mungkin berlaku untuk satu protein, tetapi tidak untuk yang lain.
Jika protein di negara asal mengalami disulfida
ikatan, sistein harus dioksidasi dengan benar. Seperti itu
oksidasi dapat dilakukan dengan berbagai cara, misalnya, udara
oksidasi, pertukaran disulfida yang dikatalisis glutation,
atau menambah formasi diikuti oleh reduksi dan
oksidasi atau dengan reshuffle disulfida.
Lipatan protein telah menjadi topik yang intensif
penelitian sejak demonstrasi Anfinsen yang ribonu-
tolong bisa dilipat dari pengurangan penuh dan
negara terdenaturasi dalam percobaan in vitro. Lipat ini
hanya dapat dicapai jika urutan asam amino itu sendiri
berisi semua informasi yang diperlukan untuk melipat ke dalam
struktur asli. Inilah masalahnya, setidaknya sebagian, untuk
banyak protein. Namun, banyak protein lain tidak
melipat kembali dalam proses satu langkah sederhana. Sebaliknya, mereka melipat kembali
melalui berbagai perantara yang relatif
pakta dan memiliki berbagai tingkat sekunder
struktur, tetapi yang tidak memiliki struktur tersier yang kaku.
Interaksi yang tidak terarah dari sekunder yang sudah terbentuk ini
struktur akhirnya mengarah ke keadaan asli.
Namun, tidak adanya struktur yang kaku dalam hal ini
struktur sekunder yang terbentuk juga dapat mengekspos a
kelompok gugus hidrofobik dengan yang lainnya
rantai polipeptida, bukan ke poli mereka sendiri
segmen peptida, menghasilkan agregasi antarmolekul
gation. Efisiensi tinggi dalam pemulihan asli
protein sangat tergantung pada bagaimana hal ini
agregasi bentuk antara diminimalkan. Itu
penggunaan chaperone atau polietilen glikol telah
ditemukan cukup efektif untuk tujuan ini. Yang pertama adalah
protein, yang membantu melipat yang tepat dari protein lain
protein dengan menstabilkan zat antara dalam lipatan
proses dan yang terakhir berfungsi untuk melarutkan protein
selama melipat dan mengurangi agregasi interchain
acara
Lipatan protein sering kali difasilitasi oleh pelarut bersama,
seperti polietilen glikol. Seperti dijelaskan di atas,
protein fungsional dan sangat terhidrasi dalam
solusi berair. Solusi fisiologis sejati,
pernah, tidak hanya mengandung air tetapi juga berbagai ion dan
zat terlarut berat molekul rendah dan tinggi, seringkali sangat
konsentrasi tinggi. Ion-ion ini dan zat terlarut lainnya berperan
peran penting dalam mempertahankan struktur fungsional
protein. Ketika diisolasi dari alamnya
lingkungan, molekul protein dapat kehilangan ini
faktor penstabil dan karenanya harus distabilkan oleh
senyawa tertentu, seringkali pada konsentrasi tinggi.
Zat terlarut ini juga digunakan secara in vitro untuk membantu protein
melipat, dan untuk membantu menstabilkan protein selama
skala pemurnian dan produksi serta untuk jangka panjang
penyimpanan jangka. Zat terlarut seperti ini sering disebut pelarut bersama
ketika digunakan pada konsentrasi tinggi, karena pada tingkat tinggi
konsentrasi mereka juga berfungsi sebagai pelarut bersama
molekul air. Zat terlarut ini meliputi gula,
asam amino, garam anorganik dan organik, dan poliol.
Mereka mungkin tidak sangat mengikat protein, tetapi sebaliknya
biasanya berinteraksi lemah dengan permukaan protein
memberikan energi stabilisasi yang signifikan tanpa
fering dengan struktur fungsionalnya.
Ketika protein rekombinan diekspresikan dalam
sel eukariotik dan disekresikan ke dalam media, protein
umumnya dilipat ke dalam konformasi asli. Jika
protein memiliki situs untuk N-linked atau O-linked
glikosilasi, mereka mengalami berbagai tingkat
glikosilasi tergantung pada sel inang yang digunakan dan
tingkat ekspresi. Untuk banyak glikoprotein, glikosida-
lation tidak penting untuk melipat, karena mereka bisa
dilipat kembali ke konformasi asli tanpa karbo-
hidrat, glikosilasi juga sering tidak diperlukan untuk
mengikat reseptor dan karenanya aktivitas biologis.
Namun, glikosilasi dapat mengubah biologis penting
dan sifat fisikokimia protein, seperti
farmakokinetik, kelarutan, dan stabilitas.
n Teknik Khusus yang Cocok untuk Mengkarakterisasi
Lipat Protein
Teknik spektroskopi konvensional digunakan untuk memperoleh
informasi tentang struktur protein terlipat
dichroism melingkar (CD), fluoresensi, dan Fourier
mengubah spektroskopi inframerah (FTIR). CD dan
FTIR banyak digunakan untuk memperkirakan sekunder
struktur protein. Isi heliks a
protein dapat dengan mudah diestimasi dengan CD sejauh ini
Wilayah UV (180-260nm) dan oleh FTIR. Sinyal FTIR
dari struktur loop, bagaimanapun, kadang-kadang tumpang tindih
dengan yang timbul dari heliks-a. B-sheet memberi
sinyal CD lemah, yang variabel dalam posisi puncak
dan intensitas karena tikungan berinteraksi b-helai,
membuat CD far-UV tidak dapat diandalkan untuk evaluasi ini
struktur. Di sisi lain, FTIR dapat diandalkan
memperkirakan konten struktur-b serta membedakan
antara bentuk paralel dan antiparalel.
CD di wilayah dekat-UV (250-340nm) mencerminkan
lingkungan asam amino aromatik, yaitu,
triptofan, tirosin dan fenilalanin, juga
bahwa struktur disulfida. Spektroskopi fluoresensi
menghasilkan informasi tentang lingkungan tirosin dan
residu triptofan. Sinyal CD dan fluoresensi masuk
banyak kasus diubah secara drastis saat refolding dan
karenanya dapat digunakan untuk mengikuti pembentukan
struktur tersier dari protein.
Tak satu pun dari teknik ini dapat memberikan lipatan
struktur pada tingkat atom, yaitu, mereka memberi tidak
informasi tentang lokasi yang tepat dari setiap asil amino
residu dalam struktur tiga dimensi
protein. Informasi ini hanya dapat ditentukan oleh
Kristalografi sinar-X atau NMR. Namun, CD, FTIR,
dan metode spektroskopi fluoresensi cepat dan
34
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 53
membutuhkan konsentrasi protein yang lebih rendah daripada NMR
atau kristalografi sinar-X, dan setuju untuk
pemeriksaan protein di bawah sangat berbeda
kondisi. Ketika bentuk yang terjadi secara alami
protein tersedia, teknik-teknik ini, khususnya
dekat-UV CD dan spektroskopi fluoresensi, bisa
dengan cepat membahas apakah protein yang dilipat mengasumsikan
struktur terlipat asli.
Ketergantungan suhu spektroskopi ini
khasiatnya juga memberikan informasi tentang protein
Melipat. Karena struktur protein terlipat
dibangun di atas interaksi kooperatif dari banyak pihak
rantai dan ikatan peptida dalam molekul protein,
penghapusan satu interaksi oleh panas dapat menyebabkan
eliminasi kooperatif dari interaksi lain, memimpin
untuk terungkapnya molekul protein. Demikian banyak
protein menjalani transisi termal kooperatif
pada kisaran suhu yang sempit. Sebaliknya, jika
protein tidak sepenuhnya terlipat, mereka dapat menjalani non-
transisi termal kooperatif seperti yang diamati oleh a
perubahan sinyal bertahap pada rentang yang lebih luas
suhu.
Transisi struktur kooperatif semacam itu juga bisa
diperiksa dengan pemindaian kalorimetri diferensial.
Ketika struktur terbuka, itu membutuhkan panas. Seperti itu
penyerapan panas dapat ditentukan dengan menggunakan ini sangat
teknik kalorimetri sensitif.
Sifat hidrodinamik protein berubah
sangat melipat, pergi dari memanjang dan
struktur diperluas menjadi yang berbentuk bulat.
Kecepatan sedimentasi dan ukuran eksklusi kromato-
graphy (lihat bagian berjudul Analytical Techni-
ques) adalah dua teknik yang sering digunakan untuk
evaluasi sifat hidrodinamik, meskipun
yang terakhir jauh lebih mudah diakses. Sedimentasi
Koefisien (seberapa cepat suatu molekul bermigrasi dalam a
bidang sentrifugal) adalah fungsi dari kedua molekul
berat dan ukuran protein hidrodinamik, sementara
posisi elusi dalam kromatografi eksklusi ukuran
(seberapa cepat ia berpindah melalui pori-pori) hanya bergantung pada
ukuran hidrodinamik (lihat Bab 3). Di keduanya
metode, perbandingan koefisien sedimentasi
atau posisi elusi dengan protein globular dengan
berat molekul identik (atau sesuai kebutuhan
normalisasi berat molekul) memberikan informasi tentang
seberapa kompak protein dilipat.
Untuk protein oligomer, penentuan
berat molekul dari negara terkait dan akuisisi-
tion dari struktur kuartener dapat digunakan untuk menilai
struktur terlipat. Untuk interaksi yang kuat, spesifik
asosiasi protein membutuhkan kontak intersubunit
permukaan sangat cocok satu sama lain. Asso- seperti
struktur yang bermutasi, jika diperoleh dengan ikatan kovalen, mungkin
ditentukan hanya dengan natrium dodecilsulfat
elektroforesis gel poliakrilamid (PAGE). Jika protein
asosiasi melibatkan interaksi non-kovalen,
kesetimbangan sedimentasi atau hamburan cahaya
KASIH dapat menilai fenomena ini. Meskipun ini
teknik telah digunakan selama beberapa dekade dengan
beberapa kesulitan, teknologi yang muncul dalam analitik
ultrasentrifugasi dan hamburan sinar laser, dan
perangkat lunak yang sesuai untuk menganalisis hasil, miliki
sangat memudahkan penggunaan umum mereka, seperti yang dijelaskan dalam
detail di bawah ini.
Dua hamburan cahaya yang berbeda secara fundamental
teknik dapat digunakan dalam mengkarakterisasi rekombinan
protein. Hamburan cahaya “statis” mengukur informasi
ketegangan cahaya yang tersebar. Penyebaran cahaya “Dynamic”
ing mengukur fluktuasi cahaya yang tersebar
Intensitas sebagai molekul berdifusi masuk dan keluar dari sangat
daerah hamburan kecil (gerak Brown).
Hamburan cahaya statis sering digunakan secara online
bersama dengan kromatografi eksklusi ukuran
(DETIK). Sinyal hamburan sebanding dengan
produk dari massa molekul kali konsentrasi berat
tion. Membagi sinyal ini dengan satu sebanding dengan
konsentrasi, seperti yang diperoleh dari penyerap UV
bance atau detektor indeks bias, kemudian memberikan langsung
dan ukuran absolut dari massa setiap puncak yang dielusi
dari kolom, terlepas dari konfigurasi molekul
posisi mation dan elution. Hamburan SEC-statis ini
kombinasi memungkinkan identifikasi cepat apakah
keadaan asli protein adalah monomer atau
oligomer dan stoikiometri multi protein
kompleks. Ini juga sangat berguna dalam mengidentifikasi
massa agregat yang mungkin ada, dan dengan demikian
berguna untuk mengevaluasi stabilitas protein.
Dynamic Light hamburan (DLS) mengukur
laju difusi molekul, yang dapat diterjemahkan
ke dalam jari-jari Stokes, ukuran ukuran hidrodinamik.
Meskipun radius Stokes sangat berkorelasi dengan
massa molekul, juga sangat dipengaruhi oleh
bentuk molekul (konformasi) dan karenanya DLS jauh
kurang akurat daripada hamburan statis untuk pengukuran
massa molekul. Kekuatan besar DLS adalah kemampuannya
untuk menutupi rentang ukuran yang sangat luas dalam satu pengukuran,
dan untuk mendeteksi jumlah agregat besar yang sangat kecil
(<0,01% berat). Keuntungan penting lainnya berakhir
hamburan statis dengan SEC adalah pilihan buffer yang luas
kondisi dan tidak ada potensi hilangnya spesies melalui
menempel pada kolom.
Ultrasentrifuge analitik menggabungkan sebuah
sistem optik dan rotor dan sel khusus dalam tinggi
centrifuge kecepatan untuk memungkinkan pengukuran
konsentrasi sampel versus posisi dalam a
berputar sel centrifuge. Ada dua primer
strategi: menganalisis kecepatan sedimentasi
atau keseimbangan sedimentasi. Saat menganalisis
kecepatan sedimentasi rotor berputar sangat tinggi
kecepatan, sehingga sampel protein akan benar-benar mengendap
dan membentuk pelet. Tingkat di mana pelet protein
diukur oleh sistem optik untuk memperoleh
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
35
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 54
koefisien sedimentasi, yang tergantung pada keduanya
konformasi massa dan molekul. Kapan lebih dari
satu spesies hadir (misalnya, monomer plus kovalen
produk degradasi dimer), pemisahan dicapai
berdasarkan pada koefisien sedimentasi relatif masing-masing
jenis.
Karena koefisien sedimentasi sensitif
untuk konformasi molekul, dan dapat diukur dengan
presisi tinggi (~ 0,5%), kecepatan sedimentasi bisa
mendeteksi perbedaan yang cukup halus dalam konformasi.
Kemampuan ini dapat digunakan, misalnya, untuk mengonfirmasi bahwa a
protein rekombinan memiliki konformasi yang sama dengan
protein tipe liar alami, atau untuk mendeteksi perubahan kecil
dalam struktur dengan perubahan pH atau kandungan garam
centration yang mungkin terlalu halus untuk dideteksi oleh yang lain
teknik, seperti CD atau pemindaian diferensial
kalorimetri.
Dalam keseimbangan sedimentasi jauh lebih rendah
Kecepatan rotor dan gaya sentrifugal yang lebih ringan digunakan daripada
untuk kecepatan sedimentasi. Protein masih menumpuk
terlambat ke arah luar rotor, tetapi tidak ada pelet
terbentuk. Gradien konsentrasi ini di sel adalah
terus ditentang oleh difusi, yang mencoba
mengembalikan konsentrasi yang seragam. Setelah berputar untuk a
lama (biasanya 12-36 jam) keseimbangan adalah
tercapai di mana sedimentasi dan difusi berada
seimbang dan distribusi protein tidak lagi
berubah seiring waktu. Pada keseimbangan sedimentasi
distribusi konsentrasi hanya tergantung pada
massa molekul dan tidak tergantung pada molekul
bentuk. Jadi, asosiasi diri untuk pembentukan
dimer atau oligomer yang lebih tinggi (apakah reversibel atau
ireversibel) mudah terdeteksi, seperti yang mengikat
interaksi antara protein yang berbeda. Untuk reversibel
asosiasi, adalah mungkin untuk menentukan kekuatan
interaksi yang mengikat dengan mengukur sampel di atas a
berbagai konsentrasi protein.
Dalam aplikasi bioteknologi, sedimentasi
kesetimbangan sering digunakan sebagai "standar emas" untuk
mengkonfirmasikan bahwa protein rekombinan memiliki
massa molekul yang diharapkan dan keadaan aktif secara biologis
oligomerisasi dalam larutan. Itu juga bisa digunakan untuk
menentukan jumlah rata-rata glikosilasi atau
konjugasi moieties seperti polietilen glikol.
Pengukuran afinitas pengikatan untuk reseptor -
sitokin, antigen-antibodi, atau interaksi lainnya
juga terkadang berfungsi sebagai karakterisasi fungsional
protein rekombinan (meskipun beberapa di antaranya
interaksi terlalu kuat untuk diukur dengan ini
metode).
Modifikasi dan protein kimiawi spesifik lokasi
Pencernaan litik juga merupakan teknik yang ampuh untuk
mempelajari lipatan protein. Luasnya
modifikasi kimia atau pencernaan proteolitik
menunggu apakah situs tertentu terpapar ke
pelarut atau dimakamkan di bagian dalam protein
molekul dan karenanya tidak dapat diakses oleh modifikasi ini
tions. Misalnya, trypsin memotong ikatan peptida
sisi terminal-C residu dasar. Meskipun kebanyakan
protein mengandung beberapa residu dasar, paparan singkat
dari protein asli untuk trypsin biasanya hanya menghasilkan
beberapa peptida, karena pembelahan hanya terjadi pada
residu dasar yang dapat diakses, sedangkan pengobatan yang sama
dapat menghasilkan lebih banyak peptida bila dilakukan pada
protein terdenaturasi (terbuka), karena semua dasar
residu sekarang dapat diakses (lihat juga pemetaan peptida
di bagian Spektrometri Massa).
STABILITAS PROTEIN
Meskipun protein yang baru diisolasi dapat dilipat
struktur tiga dimensi yang berbeda, ini dilipat
struktur tidak selalu dipertahankan tanpa batas dalam
solusi berair. Alasannya adalah karena protein
tidak stabil secara kimia maupun fisik. Protein
permukaan secara kimia sangat heterogen dan
mengandung grup reaktif. Paparan jangka panjang ini
kelompok untuk tekanan lingkungan menyebabkan berbagai
perubahan kimia. Banyak protein, termasuk pertumbuhannya
faktor dan sitokin, memiliki residu sistein. Jika beberapa
dari mereka berada dalam bentuk bebas atau sulfhidril, mereka mungkin
menjalani pertukaran oksidasi dan disulfida. Oksidasi
dapat juga terjadi pada residu metionil. Hidrolisis bisa
terjadi pada ikatan peptida dan pada amida asparagin
dan residu glutamin. Modifikasi kimia lainnya
dapat terjadi pada ikatan peptida, triptofan, tirosin, dan
gugus amino dan karboksil. Tabel 4 mencantumkan keduanya a
sejumlah reaksi yang dapat terjadi selama pemurnian
dan penyimpanan protein dan metode yang dapat digunakan
untuk mendeteksi perubahan tersebut.
Stabilitas fisik protein dinyatakan sebagai
perbedaan energi bebas, DG U , antara asli dan
negara terdenaturasi. Jadi, ada molekul protein di dalamnya
keseimbangan antara dua kondisi di atas. Selama
karena lipatan ini dapat dibalik dan DG U positif, itu
Tidak masalah seberapa kecil DG U itu. Dalam banyak kasus,
reversibilitas ini tidak berlaku. Ini sering terlihat
ketika DG U dikurangi dengan pemanasan. Sebagian besar protein
denaturasi pada pemanasan dan agregasi berikutnya
molekul terdenaturasi menghasilkan dena- ireversibel
turation. Dengan demikian, lipatan dibuat tidak dapat dipulihkan oleh
pengumpulan:
Keadaan asli (¼¼)
∆GU
Status terdenaturasi ¼¼)
k
Status agregat
Oleh karena itu, setiap tekanan yang menurunkan DG U dan
Peningkatan k akan menyebabkan akumulasi yang tidak dapat dikembalikan lagi
bentuk protein yang tidak aktif. Tekanan seperti itu mungkin
termasuk modifikasi kimia seperti dijelaskan di atas
dan parameter fisik, seperti pH, kekuatan ionik,
konsentrasi protein, dan suhu. Pengembangan
dari formulasi yang sesuai yang memperpanjang umur simpan
36
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 55
protein rekombinan sangat penting ketika akan digunakan
sebagai terapi manusia.
Penggunaan agen penstabil protein untuk meningkatkan
stabilitas penyimpanan protein telah menjadi kebiasaan.
Senyawa ini mempengaruhi stabilitas protein dengan meningkatkan
ing DG U . Namun, senyawa ini juga bisa
meningkatkan k dan karenanya efek bersihnya pada jangka panjang
penyimpanan protein juga bervariasi di antara protein
seperti pada kondisi penyimpanan.
Ketika lipatan tidak bisa dibalikkan karena agenda
Untuk itu, meminimalkan langkah yang tidak dapat diubah harus ditingkatkan
stabilitas, dan seringkali ini dapat dicapai oleh
penambahan deterjen ringan. Sebelum memilih
konsentrasi dan jenis deterjen yang tepat,
efeknya pada DG U harus dievaluasi dengan cermat.
Pendekatan lain untuk meningkatkan stabilitas penyimpanan
protein adalah untuk meliofilisasi, atau beku-kering
protein (lihat Bab 4). Liofilisasi dapat meminimalkan
langkah agregasi selama penyimpanan, karena keduanya
modifikasi dan agregasi kimia berkurang di
tidak adanya air. Efek dari liofilisasi
proses itu sendiri pada DG U dan k tidak sepenuhnya dipahami
dan karenanya proses seperti itu harus dioptimalkan untuk masing-masing
terapi protein.
TEKNIK ANALITIS
Di salah satu bagian sebelumnya tentang "Teknik
Khusus Cocok untuk Mengkarakterisasi Lipat ”a
sejumlah teknik (spektroskopi) disebutkan
yang dapat secara khusus digunakan untuk memantau pelipatan protein.
Ini adalah: CD, FTIR, spektroskopi fluoresensi, dan
DSC. Apalagi ultrasentrifugasi analitik dan cahaya
teknik hamburan dibahas secara lebih rinci. Di
bagian ini teknik lain akan dibahas.
n Teknik Blotting
Metode blotting membentuk ceruk penting dalam bioteknologi
nologi. Mereka digunakan untuk mendeteksi tingkat yang sangat rendah
molekul unik dalam lingkungan protein, nukleat
asam, dan komponen seluler lainnya. Mereka dapat mendeteksi
agregat atau kerusakan produk yang terjadi selama
penyimpanan jangka panjang dan dapat digunakan untuk mendeteksi
komponen dari sel host yang digunakan dalam memproduksi
protein rekombinan.
Sifat fisik
terpengaruh
Metode analisis
Oksidasi
Cys
Disulfida
Intrachain
Merantaikan
Bertemu, Trp, Tyr
Hidrofobik
Ukuran
Hidrofobik
RP-HPLC, SDS-PAGE
Kromatografi eksklusi ukuran
Spektrometri massa
Ikatan peptida
hidrolisis
Ukuran
Kromatografi eksklusi ukuran
SDS-PAGE
Migrasi N ke O
Ser, Thr
Hidrofobik
Kimia
RP-HPLC tidak aktif dalam reaksi Edman (digunakan untuk menentukan urutan asam amino pada
fragmen peptida dari protein terdegradasi secara enzimatik) (Gbr. 15)
a-Carboxy to
b-karboksi
migrasi
Asp, Asn
Hidrofobik
Kimia
RP-HPLC tidak aktif dalam reaksi Edman (digunakan untuk menentukan urutan asam amino pada
fragmen peptida dari protein terdegradasi secara enzimatik) (Gbr. 15)
Deamidasi
Asn, Gln
Biaya
Kromatografi penukar ion
Asilasi
kelompok a-amino,
kelompok e-amino
Biaya
Kromatografi penukar ion
Spektrometri massa
Esterifikasi /
karboksilasi
Glu, Asp, terminal-C
Biaya
Kromatografi penukar ion
Spektrometri massa
Struktur sekunder
perubahan
Hidrofobik
Ukuran
Dtk / struktur tert
Dtk / struktur tert
Pengumpulan
Dtk / struktur tert,
pengumpulan
RP-HPLC
Kromatografi eksklusi ukuran
CD
FTIR
Hamburan cahaya
Ultrasentrifugasi analitik
Tabel 4 n Reaksi umum yang mempengaruhi stabilitas protein.
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
37
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 56
Biomolekul ditransfer ke membran
("Blotting"), dan membran ini kemudian diperiksa
pereaksi spesifik untuk mengidentifikasi molekul yang diinginkan.
Membran yang digunakan dalam bercak protein terbuat dari a
berbagai bahan termasuk nitroselulosa, nilon,
dan polyvinylidine difluoride (PVDF), semuanya
mengikat protein dengan rajin.
Sampel cair dapat dianalisis dengan metode
disebut dot blots atau slot blots. Solusi yang mengandung
biomolekul yang menarik disaring melalui membran
yang menangkap biomolekulnya. Perbedaan antara
tween dot blot dan slot blot adalah yang pertama menggunakan a
format lingkaran atau disk, sedangkan yang terakhir adalah persegi panjang
konfigurasi. Metode terakhir memungkinkan untuk lebih
kuantifikasi tepat biomolekul yang diinginkan oleh
metode pemindaian dan mengaitkan hasil terintegrasi dengan
yang diperoleh dengan jumlah material yang diketahui.
Seringkali sampel dikenai beberapa jenis
fraksinasi, seperti PAGE, sebelum langkah blotting.
Teknik awal, Southern blotting, dinamai demikian
penemunya, EM Southern, digunakan untuk mendeteksi DNA
fragmen. Ketika prosedur ini diadaptasi untuk RNA
fragmen dan protein, koordinat kompas lainnya
dipilih sebagai label untuk prosedur ini, yaitu,
bercak utara untuk RNA dan bercak barat untuk protein.
Western blots melibatkan penggunaan antibodi berlabel untuk
mendeteksi protein spesifik.
Transfer Protein
Setelah PAGE, transfer protein dari gel ke
membran dapat dicapai dalam beberapa cara.
Awalnya, blotting dicapai dengan tindakan kapiler. Di
metode yang umum digunakan ini, membran ditempatkan
antara gel dan kertas penyerap. Cairan dari gel
ditarik menuju kertas penyerap dan protein
ditangkap oleh membran intervensi. Sebuah noda, atau
kesan, dari protein dalam gel dengan demikian dibuat.
Transfer protein ke membran bisa
terjadi di bawah pengaruh medan listrik, juga.
Medan listrik diterapkan secara tegak lurus ke
bidang asli digunakan dalam pemisahan sehingga maksimal
jarak yang dibutuhkan protein untuk bermigrasi adalah hanya
ketebalan gel, dan karenanya transfer protein
dapat terjadi dengan sangat cepat. Metode yang terakhir ini disebut
electroblotting.
Sistem Deteksi
Setelah transfer terjadi, langkah selanjutnya adalah
mengidentifikasi keberadaan protein yang diinginkan. Di
Selain berbagai metode pewarnaan kolorimetri,
noda dapat diperiksa dengan pereaksi khusus untuk
protein tertentu, seperti misalnya, antibodi terhadap a
protein yang menarik. Teknik ini disebut immuno-
mengotori. Di bidang bioteknologi, immunoblotting adalah
digunakan sebagai tes identitas untuk produk yang menarik. Sebuah
antibodi yang mengenali protein yang diinginkan digunakan di
contoh ini. Kedua, kadang-kadang immunoblotting
digunakan untuk menunjukkan tidak adanya protein inang. Di dalam
Misalnya, antibodi ditingkatkan terhadap protein
organisme di mana protein rekombinan memiliki
telah diungkapkan. Metode yang terakhir ini dapat membuktikan
kemurnian protein yang diinginkan.
Tabel 5 mencantumkan langkah-langkah utama yang diperlukan untuk blotting
prosedur untuk menjadi sukses. Setelah transfer
protein selesai, sisa situs pengikatan protein
pada membran perlu diblokir sehingga
antibodi yang digunakan untuk deteksi hanya bereaksi di lokasi
dari molekul target, atau antigen, dan tidak pada beberapa
lokasi tidak spesifik. Setelah memblokir, spesifik
antibodi diinkubasi dengan membran.
Antibodi bereaksi dengan protein spesifik pada
membran hanya di lokasi protein itu karena
interaksi spesifiknya dengan antigennya. Kapan
teknik imunobloting digunakan, metode masih
diperlukan untuk mengenali lokasi interaksi
antibodi dengan protein spesifiknya. Sejumlah
prosedur dapat digunakan untuk mendeteksi kompleks ini (Tabel 6).
Antibodi itu sendiri dapat diberi label dengan radio-
penanda aktif seperti 125 I dan ditempatkan di kontak langsung
dengan film sinar-X. Setelah pemaparan membran ke
film untuk periode yang sesuai, film dikembangkan dan a
foto negatif dibuat dari lokasi
radioaktivitas pada membran. Atau, yang
antibodi dapat dikaitkan dengan enzim yang, pada
penambahan reagen yang sesuai, mengkatalisasi suatu warna atau
reaksi ringan di situs antibodi. Ini
prosedur memerlukan pemurnian antibodi dan
secara khusus beri label. Lebih sering, antibodi "sekunder"
digunakan. Antibodi primer adalah yang mana
mengenali protein yang diminati. Sekunder
antibodi kemudian merupakan antibodi yang secara khusus mengenali
melemahkan antibodi primer. Cukup umum
Antibodi primer meningkat pada kelinci. Sekunder
antibodi kemudian bisa menjadi antibodi yang ditimbulkan pada yang lain
binatang, seperti kambing, yang mengenali kelinci
tubuh. Karena antibodi sekunder ini mengenali kelinci
antibodi pada umumnya, dapat digunakan sebagai reagen generik
untuk mendeteksi antibodi kelinci di sejumlah berbeda
1. ■ Transfer protein ke membran, misalnya dengan cara elektroblot.
2. ■ Memblokir situs pengikatan residu protein pada membran dengan
protein asing seperti protein susu.
3. ■ Rawat membran dengan antibodi yang mengenali
protein yang menarik. Jika antibodi ini diberi label dengan a
mendeteksi grup kemudian lanjutkan ke langkah 5.
4. ■ Tetaskan membran dengan antibodi sekunder yang
mengenali antibodi primer yang digunakan pada langkah 3. Ini
antibodi diberi label dengan kelompok pendeteksi.
5. ■ Rawat membran dengan reagen yang sesuai untuk ditemukan
situs lampiran membran berlabel
antibodi pada langkah 4 atau langkah 5.
Tabel 5 n Langkah-langkah utama dalam mengotori protein ke membran.
38
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 57
protein yang menarik yang telah dibesarkan pada kelinci.
Dengan demikian, antibodi primer secara khusus mengenali dan
kompleks protein unik, dan anti-sekunder
tubuh, berlabel sesuai, digunakan untuk deteksi (lihat
bagian berjudul ELISA dan Gbr. 10).
Antibodi sekunder dapat diberi label dengan a
kelompok penanda radioaktif atau enzimatik dan digunakan untuk
mendeteksi beberapa antibodi primer yang berbeda. Demikian,
daripada memurnikan sejumlah primer berbeda
antibodi, hanya perlu satu antibodi sekunder
dimurnikan dan diberi label untuk pengakuan semua primer
antibodi. Karena penggunaannya yang luas, banyak yang umum
antibodi sekunder tersedia secara komersial di Indonesia
kit yang berisi sistem deteksi dan ikuti
prosedur rutin dan mudah.
Selain meningkatkan antibodi terhadap
konstituen amino asil protein, antibodi spesifik
dies dapat digunakan untuk mengenali post-unik
komponen translasi dalam protein, seperti
residu phosphotyrosyl, yang penting selama
transduksi sinyal, dan bagian karbohidrat
glikoprotein.
Gambar 9 mengilustrasikan sejumlah deteksi
metode yang dapat digunakan pada imunoblot. Itu
antibodi primer, atau jika nyaman, sekunder
antibodi, dapat memiliki label yang sesuai untuk deteksi.
Mereka mungkin diberi label dengan tag radioaktif sebagai
disebutkan sebelumnya. Kedua, antibodi ini bisa
ditambah dengan enzim seperti lobak
peroxidase (HRP) atau alkaline phosphatase (AP).
Substrat ditambahkan dan dikonversi menjadi tidak larut,
produk berwarna di lokasi protein-primer
produk antibodi - antibodi sekunder - HRP. Sebuah al-
substrat ternatif dapat digunakan yang menghasilkan a
produk chemiluminescent. Reaksi kimia mengarah
untuk produksi cahaya yang dapat mengekspos foto-
grafis atau film sinar-X. Kromogenik dan kimia
sistem pendeteksian minescent memiliki kemampuan yang sebanding
sensitivitas terhadap metode radioaktif. Mantan
metode deteksi menggantikan metode yang terakhir,
karena masalah yang terkait dengan penanganan radioaktif
solusi bahan dan limbah radioaktif adalah
dihilangkan.
Seperti diilustrasikan pada Gambar 9, streptavidin, atau
alternatifnya avidin, dan biotin dapat memainkan peranan penting
peran dalam mendeteksi protein pada imunoblot. Ini adalah
karena biotin membentuk kompleks yang sangat erat dengannya
streptavidin dan avidin. Kedua, protein-protein ini
multimerik dan mengandung empat situs pengikatan untuk biotin.
Ketika biotin secara kovalen terkait dengan protein seperti
antibodi dan enzim, streptavidin berikatan dengan
terikat kovalen biotin, sehingga mengenali situs pada
membran tempat protein yang menarik berada.
S
P
E
S
P
S
S
P
P
E
SA
Ab Utama
Ab Sekunder
Ag
Ag
Ag
S
B
B
B
B
E
E
P
Dukungan membran
Dukungan membran
Dukungan membran
Gambar 9 n Sistem deteksi imunobloting umum digunakan untuk mendeteksi antigen (Ag) pada membran. Singkatan: Ab, antibodi;
E, enzim (seperti HRP atau AP); S, substrat; P, produk (baik berwarna dan tidak larut atau chemiluminescent); B, biotin; Sa, streptavidin.

Antibodi diberi label dengan penanda radioaktif seperti
125 I.

Antibodi dihubungkan dengan enzim seperti HRP atau AP.
Pada inkubasi dengan substrat, produk berwarna tidak larut
terbentuk di lokasi antibodi. Atau, yang
lokasi antibodi dapat dideteksi menggunakan substrat
yang menghasilkan produk chemiluminescent, gambar
yang dibuat pada film fotografi.

Antibodi diberi label dengan biotin. Streptavidin atau avidin adalah
ditambahkan sangat mengikat ke biotin. Setiap streptavidin
Molekul memiliki empat situs pengikatan. Ikatan yang tersisa
situs dapat bergabung dengan molekul biotin lainnya
terkait secara kovalen dengan HRP atau AP.
Tabel 6 n Metode deteksi yang digunakan dalam teknik blotting.
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
39
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 58
n Immunoassays
ELISA
Program uji ELISA (linked immunosorbent assay)
memberikan sarana untuk mengukur secara kuantitatif
sejumlah kecil protein dalam cairan biologis dan
berfungsi sebagai alat untuk menganalisis protein spesifik selama
pemurnian. Prosedur ini mengambil keuntungan dari
pengamatan bahwa permukaan plastik mampu menyerap
jumlah protein yang rendah tetapi terdeteksi. Ini solid
uji fase. Karena itu, antibodi terhadap tertentu
protein yang diinginkan diizinkan untuk teradsorpsi ke permukaan
piring mikrotitrasi. Setiap lempeng dapat berisi hingga 96
sumur sehingga beberapa sampel dapat diuji. Setelah
menginkubasi antibodi di sumur piring untuk a
periode waktu tertentu, kelebihan antibodi dihilangkan
dan sisa situs pengikatan protein pada plastik
diblokir oleh inkubasi dengan protein inert. Beberapa
piring mikrotitrasi dapat disiapkan pada satu waktu sejak itu
antibodi yang melapisi piring mempertahankan ikatannya
kapasitas untuk periode yang diperpanjang. Selama ELISA,
contoh larutan yang mengandung protein yang menarik adalah
diinkubasi di dalam sumur dan protein (Ag) adalah
ditangkap oleh antibodi yang melapisi permukaan sumur.
Kelebihan sampel dihilangkan dan antibodi lain yang
sekarang memiliki enzim (E) yang terhubung dengannya ditambahkan
bereaksi dengan antigen yang terikat.
Format yang dijelaskan di atas disebut sandwich
uji karena antigen yang menarik terletak di antara
antibodi pada permukaan sumur titer dan antibodi
mengandung enzim terkait. Gambar 10 menggambarkan a
sejumlah format yang dapat digunakan dalam ELISA.
Substrat yang cocok ditambahkan dan enzim dihubungkan
untuk antibodi-antigen-antibodi juga kompleks
verifikasikan senyawa ini ke produk berwarna. Itu
jumlah produk yang diperoleh sebanding dengan
Enzim teradsorpsi di sumur piring. Sebuah standar
kurva dapat disiapkan jika diketahui konsentrasi
antigen diuji dalam sistem ini, dan jumlah
antigen dalam sampel yang tidak diketahui dapat diperkirakan dari
kurva standar ini. Sejumlah enzim bisa jadi
digunakan dalam ELISA. Namun, yang paling umum adalah
HRP dan AP. Berbagai substrat untuk masing-masing enzim
tersedia yang menghasilkan produk berwarna saat
dikatalisis oleh enzim terkait. Absorbansi dari
solusi produk berwarna diukur di atas piring
pembaca, instrumen yang dengan cepat mengukur
absorbansi di semua 96 sumur dari pelat mikrotitrasi,
dan pemrosesan data dapat diotomatisasi untuk cepat
throughput informasi. Perhatikan deteksi itu
sebagian pendekatan paralel yang dibahas dalam
bagian tentang Blotting. Format ELISA di atas hanya
salah satu dari banyak metode yang berbeda. Misalnya,
sumur mikrotitrasi dapat dilapisi langsung dengan
antigen daripada memiliki antibodi spesifik
melekat pada permukaan. Kuantisasi dibuat oleh
dibandingkan dengan jumlah antigen yang diketahui digunakan
melapisi sumur individu.
Pendekatan lain, kali ini setelah
pengikatan antigen baik langsung ke permukaan atau ke
antibodi di permukaan, adalah menggunakan antibodi
khusus untuk antibodi yang mengikat antigen protein,
S
E
E
E
B
B
B
E
E
S
B
SA
Ag
Ag
Ag
P
S
P
S
P
S
P
P
Gambar 10 n Contoh beberapa format untuk ELISA di mana antibodi spesifik diserap ke permukaan lempeng mikrotitrasi.
(Lihat Gambar 9 untuk singkatan.) Antibodi diwakili oleh struktur tipe Y. Produk P berwarna dan jumlah yang dihasilkan adalah
diukur dengan spektrometer atau pembaca plat.
40
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 59
yaitu, antibodi sekunder. Yang terakhir ini, sekunder,
antibodi mengandung enzim terkait yang digunakan untuk mendeteksi
tion. Seperti yang sudah dibahas pada bagian blotting,
keuntungan dari pendekatan ini adalah antibodi tersebut
dapat diperoleh dalam kemurnian tinggi dan dengan yang diinginkan
Enzim terkait dengan mereka dari sumber komersial.
Dengan demikian, satu sumber antibodi terkait enzim dapat
digunakan dalam pengujian untuk antigen protein yang berbeda.
Jika uji sandwich digunakan, maka antibodi
dari berbagai spesies perlu digunakan untuk setiap sisi
roti lapis. Skenario yang mungkin adalah kelinci itu
antibodi digunakan untuk melapisi sumur mikrotitrasi;
antibodi tikus, mungkin antibodi monoklonal,
digunakan untuk kompleks dengan antigen dan kemudian seekor kambing
imunoglobulin anti-tikus yang mengandung HRP terkait
atau AP digunakan untuk tujuan deteksi.
Seperti dengan imunoblot yang dibahas di atas, strepta-
vidin atau avidin dapat digunakan dalam tes ini jika biotin
terkait secara kovalen dengan antibodi dan enzim
(Gbr. 10).
Jika label radioaktif digunakan sebagai pengganti
enzim dalam prosedur di atas, maka pengujiannya adalah a
radioimmunoassay fase padat (RIA). Tes adalah
menjauh dari penggunaan radioisotop, karena
masalah dengan keamanan dan pembuangan radioaktif
limbah dan karena uji non-radioaktif memiliki perbandingan
kepekaan mampu.
n Elektroforesis
Metodologi analitik untuk mengukur protein
sifat berasal dari yang digunakan dalam pemurnian mereka.
Perbedaan utama adalah sistem yang digunakan untuk analisis
memiliki daya penyelesaian lebih tinggi dan batas deteksi
dari yang digunakan dalam pemurnian. Dua mayor
metode untuk analisis memiliki basis dalam kromato-
teknik grafis atau elektroforesis.
HALAMAN
Salah satu metode paling awal untuk analisis protein adalah
HALAMAN. Dalam pengujian ini, protein, menjadi amfoter
molekul dengan muatan positif dan negatif
kelompok dalam struktur utama mereka, dipisahkan
sesuai dengan muatan listrik bersih mereka. Faktor kedua
yang bertanggung jawab atas pemisahan adalah massa
protein. Dengan demikian, seseorang dapat mempertimbangkan lebih tepatnya bahwa
rasio biaya terhadap massa protein menentukan bagaimana mereka
dipisahkan dalam medan listrik. Biaya dari
protein dapat dikontrol oleh pH larutan dalam
dimana protein dipisahkan. Semakin jauh
protein berasal dari nilai pI-nya, yaitu pH yang dimilikinya
muatan bersih nol, semakin besar muatan bersih dan
karenanya semakin besar rasio muatan terhadap massa. Karena itu,
arah dan kecepatan migrasi protein
tergantung pada pH gel. Jika pH gel di atas
nilai pI-nya, maka protein bermuatan negatif dan
karenanya bermigrasi ke arah anoda. Semakin tinggi pH
gel semakin cepat migrasi. Jenis elektro
phoresis disebut elektroforesis gel asli.
Komponen utama gel poliakrilamida adalah
air. Namun, mereka memberikan dukungan yang fleksibel
bahwa setelah protein dikenai listrik
bidang untuk periode waktu yang tepat, ini menyediakan a
matriks untuk menahan protein di tempat sampai mereka bisa
terdeteksi dengan reagen yang sesuai. Dengan menyesuaikan
jumlah akrilamida yang digunakan dalam gel ini, satu
dapat mengontrol migrasi material dalam gel.
Semakin banyak akrilamida, semakin banyak rintangan untuk
protein untuk bermigrasi di medan listrik.
Penambahan deterjen, natrium dodecyl
sulfat (SDS), ke sistem pemisahan elektroforesis
memungkinkan pemisahan berlangsung terutama sebagai a
fungsi dari ukuran protein. Ion dodil sulfat
membentuk kompleks dengan protein, menghasilkan lipatan-
dari protein, dan jumlah deterjen
kompleks adalah sebanding dengan massa protein.
Semakin besar protein, semakin banyak deterjen
rumit. Dodecyl sulfate bermuatan negatif
ion. Ketika protein dalam larutan SDS, bersih
efeknya adalah muatan protein sendiri
kewalahan oleh com- dodecyl sulfate
bingung dengan itu, sehingga protein mengambil jaring
muatan negatif sebanding dengan massa mereka.
HALAMAN di hadapan SDS umumnya
dikenal sebagai SDS-PAGE. Semua protein mengandung jaring
muatan negatif, dengan protein lebih besar mengikat lebih banyak
SDS tetapi dengan rasio biaya terhadap massa cukup
konstan di antara protein. Contoh SDS-
PAGE ditunjukkan pada Gambar 11. Di sini, SDS-PAGE digunakan
untuk memantau ekspresi reseptor G-CSF dan G-CSF
(panel B) di media kultur yang berbeda.
Karena semua protein pada dasarnya sama
rasio biaya terhadap massa, bagaimana pemisahan dapat terjadi? Ini
dilakukan dengan mengendalikan konsentrasi akrilamida
di jalur protein bermigrasi di medan listrik.
Semakin besar konsentrasi akrilamida, semakin banyak
sulit bagi molekul protein besar untuk bermigrasi
relatif terhadap molekul protein yang lebih kecil. Ini adalah beberapa
kali dianggap sebagai efek pengayakan, karena semakin besar
konsentrasi akrilamida, semakin kecil pori
ukuran dalam gel poliakrilamid. Memang kalau
konsentrasi akrilamida cukup tinggi, beberapa
protein dengan berat molekul tinggi mungkin tidak bermigrasi sama sekali
dalam gel. Karena dalam SDS-PAGE proteinnya adalah
didenaturasi, ukuran hidrodinamiknya, dan karenanya
tingkat keterbelakangan oleh efek pengayakan, secara langsung
terkait dengan massa mereka. Protein mengandung disulfida
obligasi akan memiliki struktur yang jauh lebih kompak dan
mobilitas yang lebih tinggi untuk massa mereka kecuali disulfida
berkurang sebelum elektroforesis.
Seperti dijelaskan di atas, elektroforesis gel asli
dan SDS-PAGE sangat berbeda dalam hal
mekanisme pemisahan protein. Dalam gel asli
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
41
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 60
elektroforesis, protein dalam keadaan asli dan
bermigrasi dengan biaya sendiri. Dengan demikian, elektrofor
esis dapat digunakan untuk mengkarakterisasi protein dalam bahasa asli
negara. Dalam SDS-PAGE, protein dibuka dan
bermigrasi berdasarkan massa molekulnya. Sebagai
kasus menengah, elektroforesis asli biru adalah
dikembangkan, di mana protein diikat oleh pewarna,
Biru Coomassie, digunakan untuk menodai pita protein. Pewarna ini
diyakini mengikat ke permukaan hidrofobik
protein dan untuk menambahkan muatan negatif ke protein.
Protein terikat pewarna masih dalam keadaan asli
dan bermigrasi berdasarkan biaya bersih, yang tergantung
pada muatan intrinsik dari protein dan
jumlah pewarna bermuatan negatif. Ini adalah
sangat berguna untuk menganalisis protein membran,
yang cenderung agregat tanpa adanya deterjen.
Pewarna mencegah protein dari agregasi oleh
mengikat ke permukaan hidrofobik mereka.
Isoelectric Focusing (IEF)
Metode lain untuk memisahkan protein berdasarkan mereka
sifat elektroforetik adalah untuk mengambil keuntungan dari mereka
titik isoelektrik. Dalam menjalankan pertama gradien pH adalah
didirikan dalam gel menggunakan campuran kecil
ampolit berat molekul dengan nilai pI yang bervariasi.
Kondisi pH tinggi ditetapkan di lokasi
katoda. Kemudian, protein dibawa pada gel,
misalnya, di lokasi di mana pH-nya 7. Di medan listrik
protein akan bermigrasi sampai mencapai pH pada
gel dengan muatan bersihnya nol. Jika protein itu untuk
bermigrasi jauh dari nilai pH ini yang bisa diperoleh a
mengisi ulang dan bermigrasi ke nilai pI-nya lagi, mengarah
ke efek pemfokusan.
Elektroforesis Gel Dua Dimensi
Metode di atas dapat digabungkan menjadi sebuah prosedur
disebut elektroforesis gel 2-D. Protein adalah yang pertama
difraksionasi oleh IEF berdasarkan nilai pI mereka. Mereka
kemudian dikenakan SDS-PAGE tegak lurus terhadap
Dimensi pertama dan difraksinasi berdasarkan mol
bobot protein. SDS-PAGE tidak bisa
dilakukan sebelum IEF, karena SDS sekali mengikat ke dan
mendenaturasi protein yang tidak lagi bermigrasi berdasarkan
pada nilai pI mereka.
Deteksi Protein dalam Gel Poliakrilamid
Meskipun gel poliakrilamida memberikan fleksibilitas
mendukung protein, seiring waktu protein akan
menyebar dan menyebar di dalam gel. Akibatnya,
praktik yang biasa dilakukan adalah memperbaiki protein atau menjebaknya di
lokasi tempat mereka bermigrasi. Ini tercapai
dengan menempatkan gel dalam solusi pemasangan di mana
protein menjadi tidak larut.
Ada banyak metode untuk pewarnaan protein
gel, tetapi dua yang paling umum dan dipelajari dengan baik
metode pewarnaan dengan Coomassie biru atau oleh
metode menggunakan perak. Metode yang terakhir digunakan jika
diperlukan peningkatan sensitivitas. Prinsip dari
mengembangkan noda biru Coomassie adalah hidro-
interaksi fobik pewarna dengan protein. Jadi, itu
gel mengambil warna di mana pun protein berada. Menggunakan
jumlah standar protein, jumlah protein atau
kontaminan dapat diperkirakan. Kuantifikasi menggunakan
metode pewarnaan perak kurang tepat. Namun, karena
untuk peningkatan sensitivitas metode ini, sangat rendah
kadar kontaminan dapat dideteksi. Memperbaiki ini
dan prosedur pewarnaan mendenaturasi protein. Karenanya,
protein dipisahkan dalam kondisi asli, seperti pada
akan asli atau elektroforesis gel asli biru, akan
didenaturasi. Untuk mempertahankan keadaan asli, gel bisa
diwarnai dengan tembaga atau ion logam lainnya.
Elektroforesis Kapiler
Dengan kemajuan terbaru dalam instrumentasi dan teknologi
Namun, elektroforesis kapiler telah meningkat
kDa
202
133
71
42
31
18
7
202
133
71
42
31
18
7
1
2
3
4
5
6
7
8
9
kDa
(A)
(B)
1
2
3
4
5
6
7
8
9
Gambar 11 n SDS-PAGE dari reseptor G-CSF, sekitar 35 kDa ( A )
dan G-CSF, sekitar 20 kDa ( B ). Protein ini diekspresikan dalam
media kultur yang berbeda (jalur 1–9). Posisi berat molekul
standar diberikan di sisi kiri. Band-band dikembangkan
dengan antibodi terhadap reseptor G-CSF ( A ) atau G-CSF ( A ) setelahnya
mengotori.
42
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 61
hadir dalam analisis protein rekombinan.
Daripada memiliki matriks, seperti dalam PAGE through
dimana protein bermigrasi, mereka bebas dalam larutan di
medan listrik dalam batas-batas tabung kapiler
dengan diameter 25 hingga 50 mikrometer. Kapiler
tabung melewati sinar ultraviolet atau fluores-
detektor cence yang mengukur keberadaan protein
bermigrasi di medan listrik. Pergerakan satu
protein relatif terhadap yang lain adalah fungsi dari
massa molekul dan muatan bersih pada protein.
Yang terakhir dapat dipengaruhi oleh pH dan analit dalam
larutan. Teknik ini hanya diperoleh sebagian
penerimaan untuk analisis rutin, karena kesulitan
dalam reproduksibilitas kapiler dan dalam memvalidasi
sistem ini. Namun demikian, ini adalah analitis yang kuat
alat untuk karakterisasi protein rekombinan
selama pengembangan proses dan dalam studi stabilitas.
n Kromatografi
Teknik kromatografi digunakan secara luas di
bioteknologi tidak hanya dalam proses pemurnian protein
dures (lihat Bab 3), tetapi juga dalam menilai
integritas produk. Prosedur rutin adalah
sangat otomatis sehingga perbandingannya mirip
sampel dapat dibuat. Sistem analitis terdiri
dari autosampler yang akan mengambil jumlah yang diketahui
(biasanya volume yang diketahui) dari bahan untuk analisis dan
secara otomatis menempatkannya dalam aliran solusi menuju
menuju kolom pemisahan yang digunakan untuk memisahkan
mencicipi. Bagian lain dari sistem ini adalah modul pompa
yang menyediakan laju aliran yang dapat direproduksi. Sebagai tambahan,
sistem pemompaan dapat memberikan gradien yang
mengubah sifat larutan seperti pH, ionik
kekuatan, dan hidrofobik. Sistem deteksi
(atau mungkin beberapa detektor secara seri) terletak di
outlet kolom. Ini mengukur relatif
jumlah protein yang keluar dari kolom. Digabungkan ke
detektor adalah sistem akuisisi data yang dibutuhkan
sinyal dari detektor dan mengintegrasikannya ke dalam a
nilai yang terkait dengan jumlah material (Gbr. 12). Kapan
protein muncul, sinyal mulai meningkat, dan
ketika protein melewati detektor, sinyal
selanjutnya menurun. Area di bawah puncak
sinyal sebanding dengan jumlah material yang
telah melewati detektor. Dengan menganalisis diketahui
jumlah protein, area versus jumlah protein
plot dapat dihasilkan dan ini dapat digunakan untuk memperkirakan
jumlah protein ini dalam sampel di bawah lainnya
keadaan. Manfaat lain dari terintegrasi ini
sistem kromatografi adalah tingkat
nents yang muncul dari waktu ke waktu dapat diperkirakan relatif
untuk protein utama yang diinginkan sedang dianalisis. Ini adalah sebuah
fungsi yang sangat berguna ketika jangka panjang
stabilitas produk sedang dalam evaluasi.
Sistem kromatografi menawarkan banyak
strategi berbeda untuk berhasil memisahkan protein
campuran dan untuk mengukur protein individu
komponen (lihat Bab 3). Berikut ini diuraikan
beberapa strategi ini.
Kromatografi Pengecualian Ukuran
Sesuai namanya, prosedur ini terpisah
protein berdasarkan ukuran atau berat molekul atau
bentuk. Matriks ini terdiri dari manik-manik yang sangat halus.
rongga dan pori-pori yang dapat diakses oleh molekul a
ukuran tertentu atau lebih kecil, tetapi tidak dapat diakses hingga lebih besar
molekul. Prinsip teknik ini adalah
distribusi molekul antara volume
solusi dalam manik-manik versus volume
solusi yang mengelilingi manik-manik. Molekul kecil miliki
akses ke volume yang lebih besar daripada molekul besar. Sebagai
solusi mengalir melalui kolom, molekul bisa
berdifusi bolak-balik, tergantung ukurannya, di
dan keluar dari pori-pori manik-manik. Molekul yang lebih kecil
dapat berada di dalam pori-pori untuk jangka waktu yang terbatas
sedangkan molekul yang lebih besar, tidak bisa masuk ini
spasi, teruskan bersama dalam aliran fluida.
Molekul berukuran menengah menghabiskan perantara
Pelarut
1
Pelarut
2
Pompa
Pemisahan
kolom
Detektor
Keluaran
Akuisisi data
sistem
integrator
Gambar12 n Komponen
stasiun kromatografi tipikal
tion. Pompa bergabung
pelarut 1 dan 2 secara tepat-
makan rasio untuk menghasilkan pH,
konsentrasi garam, atau hidro-
gradien fobia. Protein itu
difraksinasi pada kolom
melewati detektor yang
mengukur kemunculannya.
Informasi dari detektor
digunakan untuk menghasilkan kroma-
togram dan kerabat
jumlah masing-masing komponen.
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
43
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 62
jumlah waktu dalam pori-pori. Mereka bisa menjadi
difraksinasi dari molekul besar yang tidak dapat mengakses
ruang matriks sama sekali dan dari molekul kecil itu
memiliki akses gratis ke volume ini dan menghabiskan sebagian besar waktu
waktu dalam manik-manik. Molekul protein dapat merusak
upeti antara volume dalam manik-manik ini dan
volume yang dikecualikan berdasarkan pada massa dan bentuk
molekulnya. Distribusi ini didasarkan pada kerabat
konsentrasi protein dalam manik-manik versus
volume yang dikecualikan.
Kromatografi eksklusi ukuran dapat digunakan untuk
memperkirakan massa protein dengan mengkalibrasi
kolom dengan serangkaian protein globular yang diketahui
massa. Namun, pemisahan tergantung pada mol
bentuk cular (konformasi) serta massa, dan
protein yang sangat panjang — mengandung protein
daerah fleksibel, tidak teratur — dan glikoprotein akan
sering tampak memiliki massa sebanyak dua sampai
tiga kali nilai sebenarnya. Protein lain mungkin
berinteraksi lemah dengan matriks kolom dan menjadi
terbelakang, sehingga tampak memiliki yang lebih kecil
massa. Dengan demikian, sedimentasi atau hamburan cahaya
metode lebih disukai untuk pengukuran massa yang akurat
ment. Seiring waktu, protein dapat mengalami angka
perubahan yang mempengaruhi massa mereka. Ikatan peptida
dalam protein dapat terhidrolisis, menghasilkan dua
rantai polipeptida yang lebih kecil. Lebih umum, ukuran
kromatografi eksklusi digunakan untuk menilai
bentuk protein yang terjaga keamanannya. Gambar 13 menunjukkan
contoh dari ini. Puncak pada 22 menit mewakili
protein asli. Puncaknya pada 15 menit adalah
protein agregat dan pada 28 menit menggambarkan
protein terdegradasi menghasilkan polipeptida yang lebih kecil
rantai. Agregasi dapat terjadi ketika protein
Molekul terbuka sedikit dan terbuka
permukaan yang tertarik ke komplementer
permukaan pada molekul yang berdekatan. Interaksi ini
dapat menyebabkan dimerisasi atau penggandaan molekul
berat atau untuk oligomer dengan berat molekul lebih tinggi.
Dari profil kromatografi, mekanismenya
agregasi sering dapat terlibat. Jika dimer,
trimers, tetramers, dll. diamati, kemudian
tion terjadi oleh interaksi bertahap monomer
dengan dimer, trimer, dll. Jika dimer, tetramer,
octamers, dll diamati, maka agregat bisa
saling berinteraksi. Terkadang, hanya satu
mer dan agregat berat molekul tinggi
diamati, menunjukkan bahwa spesies antara
secara kinetik durasi pendek dan molekul protein
rentan terhadap agregasi bergabung menjadi sangat besar
kompleks berat molekul.
Kinerja Tinggi Fase Terbalik
Kromatografi cair
Kromo cair cair kinerja tinggi fase terbalik
graphy (RP-HPLC) mengambil keuntungan dari
sifat fobik protein. Kelompok fungsional
pada kolom berisi matriks dari satu ke atas
delapan belas atom karbon dalam rantai hidrokarbon. Itu
semakin panjang rantai ini, semakin banyak hidro-fobia adalah matriks.
Bercak hidrofobik protein berinteraksi dengan
matriks kromatografi hidrofobik. Protein adalah
kemudian dielusi dari matriks dengan meningkatkan
sifat hidrofobik dari pelarut yang lewat
kolom. Asetonitril adalah pelarut yang umum digunakan,
meskipun pelarut organik lainnya seperti etanol juga
dapat dipekerjakan. Pelarut dibuat asam oleh
penambahan asam trifluoroacetic, karena protein memiliki
peningkatan kelarutan pada nilai pH lebih lanjut dihilangkan
dari pi mereka. Gradien dengan peningkatan konsentrasi
pelarut hidrofobik dilewatkan melalui
kolom. Protein yang berbeda memiliki hidropho
bisnis dan dielusi dari kolom tergantung pada
"potensi hidrofobik" dari pelarut.
Teknik ini bisa sangat kuat. Mungkin
mendeteksi penambahan satu atom oksigen ke
protein, seperti ketika residu metionil dioksidasi, atau
ketika hidrolisis amida bagian pada a
residu glutamyl atau asparginyl terjadi. Ikatan disulfida
pembentukan atau pengocokan juga mengubah hidrofobik
karakteristik protein. Oleh karena itu, RP-HPLC dapat
digunakan tidak hanya untuk menilai homogenitas dari
protein, tetapi juga mengikuti jalur degradasi
terjadi selama penyimpanan jangka panjang.
Kromatografi fase-terbalik proteolitik
pencernaan protein rekombinan dapat berfungsi untuk mengidentifikasi
protein ini. Pencernaan enzimatik menghasilkan keunikan
peptida yang mengelusi pada waktu retensi yang berbeda atau pada
konsentrasi pelarut organik yang berbeda. Bahkan,
peta, atau kromatogram, dari peptida yang timbul dari
Absorbansi
10
20
30
Waktu
Gambar 13 n Ukuran kromatografi eksklusi dari rekombinan
protein yang, pada penyimpanan, menghasilkan agregat dan lebih kecil
peptida.
44
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 63
pencernaan enzimatik satu protein sangat berbeda
dari peta yang diperoleh dari protein lain. Beberapa
berbagai protease, seperti trypsin, chymotrypsin dan
endoproteinase lain, digunakan untuk tes identitas ini
(Lihat di bawah di bawah Spektrometri Massa).
Kromatografi Interaksi Hidrofobik
Pendamping RP-HPLC adalah interaksi hidrofobik
kromatografi (HIC), meskipun pada prinsipnya ini
Metode terakhir adalah kromatografi fase normal, yaitu,
di sini sistem pelarut berair daripada organik
satu digunakan untuk memisahkan protein. Hidrofobik
karakteristik solusi dimodulasi oleh
konsentrasi garam anorganik. Amonium sulfat
dan natrium klorida sering digunakan sejak ini
Senyawa ini sangat larut dalam air. Dalam
adanya konsentrasi garam yang tinggi (hingga beberapa
molar), protein tertarik ke permukaan hidrofobik
pada matriks resin yang digunakan dalam teknik ini. Sebagai
konsentrasi garam menurun, protein memiliki lebih sedikit
untuk matriks dan akhirnya dielusi dari
kolom. Metode ini tidak memiliki kekuatan penyelesaian RP-
HPLC, tetapi merupakan metode yang lebih lembut, karena pH rendah
nilai atau pelarut organik seperti yang digunakan dalam RP-HPLC dapat
merugikan beberapa protein.
Kromatografi Pertukaran Ion
Teknik ini memanfaatkan elektronik
sifat muatan protein. Beberapa asil amino
residu bermuatan negatif dan lainnya
bermuatan positif. Biaya bersih protein
dapat dimodulasi oleh pH lingkungannya
relatif terhadap nilai protein pI. Pada nilai pH
lebih rendah dari pI, protein memiliki positif bersih
mengisi, sedangkan pada nilai pH lebih besar dari pI, itu
protein memiliki muatan negatif bersih. Seberang menarik
kromatografi penukar ion. Resin dalam hal ini
prosedur dapat berisi kelompok fungsional dengan posisi
biaya tive atau negatif. Dengan demikian, bermuatan positif
protein mengikat matriks bermuatan negatif dan
protein bermuatan negatif mengikat positif
matriks yang dibebankan. Protein dipindahkan dari
resin dengan meningkatkan garam, misalnya, natrium klorida,
konsentrasi. Protein dengan muatan bersih berbeda
dapat dipisahkan satu sama lain selama elusi
dengan peningkatan gradien garam. Pilihan
kondisi resin dan elusi yang dibebankan tergantung
pada protein yang menarik.
Sebagai pengganti mengubah kekuatan ionik
solusi, protein dapat dielusi dengan mengubah pH
medium, yaitu, dengan menggunakan gradien pH. Ini
metode ini disebut kromatofokus dan protein
dipisahkan berdasarkan nilai pI mereka. Saat pelarut
pH mencapai nilai pI dari protein spesifik, yaitu
protein memiliki muatan netto nol dan tidak lagi
tertarik ke matriks yang dibebankan dan karenanya dielusi.
Teknik Kromatografi Lainnya
Grup fungsional lain dapat dilampirkan ke
untuk memanfaatkan matriks matrik yang unik
sifat protein tertentu. Metode afinitas ini
Namun, odologi lebih sering digunakan di Internet
proses pembuatan daripada dalam teknik analitik
(lihat Bab 3). Misalnya, afinitas konvensional
skema pemurnian antibodi menggunakan Protein-A atau
-G kolom. Protein-A atau -G secara khusus mengikat
antibodi. Antibodi terdiri dari daerah variabel
dan wilayah konstan (lihat Bab 4). Variabel
daerah bersifat spesifik antigen dan karenanya bervariasi
secara berurutan dari satu antibodi ke yang lain, sementara
daerah konstan adalah umum untuk setiap subkelompok
antibodi. Wilayah konstan berikatan dengan Protein-A
atau -G.
n Bioassay
Sangat penting untuk pengembangan terapi protein
Ini adalah untuk memiliki uji yang mengidentifikasi biologisnya
fungsi. Metode kromatografi dan elektroforesis
odologi dapat mengatasi homogenitas suatu biother-
apeutik dan berguna dalam menyelidiki stabilitas
parameter. Namun, perlu juga dipastikan
apakah protein memiliki bioaktivitas yang dapat diterima.
Bioaktivitas dapat ditentukan baik secara in vivo, yaitu oleh
pemberian protein ke hewan dan memastikan-
beberapa perubahan dalam tubuhnya (fungsi), atau
in vitro. Bioassays in vitro memonitor respons a
jalur sel reseptor atau mikrobiologis atau jaringan spesifik
ketika protein terapi ditambahkan ke sistem.
Contoh dari bioassay in vitro adalah peningkatan
Sintesis DNA dengan adanya terapi
protein yang diukur dengan penggabungan radio-
timid berlabel aktif. Faktor protein mengikat
reseptor pada permukaan sel yang memicu sekunder
untuk mengirim sinyal ke inti sel
mensintesis DNA. Pengikatan faktor protein ke
permukaan sel tergantung pada jumlah
faktor hadir. Gambar 14 menyajikan respons dosis
kurva penggabungan timidin sebagai fungsi dari
konsentrasi faktor. Pada konsentrasi rendah,
faktor terlalu rendah untuk memicu respons. Sebagai
konsentrasi meningkat, penggabungan timi
makan terjadi, dan pada konsentrasi yang lebih tinggi jumlahnya
penggabungan timidin berhenti meningkat sebagai DNA
sintesis terjadi pada tingkat maksimum. SEBUAH
kurva standar dapat diperoleh dengan menggunakan kuantitas yang dikenal
tities dari faktor protein. Perbandingan lainnya
solusi yang mengandung jumlah faktor yang tidak diketahui
dengan kurva standar ini maka akan menghasilkan kuantitatif
perkiraan konsentrasi faktor. Melalui pengalaman-
ence selama pengembangan terapi protein
peutic, nilai diperoleh untuk berfungsi penuh
protein. Perbandingan selanjutnya untuk nilai ini bisa
digunakan untuk memastikan hilangnya aktivitas selama stabilitas
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
45
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 64
studi, atau perubahan aktivitas ketika amino asil
residu protein dimodifikasi.
Bioassay in vitro lainnya dapat mengukur perubahan
dalam jumlah sel atau produksi faktor protein lain
sebagai respons terhadap stimulasi sel oleh protein
terapeutik. Jumlah protein sekunder
diproduksi dapat diperkirakan dengan menggunakan ELISA.
n Spektrometri Massa
Kemajuan terbaru dalam pengukuran molekul
massa protein telah membuat teknik ini menjadi
alat analisis penting. Sementara metode ini digunakan
di masa lalu untuk menganalisis molekul kecil yang mudah menguap,
berat molekul protein dengan muatan tinggi
massa lebih dari 100 kilodalton (kDa) sekarang dapat
ditentukan secara akurat.
Karena ketepatan metode ini,
modifikasi translasi seperti asetilasi atau
glikosilasi dapat diprediksi. Massa baru
bentuk protein yang muncul selama studi stabilitas
memberikan informasi tentang sifat formulir ini. Untuk
Misalnya, peningkatan massa 16 Dalton menunjukkan
bahwa atom oksigen telah ditambahkan ke protein
seperti yang terjadi ketika residu metionil dioksidasi menjadi
residu metionil sulfoksida. Massa molekul
peptida yang diperoleh setelah pencernaan proteolitik dan
pemisahan dengan HPLC menunjukkan dari wilayah mana
struktur utama mereka diturunkan. Seperti HPLC
kromatogram disebut "peta peptida."
contoh ditunjukkan pada Gambar 15. Ini diperoleh oleh
mencerna protein dengan pepsin dan selanjutnya
memisahkan peptida yang dicerna dengan membalikkan HPLC.
Pola yang sangat khas untuk protein ini adalah
disebut "sidik jari protein." Puncak diidentifikasi
oleh elusi kali pada HPLC. Jika peptida memilikinya
massa molekul berbeda dari yang diharapkan
dari urutan utama, sifat dari
modifikasi peptida itu dapat terlibat.
Selain itu, perkiraan massa molekul dapat dibuat
untuk peptida yang diperoleh dari
pencernaan teolitik. Massa molekul yang berbeda
dari nilai yang diharapkan menunjukkan bahwa bagian dari
molekul protein telah diubah, yaitu glikosilasi
atau modifikasi lain telah diubah, atau itu
protein yang diteliti masih mengandung
kontaminan.
Cara lain yang bisa dilakukan spektrometri massa
digunakan sebagai alat analisis dalam urutan
peptida. Struktur berulang, peptida
Ikatan, dalam peptida cenderung menghasilkan fragmen
peptida matang yang berbeda secara bertahap oleh suatu amino
residu asil. Perbedaan massa antara dua
fragmen menunjukkan asam amino dihapus dari
satu fragmen untuk menghasilkan yang lain. Kecuali untuk
leusin dan isoleusin, masing-masing asam amino memiliki
massa berbeda dan karenanya urutan dapat dibaca
dari spektograf massa. Penghapusan bertahap bisa
terjadi baik dari terminal amino atau karboksi
ujung.
Dengan mengubah tiga komponen dasar
spektrometer massa, sumber ion, penganalisa dan
detektor, berbagai jenis pengukuran mungkin
dilakukan. Sumber ion tipikal yang menguap
protein adalah ionisasi electrospray (EI), atom cepat
bombardir dan ion sekunder cair. Umum
analisis meliputi quadrupole, sektor magnetik, dan
waktu instrumen penerbangan. Fungsi dari
analisa adalah untuk memisahkan biomolekul terionisasi
berdasarkan rasio massa terhadap muatan mereka. Detektor
mengukur arus setiap kali ditimpa oleh
partikel bermuatan. El dan laser yang dibantu matriks
desorpsi (MALDI) adalah dua sumber yang bisa
menghasilkan protein volatil dengan berat molekul tinggi. Di
metode sebelumnya, tetesan dihasilkan oleh
penyemprotan atau nebulisasi larutan protein ke dalam
sumber spektrometer massa. Sebagai pelarut
menguap, protein tetap tertinggal dalam gas
fase dan melewati penganalisis ke
detektor. Dalam MALDI, protein dicampur dengan a
matriks yang menguap saat terkena sinar laser,
dengan demikian membawa protein ke dalam fase gas. Sebuah
contoh analisis massa MALDI ditunjukkan pada
Gambar 16, menunjukkan ion yang bermuatan tunggal (116118
Dalton) dan ion bermuatan ganda (58036.2) untuk a
protein murni. Karena protein bersifat multi-muatan
senyawa, sejumlah komponen diamati
mewakili massa untuk mengisi formulir, masing-masing berbeda
dari yang berikutnya dengan satu biaya. Dengan memasukkan berbagai
biaya untuk massa untuk mengisi nilai, molekul
3
H
- th
ymidine uptak
e
Log (faktor ng)
Gambar 14 n Sebuah bioassay in vitro menunjukkan respons mitogenik
di mana timidin radioaktif dimasukkan ke dalam DNA dalam
Kehadiran peningkatan jumlah faktor protein.
46
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 65
massa protein dapat diperkirakan. Langkah terakhir
bersifat empiris karena hanya rasio massa terhadap muatan
terdeteksi dan bukan biaya bersih untuk itu
partikel.
SIMPULAN PENUTUP
Dengan munculnya protein rekombinan sebagai manusia
terapi, perlunya metode untuk mengevaluasi mereka
struktur, fungsi, dan homogenitas telah menjadi
terpenting. Berbagai teknik analisis digunakan
untuk mengkarakterisasi primer, sekunder, dan tersier
struktur protein dan untuk menentukan kualitas,
kemurnian dan stabilitas produk rekombinan.
Bioassays membangun aktivitasnya.
BACAAN LEBIH LANJUT
Butler JE, ed. (1991). Imunokimia Fase Padat
Immunoassay. Boca Raton, FL: CRC Press.
Crabb JW, ed. (1995). Teknik dalam Kimia Protein VI.
San Diego, CA: Academic Press.
Coligan J, Dunn B, Ploegh H, Speicher D, Wingfield P, eds.
(1995). Protokol saat ini dalam Ilmu Protein. Baru
York: J. Wiley & Sons.
Creighton TE, ed. (1989). Struktur Protein: A Praktis
Pendekatan. Oxford, Inggris: IRL Press.
Crowther JR (1995). ELISA, Teori dan Praktek. Totowa, NJ:
Humana Press.
300
250
150
58036.2
Intensitas relatif (%)
116118
100
50
0
50000 100000 150000
Massa / Mengisi
200000 250000
200
Gambar 16 n Analisis massa MALDI dari rekombinan murni
b-sekretase manusia. Angka sesuai dengan yang dibebankan sendiri
dan ion bermuatan dua kali lipat.
ma
300
250
200
150
100
Absorbansi pada 215 mm
50
P14.4
P14.8
P15.3
P19
P27
P24
P33.7
P34.4
P35.6
P37.7
P36.6
P39
P44.1
P44.9
0
0
5
10
15
20
25
Waktu (min.)
30
35
40
45
50
Gambar 15 n Peta peptida pepsin intisari b-sekretase manusia rekombinan. Setiap peptida diberi label berdasarkan waktu elusi dalam HPLC.
ANALISIS BIOPHISIS DAN BIOKIMIA PROTEIN YANG MENARIK
47
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 66
Dunbar BS (1994). Protein Blotting: Suatu Pendekatan Praktis.
New York: Oxford University Press.
Gregory RB, ed. (1994). Interaksi Protein-Pelarut. Baru
York: Marcel Dekker.
Hames BD, Rickwood D, eds. (1990). Gel Elektroforesis dari
Protein: Pendekatan Praktis, edisi ke-2. New York:
IRL Tekan.
Jiskoot W, Crommelin DJA, eds. (2005). Metode untuk
Analisis Struktural Farmasi Protein.
Arlington, VA: AAPS Press.
Landus JP, ed. (1994). Handbook of Electro Capillary
phoresis. Boca Raton, FL: CRC Press.
McEwen CN, Larsen BS, eds. (1990). Spektrometri Massal dari
Bahan Biologis. New York: Marcel Dekker.
Harga CP, Newman DJ, eds. (1991). Prinsip dan Praktek PT
Immunoassay. New York: Stockton Press.
Schulz GE, Schirmer RH, eds. (1979). Prinsip-prinsip Protein
Struktur. New York: Springer-Verlag.
Shirley BA, ed. (1995). Stabilitas dan Lipat Protein. Totowa,
NJ: Humana Press.
48
ARAKAWA DAN PHILO
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 67

3
Produksi dan Pemrosesan Hilir PT
Senyawa Biotek
Farida Kadir
Apoteker Pendidikan Postacademic (POA), Bunnik, Belanda
Mic Hamers dan Paul Ives
SynCo Bio Partners BV, Amsterdam, Belanda
PENGANTAR
Meningkatnya penggunaan terapi protein telah menciptakan suatu
meningkatnya kebutuhan akan proses praktis dan ekonomis-
teknik bernyanyi. Akibatnya, produksi bioteknologi-
Metode-metode tion telah berkembang pesat akhir-akhir ini
tahun, khususnya di daerah di mana sekali pakai, sekali pakai
teknologi produksi dapat diterapkan untuk mengurangi banyak hal
masalah ekonomi dan kualitas yang timbul dari
pembuatan produk ini (Hodge, 2004).
Saat memproduksi protein untuk penggunaan terapeutik, a
sejumlah masalah harus dipertimbangkan terkait dengan
pembuatan, pemurnian dan karakterisasi
produk. Produk bioteknologi untuk terapi
gunakan harus memenuhi spesifikasi yang ketat, terutama ketika
digunakan melalui rute parenteral (Walter dan Werner, 1993).
Dalam bab ini beberapa aspek produksi dan
pemurnian akan ditangani secara singkat. Untuk keterangan lebih lanjut
pembaca disebut literatur yang disebutkan.
PRODUKSI
n Sistem Ekspresi
Pertimbangan Umum
Sistem ekspresi untuk protein yang menarik bagi terapi
termasuk sel pro dan eukariotik (bakteri, ragi,
jamur, tanaman, sel serangga, sel mamalia, dan
hewan transgenik). Pilihan sistem tertentu
akan ditentukan sebagian besar oleh alam dan
asal protein yang diinginkan, tujuan penggunaan
produk, jumlah yang dibutuhkan, dan biaya.
Pada prinsipnya, protein apa pun dapat diproduksi menggunakan
organisme hasil rekayasa genetika, tetapi tidak setiap jenis
protein dapat diproduksi oleh setiap jenis sel. Dalam
sebagian besar kasus protein asing bagi sel inang
yang harus memproduksinya dan meskipun terjemahan
kode genetik dapat dilakukan oleh sel, yaitu
modifikasi protein pasca-terjemahan mungkin
berbeda dibandingkan dengan produk aslinya.
Saat ini, lebih dari 60 terjemahan pasca berbeda
modifikasi protein diketahui dan modifikasi ini
ifikasi adalah spesies dan / atau tipe sel spesifik. Itu
jalur metabolisme yang mengarah ke modifikasi ini adalah
ditentukan secara genetik oleh sel inang. Jadi, bahkan jika
sel-sel mampu menghasilkan post yang diinginkan
modifikasi terjemahan, seperti glikosilasi, masih
pola glikosilasi yang dihasilkan mungkin berbeda dari
bahwa dari protein asli. Misalnya, prokariotik
sel, seperti bakteri, tidak mampu berproduksi
glikoprotein, karena mereka kekurangan post-terjemahan ini
kapasitas modifikasi. Salah satu solusi yang memungkinkan untuk ini
masalah adalah menggunakan tipe sel yang terkait erat dengan
jenis sel penghasil protein asli mungkin,
terutama ketika seseorang menganggap bahwa lebih dari 50% dari
protein manusia adalah glikoprotein. Oleh karena itu, untuk
protein turunan manusia, sel mamalia atau transgenik
Hewan seringkali merupakan pilihan yang lebih baik daripada bakteri atau ragi.
Namun, perkembangan di bidang glikosilasi
rekayasa mungkin memungkinkan bakteri untuk bereproduksi
langkah-langkah modifikasi pasca terjemahan yang umum dilakukan
sel eukariotik (Borman, 2006). Meski masih di dalamnya
masa bayi, teknologi ini bisa berdampak signifikan
pada sistem produksi masa depan.
Fitur umum dari protein diekspresikan dalam
sistem biologis yang berbeda tercantum pada Tabel 1
(Walter et al., 1992). Namun, itu harus disimpan
keberatan bahwa ada pengecualian untuk tabel ini untuk spesifik
sistem produk / ekspresi.
Hewan Transgenik
Gen asing dapat dimasukkan ke dalam hewan
tikus, kelinci, babi, domba, kambing, dan sapi
teknik transfer dan kloning nuklir. Yang diinginkan
protein diekspresikan dalam susu betina
keturunan. Selama menyusui, ASI dikumpulkan
lemak susu dikeluarkan dan susu skim digunakan
sebagai bahan awal untuk pemurnian
protein.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 68
Keuntungan dari teknologi ini adalah relatif
metode murah untuk menghasilkan protein yang diinginkan secara luas
jumlah. Kerugian adalah kekhawatiran tentang
kesehatan Hewan. Beberapa protein dinyatakan dalam
kelenjar susu bocor kembali ke sirkulasi dan
menyebabkan efek kesehatan negatif yang serius. Contohnya adalah
ekspresi erythropoetin pada sapi. walaupun
protein diekspresikan dengan baik dalam susu, itu disebabkan
efek kesehatan yang parah dan percobaan ini
berhenti.
Strategi pemurnian dan kebutuhan kemurnian-
KASIH untuk protein dari susu tidak berbeda dari
yang berasal dari sel bakteri atau mamalia
sistem, dengan kemungkinan pengecualian untuk protein
penggunaan oral ketika dinyatakan dalam susu yang sebaliknya
dikonsumsi oleh manusia. Dalam kasus terakhir,
taminants ”diketahui aman untuk dikonsumsi.
Teknologi hewan transgenik untuk
protein protein farmasi masih dalam proses
pengembangan. Tidak ada produk yang mencapai pasar
namun. Rincian lebih lanjut tentang teknologi ini disajikan
dalam Bab 7.
Tanaman
Protein terapeutik juga dapat diekspresikan pada tanaman
dan kultur sel tanaman (lihat Bab 1). Contohnya,
albumin manusia telah diekspresikan dalam kentang dan
tembakau. Apakah kendaraan produksi ini
layak secara ekonomi belum ditetapkan. Itu
kurangnya stabilitas genetik tanaman kadang-kadang a
kekurangan. Selain itu, sebagian besar tanaman mengandung fenolik
oksidase yang dapat merusak protein yang diekspresikan
ekstraksi dari bahan tanaman. Rute yang lebih baik adalah
ekspresi protein dalam biji yang dapat dimakan. Untuk
Misalnya, padi dan gandum dapat dipanen dan mudah
disimpan untuk waktu yang lama sebagai bahan baku
sumber. Terutama untuk terapi oral atau vaksin
ini mungkin solusi ideal untuk menghasilkan yang besar
sejumlah terapi murah, karena
taminants ”diketahui aman untuk dikonsumsi (lihat
Bab 21).
Penggunaan sistem pabrik untuk produksi
protein farmasi masih dalam percobaan
tahap. Rincian lebih lanjut tentang teknologi ini
dikirim dalam Bab 7.
n Sistem Budidaya
Secara umum, sel bisa dibudidayakan di pembuluh yang mengandung
media pertumbuhan cair yang tepat di mana
sel-sel yang melekat pada mikrosfer, atau bebas di
penskorsan atau dalam keadaan diam sebagai monolayer,
atau terperangkap dalam matriks (biasanya dipadatkan dengan
agar). Metode kultur akan menentukan skala
metode pemisahan dan pemurnian.
Budidaya skala produksi umumnya dilakukan
dalam fermentor atau bioreaktor. Sistem bioreaktor dapat
diklasifikasikan menjadi empat jenis: tangki berpengaduk,
pengangkutan udara, pembawa mikro (mis. bioreaktor fixed-bed) dan
bioreaktor membran (mis. perfusi serat berlubang
bioreaktor) (Gbr. 1). Karena keandalannya dan
pengalaman dengan desain dan meningkatkan potensi,
tangki yang diaduk masih yang paling umum digunakan
bioreaktor. Meningkatnya penggunaan pakai di
proses pembuatan juga menghasilkan
penampilan bioreaktor sekali pakai yang mengambil
bentuk kantong plastik besar yang bisa diaduk
atau diguncang untuk menghasilkan pencampuran untuk transfer massal. Sejauh ini
penerapan teknologi semacam ini untuk
pembuatan produk komersial belum
dilaporkan.
Kinetika pertumbuhan sel dan formasi produk
tion tidak hanya akan menentukan jenis bioreaktor yang digunakan,
tetapi juga bagaimana proses pertumbuhan dijalankan. Tiga jenis
protokol fermentasi umumnya digunakan: (1)
batch, (2) fed-batch, dan (3) produksi terus menerus
protokol. Dalam semua kasus, sel melewati empat
fase khas: lag, pertumbuhan eksponensial, stasioner,
dan fase kematian (lihat Bab 1). Kultur sel memiliki
untuk bebas dari mikroorganisme yang tidak diinginkan yang mungkin
menghancurkan sel-sel atau menghadirkan bahaya bagi pasien.
Ini membutuhkan langkah-langkah ketat untuk kedua prosedur
dan bahan yang digunakan (Berthold dan Walter, 1994; WHO
1998).
Contoh sel hewan yang paling sering
Monly digunakan untuk menghasilkan protein yang menarik secara klinis
Sel ovarium hamster Cina (CHO), bayi hamster
sel ginjal (BHK), sel tumor limfoblastoid
(Produksi interferon), sel melanoma (plasminogen
aktivator), dan sel tumor hibridisasi (monoklonal
antibodi).
Protein
fitur
Prokariotik
bakteri
Eukariotik
ragi
Eukariotik
mamalia
sel
Konsentrasi Tinggi
Tinggi
Rendah
Molekuler
berat
Rendah
Tinggi
Tinggi
Jembatan SS
Batasan
Tidak ada batasan
Tidak ada batasan
Sekresi
Tidak
Ya Tidak
iya nih
Pengumpulan
negara
Penyertaan
tubuh
Tunggal,
asli
Tunggal,
asli
Melipat
Memuaskan
Benar
Melipat
Benar
Melipat
Glikosilasi No
Mungkin
Mungkin
Retrovirus
Tidak
Tidak
Mungkin
Pyrogen
Mungkin
Tidak
Tidak
Tabel 1 n Fitur umum protein dari berbagai
asal kal.
50
KADIR ET AL.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 69
n Media Kultivasi
Untuk mencapai pertumbuhan sel yang optimal
sangat penting bahwa tidak hanya kondisi seperti pH,
Tensi dan suhu oksigen dipilih dan
dikontrol dengan tepat, tetapi juga media dengan
nutrisi yang tepat disediakan.
Media yang digunakan untuk kultur sel mamalia adalah
kompleks dan terdiri dari campuran berbagai komponen
nents, seperti gula, asam amino, elektrolit,
vitamin, serum anak sapi janin dan campuran pepton,
faktor pertumbuhan, hormon, dan protein lainnya
(Meja 2). Banyak dari bahan-bahan ini yang sudah dicampur sebelumnya
baik diencerkan atau sebagai campuran homogen dari pow-
ders. Untuk menyiapkan media final, komponennya adalah
dilarutkan dalam air murni sebelum filtrasi steril.
Beberapa suplemen, terutama serum janin,
sangat menghargai keberadaan kontaminasi
protein dan mungkin menyulitkan pemurnian
Prosedur. Selain itu, komposisi serumnya adalah
variabel; itu tergantung pada hewan individu, musim
tahun ini, perawatan pemasok, dll. Penggunaan serum
dapat memperkenalkan materi adventif seperti virus,
mikoplasma, bakteri dan jamur menjadi biakan
sistem (Berthold dan Walter, 1994). Selanjutnya,
kemungkinan adanya prion yang dapat menyebabkan penularan
sible spongiform encephalitis (TSE) hampir menghalangi
penggunaan bahan sapi, domba atau kambing. Namun, jika
penggunaan bahan ini tidak bisa dihindari, seseorang harus mengikuti
pedoman yang relevan di mana sumber selektif
material masih merupakan ukuran kunci untuk keselamatan (EMEA,
1999a). Banyak potensi masalah ini saat digunakan
serum dalam media kultur sel telah menghasilkan
pembuatan formulasi bebas serum, terutama oleh
pemasok menengah, dan kecenderungan ke arah
Udara keluar
Sel
Membingungkan
Pemeriksaan suhu
Pengendali
Pengendali
Pengendali
Pendinginan
air
(A)
Pendinginan
air
Gizi
makan
Motor
Asam Basa
Penyembur
Panen
Udara steril
Pemeriksaan oksigen
pemeriksaan pH
Gambar 1A dan representasi skematik
pengiriman bioreaktor tangki berpengaduk.
Sumber: Diadaptasi dari Klegerman
dan Groves, 1992.
Tabung draft
Udara
(B)
Gambar 1B n Representasi skematis bioreaktor pengangkutan udara.
Sumber: Diadaptasi dari Klegerman dan Groves, 1992.
PROSES PRODUKSI DAN DOWNSTREAM SENYAWA BIOTEK
51
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 70
Port inokulasi
Nutrisi
(D)
Nutrisi
Sel dalam
annular
ruang
Lumen
Membran bagian dalam
Membran luar
Produk
Jaket air
Produk
Gambar 1D n Representasi skematis bioreaktor perfusi serat berongga. Sumber: Diadaptasi dari Klegerman dan Groves, 1992.
Udara
Penukar gas
Pompa
(C)
Manik-manik Microcarrier
Gambar 1C n Representasi skematik
pengiriman tangki pengaduk fixed-bed
bioreaktor. Sumber: Diadaptasi dari
Klegerman dan Groves, 1992.
52
KADIR ET AL.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 71
penghapusan komponen medium kompleks yang tidak terdefinisi lainnya
nents. Benar-benar bebas serum dan ditentukan secara kimiawi
media telah terbukti memberikan hasil yang memuaskan di
pengaturan produksi skala industri dalam kasus-kasus tertentu,
misalnya dalam produksi antibodi monoklonal.
n Kontaminan
Kualitas biasanya diukur dari segi produk
kemurnian dan konsistensi produk (reproduktifitas). Sebuah
Pertimbangan penting dalam proses pengembangan
dari skema pemurnian adalah kemurnian tertinggi
wajib. Untuk aplikasi farmasi, produk
kemurnian sebagian besar adalah ‡ 99% bila digunakan sebagai parenteral
(Berthold dan Walter, 1994; EMEA 1999b).
Proses pemurnian harus menghasilkan
teh dengan karakteristik yang jelas untuk penggunaan manusia
dari mana "semua" kontaminan telah dihapus.
Kemurnian protein obat dalam produk akhir akan
oleh karena itu sangat tergantung pada teknologi pemurnian
nologi diterapkan.
Tabel 3 daftar kontaminan potensial yang mungkin
hadir dalam produk protein rekombinan dari bakteri
sumber ial dan non-bakteri. Kontaminan ini bisa
bisa terkait dengan host, terkait proses atau produk
terkait. Di bagian berikut perhatian khusus adalah
dibayar untuk deteksi dan penghapusan kontaminasi-
oleh virus, bakteri, DNA seluler, dan yang tidak diinginkan
protein.
Virus
Virus, yang membutuhkan keberadaan sel hidup
merambat, adalah kontaminan potensial sel hewan
budaya dan, oleh karena itu, produk akhir yang dihasilkan
oleh sel (Arathoon dan Birch, 1986). Jika ada,
konsentrasi mereka dalam produk yang dimurnikan adalah
sangat rendah dan akan sulit untuk mendeteksi mereka.
Meskipun virus seperti retrovirus (tipe B) bisa saja
divisualisasikan di bawah mikroskop elektron, sangat
uji in vitro sensitif untuk kehadiran mereka kurang
(Liptrot dan Gull, 1991). Risiko beberapa virus
(misalnya, virus hepatitis) dikenal (Marcus-Sekura, 1991;
Walter et al., 1991), tetapi ada virus lain yang
risiko tidak dapat dinilai dengan baik karena kurangnya
data eksperimen yang solid. Beberapa infeksi virus, misalnya
seperti parvovirus, dapat memiliki periode laten yang panjang sebelumnya
efek klinisnya muncul. Efek jangka panjang dari
memasukkan virus ke pasien yang dirawat dengan
protein rekombinan tidak boleh diabaikan.
Oleh karena itu, diperlukan parenteral yang bebas dari
virus. Rezim pengujian virus tertentu yang diperlukan akan
tergantung pada jenis sel yang digunakan untuk produksi (Löwer,
1990; Minor, 1994).
Virus dapat dimasukkan melalui nutrisi atau mereka
dihasilkan oleh jalur sel produksi yang terinfeksi. Itu
sumber pengenalan virus yang paling sering adalah hewan
serum. Selain itu, serum hewan dapat memperkenalkan lainnya
agen yang tidak diinginkan seperti bakteri, mikoplasma,
prion, jamur dan endotoksin. Harus jelas itu
Jenis nutrisi
Contoh
Gula
Glukosa, laktosa, sukrosa,
maltosa, dekstrin
Lemak
Asam lemak, trigliserida
Air (kualitas tinggi,
disterilkan)
Air untuk injeksi
Asam amino
Glutamin
Elektrolit
Kalsium, natrium, kalium,
fosfat
Vitamin
Asam askorbat, a-tokoferol,
tiamin, riboflavin, asam folat,
piridoksin
Serum (serum betis janin,
serum sintetis)
Albumin, transferrin
Lacak mineral
Besi, mangan, tembaga, kobalt,
seng
Hormon
Faktor pertumbuhan
Tabel 2 n Komponen utama media pertumbuhan untuk mamalia
struktur sel.
Asal
Kontaminan
Terkait dengan tuan rumah
Virus
Protein yang berasal dari asam amino
Varian glikosilasi
Varian terminal N- dan C
Endotoksin (dari bakteri Gram-negatif
tuan rumah)
Produk-
terkait
Substitusi dan penghapusan asam amino
Protein terdenaturasi
Isomer konformasional
Dimers dan agregat
Varian pasangan disulfida
Spesies terdeamidasi
Fragmen protein
Proses-
terkait
Komponen medium pertumbuhan
Reagen pemurnian
Logam
Bahan kolom
Tabel 3 n Kontaminan potensial dalam protein rekombinan
produk yang berasal dari inang bakteri dan non-bakteri.
PROSES PRODUKSI DAN DOWNSTREAM SENYAWA BIOTEK
53
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 72
penyaringan bank sel dan pertumbuhan yang tepat
konstituen medium untuk virus dan petualangan lainnya
agen-agen harus diatur secara ketat dan diawasi
vised (Walter et al., 1991; FDA 1993; EMEA, 1997;
Seri Laporan Teknis WHO 823). A divalidasi
metode untuk menghilangkan kemungkinan kontaminan virus adalah
wajib untuk lisensi semua terapi yang diturunkan
dari sel mamalia atau hewan transgenik (Putih
et al., 1991; Minor 1994). Virus dapat dinonaktifkan oleh
perawatan fisik dan kimia produk. Panas,
iradiasi, sonikasi, pH ekstrem, deterjen, larutan
ventilasi, dan desinfektan tertentu dapat menonaktifkan virus.
Prosedur ini dapat berbahaya bagi produk
dengan baik dan karena itu harus dievaluasi dan
divalidasi (White et al., 1991; Walter et al., 1992; Minor,
1994; EMEA, 1997). Penghapusan virus oleh nanofiltra-
adalah teknik yang elegan dan efektif
aspek validasi dari teknologi ini sangat
dijelaskan dengan baik dalam laporan teknis PDA 41, 2005.
Filtrasi hingga 15 nm dapat menghilangkan membran sekalipun
virus non-amplop terkecil seperti bovine parvo-
virus (Burnouf-Radosevich et al., 1994; Maerz et al.,
1996). Sejumlah metode untuk mengurangi atau menonaktifkan
kontaminan virus disebutkan pada Tabel 4
(Burnouf et al., 1989; Horowitz et al., 1991; Perret
et al., 1991; Horowitz et al., 1994).
Bakteri
Kontaminasi bakteri yang tidak diinginkan mungkin menjadi masalah
untuk sel dalam kultur. Biasanya ukuran bakteri memungkinkan
filtrasi steril sederhana untuk menghilangkan memadai. Dalam urutan
untuk lebih lanjut mencegah kontaminasi bakteri selama
produksi, bahan baku yang digunakan harus
disterilkan dan produk diproduksi di bawah
kondisi aseptik yang ketat. Produksi paling sering memakan waktu
tempat di apa yang disebut "kamar bersih" di mana peluang
kontaminasi yang berasal dari lingkungan berkurang
melalui kontrol yang cermat terhadap lingkungan, untuk
contohnya penyaringan udara. Selain itu, antibiotik
beberapa agen dapat ditambahkan ke media kultur
kasus, tetapi harus dihapus lebih lanjut di hilir di
proses pemurnian. Penggunaan beta-laktam
antibiotik seperti penisilin sangat ketat
dilarang karena kepekaan berlebihan beberapa individu
untuk senyawa ini. Karena kegigihan
residu antibiotik, yang sulit dihilangkan
dari produk, produksi yang dirancang dengan tepat
pabrik dan sistem kontrol kualitas yang luas untuk
reagen yang ditambahkan (medium, serum, enzim, dll.)
mengizinkan operasi bebas antibiotik lebih disukai.
Pirogen (biasanya endotoksin gram negatif
bakteri) adalah zat yang berpotensi berbahaya (lih.
Bab 4). Manusia sensitif terhadap kontaminasi pirogen.
pada konsentrasi yang sangat rendah (pikogram per
mL). Pirogen dapat menimbulkan respons demam yang kuat dan
bahkan bisa berakibat fatal. Filtrasi steril sederhana tidak
hapus pirogen. Penghapusan lebih rumit
karena pirogen bervariasi dalam ukuran dan komposisi kimia
tion. Namun, tes sensitif untuk mendeteksi dan mengukur
pirogen tersedia secara komersial. Pemurnian
skema biasanya mengandung setidaknya satu langkah ion
exchange chromatography (bahan pertukaran anionik)
untuk menghilangkan endotoksin yang bermuatan negatif (Nolan,
1975; Berthold dan Walter, 1994). Selanjutnya, materi
Juga digunakan dalam proses seperti gelas biasanya
dikenakan langkah depyrogenasi sebelum sering digunakan oleh
penggunaan suhu tinggi (180 o C) dalam panas kering
oven.
DNA seluler
Penerapan garis sel mamalia kontinu
untuk produksi protein rekombinan mungkin
menghasilkan kehadiran DNA yang mengandung onkogen
fragmen dalam produk protein akhir (Löwer, 1990;
Walter dan Werner, 1993). Pemurnian yang ketat
protokol yang mampu mengurangi konten DNA
ke tingkat yang aman karena itu perlu (Berthold dan
Walter, 1994). Ada sejumlah pendekatan
tersedia untuk memvalidasi bahwa metode pemurnian
menghilangkan DNA seluler dan RNA. Salah satu pendekatan seperti itu
melibatkan inkubasi garis sel dengan radiolabeled
nukleotida dan menentukan radioaktivitas dalam
produk yang dimurnikan diperoleh melalui pemurnian
protokol. Metode lain adalah fluores- binding-dye
uji peningkatan cence untuk nukleotida. Jika
Kehadiran asam nukleat bertahan di final
Kategori
Jenis
Contoh
Inaktivasi
Perawatan panas
Pasteurisasi
Radiasi
Sinar UV
Dehidrasi
Liofilisasi
Agen penghubung silang,
denaturasi atau
agen pengganggu
b-propiolakton,
formaldehida,
NaOH, organik
pelarut (misalnya,
khloroform),
deterjen
(misalnya, Na-kolat)
Penetralan
Spesifik, menetralkan
antibodi
Pemindahan
Kromatografi
Pertukaran ion,
imuno-afinitas,
kromatografi
Penyaringan
Nanofiltrasi
Pengendapan
Sitropresipitasi
Tabel 4 n Metode untuk mengurangi atau menonaktifkan kontaminasi virus
nants.
54
KADIR ET AL.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 73
persiapan, maka langkah-langkah tambahan harus diperkenalkan
dalam proses pemurnian. Pertanyaan tentang brankas
tingkat asam nukleat dalam produk biotek sulit
menjawab karena kurangnya pengetahuan yang relevan.
Transfeksi dengan apa yang disebut DNA telanjang sangat
sulit dan diperlukan konsentrasi DNA yang tinggi.
Meski demikian, disepakati demi alasan keamanan yang final
kontaminasi produk oleh asam nukleat seharusnya tidak
melebihi 100 pg hingga 10 ng per dosis harian tergantung pada
jenis sistem budaya (Eur Pharm III, 1997; WHO,
1998; Kung et al., 1990).
Kontaminan Protein
Seperti disebutkan sebelumnya, melacak jumlah "asing"
protein dapat muncul dalam produk biotek. Jenis ini
kontaminan berpotensi bahaya kesehatan karena,
jika ada, mereka dapat dikenali sebagai antigen oleh
pasien yang menerima produk protein rekombinan. Di
penggunaan berulang-ulang pasien mungkin menunjukkan kekebalan tubuh
Reaksi yang disebabkan oleh kontaminan sementara protein
yang menarik adalah melakukan fungsi menguntungkannya. Di
kasus-kasus seperti itu imunogenisitas dapat disalahartikan
karena protein rekombinan itu sendiri.
Karena itu, seseorang harus sangat berhati-hati dalam menafsirkan
data keamanan dari terapi rekombinan yang diberikan
protein.
Umumnya, sumber kontaminan protein
adalah media pertumbuhan yang digunakan atau protein inang dari
sel-sel. Di antara kontaminan turunan inang, the
versi host dari protein rekombinan bisa
hadir (WHO, 1998). Karena protein ini mirip
dalam struktur, ada kemungkinan bahwa protein yang tidak diinginkan
dimurnikan bersama dengan produk yang diinginkan. Sebagai contoh,
urokinase diketahui hadir dalam banyak kontinyu
garis sel. Sintesis biologis sangat aktif
molekul seperti sitokin oleh sel hybridoma,
mungkin menjadi perhatian lain (FDA, 1990; Schindler dan
Dinarello, 1990). Tergantung pada sifat mereka dan
konsentrasi sitokin ini dapat meningkatkan
antigenisitas produk.
Seharusnya "diketahui" atau kontaminan yang diharapkan
dipantau pada tahap berturut-turut dalam pemurnian
proses dengan kontrol dalam proses yang sesuai, misalnya sensitif
immunoassay (s). Menelusuri banyak "tidak diketahui"
protein yang diturunkan sel lebih sulit. Ketika mengembangkan-
oping proses pemurnian lainnya, kurang spesifik
analisis seperti SDS-PAGE biasanya digunakan di
dikombinasikan dengan berbagai teknik pewarnaan.
PENGOLAHAN DARURAT
Memulihkan reagen biologis dari kultur sel
supernatan adalah salah satu bagian penting dari
prosedur pembuatan untuk produk biotek dan
biaya pemurnian biasanya lebih besar daripada biaya
bagian hulu dari proses produksi. Untuk
produksi antibodi monoklonal, resin Protein A
menyumbang sekitar 10% dari biaya saat virus
filtrasi dapat mencapai sekitar 40% dari biaya
(Gottschalk, 2006).
Biasanya, produk tersedia dalam jumlah yang sangat encer
bentuk, misalnya, 10 hingga 200 mg / L, tetapi konsentrasi hingga
500 hingga 800 mg / L dapat dihubungi (Berthold dan Walter,
1994; Garnick et al., 1988). Prediksinya adalah masa depan itu
pengembangan teknologi kultur sel melalui
aplikasi genetika dan proteomik akan menghasilkan
titer produk dalam kisaran 5 hingga 10 g / L yang akan
menantang kapasitas pemrosesan hilir
unit units (Werner, 2005).
Langkah konsentrasi sering diperlukan untuk mengurangi
menangani volume untuk pemurnian lebih lanjut. Biasanya,
produk selanjutnya mengalami serangkaian
langkah pemurnian. Langkah pertama secara tradisional menangkap
dan awalnya memurnikan produk, selanjutnya
langkah-langkah menghapus sebagian besar kontaminan, dan final
langkah menghapus semua jejak kontaminan dan bentuk varian
dari molekul. Atau, strategi sebaliknya,
dimana kontaminan utama ditangkap dan
produk dimurnikan dalam langkah selanjutnya, mungkin terjadi
dalam proses yang lebih ekonomis, terutama jika produk
tidak diekskresikan dari sel. Dalam kasus sebelumnya
produk tidak akan mewakili lebih dari 1% hingga 5% dari total
protein seluler dan ikatan spesifik sebagian besar
protein dalam langkah penangkapan spesifik produk akan rusak
efisiensinya. Jika kontaminan massal dapat dihilangkan
pertama, langkah penangkapan spesifik akan lebih efisien
dan lebih kecil dalam ukuran, sehingga lebih murah, dan kromato-
kolom grafik dapat digunakan. Setelah pemurnian,
langkah-langkah tambahan seperti formulasi dan sterilisasi
dilakukan pada produk curah untuk mendapatkan
diperlukan produk akhir yang stabil. Aspek formulasi akan
dibahas di Bab 4.
Saat merancang protokol pemurnian, the
kemungkinan untuk peningkatan harus dipertimbangkan
sepenuhnya. Suatu proses yang telah dirancang untuk kecil
jumlah sering tidak cocok untuk jumlah besar
jumlah karena alasan teknis dan ekonomi.
Mengembangkan proses hilir (yaitu, isolasi
dan pemurnian produk yang diinginkan) untuk memulihkan a
protein biologis dalam jumlah besar terjadi dalam dua
tahapan: desain dan peningkatan.
Memisahkan kotoran dari produk
protein membutuhkan serangkaian langkah pemurnian (proses
desain), masing-masing menghapus beberapa kotoran dan
mendekatkan produk ke spesifikasi akhir. Di
umum, bahan baku awal mengandung puing-puing sel
dan / atau bahan partikulat sel utuh yang harus
dihapus. Menentukan kontaminan utama dalam
materi awal sangat membantu dalam proses hilir
Desain. Ini termasuk informasi terperinci tentang
sumber bahan (mis. bakteri atau mamalia
kultur sel) dan kontaminan utama (misalnya albumin atau
PROSES PRODUKSI DAN DOWNSTREAM SENYAWA BIOTEK
55
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 74
analog produk). Apalagi karakter fisik-
karakteristik produk versus kontaminan yang dikenal
(Stabilitas termal, titik isoelektrik, berat molekul,
hidrofobik, kerapatan, sifat pengikat spesifik)
sangat menentukan proses desain. Proses yang digunakan
untuk produksi terapi harus dapat direproduksi
dan dapat diandalkan. Metode yang digunakan untuk pemulihan dapat terpapar
molekul protein ke stres fisik yang tinggi (misalnya,
suhu tinggi dan pH ekstrim) yang mengubah
sifat protein yang menyebabkan kerugian yang cukup besar pada
aktivitas protein. Zat apa saja yang digunakan oleh
injeksi harus steril dan bebas dari pirogen
di bawah level tertentu tergantung pada produk (batas
dinyatakan dalam monograf individu yang akan
dikonsultasikan, seperti European Pharmacopoeia: less
dari 0,2 mg / kg / massa tubuh untuk aplikasi intratekal
tion). Ini membutuhkan teknik dan prosedur aseptik.
sepanjang dengan udara bersih dan kontrol mikroba
semua bahan dan peralatan. Selama validasi
proses pemurnian itu juga harus ditunjukkan
bahwa kontaminan virus potensial dapat dihilangkan
(Walter et al., 1992). Matriks pemurnian harus
setidaknya sanitizable atau, jika mungkin sterilkan-uap.
Untuk depyrogenasi, bahan pemurnian harus
tahan panas kering yang diperpanjang pada 180
C atau
pengobatan dengan 1 hingga 2 M natrium hidroksida (untuk lebih lanjut
informasi lihat Bab4). Jika ada bahan yang kontak
dengan produk secara tidak sengaja melepaskan senyawa,
leachables ini harus dianalisis dan dihilangkan
dengan langkah-langkah pemurnian berikutnya harus demonstrasi-
ditunjukkan selama proses validasi. Peningkatan penggunaan
dari teknologi produksi pakai film plastik-
ogy (mis., tas steril untuk menyimpan cairan dan menyaring
perumahan) telah membuat aspek - aspek ini lebih penting dalam
5 tahun terakhir dan pemasok telah bereaksi oleh
menyediakan banyak informasi terkait
leachables dan biocompatability untuk solusi tipikal
digunakan selama pemrosesan. Masalah leachables ini adalah
terutama menghambat penggunaan afinitas kromato-
grafik (lihat di bawah) dalam produksi farmasi
ticals untuk penggunaan manusia. Pada afinitas skala laboratorium
kromatografi adalah alat penting untuk pemurnian
dan produk yang dihasilkan dapat digunakan untuk toksisitas
studi, tetapi untuk manusia menggunakan penghapusan setiap leached
ligan harus ditunjukkan. Karena afinitas gratis
ligan akan mengikat ke produk, mungkin penghapusan
sangat rumit.
Scale-up adalah istilah yang digunakan untuk menggambarkan sejumlah
proses yang digunakan dalam mengkonversi proyek laboratorium
menjadi proses ekonomi, industri. Selama
fase peningkatan, proses bergerak dari
skala laboratorium ke pabrik percontohan dan akhirnya ke
pabrik produksi. Tujuan peningkatan adalah untuk
menghasilkan produk berkualitas tinggi dengan harga bersaing
harga. Karena biaya pemrosesan hilir dapat sama
setinggi 50% hingga 80% dari total biaya suatu produk,
cara praktis dan ekonomis memurnikan
produk harus digunakan. Pemurnian protein superior
metode memegang kunci untuk posisi pasar yang kuat
(Wheelwright, 1993).
Operasi dasar diperlukan untuk hilir
proses pemurnian digunakan untuk makromolekul dari
sumber biologis ditunjukkan pada Gambar 2.
Seperti disebutkan sebelumnya, desain hilir
pemrosesan sangat bergantung pada produk. Karena itu,
setiap produk membutuhkan pemurnian multistage tertentu
prosedur tion (Sadana, 1989). Skema dasar sebagai
diwakili dalam Gambar 2 menjadi kompleks. Sebuah tipikal
contoh aliran proses untuk hilir
pemrosesan ditunjukkan pada Gambar 3. Skema ini
mewakili pemrosesan dari rekombinasi glikosilasi
nant interferon (sekitar 28 kDa) diproduksi di mamma-
sel lian. Tujuan dari operasi unit individu
dijelaskan.
Setelah volume dan konsentrasi
produk dapat dikelola, fase pemurnian utama
bisa mulai. Sejumlah metode pemurnian adalah
tersedia untuk memisahkan protein berdasarkan lebar
berbagai kriteria fisikokimia yang berbeda seperti
ukuran, muatan, hidrofobik dan kelarutan. Terperinci
informasi tentang beberapa pemisahan dan pemurnian
metode yang biasa digunakan dalam skema pemurnian adalah
disediakan di bawah ini.
n Filtrasi / Sentrifugasi
Produk dari industri bioteknologi harus
dipisahkan dari sistem biologis yang mengandung sus
bahan partikulat tertunda, termasuk seluruh sel,
bahan sel yang dilisiskan, dan fragmen sel yang rusak
dihasilkan ketika kerusakan sel telah diperlukan untuk
merilis produk intraseluler. Paling hilir
Penghapusan partikulat
Konsentrasi
Tangkap / pemurnian awal
Pemurnian menengah
Pemurnian akhir
Sterilisasi / Formulasi
Gambar 2 n Operasi dasar yang diperlukan untuk pemurnian a
makromolekul biofarmasi.
56
KADIR ET AL.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 75
Oleh karena itu, pemrosesan lembar aliran akan menyertakan paling tidak
satu unit operasi untuk penghapusan ("klarifikasi") atau
konsentrasi, justru sebaliknya, dari partikulat. Paling
metode yang sering digunakan adalah sentrifugasi dan
teknik penyaringan (misalnya, ultrafiltrasi, diafiltrasi
dan mikrofiltrasi). Namun, biaya dan
efektivitas metode semacam itu sangat tergantung
pada sifat fisik bahan partikel dan
dari produk.
Penyaringan
Filtrasi dapat memusatkan biomassa sebelum lebih jauh
pemurnian. Beberapa sistem penyaringan telah
dikembangkan untuk pemisahan sel dari media, yang
paling sukses adalah sistem aliran tangensial (juga
disebut sebagai "cross flow") di mana geser tinggi melintasi
batas permukaan membran fouling, formasi lapisan gel
dan polarisasi konsentrasi. Dalam ultrafiltrasi,
campuran molekul dari dimen- molekul yang berbeda
Sion dipisahkan oleh bagian dari dispersi di bawah
tekanan melintasi membran dengan ukuran pori yang ditentukan
(Minton, 1990). Secara umum, ultrafiltrasi mencapai
sedikit pemurnian, karena pori-pori yang relatif besar
distribusi ukuran membran. Namun ini
teknik ini banyak digunakan untuk berkonsentrasi makromolekul-
cules, dan juga untuk mengubah fase air di mana
partikel-partikel tersebar atau di mana molekul berada
dibubarkan (diafiltrasi) menjadi satu yang diperlukan untuk
langkah pemurnian berikutnya.
Sentrifugasi
Partikel dan organel subseluler, tersuspensi dalam a
cairan kental (misalnya partikel yang dihasilkan
ketika sel-sel terganggu oleh prosedur mekanis)
sulit untuk dipisahkan dengan menggunakan satu perbaikan
langkah sentrifugasi atau dengan penyaringan. Tapi, mereka bisa
diisolasi secara efisien oleh sentrifugasi pada berbagai
kecepatan. Misalnya, inti dapat diperoleh dengan
sentrifugasi pada 400xg selama 20 menit, sedangkan plasma
vesikula membran dipelet pada sentrifuga lebih tinggi
tingkat tion dan waktu sentrifugasi yang lebih lama (fraksional
sentrifugasi). Namun, dalam banyak kasus, total biomassa
dapat dengan mudah dipisahkan dari medium dengan sentris
fugation (mis., centrifuge disk-stack kontinu).
Sentrifugasi densitas apung dapat berguna untuk
pemisahan partikel juga. Teknik ini menggunakan a
fluida kental dengan gradien densitas kontinu dalam
tabung centrifuge. Partikel dan molekul beragam
kepadatan dalam kisaran kepadatan dalam tabung akan
berhenti bergerak ketika daerah isopiknik telah
tercapai. Kedua teknik kontinu (cairan densi-
mengikat dalam kisaran) dan diskontinyu (blok cairan
dengan densitas berbeda) densitas gradient centrifugation
digunakan dalam sentrifugasi densitas apung pada a
skala laboratorium. Untuk aplikasi di industri
skala, bagaimanapun, sentrifugal kontinu (misalnya, tubular
Cairan kultur sel
TFF / sentrifugasi
Penghapusan sel, puing sel
dan partikel (virus)
Konsentrasi bebas sel
budaya, cairan dan diafiltrasi
UF / DF
Konsentrasi: penyesuaian
kondisi fisik
UF / DF
Konsentrasi: penyesuaian
kondisi fisik
UF / DF
Filtrasi steril
F
Manufaktur farmasi
isi
pelabelan
Bentuk sediaan akhir
Inaktivasi virus
SEBUAH
Penghapusan endapan
dan virus oleh ultrafiltrasi
UF
Penghapusan yang tersisa
protein yang terkontaminasi
Hidrofobik
interaksi
kromatografi
Perumusan:
pemisahan dari agregat
Permeasi gel
kromatografi
Penghapusan virus oleh
Filtrasi 40 nm
F
Penghapusan protein, lipid,
DNA dan virus
Pertukaran anion
kromatografi
Penghapusan BSA
dan transferrin
Pertukaran kation
kromatografi
Gambar 3 n Pemrosesan hilir dari rekomendasi glikosilasi
interferon biner, menggambarkan tujuan dari dimasukkannya
operasi unit individu. Singkatan: A, adsorpsi; DF,
diafiltrasi; F, filtrasi; TFF, penyaringan aliran tangensial; UF,
ultrafiltrasi. Sumber: Diadaptasi dari Berthold dan Walter, 1994.
PROSES PRODUKSI DAN DOWNSTREAM SENYAWA BIOTEK
57
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 76
mangkuk sentrifugal) hanya digunakan untuk diskontinyu
sentrifugasi kepadatan apung. Jenis industri ini
centrifuge terutama diterapkan untuk memulihkan endapan
protein atau kontaminan.
n Presipitasi
Kelarutan protein tertentu tergantung pada
lingkungan fisiko-kimia, misalnya pH, ionik
spesies dan kekuatan ionik larutan (lihat
Bab 4). Peningkatan ionik yang terus menerus lambat
kekuatan (campuran protein) secara selektif akan mendorong
protein keluar dari larutan. Fenomena ini diketahui
sebagai "salting-out". Berbagai macam agen, dengan
tersedia berbagai potensi “salting out”.
Seri chaotropic dengan peningkatan efek “salting out”
molekul bermuatan negatif (I) dan positif (II)
diberikan di bawah ini (von Hippel et al., 1964):
Saya SCN
SEBUAH
Saya
SEBUAH
, CLO 4
SEBUAH
, TIDAK 3
SEBUAH
, Br
SEBUAH
, Cl
SEBUAH
, CH 3 COO
SEBUAH
, PO 4
3À , SO 4

II Ba 2þ , Ca 2þ , Mg 2þ , Li
þ
, Cs
þ
, Na
þ
,K
þ
, Rb
þ
, NH 4
þ
Amonium sulfat sangat larut dalam dingin
larutan air dan sering digunakan dalam "pengasinan-
keluar ”pemurnian.
Metode lain untuk mengendapkan protein adalah dengan
menggunakan pelarut organik yang larut dalam air (ganti dalam
konstanta dielektrik). Contoh-contoh zat pengendap
adalah polietilen glikol dan asam triklorasetat. Dibawah
kondisi tertentu, kitosan dan polioks non-ion
deterjen yethylene juga menyebabkan curah hujan
(Cartwright, 1987; Homma et al., 1993; Terstappen
et al., 1993). Curah hujan adalah skala, sederhana dan
prosedur yang relatif ekonomis untuk pemulihan a
produk dari bahan baku encer. Sudah banyak
digunakan untuk isolasi protein dari kultur super-
natants. Sayangnya, dengan sebagian besar curah hujan curah hujan
metode, keuntungan dalam kemurnian umumnya terbatas.
Selain itu, komponen asing juga diperkenalkan
yang harus dihilangkan nanti. Akhirnya, jumlah besar
endapan mungkin sulit untuk ditangani. Meskipun demikian
keterbatasan, pemulihan oleh presipitasi telah digunakan
dengan kesuksesan yang cukup besar untuk beberapa produk.
n Kromatografi
Dalam sistem preparatif kromatografi molekuler
Spesies dipisahkan berdasarkan perbedaan
dalam distribusi antara dua fase, satu yang merupakan
fase diam (kebanyakan fase padat) dan yang lainnya
yang bergerak. Fase seluler ini dapat berupa cairan atau
gas (lihat Bab2). Saat ini, hampir semua
fase tionary (partikel halus menyediakan permukaan yang besar
area) dikemas ke dalam kolom. Fase seluler adalah
dilewati oleh pompa. Pemurnian hilir
protokol biasanya memiliki setidaknya dua hingga tiga kromato-
langkah-langkah grafik. Metode kromatografi yang digunakan dalam
prosedur pemurnian produk biotek terdaftar
pada Tabel 5 dan dibahas secara singkat sebagai berikut
bagian.
Fase Stationer Kromatografi
Prosedur kromatografi sering mewakili tingkat
membatasi langkah dalam pemrosesan hilir secara keseluruhan.
Faktor utama yang penting yang mengatur laju
Operasi adalah transportasi massal ke dalam pori - pori
bahan kemasan konvensional. Adsorben em-
dipekerjakan termasuk bahan anorganik seperti gel silika,
manik-manik kaca, hidroksiapatit, berbagai oksida logam
(alumina) dan polimer organik (ikatan silang)
trans, selulosa, agarosa). Pemisahan terjadi oleh perbedaan-
interaksi komponen sampel dengan
media kromatografi. Kelompok ion seperti
amina dan asam karboksilat, gugus dipolar seperti
gugus fungsi karbonil, dan ikatan hidrogen
menyumbang dan menerima kelompok mengendalikan interaksi
dari komponen sampel dengan fase diam
dan kelompok-kelompok fungsional ini memperlambat elusi
nilai jika interaksi terjadi.
Fase diam kromatografi untuk digunakan pada a
skala besar telah meningkat jauh dari yang terakhir
dekade. Hjerten et al. (1993) melaporkan penggunaan
struktur polimer berbasis akrilamida terkompresi.
Bahan-bahan ini memungkinkan pemisahan dengan relatif cepat
Pemisahan
teknik
Mode / prinsip
Pemisahan
berdasarkan
Selaput
pemisahan
Mikofiltrasi
Ukuran
Ultrafiltrasi
Ukuran
Dialisis
Ukuran
Sentrifugasi
Isopik
bandeng
Massa jenis
Tidak seimbang
pengaturan brium
Massa jenis
Ekstraksi
Ekstraksi fluida
Kelarutan
Cair / cair
ekstraksi
Partisi, ubah
kelarutan
Pengendapan
Pecahan
pengendapan
Perubahan kelarutan
Kromatografi
Ion-excange
Filtrasi gel
Afinitas
Hidrofobik
interaksi
Adsorpsi
Biaya
Ukuran
Ligan spesifik-
substrat
interaksi
Hidrofobik
Kovalen / nonkovalen
mengikat
Tabel 5 n Proses pemisahan yang sering digunakan dan proses pemisahannya
pangkalan fisik.
58
KADIR ET AL.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 77
kinerja kromatografi yang baik. Lain
pendekatan terhadap masalah yang terkait dengan massa
transportasi dalam sistem konvensional adalah dengan menggunakan kromato-
partikel grafis yang mengandung beberapa besar "melalui
pori-pori ”selain pori-pori konvensional (Gbr. 4).
Kromatografi aliran-aliran atau “perfusi” ini
media memungkinkan transportasi massa konvektif yang lebih cepat ke
partikel dan memungkinkan operasi pada kecepatan yang jauh lebih tinggi
tanpa kehilangan dalam resolusi atau kapasitas yang mengikat (Afeyan
et al., 1989; Fulton, 1994). Perkembangan lainnya adalah
desain kolom terbungkus spiral yang berisi
media adsorpsi. Konfigurasi ini memungkinkan tinggi
throughput, kapasitas tinggi dan efisiensi penangkapan yang baik
(Cartwright, 1987).
Fase diam ideal untuk pemisahan protein
harus memiliki sejumlah karakteristik, di antaranya
yang merupakan kekuatan mekanik tinggi, porositas tinggi, tidak
interaksi tidak spesifik antara protein dan protein
fase dukungan, kapasitas tinggi, biokompatibilitas dan
stabilitas tinggi dari matriks dalam berbagai pelarut. Itu
yang terakhir ini benar terutama untuk kolom yang digunakan untuk
produksi bahan klinis yang perlu
dibersihkan, dideprogenasi, didesinfeksi, dan disterilkan di
berkala. Kromato cair berkinerja tinggi
Sistem graphy (HPLC) memenuhi banyak kriteria ini.
Fase cair harus dipilih dengan hati-hati untuk meminimalkan
kehilangan aktivitas biologis yang dihasilkan dari penggunaan
beberapa pelarut organik. Dalam ukuran pori HPLC kecil
fase diam yang tidak dapat dimampatkan digunakan.
Partikel-partikel ini kecil, kaku dan ukurannya teratur
menyediakan area permukaan yang tinggi). Fase cairan bergerak
dipaksa di bawah tekanan tinggi melalui kolom
bahan. Sistem HPLC fase terbalik, menggunakan lebih sedikit
fase diam kutub dari fase seluler bisa
diintegrasikan secara efektif ke dalam pemurnian skala besar
skema protein dan dapat berfungsi baik sebagai sarana
konsentrasi dan pemurnian (Benedek dan
Swadesh, 1991).
Dalam kolom lingkungan produksi yang
beroperasi pada tekanan balik yang relatif rendah sering digunakan.
Mereka memiliki keunggulan yang dapat digunakan
peralatan yang dibuat dari plastik yang, tidak seperti
peralatan stainless steel konvensional, tahan semua
buffer kemungkinan digunakan dalam pemisahan
biomolekul (pertimbangkan efek men-leachables
sebelumnya). Kolom-kolom ini komersial
tersedia dan memungkinkan pemisahan efisien
protein dalam sekali jalan, menjadikan ini menarik
unit operasi dalam proses pembuatan. Hasil
dapat diperoleh dengan cepat dan dengan resolusi tinggi.
Perkembangan baru adalah penggunaan stainless steel
peralatan yang tahan hampir semua bahan kimia yang digunakan di
pemurnian protein termasuk desinfeksi dan sterilisasi
media ilisasi.
Sayangnya, biaya peralatan HPLC tinggi
dan teknologi ini hanya menemukan aplikasi terbatas di
skema pemurnian skala besar (Strickler dan
Gemski, 1987; Jungbauer dan Wenisch, 1989).
Kromatografi Adsorpsi
Dalam kromatografi adsorpsi (juga disebut "normal
phase ”chromatography) fase diam lebih
kutub dari fase seluler. Protein yang menarik
secara selektif mengikat ke matriks statis di bawah satu kondisi
dan dilepaskan dalam kondisi yang berbeda
(Chase, 1988). Metode kromatografi adsorpsi
memungkinkan rasio tinggi beban produk ke fase diam
volume. Karenanya, prinsip ini ekonomis
scalable.
Kromatografi Pertukaran Ion
Kromatografi pertukaran ion dapat menjadi langkah yang kuat
di awal skema pemurnian. Itu bisa saja
mudah ditingkatkan. Kromatografi penukar ion bisa
digunakan dalam mode negatif, yaitu, produk mengalir
melalui kolom dalam kondisi yang mendukung
adsorpsi kontaminan ke matriks, sedangkan
protein yang menarik tidak mengikat (Tennikova dan Svec,
1993). Jenis kolom yang dibutuhkan ditentukan
oleh sifat-sifat protein yang akan dimurnikan (misalnya,
titik isoelektrik dan densitas muatan). Anion exchan-
mereka mengikat molekul dan kation bermuatan negatif
penukar mengikat molekul bermuatan positif. Dalam garam-
kromatografi pertukaran ion gradien, konsentrasi garam
konsentrasi dalam buffer elusi perfusi meningkat
terus menerus atau dalam langkah-langkah. Semakin kuat pengikatan
protein individu ke penukar ion, yang kemudian
akan muncul di buffer elution. Demikian juga, dalam pH-
kromatografi gradien, pH diubah
tertib atau dalam langkah-langkah. Di sini, protein mengikat pada satu
pH dan dilepaskan pada pH berbeda. Sebagai akibat dari
heterogenitas dalam glikosilasi, protein glikosilasi
dapat mengelusi dalam kisaran pH yang relatif luas (hingga 2 pH
unit).
Kromatografi konvensional
Kromatografi perfusi
(A)
(B)
Gambar 4 n Struktur kromatografi konvensional
partikel (A) dan perfusi atau aliran-meskipun kromatografi
partikel (B) . Sumber: Diadaptasi dari Fulton, 1994.
PROSES PRODUKSI DAN DOWNSTREAM SENYAWA BIOTEK
59
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 78
Untuk menyederhanakan pemurnian, spesifik
ekor asam amino dapat ditambahkan ke protein di
tingkat gen untuk membuat "pegangan pemurnian". Untuk
misalnya, ekor pendek yang terdiri dari residu arginin
memungkinkan protein untuk mengikat penukar kation di bawah
kondisi di mana hampir tidak ada protein sel lainnya mengikat.
Namun, teknik ini hanya berguna untuk laboratorium
skala isolasi produk dan tidak dapat digunakan untuk
skala produksi karena masalah regulasi terkait
untuk menghilangkan arginin atau tag spesifik lainnya
dari protein.
(Immuno) Kromatografi Afinitas
Kromatografi afinitas didasarkan pada sangat spesifik
interaksi antara ligan yang diimobilisasi dan
protein yang menarik. Kromatografi afinitas sangat
metode ampuh untuk pemurnian protein.
Dalam kondisi fisiologis protein mengikat
ligan. Pencucian yang luas dari matriks ini akan
menghilangkan kontaminan dan protein yang dimurnikan bisa
pulih dengan penambahan ligan yang diperebutkan
situs pengikatan fase diam atau dengan perubahan
kondisi fisik (seperti pH rendah atau tinggi
eluent) yang sangat mengurangi afinitas. Contoh dari
kromatografi afinitas meliputi pemurnian
glikoprotein, yang mengikat lektin yang diimobilisasi dan
pemurnian serin protease dengan lisin
situs mengikat, yang mengikat lisin amobil. Di
kasus-kasus ini ligan terlarut (gula atau lisin, masing-masing
secara aktif) dapat digunakan untuk mengelusi produk yang dibutuhkan
dalam kondisi yang relatif ringan. Contoh lain adalah
penggunaan afinitas protein A dan protein G untuk
antibodi. Protein A dan protein G memiliki tinggi
afinitas untuk bagian Fc dari banyak imunoglobulin
dari berbagai binatang. Matriks protein A dan G adalah
diperoleh secara komersial dengan tingkat kemurnian yang tinggi.
Untuk pemurnian misalnya, hormon atau pertumbuhan
faktor, reseptor atau urutan peptida pendek itu
meniru tempat pengikatan molekul reseptor dapat
digunakan sebagai ligan afinitas. Beberapa protein menunjukkan sangat
afinitas selektif untuk pewarna tertentu yang tersedia secara komersial-
mampu sebagai ligan yang tidak bergerak pada matriks pemurnian.
Saat mempertimbangkan pemilihan ligan ini untuk
produksi farmasi, kita harus menyadari itu
beberapa pewarna bersifat karsinogenik dan a
fraksi dapat larut selama proses.
Pendekatan yang menarik untuk mengoptimalkan pemurnian
adalah penggunaan gen yang mengkode tidak hanya untuk yang diinginkan
protein, tetapi juga untuk urutan tambahan itu
memfasilitasi pemulihan dengan kromatografi afinitas. Di a
tahap selanjutnya urutan tambahan dihapus oleh a
reaksi pembelahan spesifik. Seperti yang disebutkan sebelumnya, ini
proses rumit yang membutuhkan pemurnian tambahan
tangga.
Secara umum, penggunaan kromatografi afinitas dalam
proses produksi untuk terapi mengarah ke
komplikasi selama validasi penghapusan
ligan atau ekstensi protein gratis. Akibatnya, ini
Teknologi ini jarang digunakan di industri.
Pengikatan spesifik antibodi terhadap antibodi
epitop digunakan dalam kromatografi immunoaffinity
(Chase, 1993; Kamihira et al., 1993). Teknik ini
dapat diterapkan untuk pemurnian antigen atau
antibodi. Antibodi dapat secara kovalen digabungkan
ke fase stasioner dan bertindak sebagai "reseptor" untuk
antigen yang akan dimurnikan. Atau, antigen,
atau bagiannya, dapat dilampirkan pada alat tulis
fase untuk pemurnian antibodi. Keuntungan
kromatografi immunoaffinity tinggi
kekhususan dan kombinasi konsentrasi dan
pemurnian dalam satu langkah.
Kerugian terkait dengan immunoaffinity
metode adalah antibodi yang terkadang sangat kuat - anti
mengikat gen. Ini membutuhkan kondisi yang keras selama
elusi ligan. Dalam kondisi seperti itu, sensitif
ligan dapat dirugikan (misalnya, oleh denatura-
protein yang akan dimurnikan). Ini bisa
dikurangi dengan (1) pemilihan antibodi dan
kondisi lingkungan dengan spesifisitas tinggi dan
afinitas yang cukup untuk menginduksi ligan antibodi
interaksi, sementara antigen dapat dilepaskan di bawah
kondisi ringan (Jones, 1990); (2) penggunaan tandem
kolom untuk mengubah kondisi fisik (mis., pH
dan kekuatan ionik) ke kondisi yang lebih fisiologis;
(3) penggunaan solusi penerima di mana
produk dielusi. Kekhawatiran lain adalah gangguan
ikatan kovalen yang menghubungkan "reseptor" dengan matriks.
Ini akan menghasilkan elusi dari seluruh kompleks.
Oleh karena itu, dalam praktiknya, langkah pemurnian lebih lanjut setelahnya
kromatografi afinitas juga sesuai
alat deteksi (mis., ELISA) hampir selalu diperlukan
sary. Di sisi lain, kimia kopling ditingkatkan
yang kurang rentan terhadap hidrolisis telah
dikembangkan untuk mencegah pencucian (Knight, 1990).
Peningkatan kromatografi immunoaffinity adalah
sering terhambat oleh jumlah yang relatif besar
"reseptor" spesifik (baik antigen atau antibodi)
yang diperlukan dan kurangnya ketersediaan komersial-
mampu, matriks siap pakai.
Contoh protein dari terapi potensial
nilai yang telah dimurnikan menggunakan immunoaffinity
kromatografi adalah interferon, urokinase, faktor
VIII: C, erythropoietin, interleukin-2, faktor manusia X,
dan aktivator plasminogen jaringan rekombinan.
Kromatografi Interaksi Hidrofobik
Dalam kondisi fisiologis sebagian besar hidrofobik
residu asam amino terletak di dalam protein
inti dan hanya sebagian kecil dari amino hidrofobik
asam terpapar pada "permukaan" protein. Mereka
eksposur ditekan karena kehadiran
asam amino hidrofilik yang menarik kelompok besar
60
KADIR ET AL.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 79
molekul air dan membentuk "perisai". Garam tinggi
konsentrasi mengurangi hidrasi protein dan
residu asam amino hidrofobik yang terpapar permukaan
menjadi lebih mudah diakses. Interaksi hidrofobik
kromatografi (HIC) didasarkan pada non-kovalen dan
interaksi non-elektrostatik antara protein dan
fase diam. HIC adalah teknik ringan, biasanya
menghasilkan pemulihan protein tinggi yang tidak
rusak, terlipat dengan benar dan terpisah dari
kontaminan yang terkait secara struktural. HIC adalah
idealnya ditempatkan dalam skema pemurnian setelah ion-
tukar kromatografi, tempat protein biasanya
dilepaskan dalam media elusi kekuatan ion tinggi (Heng
dan Glatz, 1993).
Kromatografi Permeasi Gel
Kromatografi permeasi atau eksklusi ukuran,
juga dikenal sebagai filtrasi gel, memisahkan protein
sesuai dengan bentuk dan ukurannya (Gbr. 5). Gel inert
dengan distribusi ukuran pori yang sempit dalam kisaran ukuran
protein tersedia. Gel ini dikemas menjadi
kolom dan campuran protein kemudian dimuat di atas
kolom dan protein berdifusi ke dalam gel.
Semakin kecil protein, semakin banyak volume yang dimilikinya
tersedia untuk dibubarkan. Molekul itu
lebih besar dari pori-pori terbesar tidak mampu menembus
manik-manik gel dan karena itu akan tinggal di kekosongan
volume kolom. Ketika aliran terus menerus
buffer melewati kolom, protein yang lebih besar
akan mengelusi pertama dan molekul terkecil bertahan. Gel
kromatografi permeasi adalah alternatif yang baik untuk
hampir diafiltrasi untuk pertukaran buffer
tahap pemurnian, dan itu sering digunakan di laboratorium
Desain. Pada skala produksi, penggunaan teknik ini
biasanya terbatas, karena itu membutuhkan relatif kecil
volume sampel pada kolom besar (hingga sepertiga dari
volume kolom dalam kasus "pertukaran buffer").
Oleh karena itu sebaiknya dihindari atau digunakan di akhir
proses pemurnian saat protein tersedia di
bentuk yang sangat terkonsentrasi. Filtrasi gel sangat
biasa digunakan sebagai langkah terakhir dalam pemurnian untuk
membawa protein dalam buffer yang sesuai yang digunakan dalam
formulasi akhir. Dalam aplikasi ini, penggunaannya hanya sedikit
jika tidak berpengaruh pada karakteristik kemurnian produk.
Tempat Tidur yang Diperluas
Seperti disebutkan sebelumnya, skema pemurnian didasarkan
pada protokol multistep. Ini tidak hanya menambah besar
biaya produksi keseluruhan, tetapi juga dapat mengakibatkan
kehilangan produk secara signifikan. Karena itu, masih ada
minat dalam pengembangan metode baru untuk
menyederhanakan proses pemurnian. Adsorpsi
teknik adalah metode populer untuk pemulihan
protein, dan format operasi konvensional untuk
pemisahan preparatif adalah kolom yang dikemas (atau diperbaiki
bed) dari adsorben. Namun, bahan partikulat bisa
terperangkap di dekat tempat tidur, yang menghasilkan peningkatan
dalam tekanan turun di tempat tidur dan akhirnya masuk
menyumbat kolom. Ini dapat dihindari oleh
gunakan filter pra-kolom (0,2 mm) untuk menyimpan kolom
integritas. Solusi lain untuk masalah ini adalah
penggunaan ranjang yang diperluas (Chase dan Draeger, 1993;
Fulton, 1994), juga disebut hamparan terfluidisasi (Gbr. 6). Di
prinsipnya, penggunaan tempat tidur yang diperluas memungkinkan klarifikasi-
tion, konsentrasi dan pemurnian yang ingin dicapai di Indonesia
satu langkah. Konsepnya adalah menggunakan partikulat
adsorben fase padat dalam unggun terbuka dengan ke atas
aliran cairan. Seret hidrodinamik di sekitar
partikel cenderung mengangkatnya ke atas, yang berlawanan
bertindak oleh gravitasi karena perbedaan kepadatan
antara partikel dan fase cair. Itu
partikel tetap tersuspensi jika diameter partikel,
densitas partikel, viskositas cair dan densitas cair
seimbang dengan memilih aliran yang benar
menilai. Kasur diperluas memungkinkan partikel (sel) lewat
melalui, sedangkan molekul dalam larutan secara selektif
dipertahankan (misalnya, dengan menggunakan pertukaran ion atau
adsorben afinitas) pada partikel adsorben.
Bahan baku dapat diterapkan ke tempat tidur tanpa sebelumnya
penghapusan bahan partikel dengan sentrifugasi atau
filtrasi, sehingga mengurangi waktu dan biaya proses.
Fluidized beds telah digunakan sebelumnya untuk
skala pemulihan antibiotik industri seperti
streptomisin dan novobiocin (Chase, 1994; Fulton,
1994). Stabil, tempat tidur diperluas dapat diperoleh
menggunakan peralatan sederhana yang diadaptasi dari yang digunakan
untuk adsorpsi unggun konvensional, dikemas dan
Jaringan gel yang saling terhubung
partikel membengkak dalam air
Molekul kecil
bisa berpusat
Molekul besar
tidak bisa memusatkan
Gambar 5 n Representasi skema prinsip-prinsip gel
penyaringan. Sumber: Diadaptasi dari James, 1992.
PROSES PRODUKSI DAN DOWNSTREAM SENYAWA BIOTEK
61
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 80
proses kromatografi. Adsorben penukar ion
kemungkinan akan dipilih untuk pemisahan tersebut.
MASALAH UNTUK MEMPERTIMBANGKAN DALAM PRODUKSI DAN
PEMURNIAN PROTEIN
n Heterogenitas N- dan C-Terminal
Masalah besar terkait dengan produksi
produk biotek adalah masalah yang terkait dengan
amino (NH2) -minyak protein misalnya, dalam E. coli
sistem, di mana sintesis protein selalu dimulai dengan
f-metil-metionin. Jelas, itu luar biasa
tertarik untuk mengembangkan metode (Christensen et al., 1990)
yang menghasilkan protein dengan terminal NH2 sebagai
ditemukan dalam protein otentik. Ketika protein
tidak diproduksi dengan cara yang benar, produk akhir
mungkin mengandung beberapa varian metionil dari protein
dipertanyakan atau bahkan mengandung protein kurang satu atau
lebih banyak residu dari ujung amino. Ini disebut
heterogenitas terminal amino. Heterogenitas ini
dapat juga terjadi dengan protein rekombinan (misalnya,
a-interferon) rentan terhadap protease yang baik
disekresikan oleh tuan rumah atau diperkenalkan oleh yang mengandung serum
media. Protease ini dapat menghilangkan asam amino dari
Terminal-C dan / atau terminal-N dari produk yang diinginkan
(heterogenitas terminal amino dan / atau karboksi)
(Garnick et al., 1988).
Heterogenitas terminal-amino dan / atau karboksi
tidak diinginkan karena dapat menyebabkan kesulitan dalam
pemurnian dan karakterisasi protein. Di
kasus adanya metionin tambahan di
N-terminal akhir protein, sekunder dan
struktur tersier dapat diubah. Ini dapat mempengaruhi
aktivitas biologis dan stabilitas dan dapat membuatnya
imunogenik. Apalagi metionin N-terminal
dan / atau metionin internal peka terhadap oksidasi
(Sharma, 1990).
n Modifikasi Kimia / Perubahan Konformasi
Meskipun sel mamalia mampu menghasilkan
protein secara struktural sama dengan protein endogen,
hati-hati disarankan. Transkrip berisi
urutan pengkodean panjang penuh dapat menghasilkan kesesuaian
isomer protein karena tidak terduga
struktur sekunder yang memengaruhi kesetiaan translasi
(Sharma, 1990). Faktor lain yang harus dipertimbangkan
akun adalah kemungkinan adanya keseimbangan antara
bentuk yang diinginkan dan bentuk lain seperti dimer. Itu
lipatan protein yang benar setelah biosintesis adalah
penting, karena menentukan aktivitas spesifik
protein (Berthold dan Walter, 1994). Karena itu,
penting untuk menentukan apakah semua molekul diberikan
protein rekombinan yang dikeluarkan oleh mamalia ex-
sistem tekanan dilipat sesuai dengan aslinya
tion. Dalam beberapa kasus mungkin relatif mudah dideteksi
struktur salah lipat, tetapi dalam kasus lain mungkin
sangat sulit. Terkadang seleksi dan pemurnian
protein asli mungkin membutuhkan pengembangan
ment teknologi persiapan dan analitik novel
untuk pengembangan proses dan jaminan kualitas.
Terlepas dari perubahan konformasi, protein
dapat mengalami perubahan kimia, seperti proteolisis,
deamidasi, hidroksil dan oksidasi sulfhidril
selama proses pemurnian. Perubahan ini bisa
menghasilkan denaturasi protein (sebagian). Wakil
sebaliknya, denaturasi protein dapat menyebabkan bahan kimia
modifikasi juga (misalnya, sebagai akibat dari paparan
kelompok sensitif) (Ptitsyn, 1987).
n Glikosilasi
Banyak protein terapi yang diproduksi oleh rekombinan
Teknologi DNA adalah glikoprotein (Sharma, 1990).
Kehadiran dan sifat sisi oligosakarida
rantai protein mempengaruhi sejumlah hal penting
karakteristik, seperti paruh protein serum ',
kelarutan, stabilitas dan kadang-kadang bahkan farmasi
fungsi kologis (Cumming, 1991). Darbepoietin, a
Sel lewat
tanpa hambatan
melalui tempat tidur
Penyerap
manik-manik
Sel
kue
Partikulat
mengandung
cairan proses
Memperbaiki tempat tidur
(A)
( B ) Tempat tidur diperluas
Gambar 6 n Perbandingan antara (A) tempat tidur penuh dan (B) an
tempat tidur diperluas. Sumber: Diadaptasi dari Chase dan Draeger, 1993.
62
KADIR ET AL.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 81
erythropoie- generasi kedua yang dimodifikasi secara genetis
Timah, memiliki kandungan karbohidrat 80% dibandingkan dengan
40% untuk molekul asli, yang meningkatkan
paruh in vivo setelah pemberian intravena dari
8 jam untuk erythropoietin hingga 25 jam untuk darbepoietin
(Sinclair dan Elliott, 2005).
Akibatnya, profil terapeutik mungkin
"Glikosilasi" tergantung. Seperti disebutkan sebelumnya,
glikosilasi protein tidak ditentukan oleh DNA
urutan. Ini merupakan modifikasi enzimatik dari
protein setelah terjemahan, dan dapat bergantung pada
lingkungan di dalam sel. Meskipun sel mamalia
sangat baik untuk protein glikosilasi, sulit untuk
kontrol penuh glikosilasi. Karbohidrat heterogen-
itu terdeteksi oleh variasi dalam ukuran rantai,
jenis oligosakarida, dan urutan karbohidrat
tanggal. Ini telah ditunjukkan untuk sejumlah
produk rekombinan termasuk interleukin-4, chor-
ionik gonadotropin, erythropoietin dan plasmi jaringan
aktivator nogen. Struktur karbohidrat dan
komposisi protein rekombinan mungkin berbeda dari
rekan asli mereka, karena enzim tersebut
diperlukan untuk sintesis dan pemrosesan bervariasi
sistem ekspresi yang berbeda (misalnya, glikoprotein dalam
sel-sel serangga seringkali lebih kecil dari yang sama
glikoprotein diekspresikan dalam sel mamalia) atau genap
dari satu sistem mamalia ke yang lain.
n Pemrosesan Proteolitik
Protease memainkan peran penting dalam pemrosesan,
pematangan, modifikasi, atau isolasi rekombinan
protein (Sharma dan Hopkins, 1981). Protease dari
sel mamalia terlibat dalam mensekresi protein
ke dalam media budidaya. Jika sekresi
protein rekombinan terjadi bersamaan, kemudian
sistem proteolitik intraseluler mamalia
sel seharusnya tidak berbahaya bagi protein rekombinan.
Protease dilepaskan jika sel mati atau pecah (misalnya, selama
istirahat sel saat panen sel) dan menjalani lisis. ini
karena itu penting untuk mengendalikan pertumbuhan dan panen
kondisi untuk meminimalkan efek ini. Lain
sumber serangan proteolitik ditemukan dalam komponen
dari media tempat sel tumbuh. Untuk
Misalnya, serum mengandung sejumlah protease dan
protease zymogen yang dapat mempengaruhi yang dikeluarkan
protein rekombinan. Jika ada dalam jumlah kecil,
dan jika sifat serangan proteolitik pada
protein yang diinginkan diidentifikasi, protease yang sesuai
inhibitor untuk mengendalikan proteolisis dapat digunakan. ini
terbaik untuk mendokumentasikan integritas rekombinan
protein setelah setiap langkah pemurnian.
Protein menjadi jauh lebih rentan
protease pada suhu tinggi. Tingkat pemurnian
Tegies harus dirancang untuk melaksanakan semua langkah di
4
C (Sharma, 1990) jika terjadi degradasi proteolitik.
Atau, agen pengompleks Ca 2þ (misalnya, sitrat)
dapat ditambahkan karena banyak protease bergantung pada Ca 2þ untuk
aktivitas mereka. Dari perspektif manufaktur,
Namun, menyediakan pendinginan untuk kromato- skala besar
proses grafis, meskipun bukan tidak mungkin, adalah a
faktor penyulit dalam proses pembuatan.
n Pembentukan Tubuh Inklusi Protein
Dalam bakteri protein yang larut dapat membentuk padat, halus
inklusi granular dalam sitoplasma. Ini
"Badan inklusi" sering terjadi pada sel bakteri itu
memproduksi protein berlebih dengan ekspresi plasmid. Itu
inklusi protein muncul dalam mikrograf elektron sebagai
tubuh besar dan padat sering kali mencakup seluruh diameter
sel. Inklusi protein mungkin dibentuk oleh
penumpukan agregat protein amorf yang dimiliki
bersama oleh ikatan kovalen dan non-kovalen. Itu
ketidakmampuan untuk mengukur protein tubuh inklusi secara langsung
dapat menyebabkan penilaian pemulihan yang tidak akurat dan
hasil dan dapat menyebabkan masalah jika kelarutan protein
penting untuk pemurnian yang efisien dan berskala besar
(Berthold dan Walter, 1994). Beberapa skema untuk
pemulihan protein dari badan inklusi telah
dijelaskan (Krueger et al., 1989). Pemulihan
protein dari badan inklusi membutuhkan kerusakan sel
dan inklusi pemulihan tubuh. Pembubaran inklusi
protein adalah langkah selanjutnya dalam skema pemurnian
dan biasanya terjadi dalam larutan yang sangat encer
yang cenderung memiliki efek meningkatkan
volume operasi unit selama pabrikan
fase turing. Ini dapat membuat proses kontrol lebih
sulit jika misalnya diperlukan suhu rendah
selama langkah-langkah ini. Umumnya, protein inklusi
larut dalam agen denaturasi seperti natrium
dodecylsulfate (SDS), urea, atau guanidine hydrochlor-
ide. Karena sistem bakteri umumnya tidak mampu
membentuk ikatan disulfida, protein yang mengandung ini
ikatan harus dilipat kembali dalam kondisi pengoksidasi
untuk mengembalikan ikatan ini dan untuk menghasilkan secara biologis
protein aktif. Apa yang disebut langkah renaturasi ini
semakin sulit jika lebih banyak jembatan S-S hadir
dalam molekul dan hasil produk renaturasi
bisa serendah hanya beberapa persen. Setelah itu
protein dilarutkan, kromatografi konvensional
pemisahan dapat digunakan untuk pemurnian lebih lanjut dari
protein.
Formasi agregat pada pandangan pertama mungkin tampak
tidak diinginkan, tetapi mungkin juga ada keuntungan selama
karena protein yang diminati akan dibuka dan dilipat kembali
tepat. Inklusi protein tubuh bisa dengan mudah
pulih untuk menghasilkan protein dengan kemurnian> 50%, a
peningkatan substansial atas kemurnian yang larut
protein (kadang-kadang di bawah 1% dari total sel
protein). Selanjutnya, bentuk agregat dari
protein lebih tahan terhadap proteolisis (Krueger
et al., 1989), karena sebagian besar molekul teragregasi
PROSES PRODUKSI DAN DOWNSTREAM SENYAWA BIOTEK
63
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 82
bentuk tidak dapat diakses oleh enzim proteolitik. Demikian
hasil tinggi dan produksi yang relatif murah menggunakan a
sistem bakteri dapat mengimbangi renaturasi hasil rendah
proses. Untuk molekul non-glikosilasi sederhana ini
masih merupakan sistem produksi pilihan.
REFERENSI
Afeyan N, Gordon N, Mazsaroff I, dkk. (1989). Mengalir-
melalui partikel-partikel cairan berkinerja tinggi
pemisahan kromatografi biomolekul, perfu-
kromatografi sion. J Chromatogr 519: 1–29.
Arathoon WR, Birch JR (1986). Kultur sel skala besar di
bioteknologi. Sains 232: 1390–955.
Benedek K, Swadesh JK (1991). HPLC protein dan
peptida dalam industri farmasi. Dalam: Fong GW,
Lam SK, eds. HPLC di Industri Farmasi.
New York: Dekker, 241–302.
Berthold W, Walter J (1994). Pemurnian protein: Aspek
proses untuk produk farmasi. Biologis
22: 135–50.
Borman S (2006). Rekayasa glikosilasi. Chem Eng
Berita 84: 13–22.
Burnouf T, Dernis D, Michalski C, Goudemand M, Huart JJ
(1989). Keuntungan terapeutik dari kemurnian tinggi
plasma faktor IX konsentrat yang diproduksi oleh
kromatografi nasional. Colloque Inserm 175: 25–334.
Burnouf-Radosevich M, Appourchaux P, Huart JJ, Burnouf T
(1994). Nanofiltrasi, eliminasi virus spesifik baru
metode yang diterapkan pada Faktor IX kemurnian tinggi dan Faktor XI
berkonsentrasi. Vox Sang 67: 132–8.
Cartwright T (1987). Isolasi dan pemurnian produk
dari sel hewan. Tren Biotekn 5: 25–30.
Chase HA (1988). Proses persiapan adsorpsi untuk
pemurnian protein. Dalam: Mizrahi A, ed. Hilir
proses: Peralatan dan teknik, Vol. 8.
New York: AR Liss, 163–312.
Chase HA (1994). Pemurnian protein dengan adsorpsi
kromatografi
di
diperluas
tempat tidur. Tibtech
12: 296–303.
Chase H, Draeger N (1993). Pemurnian afinitas protein
menggunakan ranjang yang diperluas. J. Chromatogr 597: 129–45.
Christensen T, Dalboge H, Snel L (1990). Postbiosintesis
modifikasi: Hormon pertumbuhan manusia dan insulin
prekursor. Dalam: Pembuatan Obat, Bagian IV.
Cumming DA (1991). Glikosilasi protein rekombinan
terapi: Kontrol dan implikasi fungsional.
Glycobiology 1 (2): 115–30.
Badan Eropa untuk Evaluasi Produk Obat
(EMEA, 1997), Unit Evaluasi Obat Manusia.
Topik ICH Q5D. Kualitas produk bioteknologi:
Derivasi dan karakterisasi substrat sel
digunakan untuk produksi bioteknologi / biologis
produk.
Badan Eropa untuk Evaluasi Produk Obat
(EMEA, 1999a). Catatan untuk panduan tentang meminimalkan
risiko penularan hewan / spongiform encephalo-
agen pathy.
Badan Eropa untuk Evaluasi Produk Obat
(EMEA, 1999b). Unit Evaluasi Obat Manusia.
Topik ICH Q6B. Spesifikasi prosedur pengujian
dan kriteria penerimaan untuk bioteknologi / biologis
produk.
European Pharmacopoeia (1997). Edisi ketiga. Strasbourg: Dewan
Eropa.
FDA, Pusat Evaluasi dan Penelitian Biologis (1990)
Sitokin dan faktor pertumbuhan pre-Ptivotal Ttrial in-
formasi Ppackage dengan penekanan khusus pada pro-
saluran diidentifikasi untuk dipertimbangkan di bawah 21 CFR 312
Subbagian E, Bethesda, MD, AS.
FDA, Kantor Penelitian dan Tinjauan Biologis (1993)
Poin yang perlu dipertimbangkan dalam karakterisasi garis sel
digunakan untuk menghasilkan biologis, Rockville Rike, Bethesda,
MD, USA
Fulton SP (1994). Pemrosesan makromolekul dalam skala besar.
Curr Opin Biotechnol 5: 201–5.
Garnick RL, Solli NJ, Papa PA (1988). Peran kualitas
kontrol dalam bioteknologi: Suatu perspektif analitis.
Anal Chem 60: 2546-57.
Gottschalk U (2006). Kebangkitan pemurnian protein.
BioPharm Int, Juni.
Heng M, Glatz C (1993). Fusi yang dibebankan untuk selektif
pemulihan b-galactosidase dari ekstrak sel menggunakan
adsorpsi membran serat penukar ion berlubang.
Biotechnol Bioeng 42: 333–8.
Hippel von PH, Wong KY (1964). Garam netral:
efek umum pada stabilitas makro-
konformasi molekul. Sains 145: 577–80.
Hjerten S, Mohammed J, Nakazato K (1993). Perbaikan
dalam sifat aliran dan stabilitas pH terkompresi,
lapisan polimer kontinyu untuk cairan kinerja tinggi
kromatografi. J Chromatogr 646: 121–8.
Hodge G (2004). Komponen sekali pakai memungkinkan yang baru
pendekatan untuk pembuatan biofarmasi.
BioPharm Int 15: 38-49.
Homma T, Fuji M, Mori J, Kawakami T, Kuroda K,
Taniguchi M (1993). Produksi selobiosa oleh
hidrolisis enzimatik: penghapusan b-glukosidae dari
selulase oleh presipitasi afinitas menggunakan kitosan.
Biotechnol Bioeng 41: 405–10.
Horowitz MS, Bolmer SD, Horowitz B (1991). Eliminasi
virus yang ditularkan melalui penyebaran dari manusia
plasma darah dan produk kultur sel mamalia.
Bioseperation 1: 409-417.
Horowitz B, Pangeran AM, Hamman J, Watklevicz C (1994). Virus
keamanan produk darah yang diolah dengan pelarut / deterjen.
Koagulasi Darah dan Fibrinolisis 5: S21–8.
James AM (1992). Pengantar teknik dasar. Di:
James AM, ed. Analisis Asam Amino dan Nukleat
Asam. Oxford: Butterworth-Heinemann, 1–28.
Jones K (1990). Kromatografi afinitas, Teknologi terkini
tanggal. Am Biotechnol Lab 8: 26-30.
Jungbauer A, Wenisch E (1989). Performa tinggi
kromatografi cair dan metode terkait di Indonesia
pemurnian antibodi monoklonal. Dalam: Uang Muka
dalam Proses Bioteknologi. New York, Liss,
hlm. 161–92.
Kamihira M, Kaul R, Mattiasson B (1993). Pemurnian
protein rekombinan A oleh ekstrak dua fase berair
tion terintegrasi dengan presipitasi afinitas. Bioteknol
Bioeng 40: 1381-87.
64
KADIR ET AL.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 83
Klegerman ME, Groves MJ (1992). Farmasi
Bioteknologi. AS: Interpharm Press, Inc.
Knight P (1990). Bioseparasi: Media dan Mode.
Bioteknologi 8: 200.
Krueger JK, Kulke MH, Schutt C, Stock J (1989). Protein
penyertaan
tubuh
pembentukan
dan
pemurnian.
Pharmaceut Technol Int, 48–51.
Kung VT, Panfili PR, Sheldon EL, dkk. (1990). Picogram
kuantifikasi total DNA menggunakan DNA-binding
protein dalam sistem berbasis sensor silikon. Anal
Biokem 187: 220–7.
Liptrot C, Gull K (1991). Deteksi virus dalam rekombinan
sel dengan mikroskop elektron. Dalam: Spier RE, Griffiths JB,
MacDonald C, eds. Teknologi Sel Hewan,
Perkembangan, Proses dan Produk. Oxford:
Butterworth-Heinemann Ltd, 653–6.
Löwer J (1990). Risiko induksi tumor in vivo secara residual
DNA seluler: Pertimbangan Kuantitatif. J Med
Virol 31: 50–3.
Maerz H, Hahn SO, Maassen A, dkk. (1996). Ditingkatkan
penghapusan partikel mirip virus dari mono murni
persiapan IgM antibodi klonal melalui penyaringan virus.
Nat Biotechnol 14: 651–2.
Marcus-Sekura CJ (1991). Validasi dan Penghapusan
Retrovirus manusia. Pusat Evaluasi Biologi
dan Penelitian. Bethesda, MD: FDA.
Minton AP (1990). Karakterisasi kuantitatif dari penghormatan
asosiasi molekul sible melalui analitik centrifuga-
tion. Anal Biochem 190: 1–6.
Minor PD (1994). Memastikan keamanan dan konsistensi dalam sel
proses produksi kultur: Penapisan virus dan
inaktivasi. TIB TECH 12: 257–61.
Nolan JG, McDevitt JJ, Goldmann GS (1975). Endotoksin
mengikat dengan resin yang dibebankan dan tidak bermuatan. Proc Soc
Exp Biol Med 149: 766-70.
Catatan untuk Bimbingan (1991). Validasi Penghapusan Virus dan
Prosedur Inaktivasi, Kelompok Kerja Ad Hoc pada
Bioteknologi / Farmasi, Komunitas Eropa, DG
III / 8115/89-EN.
Pearson FC (1987). Pirogen dan depyrogenasi, teori
dan berlatih. Dalam: Olson WP, Groves MJ, eds. Aseptik
Pabrikan Farmasi. Padang rumput
Melihat:
Interpharm Press Inc.
Perret BA, Poorbeik M, Morell A (1991). Klinische prüfung
von Premogfil M SRK, einem mit monoklonalen
antikörpern hochgereinigten gerinningsfaktor VIII-
Konzentrat aus humanplasma. Schweiz
Med
Wochenschr, 121: 1624–7.
Jurnal PDA Sains dan Teknologi Farmasi
(2005), Laporan teknis No. 41, Filtrasi Virus,
Maret / April, Vol. 59, No. S-2.
Ptitsyn OB (1987). Pelipatan protein: Hipotesis dan pengalaman
KASIH. J Protein Chem 6: 273–93.
Sadana A (1989). Inaktivasi protein selama hilir
pemisahan, Bagian I: Proses. Biofarm 2: 14–25.
Schindler R, Dinarello CA (1990). Ultrafiltrasi untuk dihapus
endotoksin dan bahan penginduksi sitokin lainnya
dari media kultur jaringan dan cairan parenteral. Bio
Teknik 8: 408–13.
Sharma SK (1990). Masalah utama dalam pemurnian dan
karakterisasi protein rekombinan untuk terapi
penggunaan peutic. Adv Drug Deliv Rev 4: 87–111.
Sharma SK, Hopkins TR (1981). Perkembangan terkini dalam
proses aktivasi bovine chymotrypsinogen.
Chem Bioorganic 10: 357-74.
Sinclair AM, Elliott S (2005). Glycoengineering: Efek dari
glikosilasi pada sifat-sifat terapi
teins. J. Pharm.Sci 94: 1626-35.
Strickler MP, Gemski MJ (1987). Produksi komersial
antibodi monoklonal. New York: Marcel Dekker,
217–45.
Tennikova T, Svec F (1993). Membran kinerja tinggi
kromatografi:
Sangat
efisien
pemisahan
metode untuk protein dalam pertukaran ion, hidrofobik
mode interaksi dan fase terbalik. J Chromatogr
646: 279-88.
Terstappen G, Ramelmeier R, Kula M (1993). Protein
mempartisi dalam dua fase berair berbasis deterjen
sistem. J Biotechnol 28: 263–75.
Walter J, Werner RG (1993). Persyaratan peraturan
dan aspek ekonomi dalam pengolahan hilir
protein yang direkayasa secara bioteknis untuk parenteral
aplikasi sebagai obat-obatan. Dalam: Kroner KH,
Papamichael N, Schütte H, eds. Hilir
Pemrosesan, Pemulihan dan Pemurnian Protein,
Buku Pegangan Prinsip dan Praktek. New York:
John Wiley Publishers Inc.
Walter J, Werz W, McGoff P, Werner RG, Berthold W (1991).
Penghapusan / inaktivasi virus dalam proses hilir-
bernyanyi. Dalam: Spier RE, Griffiths JB, MacDonald C, eds.
Teknologi Sel Hewan: Pengembangan, Proses dan
Produk. Linacre House, Oxford: Butterworth-
Heinemann Ltd. 624–34.
Walter K, Werz W, Berthold W (1992). Penghapusan virus dan
inaktivasi, konsep dan data untuk validasi proses
pengolahan hilir. Bioteknologi. Forum Eropa
9: 560–4.
Werner R (2005). Pengembangan dan produksi
biofarmasi: Keberhasilan teknologi dan ekonomi
faktor cess. Bioprocess Int 3 (9 Suppl): 6-15.
Wheelwright SM (1993). Merancang pemrosesan hilir
untuk pemurnian protein skala besar. Bioteknologi
5: 789–93.
EM Putih, Grun JB, Sun CS, Sito F (1991). Proses
validasi untuk penghapusan dan inaktivasi virus.
BioPharm 34–9.
Organisasi Kesehatan Dunia (1998). Persyaratan untuk penggunaan
sel hewan sebagai substrat in vitro untuk produksi
biologis (Persyaratan untuk Zat Biologis No.
50). Seri Laporan Teknis 878: Biologis 26: 175–93.
Organisasi Kesehatan Dunia. Pedoman untuk memastikan
kualitas produk farmasi dan biologi
disiapkan oleh teknologi DNA rekombinan. Teknis
Seri Laporan 823: 105–15.
PROSES PRODUKSI DAN DOWNSTREAM SENYAWA BIOTEK
65
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 84
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 85

4
Formulasi Produk Biotek, Termasuk
Pertimbangan Biofarmasi
Daan JA Crommelin
Universitas Utrecht, Utrecht dan Dutch Top Institute Pharma, Leiden, Belanda
PENGANTAR
Bab ini membahas aspek formulasi farma
protein ceutical. Kedua pertanyaan teknologi dan
masalah farmasi seperti pilihan pengiriman
sistem, rute administrasi dan kemungkinan untuk
pengiriman protein target spesifik lokasi dipertimbangkan.
PERTIMBANGAN MIKROBIOLOGI
n Kemandulan
Sebagian besar protein diberikan secara parenteral dan dimiliki
menjadi steril. Secara umum, protein sensitif terhadap panas
dan perawatan sterilisasi yang biasa digunakan lainnya; mereka
tidak dapat menahan autoklaf, sterilisasi gas, atau
sterilisasi dengan radiasi pengion. Karena itu,
sterilisasi produk akhir tidak dimungkinkan.
Oleh karena itu, obat-obatan protein harus
dibulatkan dalam kondisi aseptik, mengikuti
menetapkan dan mengembangkan aturan di bidang farmasi
industri untuk pembuatan aseptik. Pembaca adalah
merujuk ke buku teks standar untuk detail (Aula,
1994; Groves, 1988; Klegerman dan Groves, 1992).
Peralatan dan eksipien diperlakukan secara terpisah
dan diautoklaf, atau disterilkan dengan panas kering (> 160
C),
perawatan kimia atau radiasi gamma untuk meminimalkan
Bioburden. Teknik filtrasi digunakan untuk
penghapusan kontaminan mikroba. Prefilters
menghapus sebagian besar bioburden dan komponen lainnya
bahan terlambat. Langkah "sterilisasi" terakhir sebelum diisi
vialnya disaring melalui membran 0,2 atau 0,22 mm
filter. Perakitan produk dilakukan di kelas 100
(maksimum 100 partikel> 0,5 mm per kaki kubik)
kamar dengan aliran udara laminar yang disaring
filter udara partikulat efisiensi tinggi (HEPA). Terakhir tetapi
paling tidak, "faktor manusia" adalah sumber utama
kontaminasi. Operator terlatih mengenakan pro-
kain pelindung (masker wajah, topi, gaun, sarung tangan, atau
pakaian keseluruhan head-to-toe) harus mengoperasikan
fasilitas. Pertukaran filter reguler, validasi rutin
peralatan HEPA dan pembersihan menyeluruh
ruangan plus peralatan adalah faktor penting untuk kesuksesan.
n Dekontaminasi Viral
Sebagai produk DNA rekombinan ditanam dalam mikro-
organisme, organisme ini harus diuji untuk virus
kontaminan dan tindakan yang sesuai harus dilakukan
diambil jika kontaminasi virus terjadi. Di sisa
proses pembuatan, tidak ada bahan virus (yang tidak diinginkan)
harus diperkenalkan. Eksipien dengan risiko tertentu
faktor seperti albumin serum manusia yang diturunkan dari darah
harus diuji dengan cermat sebelum digunakan dan
Kehadiran dalam proses perumusan harus mini-
terkoneksi (lihat Bab 3).
n Penghapusan Pyrogen
Pirogen adalah senyawa yang menyebabkan demam.
Eksogen pirogen (pirogen dimasukkan ke dalam
tubuh, bukan dihasilkan oleh tubuh itu sendiri) dapat diturunkan
dari sumber bakteri, virus atau jamur. Bakteri
pirogen utamanya adalah endotoksin yang dilepaskan dari gram
bakteri negatif. Mereka adalah lipopolysaccharides. SEBUAH
struktur umum ditunjukkan pada Gambar 1. Dasar,
struktur dilestarikan dalam array penuh ribuan
endotoksin yang berbeda adalah lipid A-moiety. Lain
properti umum yang dibagikan oleh endotoksin adalah tinggi,
muatan listrik negatif. Kecenderungan mereka untuk berkumpul
dan untuk membentuk unit besar dengan MW lebih dari 10 6 dalam air
dan kecenderungan mereka untuk menyerap ke permukaan mengindikasikan hal itu
senyawa-senyawa ini bersifat amphipathic. Mereka
stabil di bawah kondisi autoclaving standar, tetapi
rusak ketika dipanaskan dalam keadaan kering. Untuk ini
alasan peralatan dan wadah dirawat di
suhu di atas 160
C untuk periode yang lama
(mis., 30 menit panas kering pada 250
C).
Penghapusan pirogen dari produk rekombinan yang berasal
dari sumber bakteri harus menjadi bagian integral dari
proses persiapan. Kromatografi penukar ion
prosedur (memanfaatkan muatan negatifnya) dapat secara efektif
mengurangi kadar endotoksin dalam larutan (lihat Bab 3).
Eksipien digunakan dalam formulasi protein
seharusnya bebas endotoksin. Untuk solusi
"Air untuk Injeksi" (standar kompendial) adalah
(Baru) disuling atau diproduksi oleh reverse osmosis.
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 86
Endotoksin teragregasi tidak dapat melewati
membran reverse osmosis. Penghapusan endotoksin
segera sebelum mengisi wadah akhir bisa
dicapai dengan menggunakan arang aktif atau lainnya
bahan dengan permukaan besar menawarkan hidrofobik
interaksi. Endotoksin juga dapat dinonaktifkan
permukaan alat dengan oksidasi (misalnya, peroksida) atau kering
pemanasan (mis., 30 menit panas kering pada 250
C).
EXCIPIENTS DIGUNAKAN DALAM FORMULASI PARENTERAL DARI
PRODUK BIOTEK
Dalam formulasi protein seseorang menemukan, terlepas dari
zat aktif, sejumlah eksipien dipilih untuk
melayani tujuan yang berbeda. Proses formulasi ini
desain harus dilakukan dengan sangat hati-hati untuk memastikan
produk yang efektif secara terapi dan aman. Alam
protein (misalnya, labilitas) dan penggunaan terapeutiknya
(misalnya, beberapa sistem injeksi) dapat membuatnya
formulasi cukup kompleks dalam hal eksipien
profil dan teknologi (pengeringan beku, pra-aseptik
paration). Tabel 1 mencantumkan komponen yang dapat ditemukan
dalam formulasi yang saat ini dipasarkan. Dalam
bagian berikut daftar ini dibahas secara lebih rinci.
n Enhancer Kelarutan
Protein, khususnya yang non-glikosilasi,
mungkin memiliki kecenderungan untuk berkumpul dan mengendap.
Pendekatan yang dapat digunakan untuk meningkatkan kelarutan
termasuk pemilihan pH yang tepat dan kekuatan ionik
kondisi. Penambahan asam amino seperti lisin atau
arginine (digunakan untuk melarutkan plasminogen jaringan)
aktivator, t-PA), atau surfaktan seperti natrium
dodecylsulfate untuk melarutkan IL-2 non-glukosilasi
juga dapat membantu meningkatkan kelarutan. Itu
mekanisme aksi peningkat kelarutan ini
tergantung pada jenis penambah dan protein
terlibat dan tidak selalu sepenuhnya dipahami.
Gambar 2 menunjukkan efek konsentrasi arginin
pada kelarutan t-PA (alteplase) pada pH 7,2 dan
25
C. Gambar ini jelas menunjukkan efek dramatis
asam amino basa ini pada kelarutan nyata
dari t-PA.
Dalam contoh di atas, agregasi adalah fisik dalam
alam, yaitu berdasarkan hidrofobik dan / atau elektrostatik
interaksi antar molekul. Namun demikian,
berdasarkan pada pembentukan jembatan kovalen
antara molekul melalui ikatan disulfida, dan ester
atau hubungan amida juga telah dijelaskan (lihat
Tabel 4). Dalam kasus tersebut, kondisi yang tepat seharusnya
ditemukan untuk menghindari reaksi kimia ini.
n Agen Anti-Adsorpsi dan Anti-Agregasi
Agen anti-adsorpsi ditambahkan untuk mengurangi adsorpsi-
tion dari protein aktif ke antarmuka. Beberapa protein
cenderung mengekspos situs hidrofobik, biasanya hadir di
n
LIPID A
INTI
Lipopolysaccharide
Kelompok asam lemak
Fosfat
Senyawa yang mengandung fosfor
Berbagai gula kecil
Rantai antigen spesifik-O
Gambar 1 n Struktur endotoksin umum. Sebagian besar sifat endotoksin diperhitungkan oleh “lipid A” aktif dan tidak larut
fraksi dilarutkan dengan berbagai gula kecil (lingkaran berwarna berbeda). Meskipun struktur umumnya mirip, individu
endotoksin bervariasi sesuai dengan sumbernya dan ditandai oleh rantai antigenik spesifik-O. Sumber: Adapted from Groves, 1988.

Bahan aktif

Enhancer kelarutan

Agen anti-adsorpsi dan anti-agregasi

Komponen penyangga

Pengawet dan antioksidan

Lyoprotectants / pembuat kue

Agen osmotik

Sistem pembawa (lihat nanti dalam bab ini)
Tabel 1 n Komponen ditemukan dalam formulasi parenteral dari
produk biotek. Semua hal di atas belum tentu ada di
satu formulasi protein tertentu.
68
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 87
inti dari struktur protein asli ketika suatu
antarmuka hadir. Antarmuka ini bisa berupa air / udara,
dinding air / wadah atau antarmuka terbentuk antara
fase air dan peralatan yang digunakan untuk mengelola
obat (misalnya, kateter, jarum). Ini diserap, sebagian
molekul protein yang tidak terlipat membentuk agregat, biarkan
permukaan, kembali ke fase berair, bentuk lebih besar
agregat dan endapan. Sebagai contoh, the
mekanisme yang diusulkan untuk agregasi insulin dalam
media air melalui kontak dengan hidrofobik
permukaan (atau antarmuka air-udara) disajikan dalam
Gambar 3 (Thurow dan Geisen, 1984).
Insulin asli dalam larutan berada dalam kesetimbangan
keadaan antara monomer, tetramerik dimer, dan
bentuk hexameric (lihat Bab 12). Relatif
kelimpahan dari berbagai negara agregasi tergantung
pada pH, konsentrasi insulin, kekuatan ionik, dan
eksipien spesifik (misalnya, Zn 2 þ dan fenol). Telah
menyarankan bahwa bentuk dimerik dari insulin menyerap
antarmuka hidrofobik dan selanjutnya membentuk lebih besar
agregat di antarmuka. Ini menjelaskan mengapa
agen adhesi juga dapat bertindak sebagai anti-agregasi
agen. Albumin memiliki kecenderungan kuat untuk menyerap
permukaan dan karena itu ditambahkan relatif tinggi
konsentrasi (misalnya, 1%) ke formulasi protein sebagai
agen anti-adhesi. Albumin bersaing dengan
protein terapi untuk situs yang mengikat dan konon
mencegah adhesi agen aktif terapeutik
dengan kombinasi kecenderungan mengikat dan
kehadiran yang melimpah.
Insulin adalah salah satu dari banyak protein yang dapat terbentuk
endapan fibrilar (struktur berbentuk batang panjang dengan
diameter dalam kisaran 0,1 mm). Konsentrasi rendah
fosfolipid dan surfaktan telah terbukti
mengerahkan efek penghambatan fibrilasi. Pemilihan
pH yang tepat juga dapat membantu mencegah hal yang tidak diinginkan ini
fenomena (Brange dan Langkjaer, 1993).
Selain albumin, surfaktan juga dapat
curahkan adhesi ke antarmuka dan presipitasi. Ini
molekul dengan mudah menyerap ke antarmuka hidrofobik
dengan kelompok hidrofobik mereka sendiri dan membuat ini
antarmuka hidrofilik dengan mengekspos hidrofilik mereka
kelompok ke fase berair.
n Komponen Buffer
Pemilihan penyangga adalah bagian penting dari formula-
Proses tion, karena ketergantungan pH protein
kelarutan dan stabilitas fisik dan kimia. Penyangga
sistem secara teratur ditemui dalam formula biotek-
Tions adalah fosfat, sitrat, dan asetat. Baik
contoh pentingnya titik isoelektrik
logaritma negatif sama dengan pI) adalah kelarutannya
profil hormon pertumbuhan manusia (hGH, pI sekitar 5)
seperti yang disajikan pada Gambar 4.
Bahkan pendek, perubahan pH sementara dapat menyebabkan
pengumpulan. Kondisi ini dapat terjadi, misalnya
selama langkah pembekuan dalam proses pengeringan beku,
ketika salah satu komponen buffer mengkristal
dan yang lainnya tidak. Dalam buffer fosfat, Na 2 HPO 4
mengkristal lebih cepat dari NaH 2 PO 4 . Ini menyebabkan a
penurunan pH yang jelas selama langkah pembekuan.
Komponen penyangga lainnya tidak mengkristal, tetapi terbentuk
sistem amorf dan kemudian perubahan pH
diminimalkan.
n Pengawet dan Antioksidan
Metionin, sistein, triptofan, tirosin, dan histi
makan adalah asam amino yang mudah teroksidasi (Tabel 4
dalam Bab 2). Protein yang kaya akan asam amino ini adalah
bertanggung jawab terhadap degradasi oksidatif. Pengganti dari
oksigen dengan gas inert dalam botol membantu mengurangi
stres oksidatif. Apalagi penambahan antioksidan
bisa seperti asam askorbat atau asetilsistein
dipertimbangkan. Menariknya, efek destabilisasi pada
protein telah dijelaskan untuk antioksidan juga
(Vemuri et al., 1993b). Asam askorbat, misalnya, bisa
0
0
20
40
60
80
100
SEBUAH
C
B
Kelarutan nyata (mg / ml)
0,05
0,1
0,15
0,20
Arginin-fosfat (M)
Gambar 2 n Pengaruh arginin pada alteplase tipe I dan tipe II di
pH 7,2 dan 25
C. A, alteplase tipe I; B, alteplase tipe II; C, 50:50
campuran alteplase tipe I dan tipe II. Sumber: Dari Nguyen dan
Ward, 1993.
Permukaan hidrofobik
Solusi berair
Kristal
Gambar 3 n Asosiasi insulin diri yang dapat dibalik, adsorpsinya
ke antarmuka hidrofobik dan agregasi ireversibel dalam
film protein teradsorpsi. Setiap lingkaran mewakili monomer
molekul insulin. Sumber: Diadaptasi dari Thurow dan Geisen,
1984.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
69
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 88
bertindak sebagai oksidan di hadapan sejumlah berat
logam.
Protein tertentu diformulasikan dalam wadah
dirancang untuk berbagai skema injeksi. Setelah admin-
dosis pertama, kontaminasi dengan mikroorganisme.
Ganisme dapat terjadi dan diperlukan pengawet
meminimalkan pertumbuhan. Biasanya, pengawet ini
hadir dalam konsentrasi yang bersifat bakteriostatik
dari bakterisida di alam. Agen antimikroba
disebutkan dalam USP 29 adalah yang mengandung merkuri
nitrat fenilmerkurat dan thimerosal dan p-hidro-
asam xybenzoic, fenol, benzyl alcohol dan chlor-
obutanol (USP 29; Groves, 1988; Pearlman dan
Bewley, 1993). Penggunaan merkuri yang mengandung
saat ini sedang dibahas (FDA, 2006).
n Agen Osmotik
Untuk protein aturan reguler berlaku untuk menyesuaikan
tonisitas produk parenteral. Saline dan mono atau
solusi disakarida yang umum digunakan. Ini
eksipien mungkin tidak lembam; mereka dapat mempengaruhi
stabilitas struktural protein. Misalnya, gula dan
alkohol polihidrik dapat menstabilkan struktur protein
melalui prinsip "pengecualian preferensial"
(Arakawa et al., 1991). Aditif ini (struk
promotor mendatang) meningkatkan interaksi pelarut
dengan protein dan mereka sendiri dikeluarkan dari
lapisan permukaan protein; protein lebih disukai
terhidrasi. Fenomena ini bisa dipantau
melalui peningkatan stabilitas termal protein.
Sayangnya, efek "pengecualian preferensial" yang kuat
meningkatkan kecenderungan protein untuk mengasosiasikan diri.
n Umur simpan Farmasi Berbasis Protein
Protein dapat disimpan (i) sebagai larutan air, (ii) di
bentuk beku-kering, (iii) dalam bentuk kering dalam bentuk dipadatkan
negara (tablet). Beberapa mekanisme di balik bahan kimia dan
proses degradasi fisik telah berlangsung singkat
dibahas dalam Bab 2.
Stabilitas larutan protein sangat tergantung
pada faktor-faktor seperti pH, kekuatan ionik, suhu,
dan keberadaan stabilisator. Sebagai contoh, Gambar 5
menunjukkan ketergantungan pH dari 1- antitripsin dan
jelas menunjukkan pentingnya pH
untuk umur simpan protein.
n Pengeringan beku protein
Protein dalam larutan sering tidak memenuhi yang disukai
persyaratan stabilitas untuk industri yang diproduksi
produk farmasi (> 2 tahun), bahkan ketika disimpan
secara permanen dalam kondisi lemari es (dingin
rantai). Keberadaan air yang melimpah mempromosikan
proses degradasi kimia dan fisika.
20
10
5
1
3
4
5
6
7
8
pH
[hGH] mg / ml
Gambar 4 n Plot kelarutan berbagai bentuk hGH sebagai a
fungsi pH. Sampel hGH adalah hGH rekombinan
(lingkaran), Met-hGH (segitiga) atau hGH hipofisis (kotak).
Kelarutan ditentukan dengan mendialisis sekitar 11 mg /
solusi ml setiap protein menjadi buffer yang tepat untuk masing-masing
pH. Buffer sitrat, pH 3–7, dan borat, pH 8–9, semuanya berada pada
Konsentrasi buffer 10mM. Konsentrasi hGH adalah
diukur dengan absorbansi UV serta RP-HPLC, relatif
ke standar eksternal. Simbol tertutup menunjukkan endapan itu
hadir dalam tabung dialisis setelah kesetimbangan; simbol terbuka
berarti bahwa tidak ada bahan padat yang hadir, dan dengan demikian kelarutannya
setidaknya jumlah ini. Sumber: From Pearlman and Bewley, 1993.
3
2.5
2
1.5
6
7
8
9
pH
k (% / minggu)
Gambar 5 n profil stabilitas pH (pada 25
C) dari monomer
rekombinan 1 -antitrypsin (rAAT) dengan pengecualian ukuran-uji HPLC
(k ¼ konstanta laju degradasi). RAAT monomer menurun
cepat dalam konsentrasi baik dalam kondisi asam dan basa.
Stabilitas optimal terjadi pada pH 7,5. Sumber: Diadaptasi dari
Vemuri et al., 1993.
70
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 89
Pengeringan beku dapat memberikan stabilitas yang diminta
sayang Selama air pengeringan beku dihilangkan melalui
sublimasi dan bukan dengan penguapan. Tiga tahap bisa
dapat dilihat dalam proses pengeringan beku: (i) a
langkah pembekuan, (ii) langkah pengeringan primer, dan (iii)
langkah pengeringan sekunder (Gbr. 6). Tabel 2 menjelaskan
apa yang terjadi selama tahap ini.
Bekukan pengeringan larutan protein tanpa
eksipien yang tepat menyebabkan, sebagai aturan, ireversibel
kerusakan protein. Tabel 3 mencantumkan eksipien
biasanya dijumpai pada pengeringan beku yang berhasil
produk protein.
n Pembekuan
Pada langkah pembekuan (Gbr. 6) suhu
sistem air dalam botol diturunkan. Kristal es
pembentukan tidak dimulai tepat pada termodinamika
atau titik beku kesetimbangan, tetapi pendinginan dingin
terjadi. Itu berarti kristalisasi sering hanya
terjadi ketika suhu –15
C atau lebih rendah miliki
telah tercapai. Selama langkah kristalisasi
suhu sementara dapat naik di dalam botol, karena
dari generasi panas kristalisasi. Selama
tahap pendinginan, konsentrasi protein dan
eksipien terjadi karena kristal es yang tumbuh
massa dengan mengorbankan fase air berair. Ini
dapat menyebabkan presipitasi satu atau lebih dari
eksipien, yang akibatnya dapat menyebabkan pH
bergeser (lihat di atas dan Gambar 7) atau perubahan kekuatan ion.
Ini juga dapat menyebabkan denaturasi protein. Pendinginan dari
botol dilakukan dengan menurunkan suhu
rak. Memilih skema pendinginan yang tepat untuk
rak, dan akibatnya botol, penting karena menentukan
tingkat pendinginan dan ukuran kristal es. Kecil
kristal terbentuk selama pendinginan cepat; kristal besar
terbentuk pada tingkat pendinginan yang lebih rendah. Kristal es kecil adalah
diperlukan untuk bahan padat berpori dan laju sublimasi yang cepat
(Pikal, 1990a).
Jika sistem tidak (sepenuhnya) mengkristal tetapi
membentuk massa amorf setelah pendinginan, suhu
perature dalam "tahap pembekuan" harus turun di bawah ini
Tg, suhu transisi gelas. Dalam bentuk amorf
sistem viskositas berubah secara dramatis di
kisaran suhu di sekitar Tg: keadaan “kenyal”
ada di atas dan keadaan kaca di bawah Tg.
Pada awal tahap pengeringan primer tidak ada "gratis."
dan cairan ”air harus ada dalam botol. Minus
empat puluh derajat Celcius adalah suhu beku yang khas
sebelum sublimasi dimulai melalui tekanan
pengurangan.
n Pengeringan Primer
Pada tahap pengeringan primer (Gbr. 6) sublimasi
massa air dalam botol diawali dengan menurunkan
tekanan. Uap air dikumpulkan di kondensor,
dengan (secara substansial) suhu lebih rendah dari
rak dengan vial. Sublimasi membutuhkan energi (sekitar
2500 kJ / gram es). Penurunan suhu dihindari oleh
T
˚C
Pembekuan
Pengeringan primer
Pengeringan sekunder
P
(Pa)
Gambar 6 n Contoh
protokol pengeringan beku untuk
sistem dengan kristalisasi
air. Singkatan: T, temp
perature; P, tekanan.

Pembekuan
Suhu produk berkurang dari sekitar
suhu ke suhu di bawah eutektik
suhu (T e ), atau di bawah transisi kaca
suhu (T g ) sistem. AT g ditemui jika
fase amorf hadir.

Pengeringan primer
Mengkristal dan air tidak terikat dengan protein / eksipien
dihapus oleh sublimasi. Suhu di bawah T e
atau Tg (mis., –40
C) dan mengurangi tekanan digunakan.

Pengeringan sekunder
Penghapusan air yang berinteraksi dengan protein dan
eksipien. Suhu di dalam kamar disimpan di bawah
T g dan naik secara bertahap, misalnya dari -40
C hingga 20
C.
Tabel 2 n Tiga tahap dalam proses pengeringan protein beku
formulasi.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
71
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 90
pasokan panas dari rak ke botol, jadi
rak dipanaskan selama tahap ini.
Panas ditransfer ke vial melalui (i) langsung
kontak rak-botol (konduktansi), (ii) radiasi, dan (iii)
konduksi gas (Gbr. 8). Konduksi gas tergantung pada
tekanan: jika seseorang memilih gas yang relatif tinggi
tekanan, transportasi panas dipromosikan karena a
konduktivitas tinggi. Tapi, itu mengurangi transfer massa,
karena kekuatan pendorong yang rendah: tekanan antara
tekanan uap kesetimbangan pada antarmuka antara
kue beku / kering dan tekanan ruang
(Pikal, 1990a).
Selama tahap pengeringan primer seseorang memindahkan panas
dari rak melalui bagian bawah botol dan beku
massa ke antarmuka massa beku / bubuk kering, untuk menjaga
proses sublimasi berjalan. Selama tahap pengeringan ini
konten botol tidak boleh mencapai atau melebihi eutektik
suhu atau kisaran suhu transisi gelas.
Biasanya margin keamanan 2
C ke 5
C digunakan, jika tidak
kue akan runtuh. Collapse menyebabkan reduksi yang kuat
dalam tingkat sublimasi dan pembentukan kue yang buruk. Panas
resistensi transfer berkurang selama proses pengeringan
karena jarak transportasi berkurang oleh mundur
antarmuka. Dengan resistensi perpindahan massa (pengangkutan dari
Namun, sebaliknya terjadi. Massa
resistensi transfer meningkat selama proses pengeringan
karena kue kering menjadi lebih tebal.
Situasi ini memperjelas parameter tersebut
seperti tekanan ruang dan pemanasan rak tidak
tentu konstan selama pengeringan primer

Agen bulking:
Mannitol / glisin

Perkecil pengubah suhu:
Dekstran, albumin / gelatin

Lyoprotectant:
Gula, albumin
Alasan:
Pencegahan keanggunan / ledakan a
Alasan:
Meningkatkan suhu jatuhnya
Alasan:
Perlindungan struktur fisik protein b
a Blowout adalah hilangnya material yang diambil oleh uap air yang meninggalkan vial. Itu terjadi ketika sedikit
bahan padat hadir dalam botol.
b Mekanisme kerja lyoprotectants tidak sepenuhnya dipahami. Faktor-faktor yang mungkin berperan adalah: (1)

lyoprotectants menggantikan air sebagai zat penstabil (teori penggantian air); (2) lyoprotectants meningkat
Tg
dari kue / sistem beku; (3) lyoprotectants akan menyerap uap air dari sumbat;
(4) lyoprotectants memperlambat proses pengeringan sekunder dan meminimalkan kemungkinan overdrying
protein. Overdrying mungkin terjadi ketika level air residu setelah pengeringan sekunder menjadi terlalu rendah.
Pikal (1990b) menganggap peluang untuk overdrying "dalam kehidupan nyata" kecil.
Tabel 3 n Eksipien khas dalam formulasi protein beku-kering.
Karet
sumbat
Kaca
botol kecil
Produk
3
2
1
Ts
Tp
Tc
Rak
Gambar 8 n Mekanisme perpindahan panas selama pengeringan beku
proses: (1) konduksi langsung melalui rak dan kaca di titik
kontak aktual, (2) konduksi gas: kontribusi perpindahan panas via
konduksi melalui gas antara rak dan bagian bawah botol, dan (3)
perpindahan panas radiasi. Singkatan: Ts, suhu rak; Tp,
produk bersublimasi suhu; Tc, kondensor suhu.
Ts> Tp> Tc.
7
6
5
pH
4
3
–16 –14 –12 –10 –8
Temperatur (˚C)
–6
–4
–2
0
Gambar 7 n Pencairan / pendinginan (biru menunjukkan pencairan; merah
menunjukkan pendinginan). Efek pembekuan pada pH sitrat
sistem buffer asam-disodium fosfat. Sumber: Diadaptasi dari
Pikal, 1990a.
72
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 91
proses. Mereka harus dipilih dan disesuaikan dengan hati-hati
saat proses pengeringan berlangsung.
Suhu eutektik atau transisi kaca
suhu adalah parameter yang sangat penting untuk
mengembangkan protokol pengeringan beku yang dirancang secara rasional.
Informasi tentang parameter ini dapat diperoleh
dengan pengamatan mikroskopis pengeringan beku
proses, pemindaian kalorimetri diferensial (DSC), atau
pengukuran hambatan listrik.
Contoh pemindaian DSC yang memberikan informasi
tion pada Tg disajikan pada Gambar 9 (Franks et al.,
1991). Tg sangat tergantung pada komposisi
sistem: eksipien dan kadar air. Penurunan
kadar air dari suatu sistem amorf menyebabkan
Tg bergeser ke suhu yang lebih tinggi.
n Pengeringan Sekunder
Ketika semua air beku atau amorf yang tidak
protein dan ikatan non-eksipien dihilangkan
langkah pengeringan sekunder dimulai (Gbr. 6). Akhir dari
tahap pengeringan primer tercapai saat produk
suhu dan suhu rak menjadi sama, atau
ketika tekanan air parsial turun (Pikal, 1990a).
Selama air "tidak terikat" dihilangkan,
tekanan air parsial hampir sama dengan total
tekanan. Pada tahap pengeringan kedua suhu
mendatang perlahan-lahan ditingkatkan untuk menghilangkan air "terikat"; itu
tekanan ruang masih berkurang. Suhu
harus tetap sepanjang waktu di bawah keruntuhan / eutektik
suhu, yang terus meningkat ketika residual
isi airnya turun. Biasanya, pengeringan sekunder
langkah berakhir ketika produk telah disimpan di 20
C untuk
beberapa waktu. Kadar air residu sangat penting,
parameter penunjuk titik akhir. Nilai serendah 1%
air sisa dalam kue telah direkomendasikan.
Gambar 10 (Pristoupil, 1985; Pikal, 1990a) mencontohkan
penurunan stabilitas hemoglobin kering-beku
dengan meningkatnya kadar air residu.
Ketika disimpan di hadapan mengurangi
lyoprotectants seperti glukosa dan laktosa
Reaksi Maillard dapat terjadi: gugus amino dari
protein bereaksi dengan lyoprotectant dalam keadaan kering
dan warna kue berubah menjadi kuning-cokelat. Penggunaan
gula non-pereduksi seperti sukrosa atau trehalosa mungkin
hindari masalah ini.
n Pendekatan Lain untuk Menstabilkan Protein
Bentuk protein padat digunakan untuk
aplikasi kedokteran hewan tertentu, seperti berkelanjutan
melepaskan formulasi hormon pertumbuhan. Pelet
harus mengandung aditif sesedikit mungkin. Mereka bisa
diterapkan secara subdermal atau intramuskuler ketika
pelet kompak diperkenalkan oleh udara terkompresi
bertenaga senapan ke binatang (Klegerman dan
Groves, 1992).
PENGIRIMAN PROTEIN: ROUTES OF ADMINISTRATION
DAN PENINGKATAN ABSORPSI
n Rute Administrasi Parenteral
Administrasi parenteral di sini didefinisikan sebagai administrasi
trasi melalui rute-rute di mana jarum digunakan,
termasuk intravena (IV), intramuskuler (IM), sub-
injeksi kulit (SC) dan intraperitoneal (IP).
Informasi lebih lanjut tentang perilaku farmakokinetik
protein rekombinan disediakan dalam Bab 5. Ini
cukup di sini untuk menyatakan bahwa paruh darah biotek
produk dapat bervariasi dalam rentang yang luas. Misalnya,
waktu paruh sirkulasi t-PA adalah beberapa menit, sementara
220
5.7
6.0
6.3
Heat flo
w (mcal / s)
230
Suhu
Gambar 9 n 9 Jejak pemanasan DSC untuk larutan beku
sukrosa dan natrium klorida, menunjukkan transisi gelas
suhu konsentrat beku pada 227K. Untuk murni
sukrosa pekat, Tg g 241 K (1 Cal¼ 4.2 J). Sumber:
Diadaptasi dari Franks et al., 1991.
80
70
60
50
40
30
20
10
0
0
2
4
6
8
10
Persentase air
Level awal bertemu hemoglobin
P
ercenta
g
e bertemu hemoglobin
Gambar 10 n Pengaruh kelembaban sisa pada stabilitas
hemoglobin kering-beku (–6%) diformulasikan dengan sukrosa 0,2M;
dekomposisi untuk bertemu hemoglobin selama penyimpanan di 23
C untuk
4 tahun. Sumber: From Pikal, 1990a; data dilaporkan oleh Pritoupil
et al., 1985.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
73
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 92
antibodi monoklonal (MAb) dilaporkan memiliki setengah
kehidupan beberapa hari. Jelas, satu alasan untuk berkembang
protein yang dimodifikasi melalui mutagenesis terarah situs
adalah untuk meningkatkan paruh waktu sirkulasi. Cara mudah untuk
memperluas waktu tinggal rata-rata untuk paruh pendek
protein adalah untuk beralih dari administrasi IV ke IM atau SC
tion. Orang harus menyadari bahwa dengan melakukan itu, perubahan
disposisi dapat terjadi, dengan dampak yang signifikan pada
kinerja terapi obat. Ini
perubahan terkait dengan: (i) tempat tinggal yang lama
waktu di situs IM atau SC injeksi dibandingkan dengan IV
administrasi dan peningkatan paparan terhadap
reaksi dation (peptidases) dan (ii) perbedaan
watak.
Mengenai poin 1: Waktu tinggal yang lama di
situs IM atau SC injeksi dan ditingkatkan
paparan reaksi degradasi. Contohnya,
penderita diabetes bisa menjadi "resisten insulin" melalui tinggi
aktivitas peptidase jaringan (Maberly et al., 1982). Lain
faktor-faktor yang dapat berkontribusi terhadap variasi penyerapan adalah
terkait dengan perbedaan tingkat latihan otot di
tempat suntikan dan juga pijatan dan panas di
situs injeksi. Keadaan jaringan, misalnya
terjadinya kondisi patologis, mungkin
portant juga.
Mengenai poin 2: Perbedaan dalam disposisi.
Setelah pemberian, protein dapat diangkut
ke darah melalui limfatik atau dapat memasuki
sirkulasi darah melalui dinding kapiler di situs
injeksi (Gambar 11 dan 12). Bagian dari
diberikan dosis mengambil rute limfatik ini
tergantung berat molekul (Supersaxo et al., 1990).
Transportasi limfatik membutuhkan waktu (jam) dan penyerapan
sirkulasi darah sangat tergantung pada
situs injeksi. Dalam perjalanan menuju darah, getah bening
melewati kelenjar getah bening yang mengering dan kontak adalah
mungkin antara isi getah bening dan sel
sistem kekebalan tubuh seperti makrofag, B- dan
Limfosit T yang berada di kelenjar getah bening.
n Rute Administrasi Lisan
Pemberian obat protein oral lebih disukai,
karena ramah pasien dan tidak ada intervensi oleh a
profesional kesehatan diperlukan untuk mengelola
obat. Namun bioavailabilitas oral biasanya sangat
rendah. Dua alasan utama kegagalan pengambilan ini
adalah: (i) degradasi protein di saluran cerna
(GI) traktat dan (ii) permeabilitas yang buruk dari dinding
saluran GI jika terjadi proses transportasi pasif
(Lee et al., 1991).
Darah
Obat MW rendah
Tinggi M W obat
Dinding kapiler
Getah bening
Situs injeksi
Gambar 11 n Rute up-up
mengambil SC atau IM disuntikkan
narkoba.
70
60
50
40
30
20
10
0
FUdR
Inulin
Sitokrom C
Berat molekul [kDa]
L.
ymph reco
sangat [% dari dosis]
IFN-  -2a
0 2 4 6 8 10 12 14 16 18 20
Gambar 12 n Korelasi antara berat molekul dan
pemulihan kumulatif rIFN alpha-2a (M w 19 kDa), sitokrom
C (M W 12,3 kDa), inulin (M W 5,2 kDa), dan FUDR (M W 256,2 Da)
di getah bening eferen dari kelenjar getah bening poplitea kanan
mengikuti administrasi SC ke bagian bawah belakang kanan
kaki domba. Setiap titik dan bilah menunjukkan mean dan standar
penyimpangan dari tiga percobaan dilakukan pada domba yang terpisah. Itu
garis yang ditarik adalah yang paling cocok dengan analisis regresi linier dihitung
dengan empat nilai rata-rata. Poin-poin memiliki korelasi
koefisien r sebesar 0,998 (p <0,01). Sumber: Diadaptasi dari
Supersaxo et al., 1990.
74
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 93
Mengenai poin 1: Degradasi protein dalam GI
sistem. Tubuh manusia telah berkembang sangat efisien
sistem untuk memecah protein dalam makanan kita menjadi amino
asam, atau di- atau tri-peptida. Batu-batu bangunan ini untuk
protein tubuh secara aktif diserap untuk digunakan di mana pun
diperlukan dalam tubuh. Di perut pepsins, a
keluarga protease aspartik, disekresikan. Mereka
sangat aktif antara pH 3 dan 5 dan hilang
aktivitas pada nilai pH yang lebih tinggi. Pepsins adalah endopepti-
Dasa mampu memisahkan ikatan peptida jauh dari
ujung rantai peptida. Mereka istimewa
ikatan peptida membelah antara dua hidrofobik
asam amino. Endopeptidase lain aktif di dalam
Saluran GI pada nilai pH netral, misalnya trypsin, chymo-
trypsin, dan elastase. Mereka memiliki peptida yang berbeda
ikatan karakteristik pembelahan yang kurang lebih
saling memuji. Exopeptidases, protease
rantai peptida yang merendahkan dari ujungnya, hadir
demikian juga. Contohnya adalah carboxypeptidase A dan B. In
lumen GI protein dipotong menjadi fragmen itu
lebih lanjut secara efektif memecah menjadi asam amino, di- dan
tri-peptida dengan batas sikat dan pro- sit sitoplasma
menggoda enterosit.
Mengenai poin 2: Permeabilitas. Molekul tinggi
molekul berat tidak mudah menembus utuh
dan penghalang epitel matang jika difusi adalah satu-satunya
kekuatan pendorong untuk transfer massal. Difusi mereka
Koefisien berkurang dengan meningkatnya ukuran molekul.
Protein tidak terkecuali pada aturan ini. Transportasi aktif
protein rekombinan terapeutik utuh di atas
GI-epitel belum dideskripsikan.
Analisis di atas mengarah pada kesimpulan bahwa
alam, sayangnya, tidak memungkinkan kita untuk menggunakan oral
rute pemberian untuk protein terapi jika tinggi
(atau setidaknya konstan) bioavailabilitas diperlukan.
Namun, untuk kategori vaksin oral tersebut
rintangan degradasi dan permeasi yang disebutkan di atas
Tidak harus selalu mahal. Untuk imunisasi oral
zasiasi, hanya sebagian kecil dari antigen (protein)
harus mencapai situs targetnya untuk mendapatkan kekebalan tubuh
tanggapan. Sel target adalah limfosit dan
sel-sel aksesori penyajian antigen terletak di Peyer's
tambalan (Gbr. 13). Populasi B-limfosit
termasuk sel yang menghasilkan antibodi IgA sekretori.
Tambalan Peyer ini secara makroskopis
struktur folikel yang dapat diidentifikasi terletak di dinding
dari saluran GI. Patch Peyer dilapisi dengan
sel microfold (M) yang memisahkan luminal
isi dari limfosit. Sel M ini memiliki
sedikit kapasitas degradasi lisosom dan memungkinkan
pengambilan sampel antigen oleh limfosit yang mendasarinya.
Selain itu, lendir yang menghasilkan kepadatan sel piala adalah
dikurangi lebih dari patch Peyer. Ini mengurangi lendir
produksi dan memfasilitasi akses ke sel M
permukaan untuk konten luminal (Jani et al., 1992; Roitt
et al., 1993). Upaya untuk meningkatkan pengiriman antigen
melalui patch Peyer dan untuk meningkatkan kekebalan tubuh
respon dibuat dengan menggunakan mikrosfer, lipo-
beberapa atau vektor hidup yang dimodifikasi, seperti dilemahkan
bakteri dan virus (Holmgren et al., 1989; Eldridge
et al., 1990; Kersten dan Hirschberg, 2004, lihat
Bab 21).
Villi
Folikel limfoid
Sel epitel
sel goblet
Area interfollicular
(Area sel T)
Germinal
pusat
(Area sel B)
Lapisan sel yang tipis
Crypts (sel M berdiferensiasi di sini)
Dewasa dan
sel M yang belum matang
Kubah sel yang mengandung sel M
dipersiapkan di antara sel-sel epitel
Gambar 13 n Skema
diagram struktur
tambalan Peyer usus.
Sel M dalam folikel-
epitel terkait adalah
diperbesar untuk penekanan.
Sumber: Diadaptasi dari
O'Hagan, 1990.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
75
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 94
n Rute Alternatif Administrasi
Administrasi parenteral memiliki kelemahan (jarum,
sterilitas, keterampilan injeksi) dibandingkan dengan kemungkinan lain
rute. Oleh karena itu, pengiriman rekombinan sistemik
protein dengan rute pemberian alternatif (terpisah
dari saluran GI, dibahas di atas) telah dipelajari
luas. Hidung, paru-paru, dubur, rongga mulut, dan
kulit telah dipilih sebagai situs potensial aplikasi
tion. Potensi pro dan kontra untuk berbeda
rute yang relevan tercantum pada Tabel 4 (Zhou dan Li Wan
Po, 1991a; Zhou dan Li Wan Po, 1991b).
Rute nasal, bukal, rektal, dan transdermal
semua telah terbukti memiliki sedikit relevansi klinis jika
tindakan sistemik diperlukan, dan jika protein sederhana
formulasi tanpa peningkatan teknologi penyerapan
nologi digunakan. Secara umum, bioavailabilitas terlalu rendah
dan terlalu banyak bervariasi! Rute paru mungkin adalah
pengecualian pada aturan ini. Tabel 5 (dari Patton et al., 1994)
menyajikan ketersediaan hayati pada tikus secara intratrakeal
solusi protein diberikan dengan berbagai
berat molekul. Penyerapan sangat protein
dependen, tanpa hubungan yang jelas dengan
berat molekul.
Pada manusia, obat harus dihirup sebagai gantinya
dari administrasi intratracheally. Pengiriman
insulin untuk Tipe I (awitan remaja) dan Tipe II (dewasa
onset) penderita diabetes telah dipelajari secara luas dan
uji klinis fase III mengevaluasi efikasi dan keamanan
Nasal (Edman dan Björk, 1992)
Keuntungan:
Mudah diakses, pengambilan cepat, rekam jejak yang terbukti dengan sejumlah obat "konvensional", mungkin lebih rendah
aktivitas proteolitik daripada di saluran Gl, penghindaran efek first pass, penahanan spasial penyerapan
perangkat tambahan dimungkinkan
Kerugian:
Reproduksibilitas (khususnya dalam kondisi patologis), keselamatan (misalnya, gerakan silia), bioavailabilitas rendah
untuk protein
Paru-paru (Patton dan Platz, 1992)
Keuntungan:
Relatif mudah diakses, pengambilan cepat, rekam jejak yang terbukti dengan obat "konvensional", fraksi substansial
insulin diserap, aktivitas proteolitik lebih rendah daripada di saluran Gl, penghindaran efek first pass hati,
penahanan ruang peningkat penyerapan (?)
Kerugian:
Reproduksibilitas (khususnya dalam kondisi patologis, perokok / bukan perokok), keamanan (misalnya,
imunogenisitas), adanya makrofag di paru dengan afinitas tinggi untuk partikulat
Rektal (Zhou dan Li Wan Po, 1991b)
Keuntungan:
Mudah diakses, penghindaran parsial dari hepatic first pass, mungkin aktivitas proteolitik lebih rendah daripada di atas
bagian dari saluran Gl, penahanan spasial dari peningkat penyerapan dimungkinkan, rekam jejak yang terbukti dengan a
jumlah obat "konvensional"
Kerugian:
Ketersediaan hayati yang rendah untuk protein
Buccal (Zhou dan Li Wan Po, 1991b; Ho et al., 1992)
Keuntungan:
Mudah diakses, penghindaran hepatik pertama, mungkin aktivitas proteolitik lebih rendah daripada di bagian bawah
saluran gl, penahanan spasial penambah penyerapan dimungkinkan, opsi untuk menghilangkan formulasi jika
perlu
Kerugian:
Ketersediaan protein yang rendah, belum ada rekam jejak yang terbukti (?)
Transdermal (Cullander and Guy, 1992)
Keuntungan:
Mudah diakses, penghindaran efek first pass hati, penghilangan formulasi jika perlu dimungkinkan, secara spasial
penahanan peningkat penyerapan, rekam jejak yang terbukti dengan obat “konvensional”, berkelanjutan / terkontrol
rilis mungkin
Kerugian:
Ketersediaan protein yang rendah
Tabel 4 n Alternatif rute administrasi ke rute oral untuk biofarmasi.
76
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 95
telah dilakukan atau sedang berlangsung (Patton et al.,
1999). Formulasi insulin paru pertama adalah
disetujui oleh FDA pada Januari 2006 (Exubera
HAI
).
Inhalasi insulin paru secara khusus diuji
untuk kontrol glukosa waktu makan. Penyerapan insulin adalah
lebih cepat daripada setelah injeksi insulin SC reguler (puncak
5–60 menit berbanding 60–180 menit). Reproduksi
respons glukosa darah terhadap inhalasi
insulin setara dengan insulin yang disuntikkan SC, tetapi
pasien lebih suka inhalasi daripada injeksi SC.
Teknologi inhalasi memainkan peran penting ketika
mempertimbangkan prospek rute paru
untuk pengiriman protein terapeutik sistemik. Kering
inhaler serbuk dan nebulisator sedang diuji. Itu
sebagian kecil dari insulin yang akhirnya diserap
tergantung pada: (i) fraksi dari inhalasi / nebulisasi
dosis yang sebenarnya meninggalkan perangkat, (ii)
fraksi yang sebenarnya disimpan di paru-paru, dan
(iii) fraksi yang diserap, yaitu total
serapan relatif (TO%) ¼% serapan dari perangkat Â%
diendapkan di paru-paru Â% sebenarnya diserap dari
paru-paru. TO% untuk insulin diperkirakan sekitar
10% (Patton et al., 2004). Fraksi insulin itu
diserap dari paru-paru diperkirakan sekitar
20%. Angka-angka ini menunjukkan bahwa penyerapan insulin
tion melalui paru-paru mungkin merupakan rute yang menjanjikan; tetapi
fraksi yang diserap kecil.
Oleh karena itu, berbagai pendekatan telah dievaluasi
digunakan untuk meningkatkan bioavailabilitas paru dan
rute administrasi non-parenteral lainnya. Itu
tujuannya adalah untuk mengembangkan sistem yang sementara berkurang
resistansi hambatan penghalang dengan minimum dan
masalah keamanan yang dapat diterima. Back- mekanik
dasar dari pendekatan ini diberikan pada Tabel 6. Sampai
sekarang, tidak ada produk yang menggunakan salah satu dari pendekatan ini
telah berhasil melewati program uji klinis. Keamanan
kekhawatiran adalah rintangan penting. Pusat pertanyaan pada
spesifisitas dan reversibilitas protein permea-
efek penambah efek dan toksisitas.
n Contoh Efek Peningkatan Serapan
Bagian berikut ini membahas "keadaan terkini"
masalah penting ini: peningkatan penyerapan dan
administrasi non-parenteral dari pro-rekombinan
teins. Sejumlah contoh khas disediakan.
Tabel 7 menyajikan contoh (rupanya
hubungan antara ketersediaan hayati hidung
beberapa obat peptida dan protein, molekulnya
berat dan keberadaan penambah penyerapan
glycocholate (Zhou dan Li Wan Po, 1991b).
Gambar 14 (Björk dan Edman, 1988) menggambarkan
kasus lain di mana mikrosfer pati terdegradasi
sarat dengan insulin digunakan dan di mana perubahan
kadar glukosa dipantau setelah pemberian hidung
administrasi untuk tikus.
Molekul
Mw
kDa
Jumlah
AA
Mutlak
ketersediaan hayati
(%)
a-interferon
20
165
> 56
PTH-84
9
84
> 20
PTH-34
4.2
34
40
Kalsitonin
(manusia)
3.4
32
17
Kalsitonin
(ikan salmon)
3.4
32
17
Glukagon
3.4
29
<1
Somatostatin
3.1
28
<1
Singkatan: AA, jumlah asam amino; PTH, manusia rekombinan
hormon paratiroid.
Sumber: Diadaptasi dari Patton et al., 1994.
Tabel 5 n Ketersediaan hayati absolut dari sejumlah protein
(intratrakeal vs IV) pada tikus.
Diklasifikasikan menurut mekanisme aksi yang diusulkan
■ Meningkatkan permeabilitas penghalang penyerapan:
■ Penambahan asam lemak / fosfolipid, garam empedu,
turunan enamine dari phenylglycine, ester dan eter
tipe (non) - deterjen ionik, saponin, salisilat
turunannya, turunan dari asam fusidic atau glycyrrhizinic
asam, atau b siklodekstrin termetilasi
■ Melalui iontophoresis
■ Dengan menggunakan liposom
■ Mengurangi aktivitas peptidase di lokasi penyerapan dan
di sepanjang "rute penyerapan": aprotinin, bacitracin, kedelai
inhibitor tirosin, boroleusin, borovalin
■ Tingkatkan resistensi terhadap degradasi dengan modifikasi
dari struktur molekul
■ Perpanjangan masa pakai (misalnya, teknologi bio-adhesi)
Sumber: Diadaptasi dari Zhou dan Li Wan Po, 1991a.
Tabel 6 n Pendekatan untuk meningkatkan bioavailabilitas protein.
Ketersediaan hayati (%)
Molekul
Jumlah
AA
Tanpa
glikolat
Dengan
glikolat
Glukagon
29
<1
70–90
Kalsitonin
32
<1
15–20
Insulin
51
<1
10–30
Bertemu-hGH a
191
<1
7–8
aLihat Bab 13, Pertumbuhan Hormones.Abbreviation: AA, asam amino.
Sumber: Diadaptasi dari Zhou dan Li Wan Po, 1991b.
Tabel 7 n Pengaruh glycocholate (penambah penyerapan) terhadap
ketersediaan hayati hidung dari beberapa protein dan peptida.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
77
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 96
Dalam contoh-contoh ini, efek dari kehadiran
peningkat penyerapan jelas. Masalah besar sekarang
yang ditangani adalah reproduktifitas, efek patologis-
kondisi gical (misalnya, rinitis) pada penyerapan dan
aspek keamanan penggunaan kronis. Menariknya, penyerapan
meningkatkan efek terbukti bergantung pada spesies
lekuk. Perbedaan efek yang diucapkan diamati
antara tikus, kelinci, dan manusia.
Dengan iontophoresis, listrik transdermal
saat ini disebabkan oleh posisi dua elektroda aktif
berbagai tempat pada kulit (Gbr. 15). Saat ini
menginduksi migrasi molekul (terionisasi) melalui
kulit. Pengiriman tergantung pada saat ini (on / off,
berdenyut / langsung, bentuk gelombang), pH, kekuatan ionik,
berat molekul, muatan protein, dan suhu
perature. Protein harus diisi penuh
ketebalan kulit (pH kulit terhidrasi tergantung pada
kedalaman dan bervariasi antara pH 4 (permukaan) dan pH
7.3), yang membuat protein dengan nilai pI di luar ini
kisaran kandidat utama untuk transportasi iontophoretic. Saya t
tidak jelas apakah ada batasan ukuran (protein
MW) untuk transportasi iontophoretic. Namun, hanya itu saja
protein yang kuat akan menjadi kandidat yang berhasil. Dengan
teknologi saat ini fluks protein melalui
kulit berada dalam kisaran 10 mg / cm 2 / jam (Sage et al., 1995).
100
0
30
60
Waktu (min)
Ubah b
Glukosa yang baik (%)
120
180
240
50
0
Gambar 14 n Perubahan glukosa darah pada tikus setelah intranasal
pemberian insulin. Sumber: Dibahas oleh Edman dan
Björk, 1992.
Kunci:
Insulin terlarut 2,0 lU / kg dalam
Insulin terlarut 0,25 lU / kg IV
Mikrosfer pati terdegradasi - insulin 0,75 lU / kg dalam
Mikrosfer pati terdegradasi - insulin 1,70 lU / kg dalam
Mikrosfer pati degradable kosong 0,5 mg / kg dalam
Stratum korneum
Papillary
lapisan
Kapiler
jaringan
Reseptor
elektroda
Darah
sirkulasi
Elektronik
generator
Obat
waduk
elektroda
Kulit ari
Perembesan
Serapan
e-
(obat)
Cp
Gambar 15 n Ilustrasi skematik dari pengiriman peptida dan protein transdermal iontophoretic di seluruh kulit. Sumber:
Diadaptasi dari Chien, 1991.
78
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 97
Gambar 16 menyajikan profil pertumbuhan plasma
faktor pelepasan hormon, GRF (44 asam amino, MW
5kDa setelah SC, IV, dan transdermal iontophoretic
pengiriman ke babi guinea yang tidak berambut. Penampilan yang berkepanjangan
ance GRF dalam plasma dapat diamati.
Pengiriman iontoforetik menawarkan peluang menarik
jika pengiriman protein diperlukan. Itu
perangkat dapat dipakai secara permanen dan hanya diaktifkan
aktif untuk periode waktu yang diinginkan, mensimulasikan pulsatile
sekresi hormon endogen seperti pertumbuhan
hormon dan insulin.
PENGIRIMAN PROTEIN: PENDEKATAN UNTUK
SITUS TERKENDALA DAN SITUS SASARAN-KHUSUS
PENGIRIMAN OLEH ROUTE PARENTERAL
Protein terapeutik yang digunakan saat ini sangat berbeda
karakteristik farmakokinetik mereka (lihat Bab 5).
Jika mereka adalah agen endogen seperti insulin, t-PA,
hormon pertumbuhan, eritropoetin, interleukin, atau faktor
VIII, penting untuk menyadari mengapa, kapan dan di mana
mereka disekresikan. Ada tiga cara berbeda
sel mana yang dapat berkomunikasi satu sama lain:
jalur endokrin, parakrin, dan otokrin
(Tabel 8).
Hubungan dosis-respons dari media ini-
tor sering tidak berbentuk S, tetapi, misalnya, bel
berbentuk: pada dosis tinggi efek terapi menghilang
pir (lihat Bab 5). Apalagi kehadiran ini
mediator dapat mengaktifkan kaskade kejadian yang kompleks
yang perlu dikendalikan dengan hati-hati. Karena itu, kuncinya
masalah untuk keberhasilan terapi mereka adalah: (i) akses ke
sel target, (ii) retensi di situs target, dan (iii)
waktu pengiriman yang tepat (Tomlinson, 1987).
Khususnya, untuk akting parakrin dan autokrin
protein, pengiriman spesifik lokasi bisa sangat diinginkan,
karena kalau tidak efek samping akan terjadi di luar
area target. Efek samping yang parah dilaporkan
sitokin, seperti faktor nekrosis tumor dan interleu-
kin-2 pada pemberian parenteral (IV atau SC) (lihat
Bab 11). Terjadinya efek samping ini membatasi
potensi terapi senyawa ini. Oleh karena itu,
pengiriman protein ini di tempat yang tepat, laju, dan dosis
merupakan bagian penting dalam proses desain dan
pengembangan senyawa ini sebagai farmasi
entitas. Bagian berikut membahas konsep pertama
dikembangkan untuk mengontrol rilis kinetika dan subse
cepat konsep untuk pengiriman obat yang diarahkan pada situs.
PENDEKATAN UNTUK PENGIRIMAN YANG DIKENDALIKAN NILAI
Kontrol nilai dapat dicapai oleh beberapa berbeda
teknologi yang mirip dengan yang digunakan untuk "konvensional"
narkoba. Insulin adalah contoh yang bagus. Spektrum
opsi tersedia dan diterima: berbagai jenis
suspensi dan sistem infus kontinu
dipasarkan (lihat Bab 12). Apalagi bahan kimia
pendekatan dapat digunakan untuk mengubah karakter protein
istics. Penempelan polioksietilen glikol ke protein
mengubah paruh mereka dalam dramatisasi darah
dihabiskan. Gambar 17 menunjukkan contoh pendekatan ini.
1.20
1,00
0,80
Konsentrasi plasma (ng / ml)
0,60
0,40
0,20
0
0
1
2
3
jam
4
5
Gambar 16 n Konsentrasi plasma versus profil waktu setelah
SC, IV dan administrasi transdermal iontophoretic dari GRF
(1–44) untuk marmut tidak berambut. Merah, iontophoresis (1mg / g;
0,17 mA / cm 2 ; 5cm 2 tambalan). Biru, SC (10 mg / kg; 0,025mg / ml).
Kuning, IV (10 mg / kg; 0,025 mg / ml). Sumber: Diadaptasi dari Kumar
et al., 1992.

Hormon endokrin: Hormon yang dikeluarkan oleh jauh
sel untuk mengatur fungsi sel didistribusikan secara luas melalui
tubuh. Aliran darah memainkan peran penting dalam
proses transportasi.

Mediator bertindak paracrine: Mediator disekresi oleh
sel untuk mempengaruhi sel di sekitarnya, jarak dekat
mempengaruhi.

Mediator akting otonom: Agen disekresikan oleh a
sel dan memengaruhi sel tempat ia dihasilkan, (sangat)
pengaruh jarak pendek.
Tabel 8 n Komunikasi antar sel: pembawa pesan kimia.
130
120
110
PT
20
10
0
2
pra
h
Inggris asli
PEG-UK
4
6
24
52
Gambar 17 n Pengaruh pencangkokan kimia poli-etilenegly-
col (PEG) pada kemampuan urokinase (UK) untuk mempengaruhi
waktu protrombin (PT) in vivo di beagles dengan waktu. Sumber:
Diadaptasi dari Tomlinson, 1987.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
79
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 98
Secara umum, protein diberikan sebagai
solusi berair. Hanya vaksin rekombinan dan sebagian besar
formulasi insulin disampaikan sebagai dis (koloid)
kegigihan. Saat ini, insulin secara rutin dan
diterapkan secara klinis melalui beberapa bentuk terkontrol
sistem rilis (lihat Bab 12) selain melalui
infus terus menerus. Seperti pengalaman dengan obat biotek
tumbuh, teknologi yang lebih maju pastinya
diperkenalkan untuk mengoptimalkan manfaat terapeutik dari
obat. Tabel 9 mencantumkan beberapa teknologi yang layak
pilihan. Mereka disentuh secara singkat di bawah ini.
n Sistem Loop Terbuka: Pompa Mekanik
Pompa yang digerakkan secara mekanik adalah alat yang umum digunakan
memberikan obat secara intravena di rumah sakit (terus menerus
infus, tipe loop terbuka). Mereka tersedia dalam berbagai jenis
macam ukuran / harga, portable atau tidak, dalam / luar
tubuh, dll. Tabel 10 menyajikan daftar periksa masalah yang akan terjadi
dipertimbangkan ketika memilih pompa yang tepat.
Pemberian obat yang terkontrol tidak
tentu menyiratkan laju input konstan. Berdenyut atau
pengiriman variabel-rate adalah mode input yang diinginkan untuk a
sejumlah obat protein, dan untuk obat ini memompa
harus memberikan karakteristik laju input yang fleksibel.
Insulin adalah contoh utama dari obat protein, di mana
ada kebutuhan untuk menyesuaikan laju input dengan kebutuhan
tubuh. Saat ini, sebagian besar pengalaman dengan sistem pompa
dalam pengaturan rawat jalan telah diperoleh dengan ini
obat. Sistem pompa mungkin gagal karena energi
kegagalan, masalah dengan jarum suntik, jarum yang tidak disengaja
penarikan, kebocoran kateter dan masalah di
tempat injeksi atau implantasi (Banerjee et al., 1991).
Selain itu, stabilitas obat jangka panjang dapat menjadi a
masalah. Protein harus stabil di 37
C atau
suhu sekitar (perangkat internal dan eksternal,
masing-masing) antara dua isi ulang. Akhirnya, bahkan dengan
sistem pompa berteknologi tinggi, pasien masih harus mengumpulkan
data untuk menyesuaikan laju pompa. Ini menyiratkan invasif
pengambilan sampel dari cairan tubuh secara teratur, diikuti
dengan perhitungan laju input yang diperlukan. Masalah ini
akan terpecahkan jika konsep sistem loop tertutup
akan terwujud (sistem umpan balik, lihat di bawah).
n Sistem Loop Terbuka: Sistem Berbasis Osmotik
Pompa mini osmotik yang ditanamkan secara subkutan
dikembangkan oleh ALZA (Alzet minipump, Gbr. 18)
Kontrol nilai melalui pendekatan tipe loop terbuka

Infus berkelanjutan dengan pompa: secara mekanis atau
input yang digerakkan secara osmotik: bentuk konstan / pulsatile / gelombang

Implan: polimer yang dapat terbiodegradasi, lipid

Input: kontrol terbatas
Kontrol nilai melalui pendekatan loop tertutup / sistem umpan balik

Kombinasi biosensor-pompa

Sistem pengaturan diri

Sel sekretori terenkapsulasi
Tabel 9 n Sistem pelepasan terkontrol untuk pengiriman parenteral.
Pompa harus mengantarkan obat pada kecepatan yang ditentukan untuk
periode waktu yang panjang. Itu harus:

Memiliki berbagai tingkat pengiriman

Pastikan pengiriman yang akurat, tepat dan stabil

Berisi komponen pompa dan listrik yang andal

Mengandung obat yang kompatibel dengan internal pompa

Berikan cara sederhana untuk memantau status dan
kinerja pompa
Pompa harus aman. Itu harus:

Memiliki eksterior biokompatibel jika ditanamkan

Memiliki perlindungan overdosis

Tidak menunjukkan kebocoran

Memiliki mekanisme gagal-aman

Memiliki interior dan eksterior yang dapat disterilkan (jika dapat ditanamkan)
Pompa harus nyaman. Itu harus:

Ukurannya cukup kecil dan tidak mencolok

Memiliki umur reservoir yang panjang

Mudah diprogram
Sumber: Diadaptasi dari Banerjee et al., 1991.
Tabel 10 n Karakteristik pompa ideal.
Solusi obat
pergi via
portal pengiriman
Tutup yang bisa dilepas
Flens
Sumbat leher
Agen osmotik
Semipermeable
selaput
Air masuk
semipermeabel
selaput
Waduk
Fleksibel
kedap
dinding reservoir
Mengalir
moderator
Gambar 18 n Potongan melintang dari fungsi Alza Alzet osmotik
minipump. Sumber: Diadaptasi dari Banerjee et al., 1991.
80
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 99
(Banerjee et al., 1991)) telah terbukti bermanfaat dalam
percobaan hewan di mana terus-menerus, informasi konstan
Sion diperlukan selama periode waktu yang lama. Itu
proses penentuan laju adalah masuknya air
melalui anggota eksternal yang kaku, semi-permeabel
bran. Air yang masuk mengosongkan yang mengandung obat-
reservoir (solusi atau dispersi) dikelilingi oleh a
membran kedap air yang fleksibel. Tingkat rilis
tergantung pada karakteristik semi-permeabel ini
membran dan perbedaan tekanan osmotik berakhir
membran ini (agen osmotik di dalam pompa).
Kinetika pelepasan urutan nol ada selama
perbedaan tekanan osmotik atas semi permeabel
membran dipertahankan konstan.
Solusi protein (atau dispersi) harus
stabil secara fisik dan kimia pada suhu tubuh
selama periode percobaan penuh. Apalagi itu
larutan protein harus kompatibel dengan pompa
bagian yang terpapar. Keterbatasan sistem
adalah tingkat rilis tetap, yang tidak selalu diinginkan
(Lihat di atas). Perangkat-perangkat ini saat ini belum
digunakan secara teratur di klinik.
n Sistem Loop Terbuka: Biodegradable Microspheres
Asam berbasis polylactic – polyglycolic acid (PLGA)-deliv-
sistem ery sedang digunakan secara luas untuk
pengiriman peptida terapeutik, khususnya lutei
nizing agonis hormon pelepas hormon (LHRH)
seperti leuprolide dalam terapi kanker prostat.
Formula rilis terkontrol agonis LHRH pertama-
Tions adalah implan yang mengandung leuprolide dengan dosis
rentang 1-3 bulan. Kemudian, mikrosfer dimuat dengan
leuprolide diperkenalkan dan interval pemberian dosis
diperpanjang hingga 6 bulan. Faktor penentu keberhasilan
untuk desain sistem rilis terkontrol ini adalah:
(i) obat harus sangat manjur (hanya dosis kecil)
diperlukan selama interval dosis), (ii) berkelanjutan
Kehadiran dalam tubuh diperlukan, dan (iii) tidak merugikan
reaksi di tempat injeksi harus terjadi.
Strategi baru untuk pelepasan terkontrol dari terapi
protein peutik saat ini sedang dikembangkan. Untuk
contoh, Gambar 19 dan 20 menggambarkan berbasis dekstran
teknologi microsphere untuk administrasi SC atau IM
yang sering memiliki enkapsulasi protein hampir 100%
efisiensi (Gbr. 19). Di sini, tidak ada pelarut organik
Protein
Solusi encer op dex dan PEG
Pemisahan fase
Pemisahan fase
Kaya protein
+
Aduk
Polimerisasi
Emulsi air-dalam-air
Percampuran
DexHEMA
DexHEMA
PASAK
PASAK
Gambar 19 n Representasi skematis dari proses persiapan microsphere untuk pelepasan terkontrol protein terapeutik dari
dextran (DexHEMA ¼ modifikasi dextran ¼ dextran hidroksietilmetakrilat) mikrosfer. Tidak ada pelarut organik yang terlibat dan
efisiensi enkapsulasi (persentase protein terapeutik yang berakhir di mikrosfer) secara rutin> 90%. Polimerisasi: silang
menghubungkan rantai dekstran melalui unit HEMA. Sumber: Diadaptasi dari Stenekes, 2000.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
81
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 100
digunakan dalam protokol persiapan. Jadi, langsung
interaksi protein terlarut dengan organik
fase (seperti yang terlihat di banyak microsphere polimer
skema persiapan) dihindari. Ini meminimalkan
denaturasi protein. Gambar 20 menunjukkan bahwa oleh
memilih kondisi cross-linking yang tepat yang dimiliki seseorang
tingkat kontrol atas kinetika rilis. Melepaskan
kinetika terutama tergantung pada kinetika degradasi
dari matriks dekstran dan ukuran molekul protein
(Stenekes, 2000). Pendekatan lain untuk jangka panjang dan
pelepasan terkontrol protein terapeutik adalah untuk digunakan
mikrosfer berdasarkan hidro- biodegradable lainnya
bahan gel. PolyActive TM adalah block-copolymer
terdiri dari blok polietilen glikol (PEG) dan
blok polibutilena tereftalat (van Dijkhuizen-
Radersma et al., 2004). Hasil studi penemuan dosis
pada manusia dengan mikrosfer PolyActive TM dimuat
dengan interferon-a ditunjukkan pada Gambar 21.
n Sistem Loop Tertutup: Kombinasi Biosensor-Pompa
Jika kontrol laju input diinginkan untuk menstabilkan badan tertentu
fungsi, maka fungsi ini harus dipantau. Melalui
algoritma dan pengaturan pompa yang terhubung, data ini
harus dikonversi menjadi tingkat input obat. Ini
sistem disebut sistem loop tertutup dibandingkan dengan
sistem loop terbuka yang dibahas di atas. Jika ada
diketahui hubungan antara level plasma dan phar-
efek makologis, sistem ini mengandung (Gbr. 22):
(1) biosensor, mengukur tingkat plasma dari
protein;
(2) suatu algoritma, untuk menghitung laju input yang diperlukan
untuk sistem pengiriman;
(3) sistem pompa, mampu memberikan obat di
tingkat yang dibutuhkan selama periode waktu yang lama.
Konsep pengiriman protein loop tertutup
masih harus mengatasi banyak konseptual dan praktis
masalah. Hubungan sederhana antara level plasma
dan efek terapeutik tidak selalu ada (lihat
Bab 5). Ada banyak pengecualian untuk hal ini
aturan, misalnya, obat “tabrak lari” bisa lama
efek farmakologis yang bertahan setelah hanya singkat
waktu pemaparan. Juga, efek obat-hubungan tingkat darah-
kapal mungkin tergantung waktu, seperti dalam kasus turun
regulasi reseptor yang relevan pada stimulasi berkepanjangan
lation. Akhirnya, jika ritme sirkadian ada, ini akan menjadi
bertanggung jawab atas hubungan variabel PK / PD juga.
Jika masalah PK / PD yang diungkapkan di atas tidak
berlaku, seperti halnya dengan insulin, masalah teknis membentuk
100
80
60
40
Rilis (%)
20
0
0
5
10
Waktu (hari)
15
20
25
Gambar 20 n Pelepasan IgG kumulatif dari penurunan nilai
DexHEMA mikrosfer dalam waktu in vitro pada pH 7, 37
C. Air
konten mikrosfer dekstran setelah pembengkakan: sekitar 60%:
DS 3 ( ■ ) dan kadar air sekitar 50%: DS 3 (¤), DS 6 (), DS
8 ( A ) dan DS 11 ( ▲ ). Nilai adalah rata-rata dari 2 independen
pengukuran yang menyimpang biasanya kurang dari 5% dari masing-masing
lain. Singkatan: DS, derajat cross-linking. Sumber:
Diadaptasi dari Stenekes, 2000.
0
2
4
6
8
10
12
14
16
18
20
-5
0
5
10
15
20
25
30
Waktu (hari)
IFN

(pg / ml)
Biru =  interferon
20 mikrogram
Merah =  interferon
80 mikrogram
Biru tua = interferon 
320 mikrogram
Gambar 21 n. Program plasma
file interferon-a setelah SC
injeksi dari PolyActive TM mi-
crospheres dimuat dengan antar
feron-dalam sukarelawan dosis
mencari studi. Eliminasi
paruh "bebas" interferon-a
adalah sekitar 4-16 jam.
82
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 101
rintangan kedua dalam pengembangan loop tertutup
sistem. Belum memungkinkan untuk mendesain
biosensor yang bekerja andal in vivo dalam waktu lama
periode waktu. Stabilitas biosensor, ketahanan dan
tidak adanya reaksi histologis masih menimbulkan masalah.
n Pengiriman Protein dengan Sistem Pengaturan Mandiri
Terlepas dari desain kombinasi biosensor-pompa
Dengan demikian, dua perkembangan lain harus disebutkan
ketika membahas pendekatan loop tertutup: self-regulat-
sistem dan sel sekretori yang dienkapsulasi. Pada
saat ini, kedua konsep tersebut masih dalam pengembangan
ment (Heller, 1993).
Dalam sistem yang mengatur sendiri, pelepasan obat adalah
dikendalikan oleh rangsangan di dalam tubuh. Sejauh ini sebagian besar
penelitian difokuskan pada pelepasan insulin sebagai fungsi dari
konsentrasi glukosa lokal untuk menstabilkan darah
kadar glukosa pada penderita diabetes. Dua pendekatan untuk
pelepasan obat terkontrol sedang diikuti: (i)
desorpsi kompetitif dan (ii) enzim-substrat
reaksi. Pendekatan desorpsi kompetitif adalah
secara skematis digambarkan dalam Gambar 23.
Ini didasarkan pada kompetisi antara glikositik-
insulin-insulin dan glukosa untuk concanavalin (Con A)
situs yang mengikat. Con A adalah lektin tumbuhan dengan afinitas tinggi
untuk gula tertentu. Con A melekat pada manik-manik sepharose
dan sarat dengan insulin glikosilasi (suatu bentuk bioaktif
insulin) ditanamkan dalam kantong dengan semiperme-
mampu membran: permeabel untuk insulin dan glukosa, tetapi
impermeable untuk manik-manik sepharose membawa racun
Con A. Contoh kinerja sebuah Con
Kompleks A-glikosilasi-insulin dalam pankreatektomi
anjing diberikan pada Gambar 24.
Reaksi enzim-substrat untuk mengatur insulin
pelepasan dari reservoir yang ditanamkan semuanya didasarkan pada
Penurunan pH terjadi ketika glukosa dikonversi menjadi
asam glukonat dengan adanya glukosa enzim
oksidase. Penurunan pH ini kemudian menyebabkan perubahan pada
struktur perangkat pengiriman asam-sensitif seperti
polimer sensitif asam, yang mulai melepaskan in-
insulin, menurunkan konsentrasi glukosa, dan
akibatnya meningkatkan pH lokal dan "penutupan
reservoir. "
Program
Obat
waduk
Sumber energi
Sinyal umpan balik negatif
Sensor
Terkendali
mengalir
Sistem terapi
Terapeutik
efek
Obat yang diinginkan
konsentrasi
di situs target
Melepaskan
pembukaan
Biosistem
Pengiriman
kontrol
elemen
Gambar 22 n Sistem terapi dengan
loop kontrol tertutup. (1) seorang biosensor,
untuk kadar plasma protein, (2) an
algoritma, untuk menghitung input yang diperlukan
tingkat untuk sistem pengiriman, dan (3) pompa
sistem, dapat memberikan obat di
tingkat yang diperlukan selama periode waktu yang lama.
Sumber: Diadaptasi dari Heilman, 1984.
Glukosa dalam
G-insulin keluar
Membran polimer
Sepharose
Manik 4B
Concanavalin A
Glikosilasi
insulin
Glukosa
Gambar 23 n Desain skematik dari bead immobilisasi Con /
G (insulin-regulasi glikosilasi) -insulin / membran mengatur diri sendiri
sistem ery. Sumber: Diadaptasi dari Kim et al., 1990.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
83
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 102
n Pengiriman Protein oleh Mikroenkapsulasi
Sel sekretori
Gagasan untuk menggunakan sel sekretori yang ditanamkan untuk administrasi
protein terapi ister telah diluncurkan sejak lama. SEBUAH
Tujuan utama adalah implantasi Langerhans
sel pada penderita diabetes untuk mengembalikan produksi insulin mereka
melalui biofeedback. Sel-sel sekretori yang ditanamkan
harus dilindungi dari lingkungan tubuh, karena
proses penolakan akan segera dimulai, jika
bahan sel yang sangat cocok digunakan. Selain itu
diinginkan untuk mencegah sel-sel dari bermigrasi di semua
arah yang berbeda. Ketika sel-sel yang dimodifikasi secara genetik
digunakan, masalah keamanan akan lebih ketat.
Oleh karena itu, enkapsulasi (mikro) sel sekretori
telah diusulkan (Gbr. 25).
Tipis (ketebalan dinding dalam kisaran mikrometer),
polimer yang kuat, biokompatibel, dan permselektif
membran telah dirancang untuk ini (mikro)
kapsul (Tresco, 1994; Uludag et al., 1993). Itu
membran harus memastikan transportasi nutrisi (dalam
UM rendah umum) dari medium luar ke
sel yang dikemas untuk menyimpannya dalam fisiologis,
"Sehat" dan untuk melarang induksi yang tidak diinginkan
respons imunologis yang mampu (proses penolakan).
Antibodi (MW> 150 kDa) dan sel milik
sistem kekebalan tubuh (misalnya, limfosit) seharusnya tidak dapat
untuk mencapai sel yang dienkapsulasi. Anggota polimer
bran harus memiliki batas antara 50 dan 150 kDa,
jumlah pastinya masih menjadi bahan perdebatan. Dalam
Kasus insulin, membran permeabel untuk ini
hormon berukuran relatif kecil (5,4 kDa) dan untuk
glukosa ("indikator" molekul), yang penting untuk
proses biofeedback yang tepat. Studi yang berhasil di
hewan diabetes dilakukan. Menjanjikan klinis
data telah dilaporkan dengan pulau sekretori manusia
sel-sel dienkapsulasi dalam mikrosfer berbasis alginat
(Shoon-Shiong et al., 1994).
PENGIRIMAN SITUS-KHUSUS (PENARGETAN) DARI
OBAT PROTEIN
Kenapa kita masih belum bisa mengalahkan yang mengancam jiwa
penyakit seperti kanker dengan gudang senjata kami saat ini
narkoba? Penyebab kegagalan dapat diringkas sebagai
berikut (Crommelin et al., 1992):
(1) Senyawa aktif tidak pernah mencapai target
situs, karena dihilangkan dengan cepat dari
tubuh melalui ginjal, atau tidak aktif
melalui aksi metabolisme (misalnya, di hati).
(2) Hanya sebagian kecil dari obat yang mencapai
situs target. Sejauh ini fraksi terbesar obat
didistribusikan ke organ-organ non-target, di mana mereka
memberikan efek samping; dengan kata lain, akumulasi
dari obat di situs target adalah pengecualian dan
bukan aturannya.
0
100
200
300
400
500
600
30 60 90 120 180 240 300 360
Waktu (min)
Glukosa darah
vel (mg / dl)
–30
Gambar 24 n Profil glukosa darah tepi dari anjing
bolus dextrose (500mg / kg) bersarang selama glukosa IV
tes toleransi. Anjing normal ( ) memiliki pankreas yang utuh, diabetes
anjing ( Π ) telah menjalani pankreatektomi total; dan anjing implan
(D) telah ditanamkan secara intraperitoneal dengan kantong selulosa
mengandung kompleks AG-insulin Con. Glukosa darah pada t ¼
–30 menit menunjukkan level puasa semalam 30 menit sebelumnya
injeksi bolus dari dekstrosa. Sumber: Diadaptasi dari Heller, 1993.
Sekretori
produk
Berpori
selaput
Nutrisi
Membran mencegah:
Migrasi sel
pembentukan tumor
penolakan kekebalan tubuh
Molekul bioartificial
sistem pengantaran
Sel
Gambar 25 n Ilustrasi skematis dari “molekul bioartificial
sistem pengiriman. "Sel sekretori dikelilingi oleh semi-
membran permeabel sebelum implantasi dalam jaringan host.
Nutrisi dan produk sekretori secara pasif berdifusi melalui pori-pori
dalam membran enkapsulasi didukung oleh konsentrasi
gradien. Penggunaan membran yang mengecualikan humoral
dan komponen seluler dari sistem imun inang memungkinkan
sel yang tidak kompatibel secara imunologis untuk bertahan dari implantasi tanpa
keluar kebutuhan untuk mengelola agen imunosupresif.
Bahan matriks ekstraseluler dapat dimasukkan tergantung pada
persyaratan sel yang dienkapsulasi. Sumber: Diadaptasi
dari Tresco, 1994.
84
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 103
(3) Banyak molekul obat (khususnya MW tinggi
dan molekul hidrofilik, yaitu, banyak terapi
protein tic) tidak masuk sel dengan mudah. Ini berpose a
masalah jika pengiriman intraseluler diperlukan untuk
aktivitas terapi mereka.
Upaya dilakukan untuk meningkatkan terapi
indeks obat melalui penargetan obat:
(1) dengan pengiriman spesifik senyawa aktif ke nya
situs aksi,
(2) untuk menyimpannya di sana sampai tidak aktif dan
didetoksifikasi.
Pemberian obat yang ditargetkan harus memaksimalkan
efek terapeutik dan menghindari efek toksik di tempat lain.
Dasar-dasar konsep penargetan narkoba adalah
didefinisikan sudah pada hari-hari awal abad ke-20
oleh Paul Ehrlich. Tetapi hanya dalam dekade terakhir yang substansial
kemajuan telah dibuat untuk mengimplementasikan situs ini-
konsep pengiriman khusus. Kemajuan terbaru bisa
dianggap berasal dari: (i) jumlah
opsi teknologi (misalnya, pembawa yang aman) untuk obat
pengiriman; (ii) banyak wawasan baru yang diperoleh
patofisiologi penyakit pada seluler dan
tingkat molekuler, termasuk keberadaan sel-spesifik
reseptor dan perangkat pengarah untuk menargetkannya (mis.,
MAb); dan akhirnya, (iii) wahyu baru tentang alam
dari hambatan anatomi dan fisiologis itu
menghalangi akses mudah ke situs target. Situs-spesifik
sistem pengiriman saat ini dalam berbagai tahapan
pengembangan umumnya terdiri dari tiga fungsi
unit terpisah (Tabel 11).
Alam telah memberi kita antibodi, yang
mencontohkan kelas perangkat penargetan obat alami. Di
molekul antibodi yang dapat dikenali sebagai homing
bagian perangkat (situs pengikatan antigen) dan bagian "aktif".
Bagian aktif dalam molekul inilah yang bertanggung jawab
berpartisipasi dalam kaskade pelengkap, atau mendorong
interaksi dengan monosit ketika antigen terikat.
Sisa molekul dapat dianggap sebagai pembawa.
Sebagian besar obat (protein) yang menargetkan pekerjaan adalah
dilakukan dengan sistem pengiriman yang dirancang
untuk pemberian parenteral dan, lebih khusus lagi, IV. Hanya
sejumlah kertas telah berurusan dengan
farmakokinetik dari proses penargetan obat (Hunt
et al., 1986). Dari model kinetik ini sejumlah
kesimpulan dapat ditarik untuk situasi di mana
pengiriman yang ditargetkan, pada prinsipnya, menguntungkan
(Tabel 12).
Potensi dan keterbatasan berbasis operator,
sistem pengiriman obat yang ditargetkan untuk protein secara singkat
dibahas. Fokusnya adalah pada konsep di mana MAb berada
sedang digunakan. Mereka dapat digunakan sebagai antibodi itu sendiri
(juga dalam Bab 15), dalam bentuk yang dimodifikasi saat anti-
tubuh terkonjugasi dengan bagian aktif, atau
melekat pada pembawa koloid yang sarat obat seperti
liposom.
Dua istilah digunakan secara teratur dalam konteks
penargetan: penargetan pasif dan aktif. Dengan pasif
menargetkan pola disposisi "alami" dari
sistem pembawa digunakan untuk pengiriman spesifik lokasi.
Misalnya, pembawa partikel yang beredar di Internet
darah (lihat di bawah) sering diambil dengan cepat
makrofag kontak dengan sirkulasi darah dan
terakumulasi di hati (sel Kupffer) dan limpa. Aktif
penargetan adalah konsep di mana upaya dilakukan
mengubah disposisi alami pembawa oleh beberapa orang
semacam alat pelacak atau prinsip pelacak untuk dipilih
satu jenis jaringan atau sel tertentu.
n Anatomis,Fisiologis, dan Patologis
Pertimbangan yang Relevan untuk Penargetan Protein
Transportasi yang dimediasi oleh pembawa dalam tubuh tergantung pada
sifat fisikokimia pembawa: sifatnya
muatan, berat / ukuran molekul, hidrofobik permukaan
kota, dan keberadaan ligan untuk berinteraksi dengan
reseptor permukaan (Crommelin dan Storm, 1990). Jika sebuah
obat memasuki sirkulasi dan situs target adalah
Di luar peredaran darah, obat harus lewat
melalui penghalang endotel. Gambar 26 memberi a
gambar skematis dari struktur dinding kapiler
(dalam kondisi fisiologis) hadir berbeda
lokasi di dalam tubuh.
Gambar 26 menunjukkan diagram endotelium utuh
dalam kondisi normal. Di bawah kondisi patologis
seperti yang ditemui pada tumor dan
1. Bagian aktif
Untuk: efek terapeutik
2. Operator
Untuk: (metabolisme) perlindungan, perubahan
disposisi obat
3. Perangkat pelacak
Untuk: spesifisitas, pemilihan
situs target yang ditetapkan
Tabel 11 n Komponen untuk pengiriman obat yang ditargetkan (karier
berdasarkan).
1. Obat-obatan dengan total clearance tinggi adalah kandidat yang baik untuk
pengiriman yang ditargetkan.
2. Membutuhkan situs respons dengan aliran darah yang relatif kecil
transportasi yang dimediasi oleh operator.
3. Peningkatan dalam tingkat eliminasi obat gratis dari
baik kompartemen pusat atau respons cenderung
meningkatkan kebutuhan akan pemberian obat yang ditargetkan; ini juga
menyiratkan tingkat input konjugat pembawa obat yang lebih tinggi
mempertahankan efek terapeutik.
4. Untuk memaksimalkan efek penargetan, pelepasan obat
dari operator harus dibatasi pada respons
kompartemen.
Tabel 12 n Pertimbangan farmakokinetik terkait dengan protein
penargetan.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
85
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 104
situs peradangan, endotelium dapat berbeda
cakap dalam penampilan dan permeabilitas endotel mungkin
sangat berbeda dari yang ada di jaringan "sehat".
Partikel dengan ukuran hingga sekitar 0,1 mm dapat masuk
jaringan tumor seperti yang ditunjukkan dengan sirkulasi panjang
ing, sistem pembawa koloid (lipo- sirkulasi lama
somes). Di sisi lain, jaringan nekrotik juga bisa
menghambat akses ke jaringan tumor (Jain, 1987). Di
Kesimpulannya, tubuh sangat terkotak; saya t
seharusnya tidak dianggap sebagai satu kolam besar tanpa
hambatan internal untuk transportasi.
n SistemCarrier Terlarut untuk Target
Pengiriman Protein
MAb sebagai Agen Terapi yang Ditargetkan: Manusia dan
Antibodi manusiawi (lihat Bab 15)
Antibodi adalah "perangkat penargetan alami."
kemampuan homing dikombinasikan dengan aktivitas fungsional
(Crommelin dan Storm, 1990; Crommelin et al., 1992).
MAb dapat memengaruhi fungsi sel target saat pemasangan.
ment. Komplemen dapat diikat melalui reseptor Fc
dan selanjutnya menyebabkan lisis sel target.
Atau, sel-sel pembunuh reseptor-bantalan Fc tertentu
dapat menginduksi “tergantung antibodi, sitokromediasi sel
toksisitas ”(ADCC), atau kontak dengan makrofag dapat terjadi
mapan. Terlebih lagi, kekurangan metabolisme bisa
diinduksi dalam sel target melalui blokade
reseptor permukaan sel esensial tertentu oleh MAb.
Aspek struktural dan potensi terapi MAb
dibahas secara rinci dalam Bab 15.
Masalah yang terjadi saat menggunakan murine
antibodi untuk terapi adalah produksi manusia
antibodi anti-tikus (HAMA) setelah pemberian.
Induksi HAMA dapat melarang penggunaan lebih lanjut dari ini
terapi MAb dengan menetralkan antigen-binding
situs; reaksi anafilaksis relatif jarang.
Pemberian imunosupresif secara bersamaan
agen adalah strategi untuk meminimalkan efek samping. Lebih dalam
informasi mendalam mengenai imunogenisitas
protein terapeutik disediakan pada Bab 6.
Ada beberapa cara lain untuk mengatasinya
Masalah imunogenisitas yang diinduksi MAb. Ini adalah
dibahas lebih rinci dalam Bab 15. Di sini, brief
ringkasan opsi yang relevan untuk penargetan protein
cukup. Pertama-tama, penggunaan F (ab) 2 atau F (ab)
fragmen (Gbr. 27) untuk menghindari peningkatan kekebalan tubuh
tanggapan terhadap bagian Fc, tetapi pengembangan
manusiawi atau MAb manusia meminimalkan induksi
HAMA lebih jauh. Untuk humanisasi MAb
beberapa opsi dapat dipertimbangkan. Seseorang bisa membangun
molekul chimeric (sebagian manusia, sebagian murine)
terdiri dari bagian Fc manusia dan bagian Fab murine,
dengan situs pengikatan antigen atau, sebagai alternatif, saja
enam wilayah penentu saling melengkapi (CDR)
dari antibodi murine dapat dicangkokkan pada manusia
struktur antibodi. Cangkok CDR meminimalkan
paparan bahan murine.
bl
Kontinu
SEBUAH
Difestrasi
B
Sinusoidal
C
bl
e
e
e
hal
Gambar 26 n Ilustrasi skematis dari struktur yang berbeda
kelas kapiler darah. ( A ) Kapiler kontinu. Itu
endotelium (e) kontinu dengan persimpangan yang rapat
sel-sel endotel yang berdekatan. Anggota ruang bawah tanah subendothelial
brane (bl) juga kontinu. ( B ) Kapiler terfestrasi. Itu
endothelium memamerkan serangkaian fenestrae yang disegel oleh a
diafragma membran. Anggota ruang bawah tanah subendothelial
bran terus menerus. ( C ) Kapiler terputus (sinusoidal). Itu
endothelium atasnya mengandung banyak celah dengan berbagai ukuran
memungkinkan bahan dalam sirkulasi untuk mendapatkan akses ke
sel parenkim yang mendasarinya (p). Ruang bawah tanah subendotel
tidak ada (hati) atau hadir sebagai terpecah terpecah
struktur (limpa, sumsum tulang). Fenestrae di hati adalah
sekitar 0,1 hingga 0,2 mm; pori-pori antara sel-sel endotel dan
mereka yang ada di membran bawah tanah di luar hati, limpa, dan
sumsum tulang jauh lebih kecil. Sumber: Diadaptasi dari Poste,
1985.
Fc
- Pelengkap
pengaktifan
Antigen
mengikat
situs
CDR
S
S
SS
S
S
F (ab) 2
F ab
- Makrofag
mengikat
Gambar 27 n Struktur IgG1 yang sangat disederhanakan. Singkatan:
CDR, wilayah penentu saling melengkapi.
86
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 105
MAb benar-benar manusia dapat diproduksi oleh
mentransfeksi gen antibodi manusia ke dalam sel tikus,
yang kemudian menghasilkan MAb manusia.
Atau, tikus transgenik dapat digunakan (lihat
Bab 7 dan 15). Pendekatan ini mengurangi
imunogenisitas dibandingkan dengan generasi yang ada
dari murine MAb. Tetapi bahkan dengan semua manusia ini atau
MAb yang dimanusiakan, respons imun anti-idiotipik
terhadap struktur situs yang mengikat dari MAb tidak bisa
dikecualikan.
Antibodi Bispecific (lihat Bab 15)
Untuk meningkatkan potensi terapi antibodi,
antibodi bispecific telah dirancang. Bispecific
antibodi diproduksi dari dua yang terpisah
antibodi membuat molekul dengan dua yang berbeda
situs yang mengikat (Fanger dan Guyre, 1991). Bispecific
MAb membawa sel atau jaringan target (satu antigen-binding)
situs) dalam kontak dengan struktur lain (antigen kedua
situs mengikat). Situs pengikatan antigen kedua ini bisa
mengikat sel-sel efektor melalui pemicu sitotoksisitas
molekul pada sel-T, sel NK (pembunuh alami), atau
makrofag, dan karenanya memicu sitotoksisitas.
Antibodi bispecific telah digunakan
mental di klinik, misalnya, untuk mengarahkan intraper-
limfosit T autologous yang disuntikkan,
dirangsang dengan interleukin-2 rekombinan, untuk intra
sel karsinoma ovarium peritoneal terletak. Ini
MAb menggabungkan situs pengikatan antigen untuk carcino-
antigen ma-permukaan dengan situs pengikatan antigen dengan
Afinitas sel-T. MAb secara in vitro diinkubasi dengan
merangsang T-limfosit sebelum injeksi IP
(Crommelin et al., 1992; De Leij et al., 1990).
Immunoconjugates: Kombinasi antara
Antibodi dan Senyawa Aktif
Dalam banyak kasus, antibodi itu sendiri atau
tubuh telah terbukti kurang terapeutik
aktivitas. Untuk meningkatkan aktivitas mereka, konjugat MAb
dan obat-obatan telah dirancang (Gbr. 28). Upaya ini
terutama berfokus pada pengobatan kanker (Crommelin
dan Storm, 1990). Untuk menguji konsep immunocon-
kendi, berbagai macam obat telah kovalen
terikat pada antibodi dan telah dievaluasi pada hewan
model tumor. Karena hanya sejumlah antibodi
molekul dapat mengikat ke sel target, hanya konjuga
obat yang sangat manjur akan menyebabkan kecukupan
aktivitas terapi. Gemtuzumab ozogamicin
(Mylotarg
HAI
) adalah konjugat dari antibodi monoklonal
dan calicheamicin (lihat Bab 16). Bagian MAb
menargetkan antigen permukaan CD33 dalam CD33-positif
sel leukemia myeloid akut (AML). Setelah internasional-
zasi ke dalam sel calicheamicin yang sangat sitotoksik
dilepaskan.
Sitostatik dengan sitotoksisitas intrinsik yang tinggi adalah
diperlukan (lihat di atas). Karena perilaku kinetik
senyawa aktif sangat dipengaruhi oleh
antibodi konjugasi, tidak hanya sitostatika yang ada,
tetapi juga senyawa aktif yang tidak pernah digunakan
sebelumnya sebagai obat, karena toksisitasnya yang tinggi, harus
sekarang dipertimbangkan kembali.
Racun imunokonjugasi sekarang diuji sebagai
agen kemoterapi untuk mengobati kanker (immunotox-
ins). Contoh keluarga toksin adalah risin, abrin, dan
toksin difteri (Gbr. 29). Protein ini adalah
mely toksik; mereka memblokir enzim secara intraseluler
sintesis protein pada tingkat ribosom. Ricin (MW
66 kDa) terdiri dari rantai A dan B yang terhubung
melalui jembatan cystin. Rantai A bertanggung jawab atas
menghalangi sintesis protein di ribosom. B
rantai penting untuk penyerapan seluler molekul
(endositosis) dan perdagangan intraseluler.
D
D
D
D
D
Gambar 28 n . Tampilan skematis imunokonjugasi.
Singkatan: D, molekul obat yang secara kovalen melekat pada antibodi
(fragmen).

AB
Antibodi
Racun, misalnya risin
SS

BA
Gambar 29 n Imunotoksin tersusun atas mol-antibodi
kapsul yang terhubung dengan racun, misalnya risin. Keduanya risin integral
Molekul telah digunakan juga sebagai rantai-A saja.
Singkatan: AB, antibodi; A and B adalah singkatan dari A and B
rantai toksin risin, masing-masing.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
87
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 106
Tabel 13 mencantumkan sejumlah masalah potensial
ditemui imunokonjugasi berbasis racun
(Crommelin et al., 1992). Dalam studi hewan dengan
risin imunokonjugasi hanya sebagian kecil
imunotoksin ini terakumulasi dalam jaringan tumor
(1%). Sebagian besar masih berakhir di hati, yaitu
organ target utama untuk risin "alami". Apalagi di
studi fase I klinis (untuk menilai keamanan
konjugat) generasi pertama imunokonjugasi
ternyata imunogenik. Sekarang, upaya adalah
dibuat untuk mengadaptasi molekul risin (secara genetik
teknik) sehingga penargetan hati sedang mini-
dikawinkan. Ini dapat dilakukan dengan memblokir (menghapus atau
masking) pada ligan molekul risin untuk galaktosa
reseptor pada hepatosit. Selain itu, Murine MAb bisa
digantikan oleh manusia atau MAb yang dimanusiakan (lihat
di atas) (Ramakrishnan, 1990).
n Potensi Jebakan dalam Penargetan Tumor
Setelah injeksi IV, hanya sebagian kecil dari homing
kompleks perangkat-pembawa-obat diasingkan di
situs target. Terlepas dari kompartementalisasi
tubuh (lihat di atas: anatomis dan fisiologis
rintangan) dan akibatnya tergantung pada operator
hambatan yang menghasilkan, beberapa faktor lainnya berperan
kurangnya akumulasi situs target (Tabel 14).
Seberapa sukseskah MAb dalam mendiskriminasi?
sel target (sel tumor) dari sel non-target? Melakukan
semua sel tumor mengekspos antigen terkait tumor?
Pertanyaan-pertanyaan ini masih sulit dijawab (Hellström
et al., 1987). Molekul spesifik permukaan sel tumor
digunakan untuk tujuan homing sering diferensiasi
antigen pada dinding sel tumor. Struktur-struktur ini
tidak unik karena terjadi pada tingkat kepadatan yang lebih rendah
sel non-target juga. Karena itu, situs target
spesifisitas MAb yang diajukan terhadap struktur ini adalah
lebih bersifat kuantitatif daripada kualitatif.
Kategori lain antigen terkait tumor
adalah antigen spesifik-klon. Mereka unik untuk
klon yang membentuk tumor. Namun, praktis
masalah ketika berfokus pada antibodi spesifik-klon
untuk penargetan obat adalah yang mungkin dibutuhkan setiap pasien
MAb yang dibuat khusus.
Permukaan "make-up" sel tumor dalam tumor
atau metastasis tidak konstan; baik dalam waktu maupun
antara sel-sel dalam tumor yang sama. Ada banyak
subpopulasi sel tumor dan mereka mengekspresikan
molekul permukaan yang berbeda. Heterogenitas ini berarti
bahwa tidak semua sel dalam tumor akan berinteraksi dengan satu,
konjugat bertarget tunggal. Pelepasan antigen dan
modulasi antigen adalah dua cara lain sel tumor
dapat menghindari pengakuan. Penumpahan antigen berarti
bahwa antigen dilepaskan dari permukaan. Mereka bisa
kemudian berinteraksi dengan konjugat yang beredar di luar
target area, membentuk kompleks antigen-antibodi dan
menetralkan potensi homing dari konjugat
sebelum area target tercapai. Akhirnya,
modulasi antigen dapat terjadi pada pengikatan MAb
ke antigen permukaan sel. Modulasi adalah
Fenomena itu pada endositosis dari (awalnya
terbuka) kompleks antigen-immunoconjugate permukaan,
beberapa antigen ini tidak terpapar lagi
permukaan; tidak ada penambahan endositosis
antigen permukaan.
Empat strategi dapat diimplementasikan untuk dipecahkan
masalah yang berkaitan dengan heterogenitas sel tumor, shed-
ding dan modulasi. (i) Koktail dari MAb berbeda
menempel pada toksin bisa digunakan. (ii) Lainnya
pendekatannya adalah menyerah berjuang untuk target lengkap
kekhususan sel dan untuk menginduksi apa yang disebut "pengamat"
efek. Kemudian, sistem yang ditargetkan dirancang sedemikian rupa
cara bagian aktif dilepaskan dari
konjugasi setelah mencapai sel target, tetapi sebelum
kompleks antigen-konjugat telah digunakan
endocytosed) oleh sel target. (iii) Tidak semua permukaan
antigen menunjukkan penumpahan atau modulasi. Jika ini
Fenomena terjadi, kombinasi antigen / MAb lainnya
harus dipilih yang tidak menunjukkan ini
efek. (iv) Saat ini, injeksi MAb gratis sebelumnya
untuk injeksi imunokonjugasi berada di bawah investasi
tigasi untuk menetralisir antigen yang beredar "bebas"; kemudian,
konjugat yang disuntikkan selanjutnya seharusnya tidak
menemukan antigen bebas yang tertanam.
Sebagai kesimpulan, MAb dan
Konjugat MAb sekarang dipelajari untuk menilai nilainya
dalam memerangi penyakit yang mengancam jiwa seperti kanker.
Selama dekade terakhir, teknologi telah berkembang
segera; banyak pilihan baru yang berbeda menjadi tersedia-
sanggup. Kurangnya detail patofisiologis dan sel
pengetahuan biologis tentang perilaku tumor,
misalnya, memperlambat kemajuan. Itu bahkan mungkin
bahwa seluruh konsep MAb- (konjugat) akan berubah
menjadi hanya nilai terapi terbatas, karena

Ikatan kovalen dari protein ke antibodi bisa
mengubah potensi sitotoksik obat dan mengurangi
afinitas MAB untuk antigen

Stabilitas konjugat in vivo mungkin tidak cukup;
fragmentasi akan menyebabkan hilangnya potensi penargetan

Imunogenisitas MAB dan toksisitas protein
yang terlibat dapat berubah secara dramatis
Sumber: Diadaptasi dari Crommelin et al., 1992.
Tabel 13 n Potensi masalah yang dihadapi dengan immunocon-
kendi.

Heterogenitas tumor

Pelepasan antigen

Modulasi antigen
Tabel 14 n Faktor-faktor yang mengganggu keberhasilan penargetan
protein ke sel tumor.
88
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 107
masalah seperti heterogenitas sel tumor, buruk
akses ke tumor dan masalah imunogenisitas.
n SistemCarrier Partikulat Koloid untuk Target
Pengiriman Protein: Nanoteknologi di Tempat Kerja
Berbagai sistem pembawa dalam ukuran koloid
kisaran (diameter hingga beberapa mikrometer) telah
diusulkan untuk penargetan protein. Contohnya adalah: lipo-
seseorang, nanoparti- polycyanoacrylate yang dapat terurai secara hayati
cles, mikrosfer albumin, asam polylactic
mikrosfer, dan low density lipoproteins (LDL).
Setelah memasuki aliran darah setelah injeksi IV, itu
sulit bagi banyak dari sistem partikulat ini untuk dilewati
melalui membran epitel dan endotel di
jaringan yang sehat, sebagai ukuran cut-off untuk permeasi
melalui hambatan berlapis-lapis ini adalah sekitar 20nm
(tidak termasuk hati, lihat di atas dan Gbr. 26).
Parameter yang mengontrol nasib pembawa partikulat
in vivo tercantum pada Tabel 15.
Sebagai aturan, sel-sel fagosit mononuklear
sistem (MPS), seperti makrofag, mengenali stabil,
sistem partikulat koloid (<5 mm) sebagai “benda asing
seperti struktur ”dan fagositosis mereka. Jadi, hati
dan limpa, organ yang kaya akan sirkulasi darah
makrofag, ambil sebagian besar
lates (Tomlinson, 1987; Crommelin dan Storm, 1990).
Partikel yang diinjeksi intravena cenderung lebih besar (> 5 mm)
untuk membentuk emboli di kapiler paru-paru pada yang pertama
bertemu dengan organ ini.
Liposom telah mendapatkan banyak perhatian
di antara sistem partikulat koloid yang diusulkan untuk
pengiriman protein spesifik lokasi (atau oleh). Liposom
adalah struktur vesikular yang didasarkan pada (fosfo) lipid
bilayers mengelilingi inti berair. Utama
komponen bilayer biasanya adalah phosphatidylcho-
line (Gbr. 30).
Dengan memilih konstituen bilayer mereka dan salah satunya
banyak prosedur persiapan yang dijelaskan, lipo-
somes dapat dibuat bervariasi dalam ukuran antara 30nm
(mis. dengan ekstrusi atau ultrasonikasi) dan 10 mm, dan
biaya (dengan penggabungan negatif atau positif
molekul lipid bermuatan), dan kekakuan bilayer (oleh
memilih fosfolipid khusus atau menambahkan lipid tersebut
sebagai kolesterol). Liposom dapat membawa muatannya
(Protein) baik di inti lipid dari bilayer
melalui partisi, melekat pada bilayer, atau
secara fisik terperangkap dalam fase berair. Untuk membuat
situs target liposom spesifik, kecuali untuk pasif
menargetkan ke hati (sel Kupffer) dan limpa makro-
fag, perangkat homing secara kovalen digabungkan ke
selebaran luar bilayer (Toonen dan Crommelin, 1983).
Dalam Tabel 16 tiga keuntungan relatif dari liposom
lebih dari sistem partikulat lainnya diberikan.
Setelah injeksi, liposom standar tetap berada di dalam
sirkulasi darah hanya untuk waktu yang singkat. Mereka diambil

Ukuran

Biaya

Hidrofilisitas permukaan

Kehadiran perangkat pelacak di permukaannya

Pertukaran bagian konstitutif dengan komponen darah
Tabel 15 n Parameter yang mengendalikan nasib partikel
operator in vivo.
Polar terlarut dalam fase air
Amfatik
molekul
Bulat
protein
Lipofilik
molekul
Kolesterol
Ssheadss kutub
lipid
Gagasan nonpolar
lipid
Liposom
Gambar 30 n in seorang artis
terpretasi multilamellar
liposom. Lamella itu
bilayers dari (phospho) lipid mo-
lecules dengan hidrofobik mereka
ekor berorientasi ke dalam dan mereka
kepala kutub diarahkan ke, dan di
kontak dengan, air
medium. Bilayer itu mungkin
mengakomodasi obat lipofilik
dalam. Obat hidrofilik akan
dapat ditemukan dalam inti berair
dan di antara bilayers.
Tergantung pada hydrophi mereka
keseimbangan / hidrofobik dan
protein struktur tersier
dan peptida akan ditemukan di
fase berair, pada
antarmuka bilayer – water, atau in-
sisi lipid bilayer. Sumber:
Diadaptasi dari Fendler, 1980.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
89
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 108
oleh makrofag di hati dan limpa, atau mereka
mendegradasi dengan pertukaran konstituen bilayer dengan
konstituen darah. Waktu tinggal Liposome di
sirkulasi darah dapat diperpanjang hingga berjam-jam dan
bahkan berhari-hari, jika rantai PEG dicangkokkan di permukaan
dan struktur bilayer stabil digunakan (Gbr. 31, lihat juga
Gbr. 17). Liposom yang bersirkulasi lama ini rupanya
mampu menghindari serapan makrofag dalam waktu lama
periode waktu dan diasingkan di organ lain
daripada hati dan limpa saja, misal tumor dan meradang
tisu. Dalam Gambar 32 contoh ditunjukkan penggunaan
Liposom berlabel 99 m Tc dalam deteksi inflamasi
situs mation pada pasien.
Akumulasi liposom yang sarat protein di
makrofag (penargetan pasif) menawarkan hal yang menarik
peluang terapeutik. Liposom dienkapsulasi
limfokin dan produk "mikroba", seperti
interferon-a atau muramyl tripeptide phosphatidyletha-
nolamine (MTP-PE), masing-masing, dapat mengaktifkan
makrofag dan memungkinkan mereka untuk membunuh mikrometri-
tases, atau membantu merangsang reaksi kekebalan tubuh.
Terlebih lagi, mencapai makrofag dapat membantu kita
lebih efektif melawan makrofag yang terletak mikroba,
penyakit virus atau bakteri dibandingkan dengan saat ini
pendekatan (Emmen and Storm, 1987; Crommelin
dan Schreier, 1994).
Beberapa upaya telah dilakukan untuk menyita
immunoliposomes (yaitu, antibodi (fragmen) -liposome
kombinasi) di situs yang telah ditentukan dalam tubuh.
Di sini tujuannya adalah penargetan aktif ke target yang diinginkan
situs alih-alih penargetan pasif ke makrofag. Itu
Konsep secara skematis disajikan pada Gambar 33.
Liposom menonjol di antara pembawa partikel lainnya
sistem, karena:

Toksisitasnya relatif rendah, catatan keamanan yang ada dan
pengalaman dengan dipasarkan, diberikan secara intravena
produk liposom (misalnya, amphothericin B, doxorubicin,
daunorubicin) (Storm et al., 1993).

Kehadiran inti berair yang relatif besar, yaitu
penting untuk menstabilkan fitur struktural banyak
protein.

Kemungkinan untuk memanipulasi karakteristik rilis
protein terkait liposom dan untuk mengontrol disposisi
in vivo dengan mengubah teknik persiapan dan bilayer
konstituen (Crommelin dan Schreier, 1994).
Tabel 16 n Liposom menonjol diantara partikulat lainnya
sistem pembawa.
100
10
0
% dari dosis IV yang disuntikkan
0
5
Gratis 67 Ga-DF
Non-pegilasi
Dipancang
10
15
Waktu
20
25
Gambar 31 n Perbandingan level darah label bebas,
67Ga – DF, galium-desferal dengan 67 Ga-DF bermuatan pegilasi (PEG)
dan liposom non-pegilasi pada pemberian IV pada tikus.
Sumber: Diadaptasi dari Woodle, et al., 1990.
Gambar 32 n 99 m Tc-PEG-liposom scintigraphy betina
sabar. Gambar seluruh tubuh anterior, 24 jam pasca injeksi, menunjukkan
serapan fisiologis dalam darah jantung, pembuluh darah yang lebih besar, hati, dan
limpa. Penyerapan liposom di situs patologis dapat dicatat
sepanjang lapisan sinovial dari siku kiri, pergelangan tangan kiri, dan lutut kanan
(Panah) dan situs medial dari kedua pergelangan kaki (panah kepala).
Sumber: Diadaptasi dari Storm dan Crommelin, 1998.
90
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 109
Saat merancang imunoliposom, antibodi
atau fragmen-antibodi terikat secara kovalen ke
permukaan liposom melalui molekul jangkar lipid
(Toonen dan Crommelin, 1983). Gambar non-PEGylated
munoliposom memiliki akses yang buruk ke situs target
di luar sirkulasi darah setelah injeksi IV. Itu
alasannya adalah resistansi yang tinggi terhadap pen liposom
trasi melalui lapisan endotel di lokasi target
dan waktu sirkulasi yang relatif singkat (Gbr. 26).
Karena itu, situs target harus dicari dalam darah
sirkulasi (sel darah merah, trombi, limfosit, atau
sel endotel mengekspos di bawah tekanan adhesi tertentu
molekul sion, misalnya ICAM-1, adhesi sel antar sel
molekul sion) (Vingerhoeds et al., 1994; Crommelin
et al., 1995).
Situs target menarik lainnya adalah yang berlokasi di
rongga, di mana seseorang dapat secara lokal memberikan obat-
kombinasi pembawa. Kandung kemih dan peritoneum
rongga adalah rongga seperti itu. Rongga ini bisa menjadi situs
di mana jaringan yang sakit terkonsentrasi. Untuk
Misalnya, dengan karsinoma ovarium, tumornya
terbatas pada rongga peritoneum untuk sebagian besar dari mereka
seumur hidup. Setelah injeksi IP imunoliposom
diarahkan terhadap karsinoma ovarium manusia di athy-
mic, nude mice, interaksi spesifik antara
imunoliposom dan karsinoma ovarium manusia
diamati (Nässander dan rekannya) (Gbr. 34).
Generasi baru liposom sedang dikembangkan
opment yang menggabungkan lapisan PEG (sirkulasi panjang
karakteristik) dan lapisan antibodi (penargetan).
Melampirkan immunoliposome ke sel target
biasanya tidak menyebabkan efek terapeutik per se.
Setelah pembentukan antar sel imunoliposom
obat protein harus mengerahkan aksinya pada
sel. Untuk melakukan itu, protein harus dilepaskan di dalamnya
bentuk aktif. Ada beberapa jalur yang diusulkan untuk
mencapai tujuan ini (Gbr. 35) (Peeters et al., 1987).
Ketika kompleks imunoliposom-sel masuk
Melawan makrofag, sel-sel ditambah menempel
liposom mungkin difagositosis dan masuk
makrofag (opsi A). Selanjutnya, liposom-
obat protein terkait dapat dilepaskan. Seperti ini akan
kemungkinan besar terjadi pada lisosomal envir- yang “bermusuhan”
Pada akhirnya, sedikit protein utuh akan tersedia. Di
situasi yang digambarkan pada Gambar 35, opsi B, obat
dilepaskan dari immunoliposomes yang melekat di Indonesia
kedekatan sel target. Pada prinsipnya,
kontrol laju pelepasan dicapai dengan memilih yang tepat
bilayers liposomal dengan obat yang tertunda atau berkelanjutan
karakteristik rilis. Pendekatan ketiga digambarkan sebagai
opsi C: pelepasan obat diinduksi dari liposomal
lapisan oleh rangsangan eksternal (perubahan pH lokal atau
perubahan suhu). Akhirnya, orang dapat membayangkan itu
Immunoliposome
mengandung obat
Target
sel
Non-
target
sel
Tidak ada imunospecific
mengikat
Gambar 33 n Representasi skematis dari
konsep penargetan narkoba dengan kekebalan
liposom. Sumber: Diadaptasi dari
Nässander, et al., 1990.
Gambar 34 n Electromicrograph menunjukkan imunoliposom
(Struktur vesikular) melekat pada karsinoma ovarium manusia
sel (lihat teks).
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
91
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 110
imunoliposom dapat dibangun dengan fuso intrinsik
potensi genik, yang hanya diaktifkan saat terpasang
ment dari pembawa ke sel target. Ini menarik
opsi D, Gambar 35, menyerupai perilaku tertentu
virus. Virus menawarkan jalur yang menarik tentang caranya
untuk memasukkan sel target dan cara mengirimkan muatannya
berhasil dalam organel target (yaitu untuk virus
inti). Pendekatan peniru virus ini mengarah pada
desain virus buatan untuk pengiriman yang ditargetkan
materi genetik, tetapi ini dapat diperluas ke
protein apeutik (Mastrobattista et al., 2006).
n Perspektif untuk Pengiriman Protein Bertarget
Strategi penargetan protein telah dikembangkan di a
langkah cepat. Generasi baru perangkat pelacak
(target spesifik sel MAb) dan wawasan yang lebih baik tentang
anatomi dan fisiologi tubuh manusia di bawah
kondisi patologis telah menjadi faktor kritis
capai kesuksesan ini. Gambaran yang jauh lebih baik
muncul tidak hanya tentang potensi, tetapi juga
keterbatasan pendekatan penargetan yang berbeda.
Sangat sedikit perhatian yang diberikan pada biasanya
aspek farmasi dari pengiriman obat lanjut
sistem seperti immunotoxins dan immunolipo-
somes. Sistem ini sekarang diproduksi di laboratorium
skala dan potensi terapi mereka saat ini masih di bawah
penyelidikan. Jika manfaat terapeutik sudah jelas
terbukti dalam uji klinis praklinis dan awal, kemudian
peningkatan, umur simpan dan masalah jaminan kualitas (misalnya,
reproduksibilitas teknologi, kemurnian bahan-
masih membutuhkan perhatian yang cukup besar.
REFERENSI
Arakawa T, Kita Y, Carpenter JF (1991). Protein – pelarut
interaksi
di
farmasi
perumusan.
Pharmaceut Res, 8: 285–91.
Banerjee PS, Hosny EA dan Robinson JR (1991). Parenteral
pengiriman obat peptida dan protein. Dalam Lee VHL,
ed. Pemberian Obat Peptida dan Protein. New York:
Marcel Dekker, 487-543.
Björk E, Edman P (1988). Karakterisasi terdegradasi
mikrosfer pati sebagai sistem pengiriman hidung untuk
narkoba. Int J Pharm, 62: 187–92.
Brange J, Langkjaer L (1993). Struktur dan stabilitas insulin.
Dalam: Wang YJ, Pearlman R, eds. Stabilitas dan
Karakterisasi Obat Protein dan Peptida. Kasus
Sejarah. New York: Plenum Press, 315–50.
Chien YW (1991). Rute transdermal peptida dan protein
pengantar obat. Dalam: Lee VHL, ed. Peptida dan Protein
Pengantar obat. New York: Marcel Dekker, 667-89.
Crommelin DJA, Bergers J, Zuidema J (1992). Antibodi-
pendekatan penargetan narkoba berbasis: perspektif dan
tantangan. Dalam: Wermuth CG, Koga N, König H,
Metcalf BW, eds. Kimia Obat untuk yang ke-21
Abad. Oxford: Publikasi Ilmiah Blackwell,
351–65.
Crommelin DJA, Scherphof G, Storm G (1995). Aktif
menargetkan dengan sistem pembawa partikulat dalam darah
kompartemen. Adv Drug Deliv Rev, 17: 49–60.
Crommelin DJA, Schreier H (1994). Liposom. Dalam: Kreuter J,
ed. Sistem Pengiriman Obat Koloid. New York:
Marcel Dekker, 73-190.
Crommelin DJA, Storm G (1990). Penargetan Narkoba. Di:
Sammes PG, Taylor JD, eds. Luas
Kimia Obat. Oxford: Pergamon Press,
661–701.
Cullander C, Guy RH (1992) Pengiriman transdermal dari
peptida dan protein. Adv Drug Deliv Rev, 8: 291–329.
De Leij L, De Jonge MWA, Ter Haar J, dkk. (1990).
Antibodi monoklonal bispecific (BIAB) retargeted
terapi seluler untuk pengobatan kanker lokal
pasien. Dalam: Crommelin DJA, Schellekens H, eds.
Dari Clone ke Klinik. Dordrecht: Kluwer Academic,
159–65.
Edman P, Björk E (1992). Pengiriman obat peptida melalui hidung.
Adv Drug Deliv Rev 8: 165-77.
Eldridge JH, Hammond CJ, Meulbroek, JA, Staas JK, Giley
RM, Tice TR (1990). Pelepasan vaksin yang terkendali di
terkait usus
limfoid
tisu.
SAYA.
Secara lisan
Penyerapan di hati dan limpa
makrofag;
pelepasan obat berikutnya
(A)
(B)
(C)
(D)
Pelepasan obat
dekat dengan sel target
Immunoliposome
mengandung obat aktif
Target
sel
(misalnya ˚T; pH)
Pelepasan obat terlarang
untuk menargetkan sel;
pemicu eksternal rilis
Fusion dengan target
sel; selanjutnya
pelepasan obat
Gambar 35 n Beberapa jalur internalisasi obat setelah
pengikatan imunospiposom imunospesifik dengan persetujuan
sel target priate. Sumber: Diadaptasi dari Peeters et al., 1987.
92
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 111
mikrosfer yang dikelola secara biodegradable menargetkan
Tambalan Peyer. J Kontrol Rel 11: 205–14.
Emmen F, Storm G (1987). Liposom dalam perawatan
penyakit menular. Pharm Weekblad Sci Ed 9: 162–71.
FDA, www.fda.gov/cber/vaccine/thimfaq.htm, 2006
Fanger MW, Guyre PM (1991). Antibodi bispecific untuk
sitotoksisitas seluler yang ditargetkan. TIBTECH 9: 375–80.
Fendler JH (1980). Mengoptimalkan jebakan obat dalam lipo-
somes. Pertimbangan kimia dan biofisik. Di:
Gregoriadis G, Allison AC, eds. Liposom di
Sistem Biologis. Chichester: Wiley, J. & Sons, 87.
Frank F, Hatley RHM, Mathias SF (1991). Ilmu material
dan produksi biologis yang stabil.
Pharmaceut Technol Int, 3.
Groves M (1988). Manual Teknologi Parenteral. Kerbau
Grove, IL: Interpharm Press, Inc.
Halls NA (1994). Mencapai Kemandulan dalam Medis dan
Produk farmasi. New York: Marcel Dekker.
Heilmann K (1984). Sistem Terapi. Tingkat Terkendali
Pengiriman: Konsep dan Pengembangan. Stuttgart: G.
Thieme Verlag.
Heller J (1993). Polimer untuk pengiriman parenteral yang terkontrol
peptida dan protein. Adv Drug Deliv Rev
10: 163–204.
Hellström KE, Hellström I, Goodman GE (1987). Antibodi untuk
pengantar obat. Dalam: Robinson JR, Lee VHL, eds. Terkendali
Pengantar obat. New York: Marcel Dekker, 623–53.
Ho NFH, Barsuhn CL, Burton PS, Merkle HP (1992).
Wawasan mekanistik untuk pengiriman bukal proteinac-
zat eous. Adv Drug Deliv Rev 8: 197–235.
Holmgren J, Clemens J, Sack D, Sanchez J, Svennerholm AM
(1989). Pengembangan vaksin oral dengan khusus
referensi untuk kolera. Dalam: Breimer DD, Crommelin DJA,
Midha KK, eds. Topik dalam Ilmu Farmasi.
Den Haag: Federasi Farmasi Internasional
(FIP), 297–311.
Hunt CA, RD MacGregor, Siegel RA (1986). Teknik
ditargetkan dalam pengiriman obat in vivo. I. Fisiologis
dan prinsip-prinsip fisikokimia yang mengatur peluang
negara dan keterbatasan. Pharm Res 3: 333-44.
Jain RK (1987). Transportasi molekul dalam tumor
interstitium: Sebuah ulasan. Kanker Res 47: 3039–51.
Jani PU, Florence AT, McCarthy DE (1992). Lebih lanjut
bukti histologis dari absorpsi gastrointestinal
tion dari nanosphere polystyrene di tikus. Int J Pharm
84: 245–52.
Kersten G, Hirschberg H (2004). Sistem pengiriman antigen.
Pendapat Ahli Vaksin 3: 89–99.
Kim SW, Pai CM, Makino K, dkk. (1990). Diatur sendiri
pengiriman insulin glikosilasi. J Kontrol Rel 11: 193–201.
Klegerman ME, Groves MJ (1992). Farmasi
Bioteknologi: Fundamentals and Essentials. Kerbau
Grove, IL: Interpharm Press.
Kumar S, Char H, Patel S, dkk. (1992). Transdermal in vivo
pengiriman iontophoretic pelepasan hormon pertumbuhan
faktor GRF (1-44) pada marmut tidak berambut. J Control Rel
18: 213–20.
Lee VHL, Dodda-Kashi S, Rumput GM, Rubas W (1991). Lisan
rute pengiriman obat peptida dan protein. Dalam: Lee
VHL, ed. Pemberian Obat Peptida dan Protein.
New York: Marcel Dekker, 691-738.
Lee HJ, Riley G, Johnson O, dkk. (1997). Karakter in vivo-
asi formulasi pelepasan manusia yang berkelanjutan
hormon pertumbuhan. Terapi Pharmacol Exp
281: 1431–9.
Maberly GF, Tunggu GA, Kilpatrick JA, dkk. (1982). Bukti
untuk degradasi insulin oleh otot dan jaringan lemak dalam
pasien diabetes resisten insulin. Diabetologica
23: 333–6.
Mastrobattista E, MAEM Aa, van der, Hennink KAMI,
Crommelin DJA (2006). Virus buatan: A nanotech-
pendekatan nologis untuk pengiriman gen. Nat Rev / Obat
Dis 5: 115–21.
Matthews SJ, McCoy C (2004). Peginterferon Alfa-2a: A
Ulasan penggunaan yang disetujui dan diselidiki. Clin
Terapi 26: 991-1024.
Nässander UK, Storm G, Peeters PAM, Crommelin DJA
(1990). Liposom. Dalam: Chasin M, Langer R, eds.
Polimer Biodegradable sebagai Sistem Pengiriman Obat.
New York: Marcel Dekker, 261–33.
O'Hagan DT (1990). Translokasi partikulat usus—
implikasi untuk pengiriman obat dan antigen. Obat Terlarang
Deliv Why 5: 265-85.
Nguyen TH, Ward C (1993). Karakterisasi stabilitas dan
pengembangan formulasi alteplase, sebuah rekombinan
aktivator plasminogen jaringan. Dalam: Wang YJ, Pearlman R,
eds. Stabilitas dan Karakterisasi Protein dan
Obat Peptida. Sejarah kasus. New York: Pleno
Tekan, 91–134.
Patton JS, Platz RM (1992). Pengiriman peptida paru
dan protein untuk aksi sistemik. Adv Drug Deliv Rev
8: 179–96.
Patton JS, Trinchero P, Platz RM (1994). Ketersediaan hayati
peptida dan protein yang dikirim paru:
interferon, kalsitonin, dan hormon paratiroid. J
Rilis Kontrol 28: 79–85.
Patton JS, Bukar J, Nagarajan S (1999). Insulin yang dihirup. Adv
Drug Deliv Rev 35: 235-47.
Patton JS, Bukar JG, Eldon MA (2004). Pharmaco- klinis
kinetika dan farmakodinamik insulin yang dihirup.
Klinik Farmakokinet 43: 781–801.
Pearlman R, Bewley TA (1993). Stabilitas dan karakterisasi-
tion dari hormon pertumbuhan manusia. Dalam: Wang YJ,
Pearlman R, eds. Stabilitas dan Karakterisasi
Protein dan Obat Peptida. Sejarah kasus. New York:
Plenum Press, 1–58.
Peeters PAM, Storm
G, Crommelin
DJA
(1987).
Immunoliposomes in vivo: Keadaan seni. Adv
Obat Deliv Wahyu 1: 249-66.
Pikal MJ (1990a). Pengeringan beku protein. Bagian I: Proses
Desain. BioPharm 3 (8): 18–27.
Pikal MJ (1990b). Pengeringan beku protein. Bagian II:
Pemilihan formulasi. BioPharm 3: 26-30.
Poste G (1985). Penargetan obat dalam terapi kanker. Di:
Gregoriadis G, Poste G, Senior J, Trouet A, eds.
Penargetan Obat yang Dimediasi Reseptor. New York:
Pers Pleno, 427–74.
Pristoupil TI (1985). Hemoglobin terliofilisasi dengan sukrosa:
Efek kelembaban sisa pada penyimpanan. Hematologis
18: 45–52.
Ramakrishnan S (1990). Status antibodi-toksin saat ini
konjugat untuk terapi tumor. Dalam: Tyle P, Ram BP, eds.
FORMULASI PRODUK BIOTEK, TERMASUK PERTIMBANGAN BIOPHARMASI
93
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 112
Sistem Terapi Bertarget. New York: Marcel
Dekker, 189–213.
Roitt IM, Brostoff J, Male DK (1993). Imunologi. 3 rd ed. St.
Louis, MO: Mosby.
Sage BH, Bock CR, Denuzzio JD, Hoke RA (1995).
Masalah teknologi dan perkembangan ion
transpor obat-obatan peptida dan protein. Di:
Lee VHL, Hashida M, Mizushima Y, eds. Tren dan
Perspektif Masa Depan dalam Obat Peptida dan Protein
Pengiriman. Chur: Penerbit Akademik Harwood
GmbH, 111–34.
Soon-Shiong P, Heintz RE, Merideth N, dkk. (1994).
Independensi insulin pada pasien diabetes tipe 1
setelah transplantasi pulau yang dienkapsulasi. Lanset
343: 950–51.
Stenekes R (2000). Mikrosfer dextran nanoporous untuk
pengantar obat. Tesis, Universitas Utrecht.
Storm G, Oussoren C, Peeters PAM, Barenholz YB (1993).
Tolerabilitas liposom in vivo. Dalam: Gregoriadis G,
ed. Teknologi Liposome. Boca Raton, FL: CRC Press,
345-83.
Storm G, Nässander U, Vingerhoeds MH, Steerenberg PA,
Crommelin DJA (1994). Liposom bertarget antibodi
untuk memberikan doxorubicin ke sel kanker ovarium. J
Liposome Res 4: 641-66.
Storm G, Crommelin DJA (1998). Liposom: Quo vadis?
Pharmaceut Sci Technol Hari Ini 1: 19–31.
Supersaxo A, Hein WR, Steffen H (1990). Efek molekuler
berat pada penyerapan limfatik larut dalam air
senyawa setelah pemberian subkutan.
Pharm Res 7: 167–9.
Thurow H, Geisen K (1984). Stabilisasi larut
protein terhadap denaturasi pada interaksi hidrofobik
wajah. Diabetologica 27: 212–8.
Tomlinson E (1987). Teori dan praktik obat spesifik situs
pengiriman. Adv Drug Deliv Rev 1: 87–198.
Toonen P, Crommelin DJA (1983). Immunogobulin sebagai
agen penargetan untuk obat enkapsulasi liposom.
Pharm Weekblad Sci Ed 16: 269–80.
Tresco PA (1994). Sel-sel yang dienkapsulasi untuk neuron berkelanjutan
pengiriman pemancar ke sistem saraf pusat. J
Kontrol Rel 28: 253–8.
Uludag H, Kharlip L, Sefton MV (1993). Pengiriman protein oleh
sel mikroenkapsulasi. Adv Drug Deliv Rev 10: 115–30.
USP 29 / NF 24 hingga suplemen kedua (2006). Rockville,
MD: Konvensi Farmakope Amerika Serikat, Inc.
van Dijkhuizen-Radersma R, Wright SJ, Taylor LM, John BA,
de Groot K, Bezemer JM (2004). In vitro / in vivo
korelasi untuk 14 C-termetilasi rilis lisozim dari
mikrosfer poli (eter-ester). Pharm Res 21: 484–91.
Vemuri S, Yu CT, Roosdorp N (1993a). Formulasi dan
stabilitas alpha-antitrypsin rekombinan. Dalam: Wang
YJ, Pearlman R, eds. Stabilitas dan Karakterisasi
Protein dan Obat Peptida. Sejarah kasus. New York:
Plenum Press, 263–86.
Vemuri S, Yu CT, Roosdorp N (1993b). Formulasi dan
stabilitas alpha1-antitrypsin rekombinan. Dalam: Wang
YJ, Pearlman R, eds. Stabilitas dan Karakterisasi
Protein dan Obat Peptida. New York: Plenum Press,
263–86.
Vingerhoeds MH, Storm G, Crommelin DJA (1994).
Immunoliposomes in vivo. Metode imun 4: 259–72.
Woodle M, Newman M, Collins L, Redemann C, Martin F
(1990). Peningkatan sirkulasi lama (Stealth
HAI
) lipo-
somes menggunakan lipid sintetis. Proc Int Symp Control
Rel Bioaktif Mater 17: 77–8.
Zhou XH, Li Wan Po A (1991a). Obat peptida dan protein: I.
Aplikasi terapi, absorpsi dan parenteral
administrasi. Int J Pharm 75: 97–115.
Zhou XH, Li Wan Po A (1991b). Obat peptida dan protein:
II Rute pengiriman non-parenteral. Int J Pharm
75: 117–30.
94
CROMMELIN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 113

5
Farmakokinetik dan Farmakodinamik dari
Obat Peptida dan Protein
Bernd Meibohm
Pusat Ilmu Kesehatan Universitas Tennessee, Sekolah Tinggi Farmasi, Departemen Ilmu Farmasi,
Memphis, Tennessee, AS
Rene Braeckman
Layanan Penelitian Klinis Reliance, Newtown, Pennsylvania, AS
PENGANTAR
Penggunaan obat yang rasional dan desain yang efektif
rejimen dosis difasilitasi oleh apresiasi
paradigma sentral farmakologi klinis yang ada a
hubungan yang didefinisikan antara dosis yang diberikan dari a
obat, konsentrasi obat yang dihasilkan di berbagai tubuh
cairan dan jaringan, dan intensitas farmakologis
efek yang disebabkan oleh konsentrasi ini (Meibohm dan
Derendorf, 1997). Hubungan dosis-paparan-respons ini-
mengirimkan dan dengan demikian dosis obat yang diperlukan untuk mencapai a
efek tertentu ditentukan oleh farmakoksi obat
sifat asli dan farmakodinamik (Gbr. 1).
Farmakokinetik menggambarkan perjalanan waktu
konsentrasi obat dalam cairan tubuh, lebih disukai
plasma atau darah, yang dihasilkan dari administrasi
dari rejimen dosis tertentu. Ini terdiri dari semua proses
mempengaruhi penyerapan obat, distribusi, metabolisme,
dan ekskresi. Karakter farmakokinetik yang disederhanakan
terizes apa yang dilakukan tubuh terhadap obat. Sebaliknya,
farmakodinamik mencirikan intensitas a
efek obat atau toksisitas yang dihasilkan dari obat tertentu
konsentrasi dalam cairan tubuh, biasanya pada asumsi
situs aksi narkoba. Ini bisa disederhanakan menjadi apa obat itu
tidak ke tubuh (Gbr. 2) (Holford dan Sheiner, 1982;
Derendorf dan Meibohm, 1999).
Pemahaman tentang dosis – konsentrasi–
efek hubungan sangat penting untuk obat apa pun - termasuk
peptida dan protein - karena meletakkan dasar untuk
desain rejimen dosis dan aplikasi klinis rasional.
Prinsip farmakokinetik dan farmakodinamik umum
ciples sebagian besar sama-sama berlaku untuk protein
dan obat peptida seperti halnya obat tradisional kecil
terapi berbasis molekul. Penyimpangan dari beberapa
prinsip-prinsip ini dan tantangan tambahan terkait dengan
karakterisasi farmakokinetik dan farmakokinetik
makodinamik terapi peptida dan protein,
namun, timbul dari beberapa sifat spesifik mereka:
Sebuah. Kesamaan struktural mereka dengan struktur endogen
protein dan nutrisi fungsional atau fungsional.
b. Keterlibatan intim mereka dalam program fisiologis
cesses pada tingkat molekuler, sering kali termasuk
mekanisme umpan balik pengaturan.
c. Tantangan analitis untuk mengidentifikasi dan mempertanyakan
tify mereka di hadapan segudang serupa
molekul.
d. Berat molekul dan makromolekulnya besar
karakter (untuk protein).
Bab ini akan menyoroti beberapa mata pelajaran utama
sifat dan proses farmakokinetik yang relevan untuk
sebagian besar terapi peptida dan protein dan kemauan
memberikan contoh farmakodik yang ditandai dengan baik
hubungan namic untuk obat peptida dan protein. Itu
farmakologi klinis antibodi monoklonal, termasuk-
dalam aspek farmakokinetik dan farmakokinetik mereka.
macodynamics, akan dibahas lebih lanjut dalam
Bab 15. Untuk diskusi yang lebih umum tentang farmasi
prinsip kokinetik dan farmakodinamik, pembaca
merujuk beberapa buku pelajaran dan artikel yang mengulas
topik dalam perincian luas (lihat bagian Bacaan Lebih Lanjut).
FARMAKOKINETIKA TERAPI PROTEIN
Disposisi in vivo obat peptida dan protein
mungkin sering diprediksi sebagian besar dari mereka
fungsi fisiologis (Tang dan Meibohm, 2006).
Peptida, misalnya, yang sering memiliki hormon
aktivitas, biasanya memiliki waktu paruh eliminasi yang pendek,
yang diinginkan untuk regulasi dekat mereka
level endogen dan karenanya berfungsi. Insulin, untuk
contoh menunjukkan eliminasi tergantung dosis dengan a
waktu paruh yang relatif singkat 26 dan 52 menit pada 0,1 dan
0,2 U / kg, masing-masing. Bertentangan dengan itu, protein itu
memiliki tugas pengangkutan seperti albumin atau jangka panjang
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 114
fungsi imunitas seperti yang dimiliki imunoglobulin
eliminasi waktu paruh beberapa hari, yang memungkinkan
dan memastikan pemeliharaan fisio
konsentrasi yang diperlukan secara logis dalam aliran darah
(Meibohm dan Derendorf, 1994). Ini misalnya
tercermin dari eliminasi paruh obat antibodi
seperti reseptor faktor pertumbuhan anti-epidermal
cetuximab antibodi, sebuah antibodi chimeric IgG1 untuk
yang waktu paruh sekitar 7 hari telah
dilaporkan (Herbst and Langer, 2002).
n Penyerapan Terapi Protein
Administrasi Enteral
Peptida dan protein, tidak seperti kecil konvensional
obat molekul, umumnya tidak bersifat terapi
Dosis
Conc
Kemanjuran
Toksisitas
Farmakokinetik
Farmakodinamik
Gambar 1 n Pusat
paradigma farma klinis
cology: Dosis – konsentrat
hubungan efek-efek.
Dosis
Penyerapan
Distribusi
Obat terikat jaringan
Konsentrasi jaringan
Eliminasi
Obat terikat protein
Konsentrasi plasma
Metabolisme
Pengeluaran
Efek obat
kompartemen
Obat terikat
untuk
reseptor / efektor
Farmakodinamik
Farmakokinetik
Pasca reseptor
acara
Biokimia
efek
Farmakologis
tanggapan
Gambar 2 n Skema fisiologis proses farmakokinetik dan farmakodinamik.
96
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 115
aktif setelah pemberian oral (Fasano, 1998; Mahato
et al., 2003; Tang et al., 2004). Kurangnya sistemik
bioavailabilitas terutama disebabkan oleh dua faktor: (1)
aktivitas enzim pencernaan yang tinggi dan (2) rendah
permeabilitas melalui mukosa gastrointestinal. Di
faktanya, aktivitas peptidase dan protease yang substansial di Indonesia
saluran pencernaan membuatnya paling efisien
kompartemen tubuh untuk metabodi peptida dan protein
lism. Selanjutnya, mukosa gastrointestinal
merupakan penghalang penyerapan utama untuk larut dalam air
makromolekul seperti peptida dan protein (Tang
et al., 2004). Jadi, meski berbagai faktor seperti
permeabilitas, stabilitas dan waktu transit gastrointestinal
dapat mempengaruhi laju dan tingkat penyerapan oral
diberikan protein, ukuran molekul umumnya
dianggap sebagai hambatan utama (Shen, 2003).
Karena pemberian oral masih sangat diinginkan
rute pengiriman obat protein yang dapat dilakukan
kenyamanan, efektivitas biaya dan tidak menimbulkan rasa sakit,
berbagai strategi untuk mengatasi hambatan
terkait dengan pengiriman protein oral baru-baru ini
menjadi bidang penelitian intensif. Disarankan
pendekatan untuk meningkatkan bioavailabilitas oral
obat protein termasuk enkapsulasi menjadi mikro atau
nanopartikel dengan demikian melindungi protein dari usus
degradasi akhir (Lee, 2002; Mahato et al., 2003; Shen,
2003). Strategi lainnya adalah modifikasi kimia
seperti modifikasi tulang punggung asam amino dan
konjugasi kimia untuk meningkatkan ketahanan terhadap
degradasi dan permeabilitas obat protein.
Pemberian protease inhibitor juga telah dilakukan
disarankan untuk menghambat degradasi enzimatik
(Pauletti et al., 1997; Mahato et al., 2003). Keterangan lebih lanjut
pada pendekatan untuk pengiriman peptida dan protein oral
terapi dibahas dalam Bab 4.
Administrasi Parenteral
Sebagian besar obat peptida dan protein saat ini adalah
Diatur sebagai formulasi parenteral karena mereka
bioavailabilitas oral yang buruk. Rute utama administrasi
termasuk intravena (IV), subkutan (SC), dan
administrasi intramuskuler (IM). Selain itu, lainnya
jalur pemberian non-oral digunakan, di-
termasuk hidung, bukal, dubur, vagina, transdermal,
pemberian obat okular dan paru (lihat Bab 4).
Pemberian peptida dan protein secara IV menawarkan
keuntungan dari menghindari degradasi presistemik
tion, dengan demikian mencapai konsentrasi tertinggi
dalam sistem biologis. Terapi protein diberikan
oleh rute IV termasuk, di antara banyak lainnya, jaringan
analog aktivator plasminogen (t-PA) alteplase dan
tenecteplase, eritropoietin manusia rekombinan
epoetin-a, dan granulocyte-colony-stimulating
faktor filgrastim (Tang dan Meibohm, 2006).
Pemberian IV baik sebagai dosis bolus atau
infus laju konstan, bagaimanapun, mungkin tidak selalu
memberikan konsentrasi profil waktu yang diinginkan
tertunda pada aktivitas biologis produk. Di
kasus-kasus ini, injeksi IM atau SC mungkin lebih disetujui
alternatif priate. Misalnya, meluteinisasi hormon
melepaskan hormon (LH-RH) dalam semburan merangsang
pelepasan hormon perangsang folikel (FSH) dan
luteinizing hormone (LH), sedangkan basa terus menerus
tingkat garis akan menekan pelepasan hormon-hormon ini
(Handelsman dan Swerdloff, 1986). Untuk menghindari yang tinggi
puncak dari pemberian IV leuprorelin, suatu LH-
Agonis RH, injeksi depot bulanan beraksi lama
disetujui untuk pengobatan kanker prostat
dan endometriosis (Periti et al., 2002). Penelitian baru-baru ini
membandingkan administrasi SC versus IV epoetin-a in
pasien yang menerima laporan hemodialisis bahwa SC
rute dapat mempertahankan hematokrit pada target yang diinginkan
Kisaran dengan dosis mingguan rata-rata yang lebih rendah dari epoetin-a
dibandingkan dengan IV (Kaufman et al., 1998).
Salah satu potensi keterbatasan SC dan IM
administrasi, bagaimanapun, adalah degradasi presistem
proses dasi sering dikaitkan dengan ini
rute administrasi, menghasilkan pengurangan bio-
kemampuan dibandingkan dengan pemberian IV. Farmasi
tingkat penyerapan semu yang diturunkan secara kokinetik
aplikasi k konstan untuk obat protein yang diberikan melalui ini
rute administrasi dengan demikian merupakan kombinasi dari
penyerapan ke dalam sirkulasi sistemik dan presis-
degradasi tematik di lokasi penyerapan, yaitu jumlah
dari konstanta laju penyerapan orde pertama yang benar k a dan a
tingkat degradasi orde pertama konstan. Penyerapan sejati
Konstanta laju tion k a kemudian dapat dihitung sebagai
k a = F 4 k app
di mana F adalah bioavailabilitas dibandingkan dengan IV
administrasi. Penyerapan jelas yang cepat, yaitu,
aplikasi k besar , dengan demikian bisa menjadi hasil benar lambat
penyerapan dan degradasi presistem yang cepat, yaitu, a
bioavailabilitas sistemik yang rendah (Colburn, 1991).
Faktor potensial lain yang dapat membatasi bioavail-
kemampuan protein setelah pemberian SC atau IM
termasuk aliran darah lokal variabel, trauma injeksi,
dan keterbatasan penyerapan ke dalam sirkulasi sistemik
terkait dengan ukuran dan difusi pori kapiler yang efektif.
Beberapa terapi protein dan peptida termasuk
anakinra, etanercept, insulin, dan pegfilgrastim adalah
diberikan sebagai suntikan SC. Setelah injeksi SC,
terapi peptida dan protein dapat masuk ke sistemik
sirkulasi baik melalui kapiler darah atau melalui
pembuluh limfatik (Porter dan Charman, 2000). Di
umum, makromolekul lebih besar dari 16 kDa adalah pra-
dominan diserap ke dalam limfatik sedangkan yang lainnya
di bawah 1kDa sebagian besar diserap ke dalam darah
sirkulasi. Tampaknya ada hubungan linier
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
97
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 116
antara berat molekul protein dan
proporsi dosis yang diserap oleh limfatik (lihat
Gambar 12 di Bab 4) (Supersaxo et al., 1990).
Ini sangat penting bagi agen-agen tersebut
yang target terapinya adalah sel limfoid (yaitu,
interferon dan interleukin). Studi dengan rekombi-
interferon manusia n-2a (rhIFNa2a) menunjukkan bahwa
setelah pemberian SC, konsentrasi tinggi
protein rekombinan ditemukan di limfatik
sistem, yang mengalir ke kelenjar getah bening regional
(Supersaxo et al., 1988). Studi klinis menunjukkan hal itu
rekombinan SC paliatif dosis rendah hingga menengah
interleukin-2 (rIL-2) dalam kombinasi dengan rhIFNa2a
dapat diberikan kepada pasien di rawat jalan
pengaturan dengan profil efikasi dan keamanan yang sebanding dengan
protokol IV rIL-2 paling agresif terhadap meta
kanker sel ginjal statis (Schomburg et al., 1993; Chen
et al., 2000).
n Distribusi
Terapi Protein
Mekanisme Distribusi dan Volume
Tingkat dan tingkat distribusi protein ditentukan
ditambang sebagian besar berdasarkan ukuran dan berat molekulnya,
sifat fisiokimia (misalnya, muatan, lipofilisitas),
pengikatan protein, dan ketergantungannya pada aktif
proses transportasi. Karena sebagian besar protein terapi
memiliki berat molekul tinggi dan dengan demikian besar
ukuran, volume distribusi yang jelas biasanya
kecil dan terbatas pada volume ekstraseluler
ruang karena mobilitas terbatas mereka sekunder
gangguan jalur melalui biomembran (Zito, 1997).
Penyerapan jaringan aktif dan mengikat intra dan
protein ekstravaskular, bagaimanapun, secara substansial dapat
meningkatkan volume distribusi yang jelas
obat protein, sebagaimana tercermin oleh relatif besar
volume distribusi hingga 2,8 L / kg untuk interferon
b-1b (Chiang et al., 1993).
Berbeda dengan obat molekul kecil, protein
transportasi dari ruang pembuluh darah ke interstitial
ruang jaringan sebagian besar dimediasi oleh konveksi
daripada difusi, mengikuti searah
fluks cairan dari ruang pembuluh darah melalui paracel-
pori-pori lular ke dalam ruang jaringan interstitial. Itu
penghapusan selanjutnya dari jaringan dilakukan
oleh drainase getah bening kembali ke sirkulasi sistemik
(Flessner et al., 1997). Ini menggarisbawahi peran unik
sistem limfatik berperan dalam disposisi
terapi protein sebagaimana telah dibahas dalam
bagian tentang penyerapan. Lain, tapi jauh lebih sedikit
jalur yang menonjol untuk pergerakan protein
molekul dari vaskular ke ruang interstitial adalah
migrasi transelular melalui endositosis (Baxter et al.,
1994; Reddy et al., 2006).
Selain pengayakan ukuran tergantung dari makro-
molekul melalui dinding kapiler, mungkin muatan
juga memainkan peran penting dalam biodistribusi
protein. Telah disarankan bahwa elektrostatik
tarik antara protein bermuatan positif dan
membran sel bermuatan negatif dapat meningkatkan
tingkat dan luasnya distribusi jaringan. Kebanyakan sel
permukaan bermuatan negatif karena mereka
banyaknya glikaminamin di dalam ekstraseluler
matriks.
Setelah pemberian IV, peptida dan protein
biasanya mengikuti konsentrasi plasma biexponential–-
profil waktu yang paling baik dijelaskan oleh dua-
model farmakokinetik kompartemen (Meibohm,
2004). Profil konsentrasi-waktu dua arah
, misalnya, telah dijelaskan untuk clenoliximab,
antibodi monoklonal chimeric-human monyet
khusus untuk molekul CD4 di permukaan
T-limfosit (Mold et al., 1999). Demikian pula,
AJW200, antibodi monoklonal yang dimanusiakan untuk
faktor von Willebrand, dipamerkan pharmaco- biphasic
kinetika setelah pemberian IV (Kageyama et al.,
2002). Kompartemen sentral dalam dua kompartemen ini
Model ini terutama mewakili ruang vaskular
dan ruang interstisial organ dengan perfusi yang baik
dinding kapiler permeabel, termasuk hati dan
ginjal. Kompartemen periferal lebih mencerminkan
tive profil konsentrasi-waktu di pengantara
ruang jaringan yang perlahan-lahan menyeimbangkan.
Kompartemen pusat di mana protein
awalnya didistribusikan setelah pemberian IV
biasanya volume distribusi sama atau sedikit
lebih besar dari volume plasma, yaitu 3 hingga 8 L. Total
volume distribusi sering terdiri dari 14
hingga 20 L tidak lebih dari 2 hingga 3 kali volume awal
distribusi (Colburn, 1991; Kageyama et al., 2002).
Contoh untuk pola distribusi seperti itu adalah t-PA
analog tenecteplase. Radiolabeled 125 I-tenecteplase
digambarkan memiliki volume awal distribusi
dari 4.2 hingga 6.3 L dan total volume distribusi
6,1 hingga 9,9L dengan hati sebagai satu-satunya organ yang memiliki a
penyerapan radioaktivitas yang signifikan. Para penulis
berpendapat bahwa volume distribusi yang kecil menunjukkan
distribusi intravaskular terutama untuk tenecteplase,
konsisten dengan berat molekul besar obat
65 kDa (Tanswell et al., 2002).
Epoetin-a, misalnya, memiliki volume
kontribusi diperkirakan mendekati volume plasma
pada 0,056L / kg setelah pemberian IV sampai sehat
sukarelawan (Ramakrishnan et al., 2004). Demikian pula,
volume distribusi untuk darbepoetin-a telah
dilaporkan sebagai 0,062L / kg setelah pemberian IV di Indonesia
pasien yang menjalani dialisis (Allon et al., 2002), dan
distribusi trombopoietin juga telah dilaporkan
terbatas pada volume plasma (~ 3L) (Jin dan
Krzyzanski, 2004).
Perlu ditekankan farmakokinetik itu
perhitungan volume distribusi mungkin
98
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 117
bermasalah untuk banyak terapi protein (Tang
et al., 2004; Straughn, 2006). Non-kompartemen
penentuan volume distribusi stabil
state (V ss ) menggunakan teori momen statistik
proses disposisi orde pertama dengan eliminasi
terjadi dari pusat ekuilibrasi cepat atau
kompartemen (Perrier dan Mayersohn, 1982; Straughn,
1982; Veng-Pedersen dan Gillespie, 1984). Dasar ini
asumsi, bagaimanapun, tidak dipenuhi untuk banyak
terapi protein, seperti proteolisis dan reseptor-
eliminasi yang dimediasi dalam jaringan perifer mungkin
merupakan sebagian besar dari keseluruhan eliminasi
proses tion. Jika terapi protein dihilangkan
dari jaringan yang perlahan-lahan menyeimbangkan pada tingkat yang lebih besar dari
proses distribusi mereka, kesalahan substansial dalam
volume penilaian distribusi dapat terjadi. SEBUAH
Studi simulasi terbaru dapat menunjukkan bahwa jika substansial
eliminasi jaringan ada, V ss ditentukan oleh non
metode kompartemen akan meremehkan
"Benar" V ss , dan besarnya kesalahan cenderung
lebih besar semakin luas protein dihilangkan
yang ditentukan oleh rute jaringan (Meibohm, 2004; Straughn,
2006; Tang dan Meibohm, 2006).
Tantangan-tantangan ini dalam mengkarakterisasi distribusi
Terapi protein hanya dapat diatasi dengan
menentukan konsentrasi protein aktual dalam
jaringan dengan biopsi atau necropsy, atau melalui biodistribusi
studi dengan senyawa radiolabeled dan / atau pencitraan
teknik.
Studi biodistribusi sangat penting untuk yang kecil
obat sintetik organik, sejak lama tinggal
label radioaktif dalam jaringan tertentu mungkin merupakan
indikasi akumulasi jaringan yang berpotensi toksik
metabolisme. Karena kemungkinan pemanfaatan ulang
asam amino dari obat protein dalam endogen
protein, masalah keamanan seperti itu tidak ada untuk protein
terapi. Oleh karena itu, studi biodistribusi untuk
obat protein biasanya hanya dilakukan untuk menilai
penargetan obat ke jaringan tertentu, atau untuk mendeteksi utama
organ eliminasi (biasanya ginjal dan hati).
Jika protein mengandung asam amino yang cocok seperti itu
sebagai tirosin atau lisin, label eksternal seperti 125 I can
secara kimiawi digabungkan dengan protein (Ferraiolo dan
Mohler, 1992). Meskipun kopling ini mudah
dicapai dan kegiatan yang sangat spesifik dapat dilakukan
diperoleh, protein diubah secara kimia. Karena itu,
mungkin lebih baik untuk memberi label protein dan bioteknologi lainnya.
senyawa nologi dengan memperkenalkan iso- radioaktif
topes selama sintesis mereka dimana internal
atom menjadi penanda radioaktif (label internal
ing). Untuk protein rekombinan, label internal dapat
dicapai dengan menumbuhkan garis sel produksi
di hadapan asam amino berlabel 3 H, 14 C,
35 S, dll. Metode ini tidak digunakan secara rutin karena
larangan kontaminasi radioaktif dari
peralatan bimbingan (Meibohm dan Derendorf,
2003). Selain itu, protein berlabel internal mungkin
kurang diinginkan daripada protein yodium karena
pemanfaatan kembali yang potensial dari asam amino radiolabeled
fragmen dalam sintesis protein endogen
dan struktur sel. Terlepas dari pelabelannya
metode, tetapi lebih untuk pelabelan eksternal, diberi label
produk harus menunjukkan fisikokimia
dan sifat biologis identik dengan yang tidak berlabel
molekul (Bennett dan McMartin, 1978).
Selain itu, seperti untuk semua jenis studi radiolabeled,
perlu ditetapkan apakah radio yang diukur
aktivitas mewakili protein berlabel utuh, atau radiolabeled
metabolit, atau label yang dibebaskan. Trichloro-acetic acid-
radioaktivitas yang cepat sering digunakan untuk membedakan
protein utuh dari label bebas atau berat molekul rendah
metabolit, yang muncul di supernatan setelah
sentrifugasi (Meibohm dan Derendorf, 2003).
Protein dengan asam amino berlabel reutilized dan besar
metabolit protein hanya dapat dibedakan dari
protein asli dengan teknik seperti poliakrilamida
gel elektroforesis (PAGE), cairan cair bertekanan tinggi
matography (HPLC), immunoassays spesifik, atau bioas-
kata (lihat Bab 2). Diskusi ini juga menyiratkan bahwa
hasil studi biodistribusi dengan autoradiografi
bisa sangat menyesatkan. Autoradiografi adalah teknik
di mana sampel jaringan dibawa ke kontak dengan X-ray
film sensitif untuk memvisualisasikan radio berlabel radioaktif
kapsul atau fragmen molekul. Meskipun autoradio-
Graphy menjadi lebih kuantitatif, tidak ada yang tahu
apa yang diukur secara kualitatif (mol asli
kapsul atau produk degradasinya) tanpa spesifik
tes. Karena itu kadang-kadang lebih baik untuk melakukan
Studi biodistribusi oleh pengumpulan jaringan
dan pengukuran spesifik obat protein dalam
homogenat jaringan.
Pengikatan Protein dari Terapi Protein
Faktor lain yang dapat mempengaruhi distribusi
peptida terapeutik dan protein mengikat
struktur protein endogen. Aktif secara fisiologis
peptida dan protein endogen sering berinteraksi
dengan protein pengikat spesifik yang terlibat dalam
pelabuhan dan regulasi. Selanjutnya, interaksi dengan
protein pengikat dapat mengaktifkan atau memfasilitasi seluler
proses pengambilan dan dengan demikian memengaruhi
dinamika. Demikian pula, terapi yang diberikan
teh dapat berinteraksi dengan protein pengikat endogen.
Ini adalah prinsip farmakokinetik umum, yang
juga berlaku untuk protein, yang hanya bebas,
fraksi obat yang tak terikat dapat diakses
proses distribusi dan eliminasi serta
interaksi dengan struktur targetnya di lokasi
aksi, misalnya saluran reseptor atau ion. Demikian,
pengikatan protein dapat mempengaruhi farmakodinamik,
tetapi juga sifat disposisi dari terapi protein.
Protein pengikat spesifik telah diidentifikasi
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
99
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.
Halaman 118
banyak obat protein, termasuk hu-
man DNase untuk digunakan sebagai mucolytic pada cystic fibrosis
(Mohler et al., 1993), hormon pertumbuhan (Toon, 1996),
dan pertumbuhan endotel vaskular manusia rekombinan
faktor (rhVEGF) (Eppler et al., 2002).
Pengikatan protein tidak hanya mempengaruhi yang tidak terikat
fraksi obat protein dan dengan demikian fraksi obat
tersedia untuk mengerahkan aktivitas farmakologis, tetapi banyak
kali itu juga memperpanjang waktu sirkulasi protein
bertindak sebagai gudang penyimpanan atau meningkatkan protein
izin. Sitokin rekombinan, misalnya, mungkin
setelah pemberian IV menghadapi berbagai sitokin-
mengikat protein termasuk reseptor sitokin terlarut
dan antibodi anti-sitokin (Piscitelli et al., 1997). Di
bagaimanapun, protein pengikat dapat memperpanjang
waktu sirkulasi sitokin dengan bertindak sebagai depot penyimpanan atau
itu dapat meningkatkan pembersihan sitokin.
Hormon pertumbuhan, sebagai contoh lain, ada di
setidaknya dua protein pengikat dalam plasma (Wills dan
Ferraiolo, 1992). Protein ini mengikat secara substansial
mengurangi eliminasi hormon pertumbuhan dengan sepuluh kali lipat
total clearance lebih kecil dibandingkan dengan pertumbuhan gratis
hormon, tetapi juga mengurangi aktivitasnya melalui pengurangan
interaksi reseptor.
Terlepas dari pengikatan spesifik ini, peptida dan
protein juga dapat secara spesifik tidak terikat pada plasma
protein. Misalnya, metkephamid, sebuah metenkepha-
Lin analog, dideskripsikan sebagai 44% hingga 49% terikat
albumin (Taki et al., 1998), dan octreotide, sebuah somatos-
analog tatin, hingga 65% terikat dengan lipoprotein
(Chanson et al., 1993).
Distribusi melalui Serapan yang Dimediasi-Reseptor
Selain dari sifat fisikokimia dan protein
pengikatan terapi protein, reseptor spesifik situs
penyerapan yang dimediasi juga dapat secara substansial mempengaruhi dan
berkontribusi pada distribusi terapi protein,
serta untuk eliminasi dan farmakodinamik (lihat
bagian tentang disposisi obat yang dimediasi target).
Seharusnya volume distribusi yang rendah
belum tentu diartikan sebagai penetrasi jaringan yang rendah.
Penyerapan spesifik yang dimediasi reseptor ke dalam target
organ, sebagai satu mekanisme, dapat menghasilkan terapi
konsentrasi jaringan efektif walaupun relatif kecil
volume distribusi. Nartograstim, seorang rekombinan
turunan dari faktor stimulasi granulosit-koloni
(G-CSF), misalnya, ditandai dengan spesifik,
pengambilan dosis tergantung dan jenuh jaringan ke dalam
sumsum tulang organ target, mungkin melalui reseptor-
endositosis yang dimediasi (Kuwabara et al., 1995).
n Penghapusan Terapi Protein
Terapi berbasis protein umumnya tunduk pada
jalur katabolik yang sama dengan endogen atau diet
protein. Produk akhir dari metabolisme protein adalah
dengan demikian asam amino yang digunakan kembali dalam endogen
kolam asam amino untuk biosintesis de novo dari
protein struktural atau fungsional dalam tubuh manusia
(Meibohm, 2004). Investigasi terperinci tentang
metabolisme protein relatif sulit karena
dari segudang fragmen molekul potensial itu
dapat dibentuk, dan karena itu umumnya tidak
dilakukan. Jalur eliminasi non-metabolik seperti itu
karena ekskresi ginjal atau empedu diabaikan untuk sebagian besar
protein. Namun, jika ekskresi empedu terjadi
umumnya diikuti oleh penurunan metabolisme berikutnya
tion dari senyawa di saluran pencernaan.
Proteolisis
Tingkat metabolisme untuk degradasi protein umumnya
meningkat dengan menurunnya berat molekul dari
protein besar ke kecil untuk peptida (Tabel 1), tetapi demikian
juga tergantung pada faktor-faktor lain seperti ukuran, muatan,
Berat molekul
Situs eliminasi
Mekanisme eliminasi dominan
Penentu utama
<500
Darah, hati
Hidrolisis ekstraseluler
Difusi lipoid pasif
Struktur, lipofilisitas
500–1.000
Hati
Penyerapan yang dimediasi oleh operator
Difusi lipoid pasif
Struktur, lipofilisitas
1.000–50.000
Ginjal
Filtrasi glomerulus dan
proses degradasi selanjutnya
(lihat Gbr. 4)
Berat molekul
50.000–200.000
Ginjal, hati
Endositosis yang dimediasi reseptor
Gula, isi daya
200.000–400.000
Opsonisasi
a 2 -acroglobulin, IgG
> 400.000
Fagositosis
Agregasi partikel
Catatan: Faktor penentu lainnya adalah ukuran, muatan, lipofilisitas, kelompok fungsional, pengenalan gula, kerentanan terhadap protease, agregasi partikel,
pembentukan kompleks dengan faktor opsonisasi, dll. Mekanisme dapat tumpang tindih dan endositosis dapat terjadi pada kisaran berat molekul apa pun.
Sumber: After Meijer dan Ziegler, 1993.
Tabel 1 n Berat molekul sebagai penentu utama mekanisme eliminasi peptida dan protein.
100
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 119
lipofilisitas, gugus fungsi, dan glikosilasi
pola serta struktur sekunder dan tersier.
Kliring peptida atau protein menjelaskan
penghapusan zat aktif dari
ruang pembuluh darah, yang termasuk selain metabolisme
juga penyerapan seluler. Degradasi proteinolitik dari pro-
teh dapat muncul secara tidak spesifik hampir di semua tempat
tubuh atau dapat terbatas pada organ atau jaringan tertentu.
Karena proteolisis spesifik beberapa protein ini
sudah dalam darah serta seluler aktif yang potensial
serapan, pembersihan obat protein dapat melebihi
curah jantung, yaitu,> 5 L / mnt untuk pembersihan darah dan
> 3 L / mnt untuk pembersihan plasma (Meibohm, 2004).
Berat molekul menentukan metabo- utama
situs lism serta degradasi dominan
proses (Wills, 1991). Enzim proteinolitik seperti
Protease dan peptidase ada di mana-mana
tubuh. Situs yang mampu menghasilkan peptida dan protein yang luas
metabolisme tidak hanya terbatas pada hati, ginjal,
dan jaringan pencernaan, tetapi juga termasuk darah dan
endotelium pembuluh darah serta organ lain dan
tisu. Karena protease dan peptidase juga ditemukan
dalam sel, penyerapan intraseluler adalah lebih dari satu
eliminasi daripada proses distribusi (Tang
dan Meibohm, 2006). Sedangkan peptidase dan protease
di saluran pencernaan dan di lisosom
relatif tidak spesifik, peptidase terlarut dalam
ruang awal dan exopeptidases pada permukaan sel miliki
selektivitas yang lebih tinggi dan menentukan metabolis spesifik
pola organ. Aktivitas proteolitik dari SC
jaringan, misalnya, mengakibatkan hilangnya sebagian aktivitas
SC dibandingkan dengan IV yang diadministrasikan interferon-g.
Metabolisme Protein Gastrointestinal
Seperti yang ditunjukkan sebelumnya, saluran pencernaan adalah a
situs utama metabolisme protein dengan proteolitik tinggi
aktivitas enzim karena fungsi utamanya untuk dicerna
protein diet. Dengan demikian, metabolisme pencernaan
obat protein adalah salah satu faktor utama yang membatasi
bioavailabilitas sistemik dari protein yang diberikan secara oral
narkoba. Aktivitas metabolisme gastrointestinal
traktat, bagaimanapun, tidak terbatas pada pemberian secara oral
protein. Peptida dan pro- gram yang diberikan secara parenteral
Teh juga dapat dimetabolisme di mukosa usus
mengikuti sekresi usus. Setidaknya 20% dari
degradasi albumin endogen, misalnya, telah
telah dilaporkan terjadi di saluran pencernaan
(Colburn, 1991).
Metabolisme dan Ekskresi Protein Ginjal
Ginjal adalah tempat utama metabolisme protein
untuk protein berukuran lebih kecil yang menjalani glomerular
penyaringan. Cut-off selektif ukuran untuk glomerular
filtrasi sekitar 60kD, meskipun efeknya
radius molekul berdasarkan berat molekul dan
konformasi mungkin merupakan faktor pembatas (Edwards
et al., 1999). Filtrasi glomerular paling efisien,
namun, untuk protein yang lebih kecil dari 30 kDa (Kompella
dan Lee, 1991). Peptida dan protein kecil (<5 kDa)
difilter sangat efisien, dan glomerularnya
izin filtrasi mendekati filtra- glomerulus
tingkat tion (GFR, ~ 120 mL / menit pada manusia). Untuk mol
Berat cular melebihi 30 kDa, laju filtrasi turun
off tajam. Selain selektivitas ukuran, isi daya
selektivitas juga telah diamati untuk glomerulus
filtrasi di mana makromolekul anionik lewat
dinding kapiler kurang mudah daripada makro netral
molekul, yang pada gilirannya melewati kurang mudah
dari makromolekul kationik (Deen et al., 2001).
Pentingnya ginjal sebagai eliminasi
organ misalnya dapat ditunjukkan untuk interleukin-2,
macrophage-colony-stimulating factor (M-CSF) dan
interferon-a (McMartin, 1992; Wills dan Ferraiolo,
1992). Kontribusi relatif ginjal dan hati
izin total plasma clearance beberapa
protein ditunjukkan pada Gambar 3.
Metabolisme ginjal peptida dan protein kecil
dimediasi melalui tiga proses yang sangat efektif
(Gbr. 4). Akibatnya, hanya jumlah sangat kecil yang utuh
protein terdeteksi dalam urin.
Mekanisme pertama melibatkan filtra- glomerulus
diikuti peptida dan protein yang lebih besar dan kompleks
oleh reabsorpsi ke dalam vesikel endositik di prox-
tubulus imal dan hidrolisis selanjutnya menjadi kecil
fragmen peptida dan asam amino (Maack et al.,
1985). Mekanisme eliminasi ini telah
dijelaskan untuk IL-2 (Anderson dan Sorenson, 1994),
IL-11 (Takagi et al., 1995), hormon pertumbuhan (Johnson
dan Maack, 1977), dan insulin (Rabkin et al., 1984).
Mekanisme kedua mensyaratkan filtra- glomerulus
diikuti oleh metabolisme intraluminal, predom-
dengan exopeptidases di perbatasan sikat luminal
membran tubulus proksimal. Hasilnya
fragmen peptida dan asam amino diserap kembali
ke dalam sirkulasi sistemik. Rute disposisi ini
berlaku untuk peptida linier kecil seperti glukagon dan
LH-RH (Carone dan Peterson, 1980; Carone et al.,
1982). Studi terbaru melibatkan impon-driven
transporter peptida PEPT1 dan terutama PEPT2 sebagai
rute utama serapan seluler peptida kecil
dan obat-obatan seperti peptida dari filtrat glomerulus
(Inui et al., 2000). Ini transportasi dengan afinitas tinggi
protein tampaknya menunjukkan serapan di- dan
tripeptides, yang berimplikasi pada peran mereka dalam amino ginjal
homeostasis asam (Daniel dan Herget, 1997).
Untuk kedua mekanisme, filtrasi glomerulus adalah
dominan, langkah pembatasan tingkat sebagai penurunan berikutnya
Proses tion tidak jenuh di bawah fisiologis
kondisi (Maack et al., 1985; Colburn, 1991). Karena
untuk pembatasan eliminasi ginjal ini, ginjal
kontribusi terhadap penghapusan protein secara keseluruhan adalah
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
101
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 120
tergantung pada aktivitas proteolitik untuk protein ini
di daerah tubuh lainnya. Jika aktivitas metabolik untuk ini
protein tinggi di daerah tubuh lain, hanya ada
kontribusi ginjal minor terhadap pembersihan total, dan itu
menjadi diabaikan di hadapan yang tidak spesifik
degradasi ke seluruh tubuh. Jika metabolisme
aktivitas rendah di jaringan lain atau jika distribusi ke
ruang ekstravaskuler terbatas, bagaimanapun, ginjal
kontribusi terhadap total clearance dapat mendekati 100%.
Ini misalnya kasus untuk manusia rekombinan
interleukin-10 (rhIL-10), di mana clearance berkorelasi
erat dengan GFR, membuat penyesuaian dosis diperlukan
sary pada pasien dengan gangguan fungsi ginjal
(Andersen et al., 1999).
Mekanisme ketiga metabolisme ginjal adalah
ekstraksi peritubular peptida dan protein dari
kapiler post-glomerulus dengan intracel-
metabolisme lular. Eksperimen menggunakan radio-iodinasi
hormon pertumbuhan ( 125 I-rGH) telah menunjukkan hal itu
sementara reabsorpsi ke dalam vesikel endositik di
tubulus proksimal masih merupakan rute dominan
disposisi, persentase kecil dari hormon mungkin
diekstraksi dari kapiler peritubular (Johnson
dan Maack, 1977; Krogsgaard Thomsen et al., 1994).
Transportasi protein dan peptida peritubular dari
membran basolateral juga telah ditunjukkan untuk
insulin (Nielsen et al., 1987).
Metabolisme Protein Hepatik
Selain dari metabolisme ginjal dan pencernaan, itu
hati juga dapat memainkan peran utama dalam metabolisme
terapi protein. Eksogen dan endogen
protein mengalami degradasi proteolitik menjadi dipeptida
dan asam amino yang digunakan kembali untuk protein endogen
100000
Laju aliran plasma hepatik
rhlL-11
LYZ
IMS
NCS
MERUMPUT
Uricase
IgG
BSA
Tingkat fase cairan endositosis hati
100000
10000
10000
1000
1000
100
100
10
Izin hati (μl / jam)
Laju filtrasi glomerulus
10
Jumlah pembersihan ginjal dan kemih (μl / jam)
Gambar 3 n Kelonggaran protein ginjal dan hati pada tikus.
Singkatan: LYZ, lisozim; IMS, inhibitor trypsin kacang kedelai;
NCS, neocarzinostatin; IgG, imunoglobulin G; BSA, termasuk keluarga sapi
serum albumin; rhIL-11, interleukin-11 manusia rekombinan.
Sumber: Dari Takagi et al., 1995.
Glomerulus
Filtrat
Protein (p)
Lisosom
hal
Reseptor
Non-reseptor
dimediasi
Protein
Protein
Pembuluh peritubular
Asam amino
hal
hal
Proksimal
Pipa kecil
Distal
pipa kecil
Lumen
Peptida linier
Gambar 4 n Jalur metabolisme ginjal peptida dan protein: Filtrasi glomerulus diikuti oleh (a) metabolisme intraluminal
atau (b) reabsorpsi tubular dengan metabolisme lisosomal intraseluler, dan (c) ekstraksi peritubular dengan lisosomal intraseluler
metabolisme. Sumber: Dimodifikasi dari Maack et al., 1985.
102
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 121
perpaduan. Proteolisis biasanya dimulai dengan endopepti-
Dases yang menyerang di bagian tengah protein, dan
oligopeptida yang dihasilkan kemudian terdegradasi lebih lanjut
oleh exopeptidases. Tingkat metabolisme hepatik adalah
sebagian besar tergantung pada urutan asam amino spesifik
protein (Meibohm, 2004).
Prasyarat untuk metabolisme protein hati adalah
penyerapan protein ke dalam hepatosit. Sebuah
ikhtisar dari berbagai mekanisme hati
serapan protein tercantum dalam Tabel 2.
Peptida kecil dapat melintasi anggota hepatosit
brane melalui difusi pasif sederhana jika ada
hidrofobik yang cukup. Peptida dari sifat ini
termasuk siklosporin (peptida siklik) (Ziegler
et al., 1988). Peptida siklik dan linear kecil lainnya
ukuran (<1,4 kDa) dan sifat hidrofobik (mengandung
asam amino aromatik), seperti cholecystokinin-8
(CCK-8; 8 asam amino), diambil oleh
hepatosit oleh transportasi yang dimediasi oleh pembawa (Ziegler
et al., 1988), dalam kasus CCK-8 oleh anion organik
mengangkut polipeptida OATP-8 (SLCO1B3) (Ismair
et al., 2001). Setelah internalisasi ke dalam sitosol,
peptida ini biasanya dimetabolisme oleh mikrosomal
enzim (sitokrom P-450 3A untuk siklosporin A) atau
peptidase sitosolik (CCK-8). Zat yang masuk
hati biasanya melalui transportasi yang dimediasi oleh pembawa
diekskresikan ke dalam empedu oleh pengangkut ekspor aktif.
Jalur pembersihan hati ini identik dengan
yang dikenal dengan hidrofobik organik paling kecil
molekul obat.
Penyerapan peptida dan protein yang lebih besar adalah
difasilitasi melalui berbagai carrier-mediated, energy-
proses transportasi tergantung. Salah satu kemungkinan
Ikatan adalah endositosis yang dimediasi reseptor, seperti untuk
insulin dan faktor pertumbuhan epidermal (Kim et al., 1988;
Sugiyama dan Hanano, 1989; Burwen dan Jones,
1990). Pada endositosis yang dimediasi reseptor, beredar
protein dikenali oleh reseptor hati spesifik
protein (Kompella dan Lee, 1991). Reseptornya adalah
biasanya glikoprotein membran integral dengan
domain pengikat terbuka pada sisi ekstraseluler
membran sel. Setelah pengikatan beredar
protein ke reseptor, kompleks sudah ada
atau bergerak di daerah lubang dilapisi, dan membran
Jenis sel
Mekanisme serapan
Protein / peptida diangkut
Hepatosit
Difusi pasif anionik
Transportasi yang dimediasi oleh operator
Peptida hidrofobik siklik dan linier (<1,4 kDa; mis., Siklosporin,
CCK-8)
RME: Gal / reseptor GalNAc
(reseptor asialoglycoprotein)
Glikoprotein yang diakhiri dengan N-acetylgalactosamine, diakhiri dengan galaktosa
glikoprotein (misalnya, EPO desialylated)
RME: Lipo-protein berkepadatan rendah
reseptor (LDLR)
LDop, lipoprotein yang mengandung apoE dan apoB
RME: protein terkait LDLR
(Reseptor LRP)
a 2 -macroglobulin, lipoprotein apo-E-diperkaya, lipoprotein lipase (LPL),
laktoferin, t-PA, u-PA, kompleks t-PA dan u-PA dengan plasminogen
aktivator inhibitor tipe 1 (PAI-1), TFPI, trombospondin (TSP), TGF-b
dan IL-1b terikat ke 2- macroglobulin
RME: Reseptor lain
IgA, glikoprotein, lipoprotein, dan imunoglobulin usus
peptida pankreas, metallo- dan hemoprotein, transferin, insulin,
glukagon, GH, EGF
Pinositosis nonselektif (non-
dimediasi reseptor)
Albumin, kompleks antigen-antibodi, beberapa protein pankreas, beberapa
glikoprotein
Sel Kupffer
Endositosis
Partikulat dengan kelompok galaktosa
Kupffer dan
endotel
sel
RME
Glikoprotein yang dihentikan IgG, N-acetylgalactosamine
RME: Reseptor Mannose
Glikoprotein yang diakhiri dengan Mannosa (mis. T-PA, renin)
RME: Reseptor fukosa
Glikoprotein yang diakhiri dengan fusi
Sel endotel
RME: Reseptor pemulung
Protein bermuatan negatif
RME: Reseptor lain
VEGF, FGF (?)
Sel penyimpan lemak
RME: Mannose-6-phosphate
reseptor
Protein terminasi Mannose-6-fosfat (misalnya, IGF-II)
Singkatan: RME, endositosis yang dimediasi reseptor.
Sumber: Dari Braeckman, 2000, disusun dari beberapa sumber (lihat referensi dalam teks), termasuk ulasan oleh Cumming (1991), Kompella dan Lee
(1991) dan Marks et al. (1995).
Tabel 2 n Mekanisme pengambilan hati untuk protein dan kompleks protein.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
103
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 122
invaginate dan pinch off untuk membentuk endositosis
vesikel dilapisi yang berisi reseptor dan ligan
(internalisasi). Mantel vesikel terdiri dari protein
(Clathrin, Adaptin, dan lain-lain), yang kemudian
dihapus oleh adenosine triphosphatase yang tidak dilapisi
(ATPase). Bagian vesikel, reseptor, dan
ligan terdisosiasi dan ditargetkan untuk berbagai intracel-
lokasi lular. Beberapa reseptor, seperti
densitas lipoprotein (LDL), asialoglikoprotein dan
reseptor transferrin, diketahui menjalani daur ulang.
Karena kadang-kadang beberapa ratus siklus adalah bagian dari a
seumur hidup reseptor tunggal, reseptor terkait
endositosis yang dimediasi memiliki kapasitas tinggi. Lain
reseptor, seperti reseptor interferon, mengalami
degradasi. Degradasi ini menyebabkan penurunan
konsentrasi reseptor pada permukaan sel
(reseptor down-regulasi). Lainnya, seperti insulin
reseptor, misalnya, menjalani daur ulang dan
degradasi (Kompella dan Lee, 1991).
Untuk glikoprotein, jika sejumlah kritis terpapar
kelompok gula (mannose, galactose, fucose, N-acetyl-
glucosamine, N-acetylgalactosamine, atau glukosa) adalah
melebihi, endositosis dimediasi reseptor melalui
reseptor pengenal gula adalah hati yang efisien
mekanisme pengambilan (Meijer dan Ziegler, 1993).
Reseptor karbohidrat penting dalam hati adalah
reseptor asialoglikoprotein dalam hepatosit dan
reseptor mannose di Kupffer dan endotel hati
sel (Smedsrod dan Einarsson, 1990; Bu et al., 1992).
Glikos manekosa tinggi dalam domain kringle pertama
t-PA, misalnya, telah terlibat di dalamnya
pembersihan hati (Cumming, 1991).
Protein terkait reseptor lipoprotein densitas rendah
(LRP) adalah anggota keluarga reseptor LDL
bertanggung jawab untuk endositosis beberapa lipo- penting
protein, protease, dan kompleks protease-inhibitor di
hati dan jaringan lain (Strickland et al., 1995).
Contoh protein dan kompleks protein untuk itu
serapan hepatic dimediasi oleh LRP tercantum dalam Tabel 2.
Penyerapan protein oleh sel-sel hati diikuti oleh
transportasi ke kompartemen intraseluler untuk meta
bolisme. Protein diinternalisasi ke dalam vesikel melalui
mekanisme endositosis menjalani trans- intraseluler
port menuju kompartemen lisosomal dekat
pusat sel. Di sana, kendaraan endositosis melebur
dengan atau matang menjadi lisosom, yang khusus
vesikel asam yang mengandung berbagai hidro-
Lases mampu mendegradasi semua makromolekul biologis-
kapsul. Proteolisis dimulai oleh endopeptidase
(Terutama cathepsin D) yang bekerja di bagian tengah
protein. Oligopeptida — sebagai hasil dari yang pertama
langkah — selanjutnya didegradasi oleh exopeptidases. Itu
asam amino dan dipeptida yang dihasilkan masuk kembali
kumpulan metabolik sel (Meijer dan Ziegler, 1993).
Metabolisme glikoprotein hepatik dapat terjadi
lebih lambat daripada protein telanjang karena
melindungi rantai oligosakarida perlu dihapus
pertama. Protein dan peptida yang dimetabolisme dalam lisosom
dari hepatosit, sel sinusoidal hati dan Kupffer
sel-sel mungkin dilepaskan ke dalam darah. Terdegradasi
protein dalam lisosom hepatosit juga dapat dihilangkan
ered ke kanalikuli empedu dan diekskresikan oleh
eksositosis.
Jalur intraseluler kedua untuk protein adalah
pesawat ulang-alik langsung atau jalur transcytotic (Kompella
dan Lee, 1991). Vesikel endositosis terbentuk di
permukaan sel melintasi sel ke ruang peribiliary,
di mana ia menyatu dengan membran kanalikuli empedu,
melepaskan isinya dengan eksositosis menjadi empedu. Ini
jalur, dijelaskan untuk imunoglobulin A polimer,
melewati kompartemen lisosom sepenuhnya.
Metabolisme Protein yang Dimediasi Reseptor
Metabolisme yang dimediasi reseptor sering kali penting
jalur eliminasi untuk terapi protein tersebut
yang mengikat dengan afinitas tinggi terhadap membran terkait
reseptor pada permukaan sel. Interaksi
terapi protein dengan reseptor membran
sering merupakan bagian dari efek farmakologis dari
obat, yaitu, reseptor adalah struktur target
terapi protein diarahkan pada. Ini bisa mengikat
menyebabkan serapan yang dimediasi reseptor oleh endositosis dan
metabolisme lisosomal intraseluler berikutnya.
Penyerapan yang dimediasi reseptor dan metabolisme melalui inter-
tindakan dengan ini umumnya afinitas tinggi, kapasitas rendah
situs pengikatan tidak terbatas pada organ atau jaringan tertentu
mengetik. Dengan demikian, jaringan pun termasuk terapeutik
sel target yang mengekspresikan reseptor untuk obat bisa
berkontribusi pada penghapusan terapi protein
tic (Meibohm dan Derendorf, 2003).
Karena jumlah reseptor obat protein adalah
metabolisme protein terbatas yang dimediasi reseptor
biasanya jenuh dalam konsentrasi terapi
atau lebih khusus pada molar yang relatif rendah
rasio antara obat protein dan reseptor. Sebagai
Konsekuensinya, penghapusan izin ini
obat protein tidak konstan tetapi tergantung dosis,
dan menurun dengan meningkatnya dosis. Dengan demikian, reseptor
eliminasi yang dimediasi merupakan sumber utama untuk
perilaku farmakokinetik nonlinear banyak
obat peptida dan protein, yaitu paparan sistemik terhadap
obat meningkat lebih dari sebanding dengan
peningkatan dosis (Tang et al., 2004).
M-CSF manusia rekombinan, misalnya,
dergo selain eliminasi ginjal linier nonlinier
jalur eliminasi yang mengikuti Michaelis-Menten
kinetika dan terkait dengan serapan yang dimediasi reseptor
ke dalam makrofag. Pada konsentrasi rendah, M-CSF
mengikuti farmakokinetik linier, sedangkan pada suhu tinggi
centations jalur eliminasi nonrenal adalah satu-
dinilai menghasilkan perilaku farmakokinetik nonlinear
(Gbr. 5) (Bartocci et al., 1987; Bauer et al., 1994).
104
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 123
n Disposisi Obat Mediasi Sasaran
Banyak terapi protein dicirikan oleh
disposisi obat yang dimediasi target, yang terjadi ketika
mengikat struktur target farmakodinamik
mempengaruhi farmakokinetik suatu senyawa obat
dan hasil dalam kapasitas, proses jenuh terbatas
(Levy, 1994). Konsekuensi dari jenuh ini
proses yang disebabkan oleh terbatasnya ketersediaan
enzim, reseptor atau struktur protein lainnya
obat berinteraksi, adalah farmakokinetik nonlinear
perilaku, yaitu, konsentrasi plasma berubah
sebagian dengan meningkatnya dosis (Mager, 2006).
Untuk obat molekul kecil konvensional, reseptor
mengikat biasanya diabaikan dibandingkan dengan total
jumlah obat dalam tubuh dan jarang mempengaruhi mereka
profil farmakokinetik. Sebaliknya, yang substansial
sebagian kecil dari terapi protein dapat terikat pada mereka
struktur target farmakologis, misalnya
untuk. Disposisi obat yang dimediasi target dapat mempengaruhi
distribusi serta proses eliminasi. Paling
khususnya, metabolisme protein yang dimediasi reseptor adalah a
jalur eliminasi sering ditemui untuk
banyak terapi protein yang sering jenuh
rejimen dosis yang digunakan secara terapi (lihat sebelumnya
bagian) (Meibohm, 2004).
Nonlinier dalam farmakokinetik berdasarkan
disposisi obat yang dimediasi oleh target misalnya
telah diamati untuk beberapa antibodi monoklonal
terapi, misalnya untuk anti-HER2 yang dimanusiakan
antibodi monoklonal trastuzumab. Trastuzumab adalah
disetujui untuk pengobatan kombinasi HER2
protein yang mengekspres kanker payudara metastatik. Dengan
meningkatkan tingkat dosis, waktu paruh trastuzu rata-rata
mab meningkat dan clearance berkurang, mengarah ke
peningkatan eksposur sistemik yang berlebihan
peningkatan dosis (Tokuda et al., 1999). Sejak trastuzu-
mab secara cepat diinternalisasi melalui reseptor-mediated
endositosis setelah mengikat HER2, struktur targetnya
pada permukaan sel, saturasi eliminasi ini
jalur adalah kemungkinan penyebab untuk dosis yang diamati-
farmakokinetik dependen (Kobayashi et al., 2002).
n Imunogenisitas dan Farmakokinetik Protein
Potensi antigenik terapi protein mungkin
menyebabkan pembentukan antibodi terhadap protein
terapi selama terapi kronis. Ini khususnya
menjadi perhatian jika protein yang berasal dari hewan diterapkan
studi klinis manusia, tetapi juga jika protein manusia
digunakan dalam penelitian hewan. Bab 6 membahas secara rinci
fenomena imunogenisitas dan konsekuensinya
quences untuk farmakoterapi dengan protein
terapi.
Kompleksasi protein-antibodi tidak hanya bisa
memodulasi atau bahkan melenyapkan aktivitas biologis
obat protein, tetapi juga dapat memodifikasi farmakokasinya
profil asli. Penghapusan izin obat protein,
misalnya, dapat ditingkatkan atau diturunkan
pembentukan dan pengikatan antibodi (Gbr. 6). Peningkatan
dalam pembersihan diamati jika protein-antibodi
kompleks dihilangkan lebih cepat daripada yang tidak terikat
protein (Rosenblum et al., 1985). Peningkatan ini mungkin
terjadi ketika kadar tinggi protein-antibodi
kompleks merangsang pembersihannya oleh reticuloen-
sistem dothelial. Dalam situasi lain, serum
konsentrasi protein dapat ditingkatkan jika mengikat
untuk antibodi memperlambat laju pembersihannya
karena kompleks protein-antibodi dihilangkan
lebih lambat dari protein yang tidak terikat (Bekerja dan
Cossum, 1991). Dalam hal ini, kompleks dapat bertindak sebagai a
depot untuk protein dan, jika antibodi tidak
menetralkan, durasi farmakologis yang lebih lama
10 6
10 5
10 4
10 3
10 2
10 1
0246
0,1 mg / kg
1 mg / kg
10 mg / kg
8 10 12 14
Waktu
Bioaktivitas plasma (ng / mL)
16 18 20 22 24 26
Gambar 5 n Farmakokinetik non-linear M-CSF, disajikan
seperti yang diukur (segitiga dan lingkaran; mean - SE) dan dimodelkan
kurva bioaktivitas-waktu plasma (jalur) setelah injeksi IV 0,1 mg /
kg (n = 5), 1,0 mg / kg (n = 3) dan 10 mg / kg (n = 8) pada tikus.
Bioaktivitas digunakan sebagai pengganti konsentrasi. Sumber:
Dari Bauer et al., 1994.
Aktivitas
Aktivitas
Imunogenik
tanggapan
Netralisasi
antibodi
Protein-Ab
kompleks
CL
CL
Gambar 6 n Pengaruh pembentukan antibodi pada farmakokinetik
dan farmakodinamik dari obat protein.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
105
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 124
tindakan dapat terjadi. Misalnya, izin
rIFNa2a pada pasien kanker meningkat karena
respons antibodi. Sebaliknya, leukosit manusia
Konsentrasi IFNb pada tikus menurun 15 kali lipat
ketika beredar antibodi hadir. Penurunan
pembersihan di hadapan titer antibodi juga
terdeteksi untuk t-PA pada anjing (Bekerja, 1992).
Baik clearance meningkat dan menurun
mungkin untuk protein yang sama, tergantung pada dosisnya
level dikelola. Pada dosis rendah, protein-antibodi
kompleks menunda izin karena eliminasi mereka
lebih lambat dari protein yang tidak terikat. Sebaliknya,
pada dosis tinggi, kadar protein-antibodi lebih tinggi
hasil kompleks dalam pembentukan agregat, yang
dibersihkan lebih cepat daripada protein yang tidak terikat.
Peningkatan clearance sitokin
interleukin-6 (IL-6) melalui pemberian koktail
tiga antibodi monoklonal anti-IL-6 disarankan sebagai
pendekatan terapeutik pada penyakit yang bergantung pada sitokin
seperti multiple myeloma, lymphoma B-cell, dan rheuma-
arthritis toid (Montero-Julian et al., 1995). Penulis
bisa menunjukkan itu, sementara mengikat satu atau dua
antibodi terhadap sitokin menyebabkan stabilisasi
sitokin, pengikatan simultan dari tiga anti-IL-6 anti-
tubuh ke tiga epitop berbeda diinduksi penyerapan cepat
kompleks oleh hati dan dimediasi dengan cepat
eliminasi IL-6 dari kompartemen pusat.
Imunogenisitas terapi protein adalah
juga tergantung pada rute administrasi.
Injeksi ekstravaskular dikenal untuk merangsang
pembentukan tubuh lebih dari aplikasi IV, yaitu
kemungkinan besar disebabkan oleh peningkatan imunogenisitas
agregat dan endapan protein yang terbentuk di
tempat injeksi (lihat Bab 6).
n Spesifisitas Spesies dan Penskalaan Alometrik
Peptida dan protein sering menunjukkan spesies yang berbeda
kekhususan berkenaan dengan struktur dan aktivitas.
Peptida dan protein dengan fisiologis identik
mungkin memiliki urutan asam amino yang berbeda di
spesies yang berbeda dan mungkin tidak memiliki aktivitas atau genap
imunogenik jika digunakan pada spesies yang berbeda. Luasnya
glikosilasi dan / atau sialilasi protein
molekul adalah faktor lain dari perbedaan spesies, misalnya,
untuk interferon-a atau erythropoietin, yang mungkin tidak hanya
ubah kemanjuran dan imunogenisitasnya (lihat Bab 6)
tetapi juga pembersihan obat. Ini khususnya
Penting jika produksi protein manusia
dilakukan dengan menggunakan sel bakteri (lihat Bab 3).
Allometry adalah metodologi yang digunakan untuk berhubungan
morfologi dan fungsi tubuh dengan ukuran
organisme. Penskalaan alometrik adalah teknik empiris.
que fungsi prediksi tubuh berdasarkan ukuran tubuh.
Scaling alometrik telah menemukan aplikasi luas dalam obat
pengembangan, terutama untuk memprediksi farmakokinetik
parameter pada manusia berdasarkan yang sesuai
parameter dalam beberapa spesies hewan dan tubuh
perbedaan ukuran antara spesies ini dan manusia.
Berbagai pendekatan penskalaan alometrik telah dilakukan
dijelaskan dengan tingkat keberhasilan variabel, terutama
selama transisi dari obat praklinis ke klinis
pengembangan (Dedrick, 1973; Boxenbaum, 1982;
Mahmood dan Balian, 1999; Mahmood, 2002). Dalam
pendekatan yang paling sering digunakan, farmakokinetik
parameter antara berbagai spesies terkait melalui
berat badan menggunakan fungsi daya:
P=a4Wb
di mana P adalah parameter farmakokinetik yang diskalakan, W adalah
berat badan dalam kg, a adalah koefisien alometrik,
dan b adalah eksponen alometrik. a dan b bersifat spesifik
konstanta untuk setiap parameter senyawa. Umum
kecenderungan untuk eksponen alometrik adalah 0,75 untuk laju
konstanta (yaitu, clearance, konstanta laju eliminasi), 1
untuk volume distribusi, dan 0,25 untuk waktu paruh.
Untuk sebagian besar obat molekul kecil tradisional,
penskalaan alometrik sering tidak tepat, terutama jika
metabolisme hati adalah jalur eliminasi utama
dan / atau jika ada perbedaan antarspesies di
metabolisme. Namun, untuk peptida dan protein,
penskalaan alometrik sering terbukti banyak
lebih tepat dan andal, mungkin karena
kesamaan dalam menangani peptida dan protein di antaranya
spesies mamalia yang berbeda (Wills dan Ferraiolo,
1992). Izin dan volume distribusi
banyak protein yang digunakan secara terapi seperti pertumbuhan
hormon atau t-PA mengikuti, berat badan
hubungan fisiologis tergantung antara lab
hewan dan manusia. Ini memungkinkan relatif tepat
prediksi kuantitatif untuk farmakokinetik mereka
perilaku pada manusia berdasarkan temuan praklinis
(Mordenti et al., 1991).
Gambar 7, misalnya, menunjukkan plot alometrik untuk
clearance dan volume distribusi P-selectin
antagonis, P-selectin glikoprotein ligan-1 (rPSGL-Ig),
untuk pengobatan penyakit yang dimediasi P-selectin seperti
trombosis, cedera reperfusi, dan trombo vena dalam
sis. Parameter farmakokinetik manusia protein
secara akurat dapat diprediksi menggunakan kekuatan alometrik
fungsi berdasarkan data dari empat spesies, tikus, tikus,
monyet dan babi (Khor et al., 2000).
Perlu ditekankan bahwa penskalaan allometrik
teknik adalah alat yang berguna untuk memprediksi dosis itu
akan membantu dalam perencanaan studi rentang dosis,
termasuk studi orang pertama, tetapi bukan pengganti
untuk studi semacam itu. Keuntungan termasuk
prediksi dosis seperti itu dalam desain protokol dosis-
mulai studi adalah bahwa jumlah dosis yang dibutuhkan lebih sedikit
harus diuji sebelum menemukan tingkat dosis akhir.
Prediksi dosis antarspesies cukup mempersempit kisaran
dosis dalam kemanjuran farmakologis awal
106
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 125
studi, studi toksikologi hewan, dan manusia
studi keamanan dan kemanjuran.
n Kimia
Modifikasi untuk Mengoptimalkan
Farmakokinetik Terapi Protein
Dalam beberapa tahun terakhir, pendekatan memodifikasi molekul
struktur terapi protein telah berulang kali
diterapkan untuk mempengaruhi imunogenisitas, pharmacoki-
netik, dan / atau farmakodinamik dari obat protein.
Pendekatan-pendekatan ini termasuk penambahan, penghapusan atau
pertukaran asam amino yang dipilih dalam protein
urutan, sintesis protein terpotong dengan a
mengurangi urutan asam amino, glikosilasi atau degly-
kosilasi, dan hubungan kovalen dengan polimer
(Veronese dan Caliceti, 2006). Pendekatan yang terakhir
telah digunakan untuk beberapa terapi protein oleh
menghubungkannya dengan monometoksi polietilen glikol
(PEG) molekul dari berbagai panjang rantai dalam suatu proses
disebut PEGylation (Caliceti dan Veronese, 2003).
Konjugasi massa polimer tinggi ke
obat protein umumnya bertujuan untuk mencegah
protein dari yang diakui oleh kekebalan tubuh
sistem serta mengurangi eliminasi melalui
filtrasi glomerulus atau enzim proteolitik, dengan demikian
memperpanjang eliminasi yang relatif singkat
paruh protein endogen. Konjugasi
obat protein dengan rantai PEG meningkatkan
berat molekul, tetapi karena daya tarik
molekul air oleh PEG bahkan lebih banyak hydro- mereka
volume dinamis, yang pada gilirannya menghasilkan pengurangan
pembersihan ginjal dan volume distribusi yang terbatas.
PEGilasi juga dapat melindungi penentu antigenik
obat protein dari deteksi oleh kekebalan tubuh
sistem melalui rintangan sterik (Walsh et al., 2003).
Demikian pula, urutan asam amino sensitif terhadap
degradasi proteolitik dapat dilindungi
serangan protease. Dengan menambahkan besar, hidrofilik
molekul ke protein, PEGilasi juga dapat meningkat
kelarutan obat (Molineux, 2003).
PEGylation telah digunakan untuk meningkatkan
sifat terapi berbagai terapi protein
termasuk interferon-a, asparaginase, dan filgras-
tim. Lebih detail tentang konsep umum
PEGilasi dan aplikasi spesifiknya untuk protein
terapi dapat ditemukan di Bab 11.
Aplikasi terapi L-asparaginase di
pengobatan leukemia limfoblastik akut memiliki
telah terhambat oleh imunogenisitas yang kuat dengan
reaksi alergi terjadi pada 33% hingga 75% dari yang diobati
pasien dalam berbagai penelitian. Pengembangan dari
pegaspargase, bentuk L-asparaginase PEGylated,
adalah contoh sukses untuk mengatasi tingkat tinggi ini
reaksi alergi terhadap L-asparaginase menggunakan PEG
teknik konjugasi (Graham, 2003). Pegaspargase
ditoleransi dengan baik dibandingkan dengan L-asparaginase, dengan 3%
hingga 10% dari pasien yang dirawat mengalami klinis
reaksi alergi.
Pegfilgrastim adalah versi PEGylated dari
faktor penstimulasi granulosit-koloni filgrastim,
yang dikelola untuk pengelolaan
neutropenia yang diinduksi oleh motherapy. PEGilasi mini-
mizes pembersihan ginjal filgrastim oleh glomerular
filtrasi, dengan demikian membuat neutrofil-mediated clear-
Selain itu rute utama eliminasi. Demikian,
PEGilasi hasil filgrastim dalam apa yang disebut "mandiri
mengatur farmakokinetik ”sejak pegfilgrastim miliki
pengurangan izin dan dengan demikian memperpanjang paruh dan
durasi aksi yang lebih berkelanjutan dalam neutropenia
dibandingkan dengan pasien normal karena hanya sedikit
neutrofil dewasa tersedia untuk memediasinya
eliminasi (Zamboni, 2003).
Faktor pertumbuhan hematopoietik darbepoetin-a
adalah contoh endogen yang dimodifikasi secara kimia
protein dengan pola glikosilasi yang diubah. Ini adalah sebuah
10.000
10000.0
1000.0
100.0
10.0
1.0
1.000
0,100
0,010
Jarak bebas (mL / jam)
Vss (mL)
0,001
Mouse
Mouse
Tikus
Tikus
Monyet (3,7 kg)
Monyet (3,7 kg)
Monyet (6,3 kg)
Monyet (6,3 kg)
Babi
Babi
y = 0,3684 x 0,9305
y = 95,712 x 1,0838
r 2 = 0,9444
R 2 = 0,988
0,01
0,10
1,00
Berat (kg)
Berat (kg)
10.00
100.00
0,01
0,10
1,00
10.00
100.00
Gambar 7 n Plot alometrik dari parameter farmakokinetik pembersihan dan volume distribusi pada kondisi tunak ( Vss ) untuk
Antagonis P-selectin P-selectin glikoprotein ligan-1 (rPSGL-Ig). Setiap titik data dalam plot mewakili nilai rata-rata
parameter farmakokinetik masing-masing dalam satu dari lima spesies: tikus, tikus, monyet (3,7 kg), monyet (6,3 kg), dan babi, masing-masing.
Garis padat adalah yang paling cocok dengan fungsi daya untuk menghubungkan parameter farmakokinetik dengan berat badan. Sumber: Dari Khor et al.,
2000.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
107
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 126
analog glikosilasi erythropoietin manusia, dengan
dua rantai oligosakarida tambahan yang terhubung N (lima
total) (Mold et al., 1999). N- tambahan
situs glikosilasi dibuat tersedia melalui
substitusi dari lima residu asam amino dalam peptida
tulang punggung erythropoietin, dengan demikian meningkatkan
berat molekul dari 30 hingga 37 kDa. Darbepoetin-a
memiliki profil farmakokinetik yang dimodifikasi secara substansial
dibandingkan dengan erythropoietin, menghasilkan tiga kali lipat
waktu paruh serum yang lebih lama yang memungkinkan pengurangan dosis
frekuensi (Gbr. 8) (Macdougall et al., 1999). Lebih
rincian tentang faktor pertumbuhan hematopoietik, termasuk
erythropoietin dan darbepoetin-a, disediakan di
Bab 10
PHARMACODYNAMICS OF THERAPEUTICS PROTEIN
Terapi protein biasanya sangat ampuh.
pound dengan kurva efek dosis yang curam sebagaimana adanya
terapi bertarget menuju spesifik, dijelaskan dengan baik
struktur atau mekanisme farmakologis. Dengan demikian,
karakterisasi penuh dari hubungan konsentrasi-efek
ikatan, yaitu farmakodinamik, khususnya
diinginkan untuk terapi protein (Tabrizi dan Roskos,
2006). Kombinasi farmakodinamik dengan phar-
makokinetik oleh farmakokinetik-farma terintegrasi
pemodelan codynamic (pemodelan PK / PD) menambahkan
tingkat kerumitan tambahan yang memungkinkan lebih jauh
karakterisasi hubungan dosis-paparan-respons
obat dan deskripsi terus menerus dari
waktu tentu saja intensitas efek yang dihasilkan langsung dari
pemberian rejimen dosis tertentu (Gbr. 9)
(Meibohm dan Derendorf, 1997; Derendorf dan
Meibohm, 1999).
Pemodelan PK / PD adalah teknik yang menggabungkan
dua disiplin farmakologis klasik pharmacoki-
netik dan farmakodinamik. Ini mengintegrasikan sebuah
komponen model kokinetik dan farmakodinamik
menjadi satu set ekspresi matematika yang memungkinkan
deskripsi arah waktu efek intensitas dalam
respon terhadap pemberian dosis obat. Ini yang disebut
model PK / PD terpadu memungkinkan mendapatkan farmakoksi
parameter model asli dan farmakodinamik itu
mencirikan hubungan dosis-konsentrasi-efek
untuk obat tertentu berdasarkan konsentrasi yang diukur
dan efek data. Selain itu, memungkinkan simulasi
waktu kursus intensitas efek untuk rejimen dosis a
obat di luar data yang sebenarnya diukur, dalam
kendala validitas asumsi model
untuk kondisi simulasi. Penambahan statistik
komponen model yang menggambarkan inter- dan intraindividual
variasi dalam parameter model memungkinkan ekspansi
Model PK / PD untuk menggambarkan program waktu efek
Intensitas tidak hanya untuk subjek individu, tetapi juga untuk
seluruh populasi subyek.
Memiliki pendekatan pemodelan PK / PD terintegrasi
banyak diterapkan untuk karakterisasi protein
terapi (Tabrizi dan Roskos, 2006). Tertanam dalam a
pendekatan pengembangan obat berbasis model, pemodelan
dan simulasi berdasarkan PK / PD terintegrasi tidak
hanya menyediakan ringkasan komprehensif dari
data yang mampu, tetapi juga memungkinkan untuk menguji hipotesis yang bersaing
10
1
IV darbepoetin-  (n = 11)
IV r-HuEPO (n = 10)
0,1
0,01
0
12
24
36
Waktu setelah injeksi (jam)
Baseline-dikoreksi
konsentrasi serum (ng / ml)
48
60
72
84
96
Gambar 8 n Pengaruh glikosilasi pada farmakokinetik erythropoietin: Perbandingan rata-rata (-SD) profil waktu konsentrasi
darbepoetin-a (0,5 mg / kg, n = 11) dan erythropoietin manusia rekombinan (100 U / kg, n = 10) setelah pemberian IV pada pasien dengan
penyakit ginjal endstage. Darbepoetin-a adalah turunan dari erythropoietin dengan pola glikosilasi yang dimodifikasi. Konsentrasi serum adalah
dikoreksi untuk konsentrasi erythropoietin endogen. Sumber: Dari Macdougall et al., 1999.
108
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 127
tentang proses yang diubah oleh obat, memungkinkan pembuatan
prediksi efek obat dalam kondisi baru, dan
memfasilitasi untuk memperkirakan variabel sistem yang tidak dapat diakses
(Meibohm dan Derendorf, 1997; Mager et al., 2003).
Apresiasi model PK / PD berbasis mekanisme
ing peristiwa fisiologis yang terlibat dalam penjabaran
tion dari efek yang diamati telah dipromosikan sebagai
pendekatan pemodelan unggul dibandingkan dengan empiris-
pemodelan kal, terutama karena itu tidak hanya
menggambarkan pengamatan tetapi juga menawarkan beberapa wawasan
proses biologis yang mendasarinya terlibat dan dengan demikian
memberikan fleksibilitas dalam mengekstrapolasi model kepada yang lain
situasi klinis (Levy, 1994; Derendorf dan
Meibohm, 1999). Karena mekanisme molekuler
aksi terapi protein umumnya baik
dipahami, seringkali mudah untuk berubah
pengetahuan yang tersedia ini menjadi berbasis mekanisme
Pendekatan pemodelan PK / PD yang sesuai karakteristik
menunjukkan proses fisiologis nyata yang mengarah ke
efek terapi obat.
Hubungan antara paparan dan respons
mungkin sederhana atau kompleks, dan dengan demikian jelas atau
tersembunyi. Namun, jika tidak ada hubungan sederhana yang jelas,
akan menyesatkan untuk menyimpulkan apriori bahwa tidak
hubungan ada sama sekali bukan itu tidak
mudah terlihat (Levy, 1986).
Penerapan pemodelan PK / PD bermanfaat
dalam semua fase pengembangan obat praklinis dan klinis
dan telah disahkan oleh farmasi
industri, akademisi dan badan pengatur (Peck
et al., 1994; Breimer dan Danhof, 1997; Machado et al.,
1999; Lesko et al., 2000; Sheiner dan Steimer, 2000;
Meibohm dan Derendorf, 2002), yang terbaru oleh
Inisiatif Jalur Kritis dari Makanan dan Obat AS
Administrasi (Lesko, 2007). Dengan demikian, konsep PK / PD
dan pengembangan obat berbasis model memainkan peran penting
peran terutama dalam proses pengembangan obat untuk
biologi, dan dukungan aplikasi mereka yang luas
yang didorong secara ilmiah, berbasis bukti, dan fokus
pengembangan produk untuk terapi protein.
Sementara berbagai pendekatan pemodelan PK / PD
telah dipekerjakan untuk bidang biologi, kami akan di
mengikuti fokus pada lima kelas pendekatan untuk
menggambarkan tantangan dan kompleksitas, tetapi juga
peluang untuk menandai farmakodinamik
terapi protein:

Tautan langsung model PK / PD

Tautan tidak langsung model PK / PD

Respons tidak langsung model PK / PD

Model umur sel

Model respons yang kompleks
Conc.
Waktu
PK / PD
Waktu
Efek
Conc. (log)
Efek
Farmakokinetik
Dosis Conc. vs. waktu
Dosis Efek vs waktu
Farmakodinamik
Conc. Efek
Gambar 9 n Konsep umum pemodelan PK / PD. Pemodelan PK / PD menggabungkan komponen model farmakokinetik yang menjelaskan
kursus waktu obat dalam plasma dan komponen model farmakodinamik yang menghubungkan konsentrasi plasma dengan efek obat di
untuk menggambarkan perjalanan waktu dari intensitas efek yang dihasilkan dari pemberian rejimen dosis tertentu. Sumber: Dari
Derendorf dan Meibohm, 1999.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
109
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 128
Namun harus disebutkan bahwa PK / PD
model untuk terapi protein tidak hanya terbatas
untuk tanggapan berkelanjutan seperti yang ditunjukkan di bawah ini,
tetapi juga digunakan untuk respons biner atau bertingkat.
Respons biner adalah respons dengan hanya dua
tingkat hasil di mana suatu kondisi hadir
atau ketidakhadiran, misalnya, mati versus hidup. Bertingkat
atau tanggapan kategoris memiliki seperangkat yang telah ditetapkan
tingkat hasil, yang mungkin dipesan atau tidak,
misalnya kategori "ringan," "sedang," dan
"Berat" untuk kondisi penyakit. Lee et al. (2003), untuk
contoh, menggunakan pendekatan pemodelan logistik PK / PD
untuk menghubungkan AUC kumulatif dari protein anti-TNF-a
etanercept dengan respons biner, orang Amerika
Kriteria respons College of Rheumatology sebesar 20%
perbaikan (ARC20) pada pasien dengan reumatoid
radang sendi.
n Tautan Langsung Model PK / PD
Konsentrasi terapi protein biasanya
hanya diukur dalam plasma, serum, atau darah, sementara
besarnya respon yang diamati adalah
ditambang oleh konsentrasi obat protein pada
situs efeknya, situs aksi di jaringan target
(Meibohm dan Derendorf, 1997). Konsentrasi situs efek
trations, bagaimanapun, biasanya tidak dapat diakses
pengukuran, dan konsentrasi plasma, serum atau darah
trasi biasanya digunakan sebagai penggantinya. Itu
hubungan antara konsentrasi obat di
plasma dan di situs efek mungkin konstan
atau mengalami perubahan tergantung waktu. Jika keseimbangan
antara kedua konsentrasi cepat tercapai atau
tempat aksi berada dalam plasma, serum atau darah,
praktis ada hubungan yang konstan antara
keduanya konsentrasi tanpa penundaan waktu antara
plasma dan efek situs. Dalam hal ini, diukur
konsentrasi plasma dapat langsung berfungsi sebagai input
untuk model farmakodinamik (Gbr. 10). Yang paling
model farmakodinamik tautan langsung yang sering digunakan
adalah model sigmoid E max :
E=
E maks 4 C n
EC n
50 + C n
dengan E max sebagai efek maksimum yang dapat dicapai, C sebagai obat
konsentrasi dalam plasma, dan EC 50 konsentrasi
dari obat yang menghasilkan setengah dari maksimum
efek. Koefisien Hill n adalah faktor bentuk itu
memungkinkan peningkatan hubungan dengan
data yang diamati. Seperti yang diwakili oleh persamaan untuk
model sigmoid E max , model tautan langsung secara langsung
menghubungkan konsentrasi yang diukur dengan yang diamati
efek tanpa penundaan waktu (Derendorf dan
Meibohm, 1999).
Model tautan langsung, misalnya, digunakan untuk
menghubungkan konsentrasi serum anti-manusia
antibodi imunoglobulin E (IgE) CGP 51901 untuk
pengobatan rhinitis alergi musiman untuk pengurangan
IgE gratis melalui model E max penghambatan (Gbr. 11)
(Racine-Poon et al., 1997). Perlu dicatat bahwa
konsentrasi dan efek puncak dan palung adalah
terkait langsung dan dengan demikian terjadi pada waktu yang sama,
masing-masing, tanpa penundaan waktu. Begitu pula yang langsung
model link digunakan untuk menghubungkan efek dari rekombi-
nant interleukin-10 (IL-10) pada rilis ex vivo dari
sitokin proinflamasi TNF-a dan interleu-
kin-1b dalam leukosit yang distimulasi LPS (Radwanski
et al., 1998). Dalam kasus pertama, situs aksi dan
situs pengambilan sampel untuk pengukuran konsentrasi
terapi protein identik, yaitu dalam plasma,
dan model tautan langsung secara mekanis baik
dibenarkan. Dalam kasus kedua, efeknya tergantung
pada konsentrasi IL-10 pada permukaan sel
leukosit tempat IL-10 berinteraksi dengan targetnya
reseptor. Sekali lagi sampel cairan dan efek situs
dalam kesetimbangan instan.
n Tautan Tidak Langsung Model PK / PD
Hubungan konsentrasi-efek banyak protein
obat-obatan, bagaimanapun, tidak dapat dijelaskan dengan hubungan langsung
Model PK / PD, tetapi ditandai oleh temporal
Efek
(E)
C2, V2
C1, V1
CL
D
Q
Sigmoid E max -model
E max , EC 50 , n
Farmakokinetik
Farmakodinamik
Gambar 10 n Skema model link langsung PK / PD khas.
Model PK adalah model dua kompartemen khas dengan linier
izin eliminasi dari kompartemen pusat (CL) dan a
izin distribusi (Q). C 1 dan C 2 adalah konsentrasi dalam
kompartemen pusat dan periferal, dan V 1 dan V 2 adalah
volume distribusi masing-masing. Efeknya (E) secara langsung
terkait dengan konsentrasi di kompartemen pusat C 1 melalui a
model sigmoid E max . Hubungan sigmoid E max adalah karakter-
ized oleh parameter farmakodinamik Emax , maksimum
efek yang dapat dicapai, EC 50 , konsentrasi obat itu
menghasilkan setengah dari efek maksimum, dan koefisien Hill n sebagai
melalui persamaan E max sigmoid (lihat teks).
110
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 129
disosiasi antara program waktu plasma
konsentrasi dan efek. Dalam hal ini, konsentrasi plasma
trasi maxima terjadi sebelum efek maxima, efek
Intensitas dapat meningkat meskipun plasma menurun
konsentrasi dan dapat bertahan melebihi waktu obat
konsentrasi dalam plasma tidak lagi terdeteksi. Itu
hubungan antara konsentrasi yang diukur dan
efek yang diamati mengikuti histeresis berlawanan arah jarum jam
lingkaran. Fenomena ini dapat disebabkan oleh suatu
mekanisme tanggapan tidak langsung (lihat bagian selanjutnya) atau oleh a
keterlambatan distribusi antara konsentrasi obat
dalam plasma dan di situs efek.
Yang terakhir dapat secara konseptual dijelaskan oleh
model tautan tidak langsung, yang melampirkan hipotesis
kompartemen efek ke kompartemen farmakokinetik
model ment (Gbr. 12). Kompartemen efek
Selain model farmakokinetik tidak
akun untuk keseimbangan massa, yaitu, tidak ada transfer massal yang sebenarnya
diimplementasikan dalam bagian farmakokinetik
Model PK / PD. Alih-alih, transfer obat sehubungan dengan
kompartemen efek ditentukan oleh kursus waktu
dari efek itu sendiri (Sheiner et al., 1979; Holford dan
Sheiner, 1982). Pendekatan kompartemen efek,
Namun, diperlukan, karena situs efek dapat
dipandang sebagai bagian kecil dari farmakokinetik
kompartemen yang dari sudut farmakokinetik
tampilan tidak dapat dibedakan dari jaringan lain
dalam kompartemen itu. Konsentrasi dalam
kompartemen efek mewakili hubungan obat aktif
konsentrasi di situs efek yang perlahan-lahan seimbang
dengan plasma, dan biasanya terkait dengan
efek melalui model E max .
Meskipun model PK / PD ini dibangun dengan
distribusi jaringan sebagai alasan keterlambatan
efek, izin distribusi ke kompartemen efek
ment dapat diartikan berbeda, termasuk yang lain
alasan keterlambatan, seperti proses transduksi dan
peristiwa pasca reseptor sekunder.
Efek hipoglikemik insulin telah terjadi
dimodelkan oleh tipe PK / PD model ini (Hooper, 1991;
Woodworth et al., 1994). Gambar 13 menunjukkan rata-rata
100000
0
10
20
30
40
Pengurangan lgE gratis (%)
50
60
70
80
90
100
10000
1000
100
0
10
20
30
40
Beberapa hari setelah dosis pertama
50
60
70
80
90
CGP 51901 (ng / mL)
Gambar 11 n Mengamati () dan model memperkirakan () konsentrasi serum antibodi IgE anti-manusia CGP 51901 dan diamati
() dan model memperkirakan () pengurangan IgE gratis pada satu pasien yang representatif, diberikan enam dosis IV 60 mg setiap dua minggu. Prediksinya
dimodelkan dengan model PK / PD tautan langsung. Sumber: Dimodifikasi dari Racine-Poon et al., 1997.
Efek
(E)
C2,V2
C1,V1
CL
D
Q
E max- model
E maks , EC 50
Ce,V1
Kompartemen efek
CL 1e
CL e0
Farmakokinetik
Farmakodinamik
Gambar 12 n Skema dari model PK / PD tautan tidak langsung tipikal.
Kompartemen efek hipotetis terkait dengan pusat
kompartemen model farmakokinetik dua kompartemen.
Konsentrasi dalam kompartemen efek (C e ) mendorong
intensitas efek farmakodinamik (E) melalui E max -
hubungan. CL 1e adalah izin transfer dari pusat ke
kompartemen efek, CL e0 izin keseimbangan untuk
kompartemen efek. Semua parameter PK dan PD lainnya adalah
identik dengan yang digunakan pada Gambar. 10.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
111
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 130
profil konsentrasi serum insulin setelah SC tunggal
injeksi 10 U dalam 10 relawan, dan korespondensi-
Efek diukur sebagai laju infus glukosa
mempertahankan keadaan euglikemik. Gambar 14 menunjukkan
histeresis dalam hubungan konsentrasi-efek,
dan bagaimana efek konsentrasi sigmoidal yang khas
kurva diperoleh dengan konsekuensi efek hipotetis.
konsentrasi menggunakan farmakokinetik satu kompartemen
model dengan tautan tidak langsung (Woodworth et al., 1994).
n Respon Tidak Langsung Model PK / PD
Efek dari kebanyakan terapi protein adalah
tidak dimediasi melalui interaksi langsung antara obat
konsentrasi di situs efek dan sistem respons,
tetapi sering melibatkan beberapa proses transduksi
itu termasuk pada langkah mereka membatasi stimulasi
atau penghambatan proses fisiologis, misalnya
sintesis atau degradasi respons molekuler
mediator seperti hormon atau sitokin. Dalam kasus-kasus ini,
program waktu konsentrasi dan efek plasma
juga dipisahkan sehingga berlawanan arah jarum jam
histeresis untuk hubungan konsentrasi-efek,
tetapi penyebab yang mendasarinya bukanlah keterlambatan distribusi
adapun model tautan tidak langsung, tetapi memakan waktu
mekanisme respon tidak langsung (Meibohm dan
Derendorf, 1997).
Model tanggapan tidak langsung umumnya menggambarkan
berpengaruh pada parameter respons representatif via
keseimbangan dinamis antara peningkatan atau sintesis
dan penurunan atau penurunan respons, dengan
yang pertama adalah urutan nol dan yang terakhir urutan pertama
proses (Gbr. 15). Respons itu sendiri dapat dimodulasi
dalam salah satu dari empat varian dasar model. Di setiap
varian, proses sintesis atau degradasi
responsnya dirangsang atau dihambat sebagai suatu fungsi
konsentrasi situs efek. Stimulasi atau
penghambatan E max model digunakan untuk menggambarkan obat
berpengaruh pada sintesis atau degradasi respons
(Dayneka et al., 1993; Sharma dan Jusko, 1998; Sun
dan Jusko, 1999).
Sebagai model respon tidak langsung menghargai
peristiwa fisiologis yang mendasari terlibat dalam
elaborasi efek obat yang diamati, aplikasi mereka
tion sering lebih disukai dalam pemodelan PK / PD karena mereka
memiliki dasar mekanistik pada molekul dan / atau
tingkat seluler yang sering memungkinkan untuk melakukan ekstrapolasi
model untuk situasi klinis lainnya.
Model respon tidak langsung misalnya
digunakan dalam evaluasi SB-240563, yang dimanusiakan
antibodi monoklonal diarahkan menuju IL-5 pada mon-
kunci (Zia-Amirhosseini et al., 1999). IL-5 tampaknya
memainkan peran penting dalam produksi, aktivasi,
dan pematangan eosinofil. Efek tertunda dari
SB-240563 pada eosinofil konsisten dengan eosinofilnya
mekanisme aksi melalui pengikatan ke dan dengan demikian
inaktivasi IL-5. Itu dimodelkan menggunakan tidak langsung
model respon dengan penghambatan produksi
respon (jumlah eosinofil) (Gbr. 16). Yang didapat
nilai EC 50 yang rendah untuk pengurangan eosino- yang bersirkulasi
phils dikombinasikan dengan paruh panjang terminal
500
2.5
1.5
0,5
0
2.0
1.0
400
300
200
100
Konsentrasi serum terukur. (sore)
Glukosa inf. tingkat (mmol / mnt)
0
0
6
12
Waktu, jam
0
6
(A)
(B)
12
Waktu, jam
Gambar 13 n Konsentrasi insulin serum diukur (- SD) setelah dosis tunggal 10 U SC insulin reguler pada 10 sukarelawan ( A );
laju infus glukosa yang sesuai diperlukan untuk mempertahankan euglycemia ( B ). Sumber: From Woodworth et al., 1994.
112
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 131
terapi protein 13 hari menunjukkan kemungkinan
dari rejimen dosis jarang untuk SB-240563 di
farmakoterapi gangguan dengan peningkatan eosino-
Fungsi phil, seperti asma.
Model tanggapan tidak langsung juga digunakan untuk
efek hormon pertumbuhan pada IGF-1 endogen
konsentrasi (Sun et al., 1999), serta efek dari
epoetin-a pada dua parameter respons, ferritin gratis
konsentrasi dan konsentrasi reseptor transferin larut
tration (Bressolle et al., 1997). Begitu pula yang dimodifikasi
model respon tidak langsung digunakan untuk menghubungkan
konsentrasi antibodi anti-faktor IX yang dimanusiakan
SB-249417 menjadi faktor aktivitas IX pada monyet Cynomolgus
serta manusia (Benincosa et al., 2000; Chow et al.,
2002). Efek obat dalam model ini diperkenalkan oleh
mengganggu degradasi alami Faktor IX oleh
sekuestrasi Faktor IX oleh antibodi.
n Model rentang hidup sel
Sejumlah besar terapi protein diberikan
efek farmakologis melalui langsung atau tidak langsung
modulasi darah dan / atau tipe sel imun.
3.0
4
EC 50 = 440 pmol / L
n = 2.00
E maks = 5,56 mmol / mnt
3
2
1
0
2.0
1.0
2.5
1.5
0,5
0
10
100
Konsentrasi serum terukur (pmol / L)
Efek cmpt yang diprediksi. conc (pmol / L)
500
10
100
500
Laju infus glukosa (mmol / mnt)
Laju infus glukosa (mmol / mnt)
(A)
(B)
Gambar 14 n Hubungan antara laju infus glukosa untuk mempertahankan euglikemia versus konsentrasi insulin serum setelah tunggal
Dosis SC 10 U insulin reguler pada 10 sukarelawan ( A ). Histeresis berlawanan dengan waktu yang bergantung pada waktu, yang merupakan indikasi
sifat tidak langsung dari hubungan konsentrasi-efek, ditunjukkan oleh panah. Panel ( B ) menunjukkan hubungan sigmoidal antara
efek dan konsentrasi kompartemen efek yang diprediksi (C e ), menunjukkan keruntuhan loop histeresis dengan menerapkan tidak langsung
mengaitkan pendekatan pemodelan PK / PD dengan kompartemen efek. Sumber: From Woodworth et al., 1994.
Efek
(E)
C2,V2
C1,V1
CL
D
Q
k di
k keluar
Farmakokinetik
Farmakodinamik
Tambah atau
perpaduan
Mengurangi
atau degradasi
Tanggapan Tidak Langsung
Subtipe Model
EC 50 + C 1
C1
= k in
- k keluar E .
dt
dE
Subtipe I : Penghambatan sintesis (k in )
. 1–
Subtipe III: Stimulasi sintesis (k dalam )
EC 50 + C 1
E maks . C1
= k in
- k keluar .E
dt
dE
. 1+
Subtipe II : Penghambatan degradasi (k out )
EC 50 + C 1
C1
= k in - k out .
.E
dt
dE
1–
Subtipe IV: Stimulasi degradasi (k out )
.
E maks C 1
EC 50 + C 1
= k in - k out .
.E
dt
dE
1+
Gambar 15 n Skema dari model respon PK / PD tidak langsung yang tipikal. Ukuran efek (E) dijaga oleh keseimbangan dinamis
antara peningkatan atau sintesis dan proses penurunan atau degradasi. Yang pertama dimodelkan oleh proses urutan nol dengan tingkat
konstanta k in , yang terakhir dengan proses orde pertama dengan konstanta laju k out . Dengan demikian, laju perubahan efek (dE / dt) dinyatakan sebagai
perbedaan antara laju sintesis (k dalam ) dan laju degradasi (k keluar kali E). Konsentrasi obat (C 1 ) dapat merangsang atau menghambat sintesis
atau proses degradasi untuk efek (E) melalui hubungan E max menggunakan salah satu dari empat subtipe (model I, II, III atau IV) dari tidak langsung
model respon. Model farmakokinetik dan semua parameter PK dan PD lainnya identik dengan yang digunakan pada Gambar. 10.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
113
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 132
Untuk jenis terapi ini, model rentang hidup sel
telah terbukti bermanfaat untuk menangkap eksposur mereka-
Menanggapi hubungan dan menggambarkan serta memprediksi obat
efek (Perez-Ruixo et al., 2005). Rentang hidup sel
model berbasis mekanisme, fisiologis PK / PD
model yang dibuat berdasarkan urutan
pematangan dan pergantian sel yang digerakkan oleh umur mereka
tipe sel yang terkena dan populasi sel nenek moyang.
Model rentang hidup sel terutama banyak digunakan untuk
mengkarakterisasi hubungan dosis-konsentrasi-efek-
ditujukan untuk faktor pertumbuhan hematopoietik
memodifikasi erythropoiesis, granulopoiesis, atau throm
bopoiesis (Perez-Ruixo et al., 2005; Agoram et al.,
2006). Rentang waktu fisiologis tetap untuk
pematangan sel prekursor adalah alasan utama
untuk penundaan yang lama antara pemberian obat
dan respon yang diamati, yaitu perubahan dalam sel
hitung dalam darah tepi. Model rentang hidup sel
mengakomodasi pematangan berurutan ini dari beberapa
populasi sel prekursor pada waktu fisiologis tetap
Interval oleh serangkaian kompartemen transit yang terhubung
melalui proses urutan pertama atau nol dengan umum
tingkat transfer konstan.
Model rentang hidup sel misalnya digunakan untuk
menggambarkan efek rejimen dosis ganda
erythropoietin manusia rekombinan (rhEPO) 600IU /
kg diberikan seminggu sekali dengan injeksi SC (Ramakrishnan
et al., 2004). Proses erythropoiesis dan
menerapkan pendekatan PK / PD termasuk rentang hidup sel
Model digambarkan dalam Gambar 17 dan 18, masing-masing.
rhEPO dikenal untuk merangsang produksi dan
pelepasan retikulosit dari sumsum tulang.
Efek rhEPO dimodelkan sebagai stimulasi
pematangan dua populasi sel nenek moyang (P1 dan
P2 pada Gambar. 17), termasuk juga penghambatan umpan balik
antara jumlah eritrosit dan proliferasi progenitor
tion. Pengembangan dan pergantian berikutnya
populasi retikulosit dan eritrosit adalah
dimodelkan dengan mempertimbangkan masa hidup mereka seperti yang tercantum
pada Gambar 17. Konsentrasi hemoglobin sebagai
Pluripotent
sel induk
Erythrocytic
leluhur
Erythrocytic
prekursor
Erythroblast
Retikulosit, belum matang
Retikulosit, matang
Sel darah merah
120 hari
3-4 hari
3-4 hari
Rentang hidup sel
()
11-48 jam
BFU, belum dewasa
Leukosit
trombosit
BFU, dewasa
CFUe
Darah
Sumsum tulang
P1
P2
R
Sel darah merah
Gambar17 n Proses erythropoiesis. Erythropoietin menstimulasi proliferasi dan diferensiasi progenitor eritrosit (BFU,
eritroid unit pembentuk meledak; CFUe, erythroid unit pembentuk koloni) serta eritroblas di sumsum tulang. Rentang hidup (t) dari
berbagai populasi sel ditunjukkan di sebelah kanan. Lihat penjelasan P 1 , P 2 , dan RBC pada Gambar 18. Sumber: Dari Ramakrishnan et al., 2004.
Hitung Eosinofil (10
9
/ L)
Konsentrasi Plasma (ug / mL) 100
10
1
0,1
Waktu (hari)
0
20
40
60
80
100
0,0
0,1
0,2
0,3
0,4
0,5
0,6
0,7
0.8
Gambar 16 n Model memprediksi dan mengamati konsentrasi plasma
tion (diamati: lingkaran; diprediksi: garis padat) dan jumlah eosinofil
(Diamati, kotak; diprediksi, garis putus-putus) mengikuti SC
pemberian 1 mg / kg monoklonal anti-IL-5 yang dimanusiakan
antibodi SB-240563 pada monyet Cynomolgus. Mekanisme-
respon tidak langsung berbasis model PK / PD digunakan untuk menggambarkan
eosinofil dihitung sebagai fungsi konsentrasi plasma SB-240563
tion. Pengurangan jumlah eosinofil dalam darah perifer (as
efek E) dimodelkan sebagai pengurangan rekrutmen
eosinofil dari tulang, yaitu penghambatan laju produksi
k dalam menggunakan model respons tidak langsung dari subtipe I (lihat Gambar 15).
Sumber: Dari Zia-Amirhosseini et al., 1999.
114
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 133
parameter target farmakodinamik dihitung
dari jumlah eritrosit dan retikulosit dan hemoglobin
konten globin per sel. Gambar 19 menunjukkan hasilnya
kali kursus dalam jumlah retikulosit, jumlah eritrosit
dan konsentrasi hemoglobin.
n Model Respons Kompleks
Karena efek dari kebanyakan terapi protein adalah
dimediasi melalui profil fisiologis regulatori yang kompleks
ceruk termasuk mekanisme umpan balik dan / atau toleransi-
Fenomena ance, beberapa model PK / PD yang telah
dijelaskan untuk obat protein jauh lebih canggih
lebih baik dari empat kelas model sebelumnya
dibahas.
Salah satu contoh pemodelan yang sedemikian kompleks
pendekatan telah dikembangkan untuk terapi
efek dari cetrorelix antagonis LH-RH (Nagaraja
et al., 2000; Pechstein et al., 2000; Nagaraja et al., 2003).
Cetrorelix digunakan untuk pencegahan prematur
ovulasi pada wanita yang menjalani ovarium terkontrol
stimulasi dalam protokol fertilisasi in vitro. LH-RH
antagonis menekan level LH dan menunda
terjadinya lonjakan LH preovulasi, dan ini
penundaan dianggap bertanggung jawab untuk menunda
ovulasi. Penindasan LH dimodelkan dalam
Pendekatan PK / PD dengan model respon tidak langsung
pendekatan langsung terkait dengan konsentrasi plasma cetrorelix
trations (Gbr. 20) (Nagaraja et al., 2003). Pergeseran dalam
Lonjakan LH dikaitkan dengan konsentrasi cetrorelix dengan a
simple E max -fungsi melalui efek hipotesis
partment ke akun untuk keterlambatan dalam respons via
langkah-langkah transduksi sinyal yang kompleks dari media yang tidak diketahui
chanism of action. Gambar 21 menunjukkan aplikasi
C1,V1
V maks , k m
D
P1
P2
R
RBC
Sel darah merah
Hb
P1
P2
R
k di
k di
k di
k di
k di
Melawan
peraturan
lingkaran
S (t)
S (t)
Saya t)
+C1
+C1
EC 50
E maks
S ( t ) = 1+
IC 50
C1
I ( t ) = 1–
C1
.
Gambar 18 n Model PK / PD yang menggambarkan disposisi
eritropoietin manusia rekombinan dan efeknya terhadap retikulosit
menghitung, jumlah sel darah merah dan konsentrasi hemoglobin. Itu
Model PK adalah model satu kompartemen dengan Michaelis-Menten
ketik eliminasi (k m , V max ) dari kompartemen pusat. Itu
Model PD adalah model rentang hidup sel dengan empat sel berurutan
kompartemen, mewakili sel progenitor eritroid (P 1 ),
eritroblas (P 2 ), retikulosit (R), dan sel darah merah (RBC).
t P1 , t P2 , t R dan t RBC yang hidup sel yang sesuai meliputi, k di dalam
tingkat transfer nol-urutan umum antara kompartemen sel.
Parameter target hemoglobin dalam darah (Hb) dihitung
dari rektikulosit dan jumlah sel darah merah dan
konten hemoglobin per sel. Efek dari erythropoietin adalah
dimodelkan sebagai stimulasi produksi kedua sel prekursor
populasi (P 1 dan P 2 ) di sumsum tulang dengan stimulasi
fungsi S (t). E max adalah stimulasi maksimum yang dimungkinkan
produksi retikulosit oleh erythropoietin, EC 50 plasma
konsentrasi erythropoietin yang dihasilkan setengah maksimal
stimulasi. Umpan balik kontra-regulasi mewakili
penghambatan umpan balik retikulosit pada produksi mereka sendiri oleh
mengurangi tingkat produksi sel-sel di P 1 kompartemen via
fungsi penghambatan I (t). IC 50 adalah jumlah retikulosit itu
menghasilkan setengah dari penghambatan total. Sumber: Diubah dari
Ramakrishnan et al., 2004.
420
480
540
600
10
12
14
16
18
RBC # (x10
10
sel / L)
Hb (g / dL)
200
400
600
800
1000
Waktu (h)
0
0
10
20
30
40
Retikulosit (x10
10
sel / L)
Gambar 19 n Retikulosit, sel darah merah (RBC), dan hemoglo-
bin (Hb) kursus waktu setelah pemberian dosis SC berganda 600 IU / kg / minggu
erythropoietin manusia rekombinan. Lingkaran padat dan terbuka
mewakili data untuk pria dan wanita, sedangkan data solid dan
garis putus-putus untuk retikulosit adalah alat kelengkapan model. Solid
garis dalam panel RBC dan Hb adalah prediksi menggunakan
kurva model-pas untuk retikulosit dan masa hidup
parameter. Sumber: Dari Ramakrishnan et al., 2004.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
115
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 134
model PK / PD ini untuk menandai penindasan LH
dan keterlambatan lonjakan LH setelah administrasi SC dari
cetrorelix untuk kelompok 12 wanita dengan dosis berbeda
level. Analisis mengungkapkan dosis-respons yang ditandai
hubungan untuk lonjakan LH dan dengan demikian dapat diprediksi
respon obat terhadap cetrorelix (Nagaraja et al., 2000).
Contoh lain untuk model PK / PD yang kompleks
adalah model sitokinetik yang digunakan untuk menggambarkan efeknya
pegfilgrastim pada jumlah granulosit di perifer
darah (Roskos et al., 2006; Yang, 2006). Pegfigrastim adalah
bentuk PEGylated dari granulocyte-koloni manusia
stimulating factor (G-CSF) analog filgrastim.
Pegfilgrastim, seperti filgrastim dan G-CSF, merangsang
aktivasi, proliferasi, dan diferensiasi neutron
sel sel nenek moyang dan meningkatkan fungsi
neutrofil matang (Roskos et al., 2006). Pegfilgrastim
terutama digunakan sebagai perawatan suportif untuk memperbaiki dan
meningkatkan pemulihan dari neutropenia sekunder
rejimen kemoterapi kanker. Seperti yang sudah dibahas
di bagian PEGilasi, pegfilgrastim mengikuti
disposisi obat yang dimediasi target dengan respon saturable
endositosis yang dimediasi reseptor oleh neutrofil sebagai utama
jalur eliminasi (CL N ) dan orde pertama paralel
proses sebagai jalur eliminasi minor (CL lin ; Gbr. 22).
Izin untuk jalur yang dimediasi reseptor adalah
ditentukan oleh jumlah neutrofil absolut (ANC),
jumlah sel pita darah tepi ( Bp ) dan
populasi neutrofil tersegmentasi (S p ).
Model sitokinetik pematangan terstruktur dari
granulopoiesis didirikan untuk menggambarkan hubungan
hubungan antara konsentrasi serum pegfilgrastim
dan jumlah neutrofil (Gbr. 22). Titik awalnya adalah
produksi metamyelocytes dari mitosis pra
kursor. Tahapan pematangan berikutnya dicatat sebagai
sel pita dan neutrofil tersegmentasi dalam tulang
sumsum. Setiap tahap pematangan dimodelkan oleh tiga
kompartemen transit berurutan. Pegfilgrastim con-
konsentrasi diasumsikan meningkatkan ANC dengan stimulasi-
mitosis dan mobilisasi sel pita dan
neutrofil tersegmentasi dari sumsum tulang ke dalam
sirkulasi sistemik. Pegfilgrastim juga mempromosikan
margin cepat dari neutrofil darah perifer,
yaitu, adhesi ke pembuluh darah; efek ini dimodelkan sebagai
ekspansi volume pengenceran neutrofil.
Gambar 23 menunjukkan pegfil yang diamati dan dimodelkan
grastim konsentrasi waktu dan profil waktu ANC
setelah meningkatkan dosis tunggal pemberian SC
pegfilgrastim. Model PK / PD yang disajikan untuk
pegfilgrastim memungkinkan penentuan EC 50 untuk
berpengaruh pada ANC. Berdasarkan nilai EC 50 ini dan
Kompartemen efek
C2,V2
C1,V1
CL
D
Q
Ce,V1
CL 1e
CL e0
-
IC 50
LH
keterlambatan lonjakan
+
E maks , EC 50
k0
ke
-ke
SW
EC 50
Ce
Ce
E maks
T0
t-
+
+
SA
IC 50
C
+C
=k0
dt
dLH
N
1-
1+
+1
LH
penekanan




























.
.
.
.














LH
Gambar 20 n Model PK / PD untuk efek gabungan cetrorelix antagonis LH-RH pada penekanan LH dan keterlambatan lonjakan LH.
Model PK adalah model dua kompartemen yang identik dengan model yang dijelaskan pada Gambar. 10. Model PD terdiri dari dua komponen:
model respons tidak langsung subtipe I untuk memodelkan penekanan LH oleh cetrorelix, dan model tautan tidak langsung yang memodelkan
keterlambatan dalam LH
lonjakan sebagai fungsi konsentrasi cetrorelix dalam kompartemen efek hipotetis. Kedua komponen model PD digabungkan dalam
disediakan ekspresi matematika yang menggambarkan laju perubahan konsentrasi LH (dLH / dt) sebagai fungsi dari kedua proses. LH adalah
konsentrasi LH, k 0 dan k e adalah laju produksi orde nol dan laju eliminasi orde pertama konstan untuk LH pada baseline, C 1 dan C e
adalah konsentrasi cetrorelix dalam plasma dan kompartemen efek hipotetis, masing-masing, SA adalah amplitudo gelombang LH, t adalah waktu,
T 0 adalah waktu di mana puncak terjadi dalam kondisi baseline, SW adalah lebar puncak dalam satuan waktu, IC 50 adalah cetrorelix
konsentrasi yang menekan kadar LH sebesar 50%, E max adalah keterlambatan maksimum dalam lonjakan LH dan EC 50 adalah konsentrasi cetrorelix yang
menghasilkan setengah dari E max . N menggambarkan kemiringan puncak lonjakan dan merupakan bilangan genap. Analisis data dasar menunjukkan
bahwa N dan SW
yang terbaik tetap pada nilai 4 dan 24 jam, masing-masing. Parameter PK dan PD lainnya identik dengan yang digunakan pada Gambar. 12. Sumber:
Dimodifikasi dari Nagaraja et al., 2003.
116
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 135
10 2
10 1
10 0
10 –1
10 2
10 1
10 0
10 –1
10 2
10 1
10 0
10 –1
0
4
8
12
16
20
0
5
10
15
20
0
5
10
15
20
8
10
12
14
16
18
8
10
12
14
16
18
8
10
12
14
16
18
Penekanan
(A)
( B ) Lonjakan gelombang
CET (ng / ml)
CET (ng / ml)
CET (ng / ml)
CET (ng / ml)
LH (mlU / ml)
LH (mlU / ml)
LH (mlU / ml)
Waktu (hari)
Waktu (hari)
Waktu (hari)
Waktu (hari)
3 mg
1 mg
5 mg
10 2
10 1
10 0
10 –1
0
20
40
60
80
100
0
10
20
30
40
50
CET (ng / ml)
LH (mlU / ml)
Waktu (hari)
10 2
10 1
10 0
10 –1
0
20
40
60
80
100
0
10
20
30
40
50
CET (ng / ml)
LH (mlU / ml)
Waktu (hari)
10 2
10 1
10 0
10 –1
0
20
40
60
80
100
0
10
20
30
40
50
LH (mlU / ml)
Gambar 21 n Hubungan farmakokinetik dan farmakodinamik antara cetrorelix () dan konsentrasi LH ( ▲ ) setelah tunggal
dosis 1, 3, dan 5 mg cetrorelix pada subjek yang representatif. Konsentrasi Cetrorelix dan LH dimodelkan menggunakan model PK / PD
disajikan pada Gambar. 20. ( A ) penekanan LH. ( B ) penekanan LH dan profil lonjakan LH. Garis merah solid mewakili model
pas konsentrasi cetrorelix, garis hijau putus-putus model dilengkapi konsentrasi LH, dan garis hitam putus-putus tipis di sebelah kanan
panel profil LH pretreatment (tidak dipasang). Penundaan tergantung cetrorelix dalam lonjakan LH terlihat sebagai pergeseran ke kanan LH
profil lonjakan di bawah terapi cetrorelix dibandingkan dengan masing-masing profil LH pretreatment. Singkatan: CET, cetrorelix. Sumber: Dari
Nagaraja et al., 2003.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
117
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 136
BP
SP
D
CL lin
CL N
Marginasi
Homeostasis
ANC
Periferal
darah
Homeostasis
Mitosis
Sumsum tulang
Metamyelocytes
meta = 40 jam
band = 66 jam
seg = 95 jam
Pita
sel
Tersegmentasi
neutrofil
Pematangan dan
mobilisasi
C1,V1
Gambar 22 n Model PK / PD menggambarkan efek granulopoietic pegfilgrastim. Model PK adalah model satu kompartemen dengan
dua jalur eliminasi paralel, proses eliminasi orde pertama (CL lin ) dan proses eliminasi yang dimediasi neutrofil (CL N ). C 1 dan
V 1 adalah konsentrasi dalam kompartemen PK dan volume distribusi yang sesuai. Model PD adalah model sitokinetik
mirip dengan model rentang hidup sel pada Gambar 5.18. Tiga tahap pematangan neutrofil dan masa hidup masing-masing (t meta , t band , t seg ) adalah
termasuk dalam model, metamyelocytes, sel band dan neutrofil tersegmentasi. Setiap tahap pematangan dimodelkan oleh tiga urutan
kompartemen transit. Konsentrasi serum pegfilgrastim merangsang mitosis dan mobilisasi sel-sel pita dan neutrofil tersegmentasi
di sumsum tulang, mengurangi waktu maturasi untuk sel-sel postmitotik di sumsum, dan memengaruhi marginasi dari sel-sel pita darah tepi ( BP )
dan populasi neutrofil tersegmentasi ( SP ), yang jumlahnya adalah total ANC. Perubahan jumlah neutrofil dalam darah perifer menyediakan
peraturan umpan balik izin pegfilgrastim. Sumber: Dimodifikasi dari Roskos et al., 2006.
Gambar 23 n Pegfilgrastim konsentrasi-waktu saja dan jumlah neutrofil absolut (ANC) -waktu profil pada subyek sehat setelah
pemberian SC tunggal 30, 60, 100, dan 300 mg / kg pegfilgrastim (n ¼ 8 / kelompok dosis). Data yang diukur disajikan dengan simbol sebagai
berarti - SEM. Garis mewakili program waktu yang dimodelkan berdasarkan pada sitokinetik PK / PD model yang disajikan pada Gambar 5.22. Sumber:
Dari
Roskos et al., 2006.
118
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 137
diperoleh konsentrasi plasma pegfilgrastim, itu
menyimpulkan bahwa dosis 100 mg / kg sudah cukup untuk
mencapai efek terapi maksimum pegfilgrastim
pada ANC (Roskos et al., 2006; Yang, 2006).
KESIMPULAN
Karakter farmakokinetik dan farmakodinamik
karakteristik peptida dan protein membentuk dasar untuk
aplikasi terapi mereka. Penghargaan atas
perbedaan farmakokinetik dan farmakodinamik
antara biologi terapi dan tradisional kecil
obat molekul akan memberdayakan pengembangan obat
ilmuwan serta penyedia layanan kesehatan untuk menangani,
mengevaluasi dan menerapkan senyawa-senyawa ini secara optimal
fashion selama proses pengembangan obat juga
seperti selama farmakoterapi terapan. Dasar pemikiran, ilmiah
pengembangan obat berbasis farmasi dan
apy berdasarkan penggunaan farmakokinetik dan
konsep farmakodinamik pasti akan mendorong
keberhasilan dan masa depan terapi protein, dan
mungkin pada akhirnya berkontribusi untuk menyediakan novel
obat-obatan yang dapat berfungsi sebagai kunci untuk yang dicita-citakan
'Obat yang dipersonalisasi' dalam sistem perawatan kesehatan
masa depan (Nagle et al., 2003).
REFERENSI
Agoram B, Heatherington AC, Gastonguay MR (2006).
Pengembangan dan evaluasi populasi
model farmakokinetik-farmakodinamik darbe-
poetin alfa pada pasien dengan keganasan noneloid
menjalani kemoterapi multisepeda. Aaps J 8 (3):
E552–63.
Allon M, Kleinman K, Walczyk M, dkk. (2002).
Farmakokinetik dan farmakodinamik darbe-
poetin alfa dan epoetin pada pasien yang menjalani
dialisis. Clin Pharmacol Ther 72 (5): 546–55.
Andersen S, Lambrecht L, Swan S, et al. (1999). Watak
interleukin manusia-10 rekombinan pada subjek dengan
berbagai derajat fungsi ginjal. J Clin Pharmacol 39
(10): 1015-20.
Anderson PM, Sorenson MA (1994). Pengaruh rute dan
formulasi pada farmakokinetik klinis interleu-
kerabat-2. Klinik Farmakokinet 27 (1): 19–31.
Bartocci A, Mastrogiannis DS, Migliorati G, Stockert RJ,
Wolkoff AW, Stanley ER (1987). Spesifikasi makrofag
secara teratur mengatur konsentrasi pertumbuhan mereka sendiri
faktor dalam sirkulasi. Proc Natl Acad Sci USA 84
(17): 6179–83.
Bauer RJ, Gibbons JA, Bell DP, Luo ZP, Young JD (1994).
Farmakokinetik nonlinear manusia rekombinan
faktor perangsang koloni makrofag (M-CSF) di
tikus. J Pharmacol Exp Ther 268 (1): 152–8.
Baxter LT, Zhu H, Mackensen DG, Jain RK (1994).
Model farmakokinetik berbasis fisiologis untuk
antibodi monoklonal spesifik dan nonspesifik dan
fragmen di jaringan normal dan tumor manusia
xenografts pada nude mice. Cancer Res 54 (6): 1517–28.
Benincosa LJ, Chow FS, Tobia LP, Kwok DC, Davis CB,
Jusko WJ (2000). Farmakokinetik dan pharmacody-
nama dari antibodi monoklonal yang dimanusiakan menjadi faktor
IX pada monyet cynomolgus. J Pharmacol Exp Ther 292
(2): 810–6.
Bennett HP, McMartin C (1978). Hormon peptida dan hormon mereka
analog: Distribusi, jarak bebas dari sirkulasi
dan inaktivasi in vivo. Pharmacol Rev 30
(3): 247–92.
Boxenbaum H (1982). Penskalaan antar spesies, alometri, phy-
waktu siologis, dan rencana dasar pharmacoki-
netics. J Pharmacokinet Biopharm 10 (2): 201–27.
Braeckman RA (2000). Farmakokinetik dan pharmacody-
nama dari terapi protein. Dalam: Reid RE, ed.
Analisis Obat Peptida dan Protein. New York:
Marcel Dekker, 633-69.
Breimer DD, Danhof M (1997). Relevansi aplikasi
pemodelan farmakokinetik-farmakodinamik
konsep dalam pengembangan obat. "Sepatu kayu"
paradigma. Klinik Farmakokinet 32 (4): 259–67.
Bressolle F, Audran M, Gareau R, Pham TN, Gomeni R
(1997). Perbandingan populasi langsung dan tidak langsung
model farmakodinamik: Aplikasi untuk menggabungkan
eritropoietin manusia pada atlet. J Pharma-
cokinet Biopharm 25 (3): 263–75.
Bu G, Williams S, Strickland DK, Schwartz AL (1992). Rendah
protein terkait lipoprotein terkait reseptor / alpha 2-
reseptor makroglobulin adalah reseptor hati
aktivator plasminogen tipe jaringan. Proc Natl Acad Sci
AS 89 (16): 7427–31.
Burwen SJ, Jones AL (1990). Pengolahan hepatoseluler
protein endositosis. J Electron Microsc Tech 14
(2): 140–51.
Caliceti P, Veronese FM (2003). Farmakokinetik dan biodiesel-
sifat kontribusi poli (etilen glikol) -protein
konjugat. Adv Drug Deliv Rev 55 (10): 1261–77.
Carone FA, Peterson DR (1980). Hidrolisis dan transportasi
peptida kecil oleh tubulus proksimal. Am J Physiol
238 (3): F151–8.
Carone FA, Peterson DR, Flouret G (1982). Tubular ginjal
pemrosesan hormon peptida kecil. J Lab Clin Med
100 (1): 1–14.
Chanson P, Timsit J, Harris AG (1993). Pharmaco- klinis
kinetika oktreotida. Aplikasi terapi di
pasien dengan tumor hipofisis. Farmakokinet Klinik
25 (5): 375–91.
Chen SA, Sawchuk RJ, Brundage RC, dkk. (2000).
Farmakokinetik plasma dan limfa dari rekombinan
manusia interleukin-2 dan polietilen glikol-modi
memadukan interleukin-2 pada babi. J Pharmacol Exp Ther 2000;
293 (1): 248–59.
Chiang J, Gloff CA, Yoshizawa CN, Williams GJ (1993).
Farmakokinetik interferon manusia rekombinan
beta ser pada sukarelawan sehat dan pengaruhnya terhadap serum
neopterin. Pharm Res 10 (4): 567–72.
Chow FS, Benincosa LJ, Sheth SB, dkk. (2002).
Pemodelan farmakokinetik dan farmakodinamik
antibodi anti-faktor IX manusiawi (SB 249417)
pada manusia. Clin Pharmacol Ther 71 (4): 235–45.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
119
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 138
Colburn W (1991). Farmasi peptida, peptoid, dan protein
kokinetik / farmakodinamik. Di: Garzone
P,
Colburn W, Mokotoff M, eds. Peptida, Peptoid,
dan Protein, Vol. 3. Cincinnati, OH, Harvey: Whitney
Buku, 94–115.
Cumming DA (1991). Glikosilasi protein rekombinan
terapi: Kontrol dan implikasi fungsional.
Glycobiology 1 (2): 115–30.
Daniel H, Herget M (1997). Seluler dan molekuler
mekanisme transportasi peptida ginjal. Am J Physiol
273 (1 Pt 2): F1–8.
Dayneka NL, Garg V, Jusko WJ (1993). Perbandingan empat
model dasar respon farmakodinamik tidak langsung.
J Pharmacokinet Bioharm 21 (4): 457–78.
Dedrick RL (1973). Peningkatan skala hewan. Farmakokinet J
Biopharm 1 (5): 435–61.
Deen WM, Lazzara MJ, Myers BD (2001). Struktural
penentu permeabilitas glomerulus. Apakah J
Physiol Renal Physiol 281 (4): F579-96.
Derendorf H, Meibohm B (1999). Pemodelan pharmacoki-
asli / farmakodinamik
(PK / PD)
hubungan:
Konsep dan perspektif. Pharm Res 16 (2): 176–85.
Edwards A, Daniels BS, Deen WM (1999). Ultrastruktural
model untuk selektivitas ukuran dalam filtrasi glomerulus. Saya
J Physiol 276 (6 Pt 2): F892–902.
Eppler SM, Combs DL, Henry TD, dkk. (2002). Sebuah target-
model dimediasi untuk menggambarkan farmakokinetik dan
efek hemodinamik dari pembuluh darah manusia rekombinan
faktor pertumbuhan endotel pada manusia. Klinik Farmakol
Ther 72 (1): 20–32.
Fasano A (1998). Pendekatan baru untuk pengiriman oral
makromolekul. J Pharm Sci 87 (11): 1351–6.
Ferraiolo B, Mohler M (1992). Tujuan dan metode analitis
odologi untuk studi distribusi protein. Dalam: Ferraiolo
B, Mohler M, Gloff CA, eds. Farmakokinetik Protein
dan Metabolisme. New York: Plenum Press.
Flessner MF, Lofthouse J, Zakariael R (1997). In vivo
difusi imunoglobulin G pada otot: Efek
mengikat, eksklusi terlarut, dan pengangkatan limfatik. Saya
J Physiol 273 (6 Pt 2): H2783–93.
Graham ML (2003). Pegaspargase: Ulasan klinis
studi. Adv Drug Deliv Rev 55 (10): 1293–302.
Handelsman DJ, Swerdloff RS (1986). Farmakokinetik dari
hormon pelepas gonadotropin dan analognya.
Endocr Rev 7 (1): 95-105.
Herbst RS, Langer CJ (2002). Faktor pertumbuhan epidermis
reseptor sebagai target pengobatan kanker: Muncul
peran IMC-C225 dalam pengobatan paru-paru dan kepala dan
kanker leher. Semin Oncol 29 (1 Suppl 4): 27–36.
Holford NH, Sheiner LB (1982). Kinetika farmakologis
tanggapan. Pharmacol Ther 16 (2): 143-66.
Hooper S (1991). Farmakokinetik dan farmakodinamik
insulin manusia reguler intravena. Di: Garzone P,
Colburn W, Mokotoff M, eds. Petides, Peptoids, dan
Protein, Vol. 3. Cincinnati, OH: Harvey Whitney
Buku, 128–37.
Inui K, T Terada, Masuda S, Saito H (2000). Fisiologis
dan implikasi farmakologis dari trans peptida
porter, PEPT1 dan PEPT2. Transplantasi Nephrol Dial
15 (Suppl 6): 11–3.
Ismair MG, Stieger B, Cattori V, dkk. (2001). Penyerapan hati
dari cholecystokinin octapeptide oleh anion- organik
mengangkut polipeptida OATP4 dan OATP8 tikus
dan hati manusia. Gastroenterologi 121 (5): 1185–90.
Jin F, Krzyzanski W (2004). Model farmakokinetik dari
target-mediated
watak
dari trombopoietin.
AAPS Pharm Sci 6 (1): E9.
Johnson V, Maack T (1977). Ekstraksi ginjal, filtrasi,
penyerapan, dan katabolisme hormon pertumbuhan. Apakah J
Physiol 233 (3): F185–96.
Kageyama S, Yamamoto, H, Nakazawa H, dkk. (2002).
Farmakokinetik dan farmakodinamik AJW200,
antibodi monoklonal yang dimanusiakan untuk von Willebrand
faktor, pada monyet. Arterioscler Thromb Vasc Biol 22
(1): 187–92.
Kaufman JS, Reda DJ, Fye CL, et al. (1998). Subkutan
dibandingkan dengan epoetin intravena pada pasien yang menerima
ing hemodialisis: Departemen Urusan Veteran
Kelompok Studi Kerjasama tentang Erythropoietin di Australia
Pasien Hemodialisis. N Engl J Med 339 (9): 578–83.
Khor SP, McCarthy K, DuPont M, Murray K, Timony G
(2000). Farmakokinetik, farmakodinamik, allo-
metry, dan pemilihan dosis rPSGL-Ig untuk fase I
percobaan. J Pharmacol Exp Ther 293 (2): 618-24.
Kim DC, Sugiyama Y, Satoh H, Fuwa T, Iga T, Hanano M
(1988). Analisis kinetik tergantung pada reseptor in vivo
pengikatan faktor pertumbuhan epidermis manusia oleh tikus
tisu. J Pharm Sci 77 (3): 200–7.
Kobayashi H, dkk. (2002). Akumulasi cepat dan
internalisasi herceptin radiolabel dalam inflamasi
xenograft kanker payudara matory dengan vasculogenic
mimikri diprediksi oleh dinamika yang ditingkatkan kontras
MRI dengan agen kontras makromolekul G6-
(1B4M-Gd) (256). Cancer Res 62 (3): 860-6.
Kompella U, Lee V (1991). Farmakokinetik peptida dan
obat protein. Dalam: Lee V, ed. Obat Peptida dan Protein
Pengiriman. New York: Marcel Dekker, 391–484.
Krogsgaard Thomsen M, Friis C, Sehested Hansen B, dkk.
(1994). Studi tentang kinetika pertumbuhan ginjal
hormon (GH) dan pada reseptor GH dan terkait
efek pada hewan. J Pediatr Endocrinol 7 (2): 93-105.
Kuwabara T, T Uchimura, Kobayashi H, Kobayashi S,
Sugiyama Y (1995). Izin yang dimediasi oleh reseptor
Turunan nartograstim G-CSF di sumsum tulang belakang
tikus. Am J Physiol 269 (1 Pt 1): E1–9.
Lee H, Kimko HC, Rogge M, Wang D, Nestorov I, Peck CC
(2003). Populasi farmakokinetik dan farmakokinetik
pemodelan codynamic dari etanercept menggunakan regresi logistik
analisis sion. Clin Pharmacol Ther 73 (4): 348-65.
Lee HJ (2002). Pemberian obat oral protein: Yang terbaru
kemajuan. Arch Pharm Res 25 (5): 572–84.
Lesko LJ (2007). Paving jalur kritis: Bagaimana bisa klinis
farmakologi membantu mencapai visi? Clin
Pharmacol Ther 81 (2): 170–7.
Lesko LJ, Rowland M, Peck CC, Blaschke TF (2000). Mengoptimalkan
pengembangan ilmu pengetahuan: Peluang untuk lebih baik
seleksi kandidat dan evaluasi dipercepat di Malaysia
kawan J Clin Pharmacol 40 (8): 803–14.
Levy G (1986). Kinetika aksi narkoba: Tinjauan umum. J
Allergy Clin Immunol 78 (4 Pt 2): 754-61.
120
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 139
Levy G (1994). Modem farmakodinamik berbasis mekanisme
Eling. Clin Pharmacol Ther 56 (4): 356–8.
Maack T, Park C, Camargo M (1985). Filtrasi ginjal,
transportasi dan metabolisme protein. Dalam: Seldin D,
Giebisch G, ed. Ginjal. New York: Raven Press,
1773–1803.
Macdougall IC, Gray SJ, Elston O et al. (1999).
Farmakokinetik erythropoiesis baru merangsang
protein dibandingkan dengan epoetin alfa dalam dialisis
pasien. J Am Soc Nephrol 10 (11): 2392–5.
Machado SG, Miller R, Hu C (1999). Regulasi
perspektif tentang farmakokinetik / farmakodinamik
pemodelan. Metode Stat Med Res 8 (3): 217–45.
Mager DE (2006). Disposisi obat yang dimediasi target dan
dinamika. Biochem Pharmacol 72 (1): 1–10.
Mager DE, Wyska E, Jusko WJ, (2003). Keanekaragaman
model farmakodinamik berbasis mekanisme. Obat
Metab Dispos 31 (5): 510–8.
Mahato RI, Narang AS, Thoma L, Miller DD (2003).
Tren yang muncul dalam pengiriman peptida dan oral
obat protein. Crit Rev Ther Drug Carrier Syst 20
(2–3): 153–214.
Mahmood I (2002). Penskalaan antar spesies: Predicting oral
clearance pada manusia. Am J Ther 9 (1): 35–42.
Mahmood I, Balian JD (1999). Prinsip farmakokinetik
ples di belakang penskalaan dari hasil praklinis ke fase I
protokol. Klinik Farmakokinet 36 (1): 1–11.
Marks DL, Gores GJ, LaRusso NF (1995). Pengolahan hati
peptida. Dalam: Taylor MD, Amidon GL, eds. Peptida-
Desain Obat Berbasis: Mengontrol Transportasi dan
Metabolisme. Washington, DC: Bahan Kimia Amerika
Masyarakat, 221–48.
McMartin C (1992). Farmakokinetik peptida dan
protein: Peluang dan tantangan. Uang muka di
Penelitian Obat-Obatan 22: 39-106.
Meibohm B (2004). Farmakokinetik protein- dan nukleo-
obat berbasis pasang surut. Di: Mahato RI, ed. Biomaterial untuk
Pengiriman dan Penargetan Protein dan Asam Nukleat.
Boca Raton, FL: CRC Press, 275–94.
Meibohm B, Derendorf H (1994). Farmakokinetik dan
farmakodinamik obat biotek. Dalam: Kayser O,
Muller R, eds. Bioteknologi Farmasi: Obat
Penemuan dan Aplikasi Klinis. Weinheim:
Wiley, 141-66.
Meibohm B, Derendorf H (1997). Konsep dasar farmasi
pemodelan kokinetik / farmakodinamik (PK / PD). Int
J Clin Pharmacol Ther 35 (10): 401-13.
Meibohm B, Derendorf H (2002). Farmakokinetik / farmasi
studi codynamic dalam pengembangan produk obat.
J Pharm Sci 91 (1): 18–31.
Meibohm B, Derendorf H (2003). Farmakokinetik dan
farmakodinamik obat biotek. Dalam: Muller R,
Kayser O, eds. Aplikasi Farmasi
Bioteknologi. Weinheim: Wiley-VCH.
Meijer D, Ziegler K (1993). Hambatan Biologis terhadap Protein
Pengiriman. New York: Plenum Press.
Mohler M, Cook J, Lewis D, et al. (1993). Diubah
farmakokinetik deoksiribo manusia rekombinan
nuclease pada tikus karena adanya ikatan
protein. Obat Metab Dispos 21 (1): 71-5.
Molineux G (2003). Pegilasi: Rekayasa ditingkatkan
biofarmasi untuk onkologi. Farmakoterapi
23 (8 Pt 2): 3S – 8S.
Montero-Julian FA, Klein B, Gautherot E, Brailly H (1995).
Studi farmakokinetik anti-interleukin-6 (IL-6)
terapi dengan antibodi monoklonal: Peningkatan
izin IL-6 oleh koktail antibodi anti-IL-6.
Darah 85 (4): 917-24.
Mordenti J, Chen SA, Moore JA, Ferraiolo BL, Green JD
(1991). Skala pembersihan ruang dan volume interspesies
data distribusi untuk lima protein terapi. Pharm
Res 8 (11): 1351–9.
Cetakan DR, Davis CB, Minthorn EA, dkk. (1999). Suatu populasi
analisis farmakokinetik-farmakodinamik tunggal
dosis clenoliximab pada pasien dengan reumatoid
radang sendi. Clin Pharmacol Ther 66 (3): 246–57.
Nagaraja NV, Pechstein B, Erb K, dkk. (2003).
Pemodelan farmakokinetik / farmakodinamik dari
penekanan teinizing hormone (LH) dan lonjakan LH
ditunda dengan cetrorelix setelah dosis tunggal dan ganda
wanita premenopause yang sehat. J Clin Pharmacol 43
(3): 243–51.
Nagaraja NV, Pechstein B, Erb K (2000). Farmakokinetik
dan pemodelan farmakodinamik cetrorelix, an
Antagonis LH-RH, setelah pemberian subkutan
pada wanita premenopause yang sehat. Klinik Farmakol
Ther 68 (6): 617–25.
Nagle T, Berg C, Nassr R, Pang K (2003). Selanjutnya
evolusi biotek. Nat Rev Drug Discov 2 (1): 75–9.
Nielsen S, Nielsen JT, Christensen EI (1987). Luminal dan
serapan basolateral insulin dalam terisolasi, perfusi,
tubulus proksimal. Am J Physiol 253 (5 Pt 2): F857-67.
Pauletti GM, Gangwar S, Siahaan TJ, Jeffrey A, Borchardt RT
(1997). Peningkatan bioavailabilitas peptida oral:
Peptidomimetika dan strategi prodrug. Obat Terlarang
Deliv Rev 27 (2–3): 235–56.
Pechstein B, Nagaraja NV Hermann R, Romeis P, Locher M,
Derendorf H (2000). Farmakokinetik – farmakodin-
pemodelan amik testosteron dan luteinisasi hor-
penekanan mone oleh cetrorelix pada sukarelawan sehat.
J Clin Pharmacol 40 (3): 266-74.
Peck CC, dkk. (1994). Peluang untuk integrasi
farmakokinetik, farmakodinamik, dan toxicoki-
netics dalam pengembangan obat rasional. J Clin Pharmacol
34 (2): 111–9.
Perez-Ruixo JJ, Kimko HC, Chow AT, Piotrovsky V,
Krzyzanski W, Jusko WJ (2005). Kehidupan sel populasi
model span untuk efek obat berikut tidak langsung
mekanisme aksi. J Pharmacokinet Pharmacodyn
32 (5-6): 767–93.
Periti P, Mazzei T, Mini E (2002). Farmakokinetik klinis dari
depot leuprorelin. Clin Pharmacokinet 41 (7): 485-504.
Perrier D, Mayersohn M (1982). Non-kompartemen
penentuan volume distribusi kondisi-mapan
untuk mode administrasi apa pun. J Pharm Sci 71 (3):
372–3.
Piscitelli SC, Reiss WG, Figg WD, Petros WP (1997).
Studi farmakokinetik dengan sitokin rekombinan.
Masalah ilmiah dan pertimbangan praktis. Clin
Farmakokinet 32 (5): 368–81.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
121
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 140
Porter CJ, Charman SA (2000). Transportasi limfatik
protein setelah pemberian subkutan. J Pharm
Sci 89 (3): 297–310.
Rabkin R, Ryan MP, Duckworth WC (1984). Ginjal
metabolisme insulin. Diabetologia 27 (3): 351–7.
Racine-Poon A, Botta L, Chang TW, dkk. (1997). Kemanjuran,
farmakodinamik, dan farmakokinetik CGP
51901, sebuah mono- monimer anti-imunoglobulin E
antibodi klonal, pada pasien dengan alergi musiman
rinitis. Clin Pharmacol Ther 62 (6): 675-90.
Radwanski E, Chakraborty A, Van Wart S, dkk. (1998).
Farmakokinetik dan respons leukosit dari rekomendasi
binant human interleukin-10. Pharm Res 15
(12): 1895–901.
Ramakrishnan R, Cheung WK, Wacholtz MC, Minton N,
Jusko WJ (2004). Farmakokinetik dan pharmacody-
pemodelan nama eritropo- manusia rekombinan
timah setelah dosis tunggal dan multipel dalam keadaan sehat
sukarelawan. J Clin Pharmacol 44 (9): 991-1002.
Reddy ST, Berk DA, Jain RK, Swartz MA (2006). A sensitif
in vivo model untuk mengukur konvektif interstitial
transportasi makromolekul yang disuntikkan dan nanoparti-
cles. J Appl Physiol 101 (4): 1162–9.
Rosenblum MG, Unger BW, Talterman JU, Hersh EM,
David GS, Frincke JM (1985). Modifikasi manusia
farmakologi interferon leukosit dengan monoklonal
antibodi. Cancer Res 45 (6): 2421–4.
Roskos LK, Lum P, Lockbaum P, Schwab G, Yang BB (2006).
Pemodelan farmakokinetik / farmakodinamik
dari
pegfilgrastim pada subyek sehat. J Clin Pharmacol
46 (7): 747–57.
Schomburg A, Kirchner H, Atzpodien J (1993). Ginjal,
efek samping metabolik, dan hemodinamik interleu-
kin-2 dan / atau interferon alfa: Bukti risiko /
manfaat manfaat terapi subkutan. J Cancer
Res Clin Oncol 119 (12): 745–55.
Sharma A, Jusko W (1998). Karakteristik tidak langsung
model dan aplikasi farmakodinamik untuk klinis
tanggapan obat. Br J Clin Pharmacol 45: 229–39.
Sheiner LB, DR Stanski, Vozeh S, Miller RD, Ham J (1979).
Pemodelan simultan farmakokinetik dan
farmakodinamik: Aplikasi untuk d-tubocurarine.
Clin Pharmacol Ther 25 (3): 358-71.
Sheiner LB, Steimer JL (2000). Farmakokinetik / pharmaco-
pemodelan dinamis dalam pengembangan obat. Annu Rev
Pharmacol Toxicol 40: 67–95.
Shen WC (2003). Peptida oral dan pengiriman protein:
Janji yang tidak terpenuhi? Obat Diskus Hari Ini 8 (14): 607–8.
Smedsrod B, Einarsson M (1990). Pembersihan jaringan
aktivator plasminogen oleh mannose dan galactose
reseptor di hati. Thromb Haemost 63 (1): 60-6.
Straughn AB (1982). Kondisi-mapan model-independen
volume distribusi. J Pharm Sci 71 (5): 597–8.
Straughn AB (2006). Keterbatasan jumlah non-kompartemen
analisis makokinetik obat biotek. Dalam: Meibohm B,
ed. Farmakokinetik dan Farmakodinamik dari
Obat Bioteknologi. Weinheim: Wiley, 181–8.
Strickland DK, Kounnas MZ, Argraves WS (1995). LDL
protein terkait reseptor: reseptor multiligand
untuk katabolisme lipoprotein dan proteinase. Faseb J
9 (10): 890–8.
Sugiyama Y, Hanano M (1989). Transportasi yang dimediasi reseptor
hormon peptida dan kepentingannya secara keseluruhan
disposisi hormon dalam tubuh. Pharm Res 6 (3): 192–202.
Sun YN, Jusko WJ (1999). Peran parameter dasar dalam
menentukan respon farmakodinamik tidak langsung.
J Pharm Sci 88 (10): 987–90.
Sun YN, Lee HJ, Almon RR, Jusko WJ (1999). Sebuah farma-
model kokinetik / farmakodinamik untuk rekombinan
efek hormon pertumbuhan manusia pada induksi
faktor pertumbuhan seperti insulin pada monyet. J Pharmacol
Exp Ther 289 (3): 1523–32.
Supersaxo A, Hein W Gallati H, Steffen H (1988).
Interferon manusia rekombinan alfa-2a: Pengiriman ke
jaringan limfoid dengan mode aplikasi yang dipilih.
Pharm Res 5 (8): 472–6.
Supersaxo A, Hein WR, Steffen H (1990). Efek molekuler
berat pada penyerapan limfatik larut dalam air
senyawa setelah pemberian subkutan.
Pharm Res 7 (2): 167–9.
Tabrizi M, Roskos LK (2006). Exposure – relasi respons-
kapal untuk biologi terapi. Dalam: Meibohm B, ed.
Farmakokinetik dan Farmakodinamik Biotek
Narkoba. Weinheim: Wiley, 295–330.
Takagi A, Masuda H, Takakura Y, Hashida M (1995).
Karakteristik disposisi manusia rekombinan
interleukin-11 setelah pemberian bolus intravena
tion pada tikus. J Pharmacol Exp Ther 275 (2): 537–43.
Taki Y, Sakane T, Nadai T, dkk. (1998). Metabolisme first-pass
obat peptida di hati perfusi tikus. J Pharm
Pharmacol 50 (9): 1013–8.
Tang L, Meibohm B (2006). Farmakokinetik peptida
dan protein. Dalam: Meibohm B, ed. Farmakokinetik
dan Farmakodinamik Obat Biotek. Weinheim:
Wiley, 17-44.
Tang L, Persky AM, Hochhaus G, Meibohm B (2004).
Aspek farmakokinetik dari produk bioteknologi.
J Pharm Sci 93 (9): 2184–204.
Tanswell P, Modi N, Combs D, Danays T (2002).
Farmakokinetik dan farmakodinamik tenekte
gunakan terapi fibrinolitik miokard akut
infark. Clin Pharmacokinet 41 (15): 1229–45.
Tokuda Y, dkk. (1999). Peningkatan dosis dan farmakokinetik
mempelajari antibodi monoklonal anti-HER2 yang dimanusiakan di Indonesia
pasien dengan metastasis HER2 / neu-overexpressing
kanker payudara. Br J Cancer 81 (8): 1419–25.
Toon S (1996). Relevansi farmakokinetik dalam
pengembangan produk bioteknologi. Obat Eur J
Metab Pharmacokinet 21 (2): 93-103.
Veng-Pedersen P, Gillespie W (1984). Berarti waktu tinggal di
jaringan perifer: Parameter disposisi linier
berguna untuk mengevaluasi distribusi jaringan obat.
J Pharmacokinet Biopharm 12 (5): 535–43.
Veronese FM, P. Caliceti (2006). Farmasi yang dirancang khusus
kinetika dan farmakodinamik melalui moda kimia
informasi obat biotek. Dalam: Meibohm B, ed.
Farmakokinetik
dan
Farmakodinamik
dari
Obat Boptech. Weinheim: Wiley, 271–94.
Walsh S, Shah A, Mond J (2003). Pharmacoki- ditingkatkan
Netika dan berkurangnya reaktivitas antibodi lisostaphin
terkonjugasi menjadi polietilen glikol. Agen Antimicrob
Chemother 47 (2): 554–8.
122
MEIBOHM DAN BRAECKMAN
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 141
Wills R (1991). Perspektif kinetik / dinamis peptida
dan protein: GRF dan rHuIFN-alpha-2a. Di: Garzone
P, Colburn W, Mokotoff M, eds. Petides, Peptoids, dan
Protein, Vol. 3. Cincinnati, OH: Harvey Whitney
Buku, 117–27.
Wills RJ, Ferraiolo BL (1992). Peran farmakokinetik
dalam pengembangan yang diturunkan secara bioteknologi
agen. Klinik Farmakokinet 23 (6): 406-14.
Woodworth JR, Howey DC, Bowsher RR (1994). Pembentukan
profil aksi-waktu untuk penggunaan insulin reguler dan NPH
pemodelan farmakodinamik. Perawatan Diabetes 17 (1): 64–9.
Bekerja P, Cossum P (1991). Studi klinis dan praklinis
dengan protein manusia rekombinan: Efek antibodi
produksi. Dalam: Garzone P, Colburn W, Mokotoff M,
eds. Peptida, Peptoid, dan Protein, Vol. 3.
Cincinnati, OH: Harvey Whitney Books, 158–68.
Working PK (1992). Efek potensial dari induksi antibodi
oleh obat protein. Dalam: Ferraiolo BL, Mohler MA, Gloff
CA, eds. Farmakokinetik dan Metabolisme Portein.
New York: Plenum Press, 73–92.
Yang BB (2006). Integrasi farmakokinetik dan
farmakodinamik ke dalam pengembangan obat
pegfilgrastim, protein pegilasi. Dalam: Meibohm B, ed.
Farmakokinetik dan Farmakodinamik Biotek
Narkoba. Weinheim: Wiley, 373-94.
Zamboni WC (2003). Farmakokinetik pegfilgrastim.
Farmakoterapi 23 (8 Pt 2): 9S – 14S.
Zia-Amirhosseini P, Minthorn E Benincosa LJ, dkk. (1999).
Farmakokinetik dan farmakodinamik SB-
240563, antibodi monoklonal manusiawi diarahkan
untuk manusia interleukin-5, pada monyet. J Pharmacol Exp
Ther 291 (3): 1060–7.
Ziegler K, Polzin G, Frimmer M (1988). Hepatoseluler
penyerapan siklosporin A dengan difusi sederhana. Biokim
Biophys Acta 938 (1): 44-50.
Zito SW (1997). Bioteknologi Farmasi: Sebuah
teks yang di-gramm. Lancaster, PA: Technomic Pub. Bersama.
BACAAN LEBIH LANJUT
n Farmakokinetik Umum dan Farmakodinamik
Atkinson A, Abernethy D, Daniels C, Dedrick R, Markey S
(2006). Prinsip Farmakologi Klinis. San
Diego, CA: Academic Press.
Bjornsson TD (1997). Penggunaan praktis dari farmasi individu
parameter kokinetik dalam pengembangan obat dan
praktik klinis: Contoh dan simulasi. Eur J
Obat Metab Farmakokinet 22 (1): 1–14.
Bonate PL (2006). Farmakokinetik-Farmakodinamik
Pemodelan dan Simulasi. New York: Springer.
Derendorf H, Meibohm
B
(1999). Pemodelan
dari
hubungan farmakokinetik / farmakodinamik (PK / PD)
ikatan: Konsep dan perspektif. Pharm Res
16 (2): 176–85.
Gibaldi M, Perrier D (1982). Farmakokinetik. New York:
Marcel Dekker.
Holford NH, Sheiner LB (1982). Kinetika farmakologis
tanggapan. Pharmacol Ther 16 (2): 143-66.
Rowland M, Tozer T (1993). Farmakokinetik Klinis:
Konsep dan Aplikasi. Media, PA: Williams &
Wilkins.
n Farmakokinetik dan Farmakodinamik dari
Peptida dan Protein
Baumann A (2006). Pengembangan awal terapi
biologi - farmakokinetik. Curr Drug Metab 7,
15–21.
Ferraiolo BL, Mohler MA, Gloff CA (1992). Protein
Farmakokinetik dan Metabolisme. New York:
Rapat Pleno.
Meibohm B (2006). Farmakokinetik dan Farmakodinamik
Obat Biotek. Weinheim: Wiley.
Tang L, Persky AM, Hochhaus G, Meibohm B (2004).
Aspek farmakokinetik dari produk bioteknologi. J
Pharm Sci 93 (9): 2184–204.
PHARMACOKINETICS DAN PHARMACODYNAMICS OF PEPTIDE DAN OBAT PROTEIN
123
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 142
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 143

6
Imunogenisitas Protein Terapi
Huub Schellekens
Departemen Ilmu Farmasi dan Studi Inovasi, Universitas Utrecht, Utrecht,
Belanda
Wim Jiskoot
Divisi Teknologi Pengiriman Obat, Leiden / Amsterdam Centre for Drug Research, Leiden University, Leiden,
Belanda
PENGANTAR
Era aplikasi medis protein dimulai
pada akhir abad ke-19 ketika serum hewan
diperkenalkan untuk pengobatan komplikasi serius
infeksi seperti difteri dan tetanus. Yang tinggi
dosis yang digunakan, kurangnya kontrol kualitas secara umum dan a
sistem regulasi, dan ketidakmurnian dari persiapan
tions menyebabkan banyak yang serius dan kadang-kadang bahkan fatal
efek samping. Banyak masalah disebabkan oleh
respon imun yang kuat protein asing ini
diinduksi, terutama ketika diatur ulang. Orang-orang
yang telah dirawat secara umum memiliki peringatan di
paspor atau kartu pengenal mereka untuk memperingatkan
mungkin untuk reaksi anafilaksis setelahnya
rechallenge dengan antiserum. Juga penyakit serum
disebabkan oleh deposit kompleks antigen-antibodi
adalah komplikasi umum dari terapi serum.
Insulin babi dan bovine juga diperkenalkan
setelah 1922 diinduksi antibodi pada banyak pasien. Ini
juga dijelaskan oleh asal binatang
produk, meskipun selama bertahun-tahun
kota menjadi kurang karena perbaikan dalam
metode produksi dan meningkatkan kemurnian.
Di paruh kedua abad ke-20 sejumlah
protein manusia dari sumber alami telah diperkenalkan
seperti faktor pembekuan turunan plasma dan pertumbuhan
hormon yang diproduksi dari kelenjar hipofisis mayat.
Produk-produk ini diberikan terutama kepada anak-anak dengan
defisiensi bawaan yang karenanya kurang alami
toleransi imun. Karena itu, respon imun mereka
juga ditafsirkan sebagai respons terhadap protein asing.
Korelasi antara cacat gen faktor VIII dan
tingkat defisiensi dengan respon imun pada
pasien hemofilia mengkonfirmasi penjelasan ini.
Dengan demikian, hingga munculnya DNA rekombinan
teknologi, respons imunologis terhadap terapi
protein ini dapat dijelaskan sebagai kekebalan klasik
respon sebanding dengan vaksin.
PARADIGMA BARU
Pada tahun 1982, insulin manusia dipasarkan sebagai yang pertama
protein turunan DNA rekombinan untuk penggunaan manusia.
Sejak itu, puluhan protein rekombinan telah terbentuk
diperkenalkan dan beberapa produk ini seperti
interferon dan epoetin adalah yang paling banyak
obat yang banyak digunakan di dunia. Dan, meskipun ini
protein dikembangkan sebagai salinan dekat manusia
protein endogen, hampir semua protein ini menginduksi
antibodi, kadang-kadang bahkan pada sebagian besar pasien
(Tabel 1). Selain itu, sebagian besar produk ini digunakan
pada pasien yang tidak memiliki defisiensi bawaan dan
dapat diasumsikan memiliki toleransi imun terhadap
protein.
Asumsi awal adalah bahwa produksi
oleh teknologi rekombinan dalam sel inang bukan manusia
dan proses hilir memodifikasi protein
dan respons imunologis adalah yang klasik
Menanggapi protein asing. Namun menurut
pendapat saat ini respon antibodi terhadap manusia
homolog didasarkan pada pemecahan toleransi sel-B.
Fenomena ini belum sepenuhnya dipahami
tetapi jelas berbeda dari jenis vaksin
Reaksi terlihat dengan protein asing.
Manifestasi klinis dari kedua jenis
Reaksinya sangat berbeda. Respon tipe vaksin
terjadi dalam beberapa minggu dan terkadang injeksi tunggal
cukup untuk menginduksi respon antibodi yang substansial.
Secara umum, tingkat antibodi penawar yang tinggi
diinduksi dan tantangan ulang mengarah ke reaksi penguat,
menunjukkan respons memori.
Namun, memecah toleransi sel B menerima
umum 6 hingga 12 bulan perawatan kronis dan sering
hanya mengarah pada produksi antibodi yang mengikat
tanpa efek biologis. Antibodi sering
muncul segera setelah pengobatan dihentikan dan
terkadang bahkan selama perawatan. Tanggapan ini juga
tampaknya tidak memiliki memori, karena rechallenging
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 144
pasien yang tingkat antibodinya menurun
tidak memunculkan respons.
TANGGAPAN IMUNOLOGIS
Protein terapeutik yang tersedia saat ini meliputi
seluruh spektrum, dari sepenuhnya asing, seperti bakteri
asparaginase yang diturunkan menjadi sepenuhnya seperti manusia
interferon a-2a dan semuanya di antaranya. Itu
protein asing memunculkan antibodi secara klasik
jalur yang meliputi menelan dan membelah
protein menjadi peptida oleh makrofag dan
sel dendritik, presentasi peptida oleh
Sistem MHC-II dan aktivasi sel-B dan meningkatkan,
dan pematangan afinitas dan pengalihan isotipe dari
Sel-B oleh sel-T pembantu. Selanjutnya, sel-B memori
diinduksi (lihat Bab 21 untuk detail)
Jauh lebih tidak jelas bagaimana toleransi sel-B
rusak. Sel B selalu ada secara autoreaktif.
Ketika reseptor pada sel-B ini memenuhi epitopnya
pada protein dalam larutan, interaksi ini tidak
mengarah ke aktivasi. Ketika sel-B ini bertemu
epitop dalam bentuk yang berulang secara teratur, kemudian sel-B
reseptor oligomerisasi dan sel diaktifkan, dan
mulai membelah dan memproduksi antibodi. Jadi, sel-B bisa
mengenali struktur protein berulang tiga dimensi
mendatang seperti yang telah ditunjukkan secara eksperimental dalam angka
studi. Penjelasan mengapa didasarkan pada evolusi.
Satu-satunya yang terjadi secara alami, berjarak sempit
struktur protein gambut ditemukan di permukaan
virus dan beberapa struktur bakteri (Bachmann
et al., 1993). Ternyata, sistem sel-B juga
dipilih karena potensinya untuk merespons mikroba
struktur independen dari sistem yang membedakan
nates diri dari nonself.
Penjelasan tentang nonself-independent ini
disponsori oleh struktur protein berulang yang cocok dengan
agregat yang diakui sebagai pendorong utama suatu
respon autoreaktif oleh protein terapi manusia,
karena dalam agregat protein struktur tertentu
juga disajikan dalam bentuk berulang (Gbr. 1) (Moore dan
Leppert, 1980).
Dengan demikian, aktivasi awal sel-B oleh
gerbang dapat dijelaskan dan juga bagaimana sel-sel ini mulai
dengan memproduksi IgM. Tidak diketahui bagaimana isotipe tersebut
beralih dari IgM ke IgG terjadi. Beberapa penelitian
menyarankan agregat setelah bereaksi dengan sel-B
reseptor diinternalisasi. Dan dengan menginternalisasi, B-
sel menjadi sel penolong dan mulai berproduksi
sitokin yang akan mengaktifkan sel-B lainnya. Lainnya
klaim bahwa sel-T pembantu ikut terlibat. Namun,
penelitian untuk menunjukkan adanya aktivitas sel T spesifik
pada pasien yang memproduksi antibodi untuk terapi manusia
protein ini telah gagal. Selain itu,
Mekanisme penyok disarankan oleh kurangnya
asosiasi dengan tipe HLA dan tidak adanya
ingatan.
FAKTOR-FAKTOR YANG MEMPENGARUHI PEMBENTUKAN ANTIBODI UNTUK
PROTEIN TERAPEUTIK
Gambar 2 menggambarkan berbagai faktor yang mempengaruhi
imunogenisitas (Schellekens, 2002; Hermeling
et al., 2004).
n Faktor Struktural
Tingkat nonself dan keberadaan agregat adalah
pemicu awal respons antibodi terhadap a
protein terapi. Tingkat nonself diperlukan
untuk mendorong respons tipe vaksin sangat tergantung
pada protein yang terlibat dan situs divergensi
dari urutan alami protein endogen.
Untuk insulin ada mutasi tunggal yang menyebabkan a
epitop baru dan respons antibodi sementara lainnya
Menghancurkan kekebalan tubuh
toleransi
(pasien membentuk antibodi)
Diagregasi
protein
Ulang
administrasi
kepada pasien
Toleransi kekebalan tubuh
(tidak ada antibodi)
Monomer
protein
Ulang
administrasi
kepada pasien
Gambar 1 n Dogma: Agregat protein bersifat imunogenik.
Kehilangan kemanjuran
Insulin
Faktor VIII
Interferon alfa 2
Interferon beta
Interleukin-2
Human chorionic gonadotropin (HCG)
Antibodi monoklonal
Peningkatan khasiat
Hormon pertumbuhan
Netralisasi protein endogen
Faktor pertumbuhan turunan megakaryocyte (MDGF)
Epoetin
Efek imun umum
Alergi
Anafilaksis
Penyakit serum, dll.
Tabel 1 n Tidak ada daftar lengkap dari protein rekombinan yang menunjukkan
reaksi imun setelah pemberian.
126
SCHELLEKENS DAN JISKOOT
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 145
mutasi tidak memiliki pengaruh sama sekali. Konsensus antar
feron di mana lebih dari 10% asam amino
menyimpang dari gangguan alami yang terdekat
pada subtipe menunjukkan imunogenisitas tidak lebih dari
homolog interferon a-2.
Glikosilasi adalah struktur penting lainnya
faktor untuk imunogenisitas protein terapeutik.
Ada sedikit bukti yang memodifikasi glikosilasi, e.
g., dengan mengekspresikan glikoprotein manusia dalam sel tanaman
atau inang eukariotik non-manusiawi lainnya, dapat menyebabkan
respon imunogenik. Namun, tingkat glikogen
silasi memiliki efek yang jelas. Interferon b diproduksi di
Escherichia coli jauh lebih imunogenik daripada
produk yang sama diproduksi di sel mamalia. Itu
Penjelasannya adalah kelarutan yang lebih rendah menyebabkan
tion dalam produk E. coli nonglycosylated.
Glikosilasi juga dilaporkan mempengaruhi antigeni-
kota dengan pengikatan antibodi. Epoetin yang tidak dikosongkan
dilaporkan memiliki afinitas yang lebih tinggi terhadap antibodi
dari epoetin dengan tingkat glikosilasi normal; itu
sebaliknya telah ditunjukkan untuk epoetin yang direkayasa untuk
memiliki glikosilasi ekstra. Namun, data tersebut harus
ditafsirkan dengan hati-hati. Antigenisitas tidak
sama dengan imunogenisitas (Gbr. 3). Protein atau peptida
dengan afinitas tinggi untuk antibodi mungkin tidak mampu
menginduksi antibodi sama sekali.
n Kotoran
Kotoran tampaknya merupakan faktor penting dalam
imunogenisitas protein terapeutik. Zat
seperti komponen sel inang, resin dari kromatografi
Glikosilasi
Kontaminan &
pengotor
Perumusan
Aplikasi
rute
Dosis
Panjang dari
pengobatan
Teknologi pengujian
Fitur pasien
Tidak dikenal
faktor-faktor
SEBUAH
L.
C
N
SEBUAH
T
FK
K
T
K
SEBUAH
L.
S
N
SEBUAH
saya
FK
K
F
K
Variasi urutan
manusia
bukan manusia
9
12
345
6
78
10 11 12
13 14 15 16 17 18
19 20 21 22 23 24
25 26 27 28
Kekebalan tubuh
genetika
Februari
Gambar 2 n Faktor-faktor yang relevan dalam imunogenisitas. Sumber: From Schellekens, 2002.
Perbedaan antara antigenisitas dan
imunogenisitas
- Antigenisitas: kemampuan suatu zat untuk berinteraksi
dengan komponen (yang sudah ada) dari sistem kekebalan tubuh
- Imunogenisitas: kemampuan suatu zat untuk memperoleh
respon imun
Gambar 3 n Imunogenisitas versus antigenisitas.
IMMUNOGENISITAS PROTEIN TERAPIUTER
127
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 146
kolom, atau enzim yang digunakan untuk mengaktifkan produk dan
antibodi monoklonal digunakan untuk pemurnian afinitas
dapat berakhir pada produk akhir. Kotoran mungkin juga
diperkenalkan oleh komponen formulasi atau
dapat bocor dari wadah dan penyegelan produk.
Kotoran ini dapat meningkatkan respon imun,
meskipun mereka tidak mampu memulai kekebalan tubuh
Menanggapi protein terapeutik. Namun ini
produk dapat bersifat imunogenik sendiri.
Antibodi yang diinduksi oleh pengotor dapat mengarah ke umum
reaksi imun seperti reaksi kulit, alergi, anafia-
laxis, dan serum sickness. Antibodi terhadap kotoran juga
meningkatkan masalah kualitas terkait produk dan
kedepan perlu dimonitor.
Menariknya, ada sejumlah contoh
produk menurun dalam imunogenisitas selama bertahun-tahun
karena perbaikan dalam pemurnian dan lainnya
langkah-langkah pemrosesan hilir. Kotoran dapat meningkatkan
hance imunogenisitas melalui mekanisme yang berbeda.
Endotoksin dari sel inang bakteri telah
dilaporkan menyebabkan imunogenisitas yang pertama
hormon pertumbuhan manusia turunan DNA rekombinan.
DNA sel host bakteri kaya GC dan terdenaturasi
protein mampu mengaktifkan reseptor seperti Toll
dan juga bisa bertindak sebagai pembantu. Aktivitas ini
kenajisan, bagaimanapun, terbatas pada yang bukan manusia
protein yang memiliki aktivitas seperti vaksin.
Adjuvan tidak mampu meningkatkan kekebalan tubuh
respon berdasarkan pemecahan sel-independen B-
toleransi sel. Namun, pengotor itu dimodifikasi
protein manusia seperti varian terpotong dan teroksidasi
yang dapat hadir dalam produk protein terapi
secara tidak langsung dapat menginduksi antibodi yang bereaksi dengan
protein yang tidak dimodifikasi. Mimikri imunologis ini
telah dijelaskan pada anjing yang dirawat dengan manusia
epoetin. Tingkat nonself dari protein ini untuk anjing
cukup untuk menginduksi respon imun. Tapi disana
masih cukup homologi antara manusia dan manusia
canine erythropoietin untuk antibodi untuk dinetralkan
erythropoietin, endogen, dan penyebabnya
anemia berat.
n Formulasi
Protein terapeutik manusia seringkali sangat
aktif secara oral dan dosisnya mungkin pada tingkat mg,
menjadikannya tantangan teknologi untuk merumuskan
produk agar tetap stabil dengan masa simpan yang wajar
dan untuk menghindari pembentukan agregat dan lainnya
modifikasi produk. Pentingnya formulasi
dalam menghindari imunogenisitas disorot dalam dua
kasus historis (Gbr. 4). Dalam kasus interferon a-2a,
perbedaan besar dicatat di antara
mulasi. Formulasi beku-kering, mengandung
albumin serum manusia sebagai penstabil yang sesuai
untuk instruksinya dapat disimpan pada suhu kamar
terutama imunogenik. Tampaknya di
suhu kamar interferon a-2a menjadi sebagian
teroksidasi. Molekul teroksidasi membentuk agregat
juga dengan interferon dan manusia yang tidak dimodifikasi
albumin serum, dan agregat ini bertanggung jawab
cukup untuk respon imun.
Baru-baru ini antibodi yang dimediasi parah
bentuk anemia (aplasia sel darah merah murni; PRCA) terjadi
setelah perumusan produk epoetin-adalah
berubah (Casadevall et al., 2002). Serum manusia
albumin digantikan oleh polysorbate 80. Bagaimana ini
perubahan formulasi diinduksi imunogenisitas masih
tidak pasti. Namun, penjelasan yang paling mungkin adalah a
formulasi baru yang kurang stabil menghasilkan agregat
formasi ketika tidak ditangani dengan tepat.
n Rute Administrasi
Ada efek yang jelas dari rute administrasi pada
imunogenisitas. Rute subkutan adalah yang paling banyak
imunogenik dan imuno-
satu genik. Namun, imunogenisitas dapat dilihat
Lama pengobatan (bulan)
0
0
1
2
3
4
5
6
7
8
200
400
600
800
1000
1200
1400
1600
1800
2000
IFN menetralkan unit
Bekukan kering / suhu kamar disimpan (n = 190)
B (n = 86)
C (n = 110)
D (n = 81)
E (n = 74)
Gambar 4 n Immunogeni-
perbedaan kota antara
interferon (IFN) sebuah formula-
pada pasien. Sumber:
Dari Ryff, 1997.
128
SCHELLEKENS DAN JISKOOT
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 147
setelah setiap rute aplikasi termasuk mukosa
dan rute intrapulmoner.
n Dosis
Efek dosisnya tidak begitu jelas. Ada
studi dengan insidensi antibodi terendah
tion dalam kelompok dosis tertinggi. Namun demikian data tersebut
harus ditafsirkan dengan hati-hati. Di tempat tertinggi
kelompok dosis mungkin ada lebih banyak produk dalam
sirkulasi mengganggu pengujian atau antibodi
tingkat mungkin lebih rendah dengan meningkatnya kompleks imun
pembentukan.
n Fitur Pasien
Ada juga sejumlah faktor terkait pasien
yang mempengaruhi timbulnya pembentukan antibodi.
Efek biologis dari produk tersebut dapat meningkat
atau menghambat pembentukan antibodi seperti halnya
perawatan komit pasien. Terkadang
pengobatan komit diberikan untuk menghambat antibodi
pembentukan, misalnya, pengobatan metotreksat untuk menghambat
pembentukan antibodi terhadap etanercept (Enbrel
HAI
).
Penyakit yang mendasarinya untuk para pasien
sedang dirawat juga penting. Pasien dirawat
dengan interferon a-2 untuk hepatitis kronis lebih banyak
cenderung menghasilkan antibodi dibandingkan pasien dengan padatan
tumor. Meningkatnya epoetin-sebuah PRCA diinduksi setelah
perubahan formulasi hanya terlihat pada pasien dengan
penyakit ginjal kronis dan tidak pada pasien dengan
kanker.
Seperti dibahas sebelumnya ada banyak indikasi
bahwa melanggar toleransi sel-B adalah sel-T independen
dan dengan demikian tidak tergantung pada tipe-HLA. Memang a
sejumlah studi klinis telah gagal menunjukkan
hubungan antara respon antibodi dan HLA-
mengetik.
n ASSAYS UNTUK ANTIBODIES
Tes mungkin merupakan faktor penting yang memengaruhi
kejadian yang dilaporkan dari induksi antibodi oleh
protein terapi. Dalam studi yang diterbitkan dengan
interferon a-2 pada pasien dengan infeksi virus
kejadian induksi antibodi bervariasi dari 0% hingga
lebih dari 60% pasien positif. Variasi ini harus
menjadi uji terkait. Evaluasi kinerja
laboratorium uji yang berbeda dengan pengujian panel buta
menunjukkan perbedaan lebih dari 50 kali lipat dalam titer yang ditemukan
dalam serum yang sama. Dengan demikian, perbandingan pun bisa diandalkan
antara berbagai kelompok pasien saat mencari
untuk efek klinis antibodi atau faktor belajar
mempengaruhi imunogenisitas hanya dapat dilakukan jika
kuantifikasi antibodi dilakukan dengan
uji validasi di laboratorium yang sama.
Jelas ada kekurangan standardisasi
metodologi pengujian. Hanya ada beberapa
referensi dan / atau persiapan antibodi standar
tersedia. Baru-baru ini, sejumlah kertas putih miliki
muncul terutama ditulis oleh perwakilan dari
industri bioteknologi di Amerika Serikat (Mire-
Sluis et al., 2004). Meskipun bidang bioteknologi-
terapi turunan masih terlalu banyak dalam pengembangan
untuk merumuskan metodologi pengujian yang pasti, ada a
menumbuhkan konsensus tentang prinsip-prinsip umum.
Ada kesepakatan bahwa uji tunggal tidak
cukup untuk mengevaluasi imunogenisitas yang baru
obat protein, tetapi sejumlah tes perlu digunakan
bersama Kebanyakan strategi uji antibodi
berdasarkan pada pendekatan dua tingkat: uji penyaringan
untuk mengidentifikasi serum positif antibodi diikuti oleh
karakterisasi lebih lanjut seperti apakah antibodi
mati menetralkan dan apa titer, afinitas dan
isotipe.
Secara umum, uji skrining adalah uji yang mengikat,
sebagian besar merupakan jenis uji ELISA (lihat Bab 2) dengan
metodologi curah hujan radioimun sebagai
alternatif. Antibodi yang mengikat sebagian besar tidak memiliki biolo-
konsekuensi gical. Namun, tes untuk lebih banyak
ada antibodi penetral yang penting secara biologis
umum rumit dan mahal. Demikian skrining
dengan uji mengikat untuk memilih serum positif untuk
penetapan kadar netral menghemat waktu dan uang.
Tes penyaringan dirancang untuk optimal
sensitivitas untuk menghindari negatif palsu. Untuk protein baru
mendefinisikan sensitivitas absolut tidak mungkin karena
dari kurangnya serum positif. Pendekatan alternatif adalah
untuk menetapkan titik potong untuk pengujian pada 5% false-positive
level menggunakan panel sera manusia normal dan / atau
perwakilan kelompok pasien yang tidak diobati dari kelompok
diperlakukan.
Pengujian untuk menetralkan antibodi ada di
modifikasi modifikasi potensi untuk
produk protein terapi. Uji potensi ada di
sebagian besar kasus uji berbasis sel in vitro. A yang sudah ditentukan sebelumnya
jumlah produk ditambahkan ke serum dan a
pengurangan aktivitas yang dievaluasi dalam bioassay.
Peringatan penting dalam menafsirkan neutra-
Hasil uji lisasi adalah kemungkinan adanya
penghambat produk selain antibodi (misalnya,
reseptor larut) dalam serum manusia, atau faktor stimulasi
lating bioassay yang dapat mengkompensasi
aktivitas menetralisir. Untuk mengatasi masalah ini,
serum pasien juga harus diuji sebagai kontrol. IgG-
serum yang terkuras juga harus diuji untuk menetralisir
aktivitas untuk mengidentifikasi faktor penetralisir selain
antibodi. Karakterisasi lebih lanjut dari antibodi
dapat mencakup evaluasi Ig isotipe dan afinitas.
PERMASALAHAN TERKAIT DENGAN
ANTIBODI MONOCLONAL
Pemikiran tentang imunogenisitas mono-
antibodi klonal mengalami paradigma yang sama
IMMUNOGENISITAS PROTEIN TERAPIUTER
129
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 148
bergeser seperti yang terjadi dengan protein terapi pada umumnya.
Generasi pertama antibodi monoklonal adalah dari
asal murine. Mereka menginduksi respon imun pada
mayoritas pasien sebagai protein asing seharusnya
memicu respons imun tipe vaksin klasik.
Ini disebut antibodi antimurine manusia (HAMA)
respon adalah batasan utama dalam klinis
Keberhasilan antibodi murine ini. Selama bertahun-tahun,
Namun, metode diperkenalkan untuk memanusiakan
antibodi monoklonal dalam berbagai tahap (lihat
Bab 15). Teknologi DNA rekombinan digunakan
untuk menukar bagian konstan murine dari kekebalan tubuh
rantai globulin dengan rekan manusia mereka
menghasilkan antibodi monoklonal chimeric. Itu
Langkah selanjutnya adalah mencangkokkan saling melengkapi murine
menentukan wilayah (CDR), yang menentukan
spesifisitas, menjadi tulang punggung globulin imun manusia
menciptakan antibodi monoklonal yang dimanusiakan. Dan itu
langkah terakhir adalah pengembangan hewan transgenik.
mals, teknologi tampilan fage, dan pengembangan lainnya
opments memungkinkan produksi manusia
antibodi monoklonal.
Namun, anggapan bahwa manusia
antibodi klonal tidak memiliki imunogenisitas
terbukti salah. Meskipun humanisasi telah
mengurangi imunogenisitas, bahkan sepenuhnya manusia
antibodi monoklonal telah terbukti menginduksi
antibodi. Pengenalan antibodi chimeric oleh
pertukaran daerah konstan murine dengan
rekan manusia mereka telah menghasilkan substansial
pengurangan induksi antibodi. Apakah
humanisasi lebih lanjut telah menghasilkan tambahan
penurunannya kurang jelas. Seperti yang dibahas, kehadiran
agregat telah diidentifikasi sebagai penyebab utama
imunogenisitas protein terapeutik manusia. ini
kemungkinan bahwa dengan antibodi monoklonal manusia
gerbang juga bertanggung jawab untuk induksi antibodi.
Bahkan dalam studi klasik toleransi sel-B
dilakukan lebih dari 40 tahun yang lalu
persiapan globulin digunakan untuk memecah toleransi
(Weigle, 1971).
Antibodi monoklonal memiliki sifat, yaitu
dapat berkontribusi pada imunogenisitasnya. Mereka bisa
mengaktifkan sel-T sendiri dan dapat meningkatkan
respon imun oleh fungsi Fc mereka seperti
aktivasi makrofag dan aktivasi komplemen.
Memang penghapusan rantai glikosil N-linked dari
Bagian Fc dari imunoglobulin dapat mengurangi Fc
berfungsi dan menyebabkan imunogenisitas berkurang.
Apa yang mengikat antibodi juga mempengaruhi
cing imunogenisitas mereka. Antibodi monoklonal
penargetan antigen terikat sel menginduksi tingkat yang lebih tinggi
pembentukan antibodi dibandingkan dengan yang beredar
target. Antibodi monoklonal diarahkan ke antigen
sel imun dengan tujuan menginduksi kekebalan tubuh
penindasan juga menekan respons imunogenik.
Meskipun lebih banyak suntikan dan dosis yang lebih tinggi
terkait dengan respon imun yang lebih tinggi, pada beberapa orang
kasus pengobatan kronis dan dosis yang lebih tinggi
dilaporkan kurang imunogenik daripada episodik
pengobatan dan dosis yang lebih rendah. Penafsiran ini
data sulit karena dalam perawatan ini
kondisi tingkat produk yang beredar lebih tinggi
dan lebih gigih serta adanya sirkulasi
antibodi monoklonal selama waktu darah
pengambilan sampel dapat menutupi deteksi
tubuh. Hanya beberapa penelitian yang dilakukan
rute administrasi dan subkutan dari intravena
trasi antibodi monoklonal dibandingkan
menunjukkan sedikit perbedaan dalam imunogenisitas.
Status kekebalan tubuh pasien mempengaruhi
respon antibodi seperti dengan terapi protein lainnya.
Banyak pasien yang menerima antibodi monoklonal
kekebalan tubuh terganggu oleh penyakit seperti kanker
atau dengan pengobatan penekan kekebalan tubuh dan kurang
kemungkinan menghasilkan antibodi dibandingkan pasien dengan a
status kekebalan normal. Terkadang supresi imun
agen sive seperti metotreksat diberikan kepada pasien
dengan tujuan menghambat respon antibodi.
Aspek penting lainnya ketika mempelajari
imunogenisitas antibodi monoklonal adalah waktu
pengambilan sampel darah pasien. Produk-produk ini memiliki
waktu paruh relatif lama (beberapa minggu) dan sirkulasi
produk dapat mengganggu deteksi
antibodi yang diinduksi dan dapat menyebabkan false-negative
hasil. Pengambilan sampel serum hingga 20 minggu setelah pasien
mungkin telah menerima suntikan terakhir
hindari gangguan sirkulasi monoklonal
antibodi. Juga antibodi alami, reseptor larut,
dan kompleks imun dapat mengganggu tes
dan mengarah pada false-positive atau false-negative
hasil (seperti yang dijelaskan di atas).
EFEK KLINIS ANTIBODI INDUK
Meskipun ada kelemahan metodologis, daftar
produk protein dengan kekebalan yang relevan secara klinis
efek samping genik sedang tumbuh. Yang paling umum
konsekuensinya adalah hilangnya kemanjuran. Terkadang kerugian ini bisa
diatasi dengan menambah dosis atau mengganti ke
produk lain.
Komplikasi yang paling dramatis dan tak terbantahkan
terjadi ketika antibodi terhadap produk bersilangan
menetralisir faktor endogen dengan faktor penting
fungsi biologis. Ini telah dijelaskan untuk a
pertumbuhan megakaryocyte dan faktor diferensiasi
yang menginduksi antibodi yang bereaksi silang dengan endo-
trombopoietin genus (Tabel 1). Relawan dan
pasien dalam uji klinis mengembangkan trombo parah
sitopenia dan membutuhkan transfusi trombosit. Karena
dari komplikasi ini produk ditarik dari
pengembangan lebih lanjut.
130
SCHELLEKENS DAN JISKOOT
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 149
Baru-baru ini kebangkitan PRCA (lihat di atas)
terkait dengan perumusan perubahan epoetin-a
dipasarkan di luar Amerika Serikat terjadi. Itu
antibodi yang disebabkan oleh produk menetralkan
eritropoietin endogen residual pada pasien ini
mengakibatkan anemia parah yang hanya bisa terjadi
diobati dengan transfusi darah.
Antibodi juga dapat mempengaruhi efek samping
protein terapi. Konsekuensinya tergantung
pada penyebab efek samping. Jika berdampak buruk
adalah hasil dari aktivitas intrinsik produk
Antibodi dapat mengurangi efek samping, seperti yang terjadi
dengan interferon a-2. Terkadang mitigasi dari
efek samping bahkan merupakan tanda klinis pertama
induksi antibodi.
Dengan beberapa produk efek samping yang ditimbulkan
oleh pembentukan antibodi. Ini secara umum terjadi
ketika produk diberikan dalam jumlah yang relatif tinggi
dosis, seperti dengan beberapa antibodi monoklonal.
Gejala yang disebabkan oleh kompleks imun seperti
hipersensitivitas tipe layed dan serum sickness
terkait dengan tingkat antibodi yang diinduksi.
Efek umum yang disebabkan oleh reaksi imun
untuk protein terapeutik seperti anafilaksis akut,
hipersensitivitas, reaksi kulit, penyakit serum, dll
relatif umum ketika sejumlah besar bukan manusia
protein diberikan. Efek ini relatif
jarang untuk produk turunan bioteknologi modern
yang merupakan protein manusia yang sangat dimurnikan
Tered dalam jumlah yang relatif rendah. Namun sisi ini
efek yang disebabkan oleh respon imun saat ini
masih relatif umum selama perawatan dengan tinggi
dosis antibodi monoklonal.
MEMPREDIKSI DAN MENGURANGI IMUNOGENISITAS
Sebagaimana dibahas mekanisme yang mengarah ke antibodi
induksi oleh protein terapeutik masih belum
sepenuhnya dipahami. Akibatnya tidak mungkin
berdasarkan pengetahuan kami saat ini untuk sepenuhnya memprediksi
imunogenisitas produk baru pada pasien. Untuk
protein nonhuman yang menginduksi kekebalan klasik
respons mune, tingkat nonself adalah relatif
prediktor respons imun. Namun, tidak
prediktor absolut. Terkadang asam amino tunggal
perubahan cukup untuk membuat protein diri tinggi
imunogenik. Dengan protein lain penyelam substansial
Gence dari urutan alami tidak berpengaruh. Untuk
protein asing sejumlah stimulasi in vitro dan
tes mengikat dan model komputasi adl
dianggap sebagai prediktor imunogenisitas. Namun semuanya
tes ini memiliki keterbatasan. Proliferasi sel-T
tes, misalnya, memiliki kelemahan yang banyak
antibodi mampu menginduksi beberapa tingkat sel-T
aktivasi atau menghambat proliferasi sel. Perusahaan-
Algoritma nasional yang memprediksi pengikatan antigen ke
HLA kelas II hanya memberikan informasi terbatas pada
interaksi protein dengan sistem kekebalan tubuh
dan juga epitop yang tidak terdeteksi (Stevanovic, 2005).
Keterbatasan ini juga jelas ketika tes ini
atau algoritma digunakan untuk mengurangi imunogenisitas:
hampir tidak ada bukti klinis yang meyakinkan
pengurangan induksi antibodi yang relevan.
Untuk homolog manusia prediktor terbaik
imunogenisitas adalah adanya agregat dan terhadap
tingkat minor adanya kotoran. Jadi, itu
kualitas protein terapeutik dan formulasinya
adalah faktor penting. Ada juga bukti tentang
imunogenisitas yang disebabkan oleh perubahan formula-
dan pengurangan imunogenisitas dengan menghindari
agregasi dan meningkatkan pemurnian dan formula-
tion (lihat di atas).
Meskipun studi hewan sangat membantu dalam memperoleh
mengontrol serum dan dapat memberikan wawasan tentang kemungkinan
efek klinis imunogenisitas, mereka tidak terlalu
prediktor imunogenisitas yang baik pada pasien. Semua
protein, termasuk homolog manusia, akan masuk
prinsip imunogenik pada hewan. Terkadang binatang
studi dapat membantu untuk mempelajari imunogenik relatif
kota berbagai produk atau formulasi, walaupun
nilai prediktif mereka untuk klinik dipertanyakan.
Bahkan studi monyet tidak sepenuhnya memprediksi
imunogenisitas pada pasien. Beberapa produk yang
imunogenik pada primata bukan manusia tidak menginduksi
antibodi pada manusia dan sebaliknya.
Model hewan untuk mempelajari faktor-faktor penting
untuk melanggar toleransi adalah tikus transgenik
membawa gen untuk protein manusia (Hermeling
et al., 2005). Hewan-hewan ini memiliki toleransi imun
sebanding dengan toleransi imun pada pasien.
Hewan-hewan ini juga telah berhasil digunakan
mengidentifikasi epitop baru dalam produk yang dimodifikasi. Meskipun
hewan transgenik telah terbukti penting
alat ilmiah, pengalaman masih terlalu terbatas
klaim mereka dapat berfungsi untuk sepenuhnya memprediksi manusia
tanggapan.
n Mengurangi Immunogenisitas
Beberapa strategi sedang diterapkan untuk mengurangi dampak
Munogenisitas selain mengubah asam amino
urutan produk. Menghubungkan protein dengan polimer
seperti polietilen glikol (lihat Bab 5) dan rendah
dekstran berbobot molekul mengurangi imunogenisitas.
Namun, modifikasi ini juga membuat mol
kapsul kurang aktif, memerlukan dosis lebih tinggi. Ini
dan peningkatan waktu paruh mereka memperpanjang paparan
sistem kekebalan tubuh, yang dapat meningkatkan kekebalan tubuh
potensi genik. Pendekatan lain adalah mengurangi
respon imunogenik dengan terapi imunosupresif
KASIH. Selain itu, induksi toleransi sedang dilakukan
diterapkan, misalnya, pada pasien hemofilia dengan antibodi
ke faktor VIII.
IMMUNOGENISITAS PROTEIN TERAPIUTER
131
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 150
KESIMPULAN
Poin terpenting dari bab ini adalah
diringkas sebagai berikut:

Imunogenisitas protein terapeutik adalah a
Fenomena yang umumnya terjadi

Konsekuensi klinis dapat bervariasi

Sistem deteksi yang divalidasi sangat penting untuk dipelajari
imunogenisitas protein terapeutik

Prediksi imunogenisitas pada pasien
berdasarkan karakterisasi fisikokimia dan
Penelitian pada hewan tidak mudah

Proses pengaturan untuk protein terapi baru
sekarang termasuk evaluasi imunogenisitas

Masih banyak yang harus dipelajari tentang mengapa dan bagaimana
pasien menghasilkan antibodi terhadap protein terapeutik
REFERENSI
Bachmann MF, Rohrer UH, Kundig TM, Burki K,
Hengartner H dan Zinkernagel RM. (1993). Itu
pengaruh organisasi antigen pada respon sel-B
kepekaan. Sains 262: 1448–51.
Casadevall N, Nataf J, Viron B, dkk. (2002). Sel darah merah murni
aplasia dan antibodi antierythropoietin pada pasien
diobati dengan erythropoietin rekombinan. N Engl J
Med 346: 469-75.
Hermeling S, Crommelin DJA, Schellekens H, Jiskoot W.
(2004) Hubungan struktur-imunogenisitas
protein terapi. Pharm Res 21: 897–903.
Hermeling S, Jiskoot W, Crommelin DJA, Bornaes C,
Schellekens H. (2005). Pengembangan transgenik
model tikus yang toleran terhadap interferon manusia
b. Pharm Res 22: 847–51.
Mire-Sluis AR, Barrett YC, Devanarayan V, dkk. (2004).
Rekomendasi untuk desain dan optimalisasi
immunoassays digunakan dalam pendeteksian anti-host
badan terhadap produk bioteknologi. J Immunol
Metode 289: 1–16.
Moore WV, Leppert P. (1980) Peran manusia agregat
hormon pertumbuhan (hGH) dalam pengembangan antibodi
ke hGH. J Clin Endocrinol Metab 51: 691–97.
Ryff JC. (1997). Investigasi klinis imunogenik
kota interferon-a2a. J Interferon Cytokine Res
17: 529–533.
Schellekens H. (2002). Bioequivalence dan immunogeni-
kota biofarmasi. Nat Rev Obat Discov
1: 1–7.
Stevanovic S. (2005). Pemrosesan antigen dapat diprediksi: Dari
gen ke epitop sel T. Transpl Immunol 14: 171–4.
Weigle WO. (1971) Pengamatan dan konsep terbaru di Indonesia
ketidak responsif imunologis dan autoimunitas.
Clin Exp Immunol 9: 437-47.
BACAAN LEBIH LANJUT
Hermeling S, Crommelin DJA, Schellekens H, Jiskoot W.
(2007). Imunogenisitas protein terapeutik. Di: Gad
SC, ed. Buku Pegangan Bioteknologi Farmasi.
Hoboken, NJ: John Wiley & Sons, 911–31.
Schellekens H, Crommelin
D, Jiskoot W
(2007).
Imunogenisitas terapi antibodi. Di: Dübel
S, ed. Buku Pegangan Antibodi Terapi. Weinheim,
Jerman: Wiley-VCH, 267–76.
132
SCHELLEKENS DAN JISKOOT
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 151

7
Genomics, Teknologi “Omics” Lainnya,
Obat yang Dipersonalisasi, dan Tambahan
Teknik Terkait Bioteknologi
Robert D. Sindelar
Universitas British Columbia, Vancouver, British Columbia, Kanada
PENGANTAR
Bioteknologi farmasi dan hasil produk-
untuk bioteknologi terus tumbuh di
tingkat eksponensial. Perhatikan bahwa 2005 adalah pengaturan catatan
tahun dengan Administrasi Makanan dan Obat-obatan AS
(FDA) menyetujui 21 produk biofarmasi.
Ada 15 persetujuan FDA pada tahun 2004, 20 pada tahun 2003, dan
13 tahun 2002 sejak edisi terakhir buku pelajaran ini (Rader
2006; Staf, 2006). Awal 2006 melihat persetujuan beberapa
entitas biofarmasi baru yang unik termasuk a
vaksin rekombinan secara luas dipuji sebagai vaksin pertama
untuk pencegahan terkait virus onkogenik
kanker. Namun, hingga saat ini, teknik yang dibuat
tersedia oleh kemajuan dalam biologi molekuler dan
bioteknologi yang telah disediakan saat ini disetujui
agen terapi umumnya jatuh ke dalam dua area luas:
teknologi DNA rekombinan (rDNA) dan hibridoma
teknik (untuk menghasilkan antibodi monoklonal). Itu
teknologi yang memicu under- kami melebar
berdiri fungsi dan penyakit sel manusia
proses sedang mengalami evolusi eksplosif.
Banyak bioteknologi tambahan dan inovatif,
telah, dan akan terus dikembangkan secara berurutan
untuk memanen informasi yang ditemukan dalam genom manusia.
Kemajuan teknologi ini akan memberikan yang lebih baik
pemahaman tentang hubungan antara genetika
dan fungsi biologis, mengungkap penyebab yang mendasarinya
penyakit, mengeksplorasi hubungan variasi genomik
dan respon obat, meningkatkan penelitian farmasi,
dan memicu penemuan dan pengembangan baru dan
biofarmasi baru. Teknologi revolusioner ini
nologi dan teknologi terkait bioteknologi tambahan
pertanyaan meningkatkan yang sangat kompetitif dan mahal
proses pengembangan obat agen obat baru,
diagnostik dan perangkat medis. Beberapa teknologi
keduanya adalah teknik dan teknik yang dijelaskan dalam bab ini
aplikasi mapan dan umum digunakan
bioteknologi yang menghasilkan potensi terapi
saluran sekarang dalam pengembangan termasuk uji klinis. Masih
semakin banyak aplikasi yang berkembang saat Anda membaca teks ini.
Dampaknya penuh pada masa depan kedokteran molekuler
belum dibayangkan.
Tidak ada diskusi yang berarti tentang farmasi
bioteknologi dan perawatan kesehatan abad ke-21 dapat terjadi
tanpa menyebutkan teknologi "omics". Penelitian di
genomik dan proteomik diberitakan sebagai yang berikutnya
sumber pasokan penting obat masa depan yang inovatif
target desain. Dengan Proyek Genom Manusia
(HGP) mendekati penutupan dengan cepat, para peneliti
beralih ke tugas mengubah
Urutan DNA data menjadi informasi yang akan
berpotensi meningkat, dan bahkan mungkin merevolusi,
penemuan obat (Gbr. 1) dan perawatan farmasi.
Ilmuwan farmasi siap mengambil keuntungan
terobosan ilmiah ini dengan memasukkan negara-
of-the-art teknik genomik dan proteomik bersama
dengan teknologi terkait yang digunakan dalam bioinfor-
Matics, metabonomics / metabolomics, sistem biol-
ogy, pharmacogenomics, toxicogenomics, glycomics,
dan genomik kimia menjadi penemuan obat baru,
pengembangan, dan paradigma terjemahan klinis.
Teknik seperti rekayasa genetika
mals (termasuk hewan transgenik, tanaman transgenik,
dan tikus knockout), rekayasa protein, peptida
kimia dan peptidomimetik, terapi sel dan
Terapi Terapan: Penggunaan Klinik
Obat-obatan ( Koda-Kimble, MA, et al., Eds. ) , Edisi ke-8,
Williams & Wilkins, Baltimore 2005 : Bab 5.
Farmakoterapi: Suatu Pendekatan Patofisiologis
( DiPiro, JT, et al., Eds. ) , Edisi ke-6, McGraw-Hill,
New York 2005 : Bab 6, 10.
Buku Pelajaran Terapi: Obat dan Penyakit
Manajemen ( Helms, RA, et al., Eds. ) , Edisi ke-8,
Lippincott Williams & Wilkins, Baltimore 2006 :
Bab 2, 4, 7.
Informasi lebih lanjut tentang farmakoterapi terapan
terkait dengan teknologi "omics" dan / atau yang dipersonalisasi
obat-obatan dapat ditemukan dalam berikut ini sering digunakan
buku teks:
INFORMASI FARMAKOTERAPI
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 152
obat regeneratif secara langsung mempengaruhi
ilmu farmasi dan diposisikan dengan baik
untuk mempengaruhi secara signifikan medis modern dan farmasi
perawatan ceutical. Teknik tambahan ini dalam biotek
nologi dan biologi molekuler sedang berkembang pesat
dieksploitasi untuk membawa obat baru ke pasar.
Bukan maksud penulis ini untuk merinci masing-masing
dan setiap teknik bioteknologi secara mendalam, sejak itu
banyak sumber daya khusus sudah memenuhi itu
perlu. Sebaliknya, bab ini akan menggambarkan dan menghitung
memakan berbagai bioteknologi yang seharusnya menjadi kunci
menarik bagi siswa farmasi, berlatih apoteker,
dan ilmuwan farmasi karena efeknya
pada banyak aspek farmasi.
PENGANTAR TEKNOLOGI "OMICS"
Sejak penemuan struktur keseluruhan DNA pada tahun 1953,
komunitas ilmiah dunia terus berlanjut
mendapatkan pemahaman yang lebih baik tentang informasi genetik
dikodekan oleh DNA dan informasi genetik yang dibawa
oleh sel atau organisme. Pada 1980-an dan 1990-an,
teknik bioteknologi menghasilkan terapi baru
dan banyak informasi tentang mekanisme
berbagai penyakit seperti kanker. Namun etiologi
banyak penyakit lain, termasuk obesitas dan jantung
penyakit, tetap tidak diketahui pada genetik dan
tingkat molekuler, tidak menunjukkan target serangan yang jelas
dengan obat molekul kecil atau yang diproduksi bioteknologi
agen terapi. Jawabannya tersembunyi dalam apa
tidak diketahui tentang genom manusia. Meskipun
meningkatkan pengetahuan tentang struktur dan fungsi DNA
pada 1990-an, genom, seluruh kumpulan gen
dan semua DNA fungsional dan non-fungsional lainnya
urutan dalam inti suatu organisme, belum
diurutkan. DNA mungkin yang terbesar, secara alami
molekul yang dikenal dikenal. Berhasil memenuhi
Tantangan mengurutkan seluruh genom manusia adalah
salah satu tonggak sejarah dan pemberita besar
potensial (Venter et al., 2001; The Genome International
Sequencing Consortium, 2001). Sedangkan kode genetik
untuk transkripsi dan terjemahan telah dikenal
tahun, sekuensing genom manusia menyediakan
cetak biru untuk semua protein manusia dan urutan
semua elemen regulasi yang mengatur perkembangan
interpretasi genom. Signifikansi potensial
termasuk mengidentifikasi penentu genetik yang sama
dan penyakit langka, menyediakan metodologi untuk mereka
diagnosis, menunjukkan situs molekul baru yang menarik
untuk intervensi (Gbr. 1), dan pengembangan baru
bioteknologi untuk membawa pemberantasan mereka.
Membuka kunci rahasia genom manusia dapat menyebabkan
untuk perubahan paradigma dalam praktik klinis menuju benar
obat molekuler yang ditargetkan dan spesifik pasien
terapi.
n Genomik
Mengurutkan genom manusia dan genom
organisme lain telah menyebabkan peningkatan
berdiri biologi dan penyakit manusia. Banyak
analis industri memperkirakan tiga kali lipat dari farmasi
Produktivitas litbang Tical karena pengurutan
genom manusia (Williams, 2007). Keberhasilan sampai saat ini
terbatas dan ada perdebatan signifikan mengenai
dampak genomik pada penemuan obat yang berhasil dan
pengembangan (Nirmala, 2006; Caldwell et al., 2007).
Validasi target obat yang layak diidentifikasi oleh
genomik telah menantang (Bagowski, 2005). Sebuah
konsep yang menarik adalah bahwa dari genom "druggable"
(Hopkins and Groom, 2002). Ini adalah perkiraan 600
hingga 1.500 target molekul yang valid untuk penemuan obat, seperti
dinilai sebagai persimpangan dari jumlah manusia
gen yang diidentifikasi terkait dengan penyakit dengan subset dari
produk genom manusia yang dapat dimodulasi
oleh target molekul kecil. Namun, genomiknya
Revolusi telah menjadi dasar untuk ledakan di Indonesia
"Omics" teknologi yang menemukan aplikasi dalam penelitian
untuk mengatasi penyakit yang terabaikan.
Urutan genom manusia
mengidentifikasi urutan gen
Genomik fungsional (dan SNP)
mengidentifikasi fungsi gen pada penyakit yang menarik
Proteomik / bioinformatika
mengidentifikasi produk gen yang terlibat dalam penyakit yang menarik
Produksi protein
menghasilkan target protein potensial (molekul baru
situs untuk intervensi) untuk penyakit yang menarik
Penemuan ligan
mengidentifikasi molekul yang mengikat target protein
dalam penyakit yang menarik
Validasi target, bioassay ligan,
optimasi ligan
buktikan target protein kritis terhadap penyakit yang diminati, buktikan
Pengikatan ligan mempengaruhi target protein secara tepat,
memodifikasi struktur ligan secara logis untuk mengoptimalkan potensi
efek terapeutik
Entitas obat baru dengan mekanisme aksi baru
Gambar 1 n Strategi genomik untuk penemuan obat baru.
134
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 153
Genomik Struktural dan Manusia
Proyek Genom
Genomik adalah studi komparatif yang lengkap
urutan genom dan fungsinya dari berbeda
organisme (Caldwell et al., 2007). Awalnya, genetik
Analisis difokuskan pada genomik struktural, pada dasarnya
karakterisasi struktur genom.
Genomik struktural memotong teknik
Sequencing DNA, kloning, PCR, ekspresi protein,
kristalografi, dan analisis data. Ini berfokus pada
aspek fisik genom melalui konstruksi
tion dan analisis urutan gen dan peta gen.
Diusulkan pada akhir 1980-an, HGP yang didanai publik
atau Human Genome Initiative (HGI) secara resmi
sanksi pada Oktober 1990 untuk memetakan struktur dan
untuk mengurutkan DNA manusia (Collins dan Galas, 1993;
Cantor dan Smith, 1999). Seperti dijelaskan dalam Tabel 1, HGP
genomik struktural diperkirakan akan dilanjutkan
melalui peningkatan tingkat resolusi genetik:
peta hubungan genetik manusia berekor [sekitar 2
resolusi megabase pasangan (Mb = juta pasangan basis)],
melengkapi peta fisik (resolusi 0.1Mb), dan
akhirnya menyelesaikan urutan DNA dari pendekatan-
hampir 3,5 miliar pasangan basa (2, 3 pasang krom
somes) dalam nukleus sel manusia [1 pasangan basa (bp)
resolusi] (Griffiths et al., 2000). Diproyeksikan untuk
selesai pada tahun 2003, tujuan proyek adalah untuk
belajar tidak hanya apa yang terkandung dalam kode genetik,
tetapi juga bagaimana "menambang" informasi genomik untuk
menyembuhkan atau membantu mencegah sekitar 4.000 genetik
penyakit yang menimpa umat manusia. Pada Mei 1999, 700
juta pasangan basa genom manusia
disimpan di arsip publik. Setelah hanya lima belas
berbulan-bulan studi tambahan, angkanya telah meningkat
hingga lebih dari 4 miliar pasangan basa (Pennisi, 2000). Dua
tahun lebih awal dari yang diproyeksikan, tonggak sejarah dalam genom
sains dicapai pada 26 Juni 2000, ketika
peneliti di Celera Genomics yang didanai secara pribadi
dan Genome International yang didanai publik
Sequencing Consortium (kolaborasi internasional
yang terkait dengan HGP) bersama - sama mengumumkan hal itu
mereka telah menyelesaikan urutan 97% hingga 99% dari
gen manusia. Jurnal Science menilai pemetaan tersebut
genom manusia sebagai "terobosan
tahun ”dalam edisi 22 Desember 2000. Kedua kelompok
menerbitkan hasil mereka pada tahun 2001 (Venter et al., 2001; The
Genome International Sequencing Consortium, 2001).
Strategi sekuensing genom dari HGP
dan Celera Genomics berbeda (Brown, 2000). HGP
menggunakan pendekatan "shotgun bersarang". Manusia
Urutan DNA “dicincang” ke dalam segmen yang pernah ada
ukuran berkurang dan segmen dimasukkan ke kasar
memesan. Setiap segmen selanjutnya "meledak" menjadi kecil
fragmen. Setiap fragmen kecil diurutkan dan
fragmen berurutan berkumpul sesuai dengan mereka
urutan relatif dikenal. Para peneliti Celera em-
menggunakan pendekatan "seluruh senapan" di mana mereka
“Menghancurkan” seluruh genom menjadi fragmen-fragmen kecil.
Setiap fragmen diurutkan dan disusun secara berurutan
dengan mengidentifikasi di mana mereka tumpang tindih. Setiap pendekatan
diperlukan sumber daya komputer yang belum pernah ada sebelumnya (bidangnya
bioinformatika dijelaskan nanti dalam bab ini).
Terlepas dari strategi sekuensing genom, the
hasil kolektif sangat mengesankan. Lebih dari 27 juta
pembacaan urutan kualitas tinggi disediakan lima kali lipat cover-
umur seluruh genom manusia. Studi genomik
telah mengidentifikasi lebih dari 1 juta nukleotida tunggal
polimorfisme (SNP), elemen biner genetik
variabilitas (SNP dijelaskan nanti dalam bab ini).
Sedangkan perkiraan aslinya dari jumlah manusia
gen dalam genom bervariasi secara konsisten
80.000 hingga 120.000, para peneliti genom meluncurkan a
jumlah yang jauh dari prediksi ahli biologi; 32.000
(Venter et al., 2001; Genome International
Tujuan proyek genom manusia
Pasangan basa
resolusi
Peta keterkaitan genetik terperinci
Komentar: Resolusi termiskin; menggambarkan lokasi kromosom relatif dari penanda DNA, gen, atau lainnya
spidol dan jarak di antara mereka pada setiap kromosom.
2 Mb a
Peta fisik lengkap
Komentar: Alih-alih jarak relatif antara penanda, memetakan jarak fisik aktual dalam pasangan basa
antara penanda; resolusi lebih rendah = ketaatan sebenarnya dari pita kromosom di bawah mikroskop; lebih tinggi
resolusi adalah "peta restriksi" yang dihasilkan di hadapan enzim restriksi.
0,1 Mb
Urutan DNA lengkap
Komentar: Tujuan akhir; tentukan urutan dasar gen dan marka yang ditemukan dalam pemetaan
teknik bersama dengan segmen lain dari seluruh genom; teknik yang biasa digunakan termasuk DNA
metode amplifikasi seperti kloning, PCR dan teknik lain yang dijelaskan dalam Bab 1 bersama dengan novel
teknik sequencing dan bioinformatika.
1 bp b
a Mb = megabase = 1 juta pasangan basa; b bp = pasangan basa.
Tabel 1 n Meningkatnya tingkat resolusi genetik yang diperoleh dari studi genomik struktural HGP.
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
135
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 154
Sequencing Consortium, 2001). Dalam beberapa bulan, yang lain
menyarankan bahwa genom manusia memiliki antara
65.000 dan 75.000 gen (Wright et al., 2001).
Sekitar 25.000 gen sekarang paling sering dikutip
number (Lee et al., 2006).
Fokus proyek genomik struktural baru
menurunkan biaya rata-rata penentuan struktur
sementara mengukur struktur novel dengan urutan langsung
perbandingan (Chondonia dan Brenner, 2006). Gerakan
menuju biaya rendah, urutan proses tinggi
penting untuk implementasi genomik dalam
laboratorium klinis kedokteran perorangan. $ 1000
(AS) genom tetap menjadi target.
Genomik Fungsional dan Komparatif
Sekarang urutan dari seluruh genom adalah a
realitas, tugas memilah-milah manusia, patogen
dan faktor keanekaragaman organisme lainnya dan yang berkorelasi
mereka dengan data genom untuk menyediakan obat-obatan nyata
manfaat tical adalah bidang penelitian aktif (Kramer dan
Cohen, 2005). Pipa obat perusahaan farmasi
baris penuh dengan agen terapi yang menjanjikan
mengarah, sebagian besar karena penerapan
bioteknologi untuk proses penemuan. Dukungan awal-
proyek genom manusia mencirikannya sebagai a
obat mujarabaga potensial yang cepat akan menambah
pipa. Namun, upaya untuk menerjemahkan genomik
urutan data dari genomik struktural menuju
fungsi biologis telah diprediksi memicu
penutup dari atas bangku ke samping tempat tidur pasien.
Ini membutuhkan pemahaman gen apa
lakukan, bagaimana mereka diatur, dan hubungan langsung
antara gen dan aktivitasnya. Urutan DNA
informasi itu sendiri jarang memberikan informasi definitif
tentang fungsi dan regulasi itu
gen tertentu. Namun ada harapan yang melengkapi
urutan genom manusia akan secara dramatis
ubah pencegahan, pengobatan, dan bahkan definisi kita
penyakit (Temple et al., 2001). Studi tentang
genomik fungsional diharapkan memainkan peran kunci dalam
identifikasi dan validasi target obat baru
(Caldwell et al., 2007). Setelah sekuensing genom, ini
pendekatan adalah langkah selanjutnya dalam rantai pengetahuan untuk
mengidentifikasi produk gen fungsional yang potensial
sadapan obat biotek dan target penemuan obat baru
(Gbr. 1). Genomik fungsional berfokus pada genom-lebar
pola ekspresi gen, mekanisme yang dengannya
ekspresi gen terkoordinasi, dan keterkaitan-
kapal ekspresi gen ketika lingkungan seluler
perubahan mental terjadi.
Untuk menghubungkan genomik fungsional dengan terapi
hasil klinis, urutan genom manusia harus
mengungkap ribuan variasi genetik di antaranya
individu yang akan menjadi terkait dengan penyakit
seumur hidup pasien. Sekuensing sendiri bukan
akhirnya, hanyalah akhir dari awal genomik
era kedokteran. Menentukan fungsionalitas gen dalam
organisme membuka pintu untuk menghubungkan penyakit
gen atau protein tertentu, yang menjadi target
obat baru, metode untuk mendeteksi organisme (yaitu, baru
agen diagnostik), dan atau biomarker (keberadaan atau
perubahan profil ekspresi gen yang berkorelasi dengan
risiko, perkembangan atau kerentanan suatu penyakit).
Wajah biologi telah berubah selamanya dengan
pengurutan genom berbagai organisme.
Bioteknologi diterapkan pada urutan
genom manusia juga digunakan untuk urutan
genom organisme yang relatif sederhana
serta mamalia lainnya. Seringkali, protein dikodekan oleh
genom organisme yang lebih rendah dan regulasi
gen-gen itu sangat mirip dengan protein dan gen
regulasi pada manusia. Karena organisme model banyak
lebih mudah dirawat di laboratorium, para peneliti
secara aktif mengejar studi genomik "komparatif"
(Clark, 1999; Hardison, 2003). Membuka kunci data genom
untuk masing-masing organisme ini memberikan wawasan yang berharga
ke dalam dasar molekuler penyakit manusia yang diwariskan
(Karow, 2000). S. cerevisiae adalah model yang baik untuk belajar
kanker dan merupakan organisme umum yang digunakan dalam rDNA
metodologi. Sebagai contoh, telah menjadi terkenal
bahwa wanita yang mewarisi mutasi gen dari BRCA1
gen memiliki risiko tinggi, mungkin setinggi 85%, dari
mengembangkan kanker payudara sebelum usia 50 (sumber:
www.ncbi.nlm.nih.gov). Produk diagnostik pertama
dihasilkan dari data genom adalah tes BRCA1 untuk
kecenderungan kanker payudara. Produk gen dari
BRCA1 adalah protein yang ditandai dengan baik terlibat dalam
kanker payudara dan ovarium. Bukti memiliki akumulasi
terlambat menunjukkan bahwa protein Rad9 dari S. cerevisiae adalah
jauh, tetapi secara signifikan, terkait dengan BRCA1
protein. Lalat buah memiliki gen yang mirip dengan p53,
gen penekan tumor manusia. Mempelajari C. elegans
telah memberikan banyak pengetahuan awal kami tentang
apoptosis, proses biologis normal dari
sel kematian grammed. Lebih besar dari 90% protein
diidentifikasi sejauh ini dari hewan laboratorium yang umum,
mouse, memiliki kesamaan struktural yang diketahui
protein manusia. Memetakan seluruh kanker manusia
genom sel akan menunjukkan dengan tepat gen yang terlibat dalam kanker
dan membantu dalam memahami perubahan sel dan
pengobatan keganasan manusia (Collins dan Barker,
2007). Urutan pengkodean konsensus manusia
kanker payudara dan kolorektal telah dijelaskan.
Kanker Lembaga Kesehatan Nasional AS (NIH)
Genome Atlas adalah salah satu proyek semacam itu.
Tidak semua studi genomik komparatif mencari
untuk kemiripan dengan genom manusia. Sebagai contoh,
beberapa dapat memberikan dasar untuk membuat dan
target potensial antibiotik dan antivirus baru untuk
desain obat (Guild, 1999). Genomik komparatif adalah
sedang digunakan untuk menyediakan kompilasi gen itu
kode untuk protein yang penting untuk pertumbuhan atau
136
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 155
viabilitas organisme patogen, namun berbeda dari yang lain
protein manusia. Upaya seluruh dunia untuk mengurutkan
sindrom pernafasan akut yang parah (SARS) terkait
Genom coronavirus adalah salah satu contoh yang akan membantu
diagnosis, penemuan antivirus, dan pengembangan vaksin
ment (Marra et al., 2003). Menjamin toksisitas selektif terhadap
organisme, bukan pasien manusia, genomik ini
penambangan target baru untuk desain obat dapat membantu
mencari antibiotik baru di lingkungan klinis
meningkatnya insiden resistensi antibiotik.
Perbankan DNA, pengumpulan, penyimpanan, dan
analisis ratusan ribu spesimen
mengandung DNA yang dapat dianalisis, terbukti menjadi a
alat yang berharga untuk penelitian genetika (Thornton et al.,
2005). Semua sel berinti, termasuk sel dari darah,
folikel rambut, apusan bukal, biopsi kanker, dan urin
spesimen, adalah spesimen yang cocok untuk analisis DNA
di masa kini atau nanti. Bank-bank ini punya
menjadi sumber daya berharga untuk penemuan baru
dan peningkatan perawatan medis pada beberapa penyakit
menyatakan, terutama kanker.
Epigenomik
Menggunakan pendekatan seluruh genom, epigenomik adalah
studi efek genetik lingkungan atau perkembangan
seperti metilasi DNA, pada fungsi gen. Demikian,
epigenomics berfokus pada gen-gen yang fungsinya
ditentukan oleh faktor eksternal. Epidemiologis
bukti semakin menunjukkan bahwa faktor eksternal
termasuk paparan lingkungan di awal pengembangan
ment memiliki peran dalam kerentanan penyakit (Jirtle dan
Skinner, 2007).
n Teknologi Pengaktifan “Omics”: Bioinformatika
Genomik struktural, genomik fungsional, proteomik,
dan teknologi "omic" lainnya telah menghasilkan
volume data genetik dan biokimia yang sangat besar
toko. Seluruh urutan DNA manusia yang disandikan
sendiri membutuhkan penyimpanan komputer sekitar 10 9
bit informasi: setara dengan seribu 500-
buku halaman! GenBank (dikelola oleh National
Pusat Informasi Bioteknologi, NCBI, dari
Institut Kesehatan Nasional), Eropa
Laboratorium Biologi Molekuler (EMBL), dan
Bank Data DNA Jepang (DDBJ) adalah tiga di antaranya
banyak pusat di seluruh dunia yang berkolaborasi dalam mengumpulkan
Urutan DNA. Bank data ini, (baik publik dan
pribadi) menyimpan puluhan juta sekuens (Martin
et al., 2007). Database metabolik dan koleksi lainnya
data biokimia dan bioaktivitas menambah
kompleksitas dan kekayaan informasi (Olah dan
Oprea, 2007). Setelah disimpan, menganalisis volume
data, (yaitu, membandingkan dan menghubungkan informasi dari
berbagai sumber) untuk mengidentifikasi manfaat dan / atau prediksi
karakteristik atau tren, seperti memilih grup
target obat dari semua protein dalam tubuh manusia,
menyajikan tugas Hercules. Pendekatan ini memiliki
potensi mengubah cara mendasar di mana
ilmu dasar dilakukan dan valid secara biologis
kesimpulan dicapai (Baxevanis, 2001).
Para ilmuwan telah menerapkan kemajuan dalam informasi
teknologi, algoritma perangkat lunak yang inovatif dan
sive parallel computing untuk penelitian yang sedang berjalan di
genetika, genomik, proteomik, dan bidang terkait
melahirkan bidang bioinformatika yang tumbuh cepat
(Emmett, 2000; Felton, 2001; Watkins, 2001; Lengauer
dan Hartman, 2007). Bioinformatika adalah aplikasinya
dari teknologi komputer ke ilmu biologi
dengan objek menemukan pengetahuan. Dengan
bioinformatika, seorang peneliti sekarang dapat mengeksploitasi lebih baik
banjir yang luar biasa dari data genom dan proteomik,
penambangan data yang lebih efektif untuk penemuan obat
"Jarum" dalam data besar "tumpukan jerami." Dalam hal ini,
data mining mengacu pada pendekatan bioinformatika untuk
"Menyaring" melalui volume data mentah, mengidentifikasi
dan menggali informasi yang relevan, dan mengembangkan
hubungan yang bermanfaat di antara mereka. Obat modern
Penemuan akan memanfaatkan teknik bioinformatika untuk
mengumpulkan informasi dari berbagai sumber (seperti
HGP, studi genomik fungsional, proteomik, fenomenal
mengetik, catatan medis pasien, dan hasil bioassay
termasuk studi toksikologi), mengintegrasikan data,
menerapkan algoritma yang dikembangkan ilmu kehidupan, dan menghasilkan
identifikasi target yang berguna dan identifikasi timbal obat
data tion. Tujuan lain dari bioinformatika adalah untuk dapat
untuk mempelajari molekul dan proses yang ditemukan oleh
genomik dan penelitian proteomik dalam silico: yaitu, untuk
dapat memprediksi struktur kimia dan fisik dan
properti oleh komputer (Rashidi dan Buehler, 2000).
Bioinformatika dalam implementasinya yang multi-segi
Tions dapat dianggap sebagai teknik "elektronik
biology ”(eBiology), biologi konseptual, dalam silico biol-
ogy, atau biologi komputasi (Blagosklonny dan
Pardee, 2002). Alat berbasis data, integrasi
bioinformatika dengan pengetahuan fungsional
sistem biologis pleksus yang diteliti masih tetap kritis
dari salah satu teknologi omic yang dijelaskan di atas dan ke
mengikuti. Seperti terlihat pada Gambar 2, hierarki informasi
koleksi jauh melampaui biodata yang terkandung di dalamnya
kode genetik yang ditranskripsi dan diterjemahkan.
n Transkriptomik
Teknologi ini menguji kompleksitas pesan
ger transkrip RNA dari suatu organisme (yaitu, transkrip
tome), di bawah berbagai internal dan eksternal
kondisi yang mencerminkan gen yang sedang aktif
diekspresikan pada waktu tertentu (dengan pengecualian
fenomena degradasi mRNA seperti transkrip
redaman nasional) (Subramanian et al., 2005).
Oleh karena itu, transkriptom dapat bervariasi dengan eksternal
kondisi lingkungan sementara genomnya
kira-kira diperbaiki untuk garis sel yang diberikan (tidak termasuk
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
137
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 156
mutasi). Transkriptom sel induk dan
sel-sel kanker sangat menarik untuk
tahan proses diferensiasi seluler dan
karsinogenesis. Teknik throughput tinggi berdasarkan
teknologi microarray digunakan untuk memeriksa
tingkat ekspresi mRNA dalam populasi sel tertentu.
n Proteomik,
Proteomik Struktural, dan
Proteomik Fungsional
Penelitian genomik fungsional akan menyediakan
penyok sumber daya informasi untuk studi biochem-
jalur ical di tingkat molekuler. Tentunya besar
jumlah ~ 25.000 gen yang diidentifikasi dalam urutan
genom manusia akan ditampilkan secara fungsional
penting di berbagai negara penyakit (lihat druggable
diskusi genom di atas). Ini akan menghasilkan
identifikasi sejumlah besar protein yang terlibat sebagai
memainkan peran penting dalam proses penyakit (Evans, 2003).
Protein-protein kunci yang diidentifikasi ini akan berfungsi sebagai potensi
situs baru untuk intervensi terapeutik (Gbr. 1). Itu
daerah penelitian yang disebut proteomik berusaha untuk mendefinisikan
berfungsi dan menghubungkannya dengan profil ekspresi
semua protein dikodekan dalam genom organisme atau
"Proteome" (Edwards et al., 2000; Kreider, 2001; Voshol
et al., 2007). ~ 25.000 gen manusia dapat diproduksi
100.000 protein. Jumlah, jenis dan konsentrasi
dapat bervariasi tergantung pada jenis sel atau jaringan, keadaan penyakit,
dan faktor lainnya. Fungsi protein adalah
tergantung pada primer, sekunder, dan tersier
struktur protein dan molekul yang berinteraksi
dengan. Kurang dari 20 tahun, konsep proteomik
membutuhkan tekad struktural, biokimia
dan daftar fisiologis semua protein. Proteomik
merupakan tantangan ilmiah yang lebih besar daripada genomik karena
kerumitan ekspresi protein dan kompleksitas
Struktur protein 3-D (struktural proteomik) seperti itu
berkaitan dengan aktivitas biologis (proteomik fungsional)
(Saeks, 2001). Ekspresi protein, isolasi, pemurnian,
identifikasi, dan karakterisasi adalah kuncinya
prosedur yang digunakan dalam penelitian proteomik. Untuk tampil
prosedur ini, platform teknologi seperti gel 2-D
elektroforesis, spektrometri massa, mikro berbasis chip
array (dibahas nanti dalam bab ini), X-ray crystal-
lography (dibahas nanti dalam bab ini), protein
resonansi magnetik nuklir (NMR) (juga dibahas
nanti dalam bab ini), dan tampilan fag digunakan.
Diprakarsai pada tahun 2002, Organisasi Proteome Manusia
(HUPO) baru-baru ini menyelesaikan studi skala besar pertama
untuk mencirikan protein serum dan plasma manusia,
yaitu, serum serum manusia dan plasma (Negara
et al., 2006). Ilmuwan farmasi mengantisipasi hal itu
banyak protein yang diidentifikasi oleh penelitian proteomik
akan sepenuhnya novel, memiliki fungsi yang tidak diketahui.
Skenario ini menawarkan tidak hanya peluang unik untuk
mengidentifikasi target molekuler yang sebelumnya tidak diketahui, tetapi
juga untuk mengembangkan diagnostik ultrasensitif baru ke
mengatasi kebutuhan klinis yang tidak terpenuhi (Petricoin et al., 2002).
Metodologi hari ini tidak memungkinkan kami untuk mengidentifikasi
target obat yang valid dan metodologi diagnostik baru
hanya dengan memeriksa informasi urutan gen.
Namun, “in silico proteomics”, berbasis komputer
prediksi struktur protein 3-D, antarmolekul
interaksi, dan fungsionalitas saat ini sangat aktif
bidang penelitian (Roberts dan Swinton, 2001; Voshol
et al., 2007).
Seringkali, banyak gen dan produk proteinnya
terlibat dalam proses penyakit tunggal. Karena sedikit
protein bertindak sendiri, mempelajari interaksi protein
sangat penting untuk pemahaman fungsional penuh.
Juga, banyak kelainan fungsi sel dapat terjadi
dari ekspresi gen dan / atau protein yang berlebihan,
ekspresi gen dan / atau protein, mutasi gen
menyebabkan protein cacat, dan pasca terjemahan
perubahan modifikasi yang mengubah fungsi protein.
Oleh karena itu, nilai nyata dari urutan genom manusia
data hanya akan direalisasikan setelah setiap protein dikodekan oleh
25.000 gen memiliki fungsi yang ditugaskan padanya.
n Teknologi Pengaktifan “Omics”: Microarrays
Biochip dikenal sebagai microarray DNA dan
microarrays oligonucleotide adalah koleksi permukaan
ratusan hingga ribuan DNA amobil
sekuens atau oligo-nukleotida dalam kotak dibuat dengan
peralatan khusus yang bisa bersamaan
DNA genom
RNA
Protein
Interaksi protein
Jalur informasi
Jaringan informasi
dalam sel
Jaringan informasi
dalam sel
Individu
Populasi
Ekologi
dogma sentral
Tantangan dari
biologi modern
adalah menangkap
dan mengintegrasikan
informasi dari
masing-masing
tingkat hirarkis.
Bioinformatika
menyediakan yang dibutuhkan
sumber daya untuk bertemu
tantangan ini.
Gambar 2 n Tantangan informasi sistem biologi di
era genomik. Sumber: Aderem dan Hood, 2001.
138
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 157
diperiksa untuk melakukan analisis ekspresi (Khan et al.,
1999; Selatan, 2001; Amaratunga et al., 2007).
Biochip dapat mengandung perwakilan dari tertentu
set urutan gen (yaitu, urutan pengkodean untuk semua
isozim sitokrom manusia P450) atau mungkin mengandung
urutan yang mewakili semua gen suatu organisme. Mereka
dapat menghasilkan sejumlah besar informasi genetik
(Butte, 2002; Vaince et al., 2006). Sedangkan in vitro
pasar diagnostik sulit untuk dimasuki, Roche
Diagnostik AmpliChip CYP 450 adalah yang disetujui FDA
alat diagnostik dapat menentukan genotipe pasien
sehubungan dengan dua gen yang mengatur metabolisme obat
lism. Informasi yang diperoleh ini dapat bermanfaat oleh a
dokter untuk memilih obat yang sesuai dan / atau
dosis untuk pasien tertentu di bidang kardiovaskular-
penyakit cular, tekanan darah tinggi, depresi, dan
lain-lain (menurut perusahaan).
Umumnya, array disiapkan pada non-porous
mendukung seperti slide mikroskop kaca. DNA
microarrays umumnya mengandung micro- density tinggi
melihat urutan cDNA sekitar 1Kb di
panjangnya mewakili ribuan gen. Lapangan
telah maju secara signifikan ketika teknologi
dikembangkan untuk mensintesis oligo-nukleo- jarak dekat
pasang pada wafer kaca menggunakan industri semikonduktor
teknik maskot photolithographic (Gbr. 3).
Olarukleotida mikroarray (sering disebut oligonu-
array cleotide atau chip DNA) mengandung jarak dekat
oligonukleotida spesifik gen sintetis mewakili
ribuan sekuens gen. Microarrays dapat
analisis ekspresi vide untuk mRNA. Penapisan
Variasi DNA juga dimungkinkan. Dengan demikian, biochip bisa
menyediakan deteksi polimorfisme dan genotyping sebagai
serta pemantauan ekspresi berbasis hibridisasi.
Analisis microarray telah memperoleh peningkatan sinyal
pentingnya sebagai akibat langsung dari sekuensing genom
studi. Teknologi array adalah alat yang logis untuk belajar
genomik fungsional karena hasil yang diperoleh mungkin terkait
berfungsi untuk berekspresi. Potensi teknologi Microarray
untuk mempelajari bidang-bidang utama kedokteran molekuler dan obat-obatan
Penemuan tidak terbatas pada tahap pengembangan ini. Untuk
Misalnya, tingkat ekspresi gen ribuan mRNA
spesies dapat dipelajari secara bersamaan dalam keadaan normal
versus sel kanker, masing-masing diinkubasi dengan potensi
kandidat obat antikanker. Teknologi microarray terkait
nologies termasuk mikroarray protein, mikroorganisme jaringan
array, microarrays sel (juga disebut transfeksi
microarrays), microarrays senyawa kimia, dan
mikroarray antibodi. Prinsip-prinsipnya sama,
sedangkan koleksi amobil berbeda sesuai.
n TeknologiDiaktifkan “Omics”: Singkat
Pengantar Biomarker
Biomarker adalah zat yang relevan secara klinis digunakan sebagai
indikator keadaan biologis (Shaffer, 2006; DePrimo,
2007). Deteksi atau perubahan konsentrasi a
biomarker dapat mengindikasikan keadaan penyakit tertentu
(misalnya, keberadaan antibodi dapat mengindikasikan suatu
infeksi), fisiologi, atau toksisitas. Perubahan
ekspresi atau keadaan biomarker protein dapat
berkorelasi dengan risiko atau perkembangan suatu penyakit,
dengan kerentanan penyakit terhadap yang diberikan
pengobatan, atau profil keamanan obat. Diimplementasikan
dalam bentuk perangkat medis, diukur
biomarker menjadi alat diagnostik in vitro
(Williams et al., 2006). Meskipun jauh melampaui ini
bab untuk memberikan diskusi rinci tentang
kers, penting untuk dicatat bahwa teknologi omics
termasuk teknologi yang mendukung omics seperti mikro
array sedang dikembangkan sebagai pengukuran klinis
perangkat untuk biomarker. Biomarker mengaktifkan karakter-
populasi pasien yang menjalani uji klinis
atau terapi obat, dan mempercepat pengembangan obat.
Penemuan obat modern sering bersamaan
penemuan biomarker dan pengembangan diagnostik
ment (Frank dan Hargreaves, 2003; Pien et al., 2005).
"Theranostik" adalah diagnostik cepat, mungkin a
microarray, mengukur biomarka yang signifikan secara klinis
Ker, yang mungkin mengidentifikasi pasien yang paling mungkin mendapat manfaat
atau dirugikan oleh obat baru (Warner, 2004).
Dibundel dengan obat baru (dan kemungkinan berkembang di Indonesia)
sejajar dengan obat itu), diagnosis theranostik terhadap
biomarker yang diperlukan (misalnya, ekspresi berlebih dari
produk gen HER2 pada kanker payudara tertentu
pasien) mempengaruhi keputusan terapi dokter
Sions [yaitu, meresepkan trastuzumab obat
(Herceptin) untuk kanker payudara positif reseptor HER2
pasien]. Dengan demikian, diagnostik dan terapinya adalah
jelas digabungkan = theranostik. Theranostik
memprediksi keberhasilan klinis obat. Contoh ini
digunakan untuk memperkenalkan konsep theranostic, adalah
mungkin contoh terbaik obat pribadi
(lihat nanti dalam bab ini), mencapai medis terbaik
hasil dengan memilih perawatan yang bekerja dengan baik
profil genom seseorang, atau dengan tertentu
karakteristik.
n Metabonomi dan Metabolomik
Informasi besar yang diungkapkan dengan urutan
genom manusia belum menghasilkan kemajuan dalam
obat pribadi diharapkan. Namun, teknologi
nique dan proses mengidentifikasi secara klinis signifikan
cant biomarker penyakit manusia dan keamanan obat
telah memupuk studi sistematis yang unik
sidik jari kimia yang memproses seluler tertentu
tinggalkan, khususnya, meta-
profil bolite (Nicholson dan Wilson, 2003; Fernie
et al., 2004; Delnomdedieu dan Schneider, 2005;
Lindon et al., 2005; Weckwerth dan Morgenthal,
2005) "Metabolom" manusia mewakili
koleksi semua metabolit dalam organisme biologis,
yang merupakan produk akhir dari ekspresi gen dan
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
139
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 158
fungsi produk gen. Jadi, sementara genomik dan
proteomik tidak menceritakan keseluruhan kisah tentang apa yang mungkin terjadi
terjadi di dalam sel, profil metabolisme dapat
memberikan gambaran langsung fisiologi
sel itu.
Kromatografi cair kinerja tinggi
ditambah dengan NMR canggih dan spektroskopi massa
teknik metry (MS) digunakan untuk memisahkan dan
mengukur campuran metabolit kompleks yang ditemukan di
cairan biologis untuk mendapatkan gambaran metabolisme
kontinum suatu organisme yang dipengaruhi oleh internal
dan lingkungan eksternal. Bidang metabonomi
adalah studi holistik dari kontinum metabolisme di
tingkat yang setara dengan studi genomik dan
proteomik. Namun, tidak seperti genomik dan protein
Mic, teknologi microarray sedikit digunakan sejak
molekul yang diuji dalam metabonomi adalah mol-kecil
produk akhir dari ekspresi gen dan hasil
fungsi protein. Metabolisme istilah telah muncul sebagai
komposisi metabolisme sel pada waktu tertentu
sedangkan metabonomi mencakup keduanya statis
komposisi dan konsentrasi metabolit juga
sebagai fluktuasi saja penuh waktu. Menggabungkan
informasi dikumpulkan dalam biobanks, koleksi besar
sampel biologis pasien dan medis
catatan, dengan studi metabonomis dan metabolisme
tidak hanya akan mendeteksi mengapa tingkat metabolit yang diberikan adalah
menambah atau mengurangi, tetapi dapat memprediksi
timbulnya penyakit. Juga, teknik menemukan penggunaan
dalam skrining keamanan obat, identifikasi klinis
biomarker, dan sistem studi biologi (lihat di bawah).
n Farmakogenetika dan Farmakogenomik
Telah dicatat selama beberapa dekade bahwa respons pasien terhadap
pemberian obat sangat bervariasi
dalam populasi pasien yang beragam. Khasiat sebagai
Diekstraksi dan dimurnikan
kontrol mRNA
(Yaitu, pola ekspresi gen
dalam sel / jaringan normal)
Diekstraksi dan dimurnikan
sampel mRNA
(Yaitu, pola ekspresi gen
dalam penyakit, atau dalam model
sistem, atau dalam patogen, atau
dalam menanggapi obat
perawatan, dll.)
Label dengan warna hijau
nukleotida fluoresen
Label dengan warna merah
nukleotida fluoresen
1. Membalik transkriptase
cDNA
2. Campurkan kedua cDNA yang berlabel
CDNA berlabel campuran
atau
DNA microarray atau * ON array
Fotolitografi
teknologi
+
sintesis in situ
dari yang tidak berlabel
oligonukleotida
1. Tetaskan microarray dengan campuran
cDNA berlabel
2. Bersihkan cDNA yang tidak terkendali
3. Lihat dengan fluoresensi mikroskopis
pemindaian
hasil ditentukan oleh:
a) Ada tidaknya warna
fluoresensi, dan
b) Intensitas warna
Mikroskopi robot
cDNA tidak berlabel
Gambar 3 n Prinsip operasi microarray DNA representatif atau oligonukleotida (* ON) microarray.
140
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 159
ditentukan dalam uji klinis berdasarkan standar
kisaran dosis berasal dari populasi besar
studi. Pemahaman molekul yang lebih baik
interaksi yang terjadi dalam farmakokinetik
fase aksi obat, ditambah dengan genetika baru
pengetahuan dan kemudian pengetahuan genomik
manusia telah memajukan kita lebih dekat ke cara yang rasional
untuk mengoptimalkan terapi obat. Optimasi dengan hormat
ke genotipe pasien, untuk memastikan maksimum
kemanjuran dengan efek samping minimal adalah tujuannya.
Lingkungan, pola makan, usia, gaya hidup, dan kondisi kesehatan semua
dapat mempengaruhi respons seseorang terhadap obat-obatan, tetapi
memahami susunan genetik seseorang adalah
dianggap sebagai kunci untuk membuat obat-obatan yang dipersonalisasi
dengan kemanjuran dan keamanan yang lebih besar. Pendekatan seperti
farmakogenetika dan farmakogenomik terkait
menjanjikan munculnya "obat pribadi", di
untuk obat dan kombinasi obat mana yang dioptimalkan
susunan genetik unik setiap individu (Silber, 2001;
Huang dan Lesko, 2005).
Polimorfisme Nukleotida Tunggal (SNP)
Sambil membandingkan urutan basa dalam DNA
dari dua individu mengungkapkan mereka menjadi sekitar
99,9 persen identik, perbedaan basis, atau poli-
morfisme, tersebar di seluruh genom.
Polimorfisme manusia dengan ciri terbaik adalah
SNP terjadi kira-kira sekali setiap 1000 pangkalan
dalam genom manusia pasangan 3,5 pangkalan (Cargill
et al., 1999; Silber, 2001; Kassam et al., 2005). DNA
variasi urutan adalah nukleotida tunggal - A, T, C, atau
G - dalam perbedaan genom antara anggota a
spesies (atau antara kromosom berpasangan dalam suatu
individu). Sebagai contoh, dua fragmen DNA berurutan
KASIH dari individu yang berbeda, AAGTTCCTA ke
AAGTTCTTA, berisi perbedaan dalam satu
nukleotida. Biasanya disebut sebagai "snips," ini
akun variasi urutan halus untuk sebagian besar
perbedaan genetik diamati di antara manusia. Demikian,
mereka dapat digunakan untuk menentukan warisan gen
dalam generasi berikutnya. Teknologi tersedia dari
beberapa perusahaan mengizinkan ratusan genotipe
dari ribuan SNP untuk biasanya di bawah $ 1.000 dalam a
beberapa hari.
Penelitian menunjukkan bahwa, secara umum, manusia
mentolerir SNP sebagai mekanisme bertahan hidup yang memungkinkan.
Toleransi ini dapat terjadi karena sebagian besar SNP terjadi di
daerah non-coding genom. Mengidentifikasi SNP
terjadi di daerah kode gen (cSNPs) dan / atau
urutan peraturan mungkin memegang kunci untuk menjelaskan
penyakit poligenik kompleks seperti kanker, jantung
penyakit, dan diabetes, dan memahami perbedaan-
dalam menanggapi terapi obat yang diamati di Indonesia
pasien individu (Grant dan Phillips, 2001; juga
lihat situs web Konsorsium SNP, http://snp.cshl.org/).
Beberapa cSNP tidak menghasilkan substitusi asam amino
dalam produk protein gen mereka karena
erasi kode genetik. CSNP ini disebut
sebagai cSNPs identik. CSNP lain, yang dikenal sebagai non-
identik, dapat menghasilkan asam amino konservatif
perubahan, seperti kesamaan dalam biaya atau ukuran sidechain,
atau substitusi asam amino yang lebih signifikan.
SNP, bila dikaitkan dengan epidemiologi
dan data patologis, dapat digunakan untuk melacak kerentanan
iblis terhadap penyakit umum seperti kanker, jantung
penyakit, dan diabetes (Davidson dan McInerney,
2004). Peneliti biomedis telah mengakui hal itu
menemukan SNP yang terkait dengan penyakit akan berpotensi
terkait dengan identifikasi target obat baru dan
tes diagnostik. Identifikasi dan pemetaan
ratusan ribu SNP untuk digunakan dalam skala besar
studi asosiasi dapat mengubah SNP menjadi biomar-
raja penyakit dan / atau respons obat (McCarthy,
2005). Proyeksi dampak SNP terhadap pemahaman kami
berdiri penyakit manusia menyebabkan pembentukan
SNP Consortium pada tahun 1999, sebuah penelitian internasional
kolaborasi yang melibatkan perusahaan farmasi,
laboratorium akademik, dan dukungan pribadi. Mengunjungi
situs berikut untuk informasi lengkap tentang SNP
ditemukan hingga saat ini: http://www.snps.com/, http: // www.
ncbi.nlm.nih.gov/LocusLink/, dan http://dir.niehs.nih.gov/
egsnp / status /.
Farmakogenetika Versus Farmakogenomik
Dalam istilah yang paling sederhana, farmakogenomik adalah keseluruhan
aplikasi genom farmakogenetika, yang
amina interaksi gen tunggal dengan obat-obatan.
Kemajuan luar biasa dalam bioteknologi menyebabkan
perubahan dramatis dalam cara farmasi baru
ditemukan, dikembangkan, dan dipantau selama pasien
menggunakan. Apoteker akan memanfaatkan pengetahuan yang didapat
dari genomik dan proteomik ke obat penjahit
terapi untuk memenuhi kebutuhan pasien masing-masing
menggunakan bidang farmakogenetika dan phar-
makogenomik (Evans dan Relling, 1999; Lau dan
Sakul, 2000; Kalow, 2004; Weinshilboum dan Wang,
2004; Lindpaintner, 2007).
Farmakogenetika adalah studi tentang bagaimana suatu
perbedaan genetik individu mempengaruhi aksi obat,
penggunaan, dan dosis. Pengetahuan rinci tentang a
farmakogenetik pasien dalam kaitannya dengan tertentu
terapi obat dapat menyebabkan peningkatan efikasi dan
keamanan yang lebih besar. Analisis farmakogenetika dapat mengidentifikasi
dari populasi pasien yang responsif sebelumnya
administrasi.
Bidang farmakogenetika hampir 50 tahun
tua, tetapi sedang mengalami pertumbuhan eksponensial yang baru
pada saat ini. Yang menarik di bidang
farmakogenetika adalah pemahaman kita tentang genetik
pengaruh pada profil farmakokinetik obat seperti
variasi genetik yang memengaruhi enzim hati (yaitu
chrome P450 group) dan protein pengangkut obat,
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
141
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 160
dan pengaruh genetik pada farmakodinamik obat
profil seperti variasi dalam protein reseptor
ekspresi (Kalow, 2004; Weinshilboum dan Wang,
2004; Lindpaintner, 2007).
Sebaliknya, farmakogenomik terkait dengan
seluruh genom, bukan SNP dalam satu gen
(Weinshilboum dan Wang, 2004; Lindpaintner, 2007).
Ini adalah studi tentang keseluruhan genom suatu
organisme (yaitu, pasien manusia), keduanya diekspresikan
dan gen yang tidak diekspresikan dalam fisiologis apa pun
negara. Farmakogenomik menggabungkan phar- tradisional
ilmu farmasi dengan pengetahuan beranotasi
gen, protein, dan SNP. Itu mungkin dipandang sebagai
konvergensi logis dari kemajuan langkah-bijaksana di
genomik dengan bidang farmakogenetika yang berkembang.
Secara keliru, definisi farmakogenetika dan
farmakogenomik sering digunakan secara bergantian.
Apa pun definisi itu, mereka berbagi tantangan
terjemahan klinis, pindah dari penelitian benchtop ke
aplikasi samping tempat tidur untuk perawatan pasien.
n DiJalan Menuju Pengobatan yang Dipersonalisasi:
Perkenalan singkat
Harapan dan realitas obat yang dipersonalisasi
(kadang-kadang disebut sebagai bagian dari "media molekuler
cine ”), farmakoterapi yang diinformasikan oleh pasien
informasi genomik dan proteomik individu, adalah
tergantung pada keberhasilan implementasi multi-
beberapa teknologi omel (Knoell dan Sadee, 2004;
Gurwitz dan Manolopoulos, 2007). Distribusi terbatas kami
cussion di sini akan fokus pada farmakogenomik dan
farmakogenetika, namun teknologi lain di
termasuk proteomik, metabolomik, dan nanobio-
teknologi akan menjadi sangat penting untuk kesuksesan
penerapan obat pribadi. Ini di-
Pendekatan kedokteran berbasis formasi sedang didorong
oleh ledakan penelitian di bidang farmasi
cogenetika dan farmakogenomik. Harapannya adalah itu
ilmu omic akan membawa prediktabilitas ke optimisas
pemilihan obat dan dosis obat untuk memastikan keamanan
dan farmakoterapi yang efektif (Gbr. 4).
Untuk diskusi kita, sekali lagi penting untuk
mengakui farmakogenetika farmakogenetika
agak berbeda (Kalow, 2001). Farmakogenomik
memperkenalkan elemen tambahan dari hadiah kami
kemampuan teknis untuk menentukan DNA spesifik pasien
variasi menggunakan teknik genomik. Daerah terlihat
pada komposisi genetik atau variasi genetik dari suatu
organisme dan hubungannya dengan respon obat.
Variasi dalam jalur target dipelajari untuk
bertahan bagaimana variasi diwujudkan dan bagaimana mereka
mempengaruhi respons. Sementara bidang studi yang tumpang tindih,
farmakogenomik adalah istilah yang jauh lebih baru
Beragam populasi pasien dengan suatu penyakit
Pendekatan farmakoterapi saat ini
Pendekatan pengobatan pribadi
Mulai identik
terapi obat
untuk semua
Analisis genetik
(genomik, proteomik, farmakogenomik,
dan metabolisme, dll)
Stratifikasi pasien
Memulai berhasil
rejimen terapi
Memulai
berbeda
terapi obat
Memulai
berbeda
terapi obat
Mencapai hasil terapeutik
Tidak ada terapi
efek
Mengamati
ADR
Prediksi respons obat
Gambar 4 n Peran teknologi "omics" dalam pengobatan pribadi.
142
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 161
mengkorelasikan variasi DNA pasien individu (SNP
tingkat variasi pengetahuan daripada tingkat gen
variasi pengetahuan) dengan tanggapannya terhadap
farmakoterapi. Obat pribadi akan digunakan
keduanya teknologi.
Memanfaatkan obat yang dioptimalkan secara pribadi
pengetahuan farmakogenomik tidak hanya akan terlihat
penyakit sebelum terjadi pada pasien, tingkatkan obat
kemanjuran pada farmakoterapi, dan mengurangi obat
toksisitas, itu juga akan memfasilitasi pengembangan obat
proses (Gbr. 1) termasuk meningkatkan pengembangan klinis
hasil, mengurangi biaya keseluruhan pengembangan obat
opment, mengarah pada pengembangan diagnostik baru
tes yang berdampak pada keputusan terapi, dll.
(Valgus, 2004). Farma- optimal yang dioptimalkan secara individual
pertama-tama terapi akan membutuhkan genetika terperinci
analisis seorang pasien, menyusun daftar lengkap
SNP. Tes farmakogenomik yang paling mungkin di
bentuk teknologi microarray dan berdasarkan
biomarker yang divalidasi secara klinis akan diberikan
untuk mengidentifikasi pasien responsif sebelum pemberian dosis
dengan agen tertentu. Contoh microarray- seperti
diagnostik berbasis adalah AmpliChip yang disetujui FDA
P450 dari Roche untuk menyaring pasien untuk kehadiran
salah satu dari 27 SNP di CYP2D6 dan CYP2C19, dan
tes investigasi DrugMEt (tes untuk 29 SNP di
8 enzim CYP 450) dan MegAllele DME-T (tes untuk
sekitar 170 SNP di 29 gen metabolisme).
Dampak SNP pasien pada penggunaan baru atau
obat yang ada dengan demikian akan diprediksi, dan
terapi obat ganda akan diidentifikasi itu
menjamin kemanjuran maksimal dan toksisitas minimal.
Dipahami dengan baik bahwa di luar genomik dan
proteomik, perilaku dan lingkungan pasien
faktor-faktor yang mempengaruhi hasil klinis dan kerentanan
untuk penyakit. Ladang nutrigenomik dan
Envirogenomics sedang mempelajari lapisan tambahan ini
kompleksitas. Obat pribadi akan menjadi
sangat penting dalam kasus di mana biaya pengujian
kurang dari biaya obat, atau biaya
memperbaiki reaksi obat yang merugikan (ADR) yang disebabkan oleh
obat. Perawatan farmasi akan dimulai dengan
mengidentifikasi kerentanan pasien terhadap suatu penyakit, kemudian
pemberian obat yang tepat untuk pasien yang tepat di RS
waktu yang tepat. Misalnya, antibodi monoklonal
trastuzumab (Herceptin) adalah payudara yang dipersonalisasi
terapi kanker secara khusus ditargetkan pada gen HER2
produk (25–30% kanker payudara manusia
mengekspresikan reseptor faktor pertumbuhan epidermal manusia,
Protein HER2) (Gutjahr dan Reinhardt, 2005).
Memperlihatkan efek samping yang berkurang dibandingkan dengan
kemoterapi standar karena target protein ini
spesifisitas, trastuzumab tidak diresepkan untuk mengobati a
penderita kanker payudara kecuali pasien tersebut sudah terlebih dahulu dites
positif untuk ekspresi berlebihan HER2. Saat ini seorang
uji immuno-histokimia, bukan yang canggih
Pengujian DNA microarray, contohnya menunjukkan kekuatan
tes masa depan tersebut.
Konsep terapi bertarget untuk personalisasi
obat telah menumbuhkan konsep bahwa era
obat blockbuster mungkin sudah berakhir dan akan diganti oleh
obat "niche buster", obat yang sangat efektif
individual untuk sekelompok kecil responden
pasien diidentifikasi oleh teknik genomik dan proteomik
ques. Juga, sementara banyak artikel memprediksikan hal itu
farmakogenomik akan merevolusi obat,
prediksi awal belum dijalani sampai
hype karena statistik, ilmiah, dan komersial
lari gawang. Dengan lebih dari 11 juta posisi SNP
diyakini hadir dalam populasi manusia, besar
deteksi skala variasi genetik memegang kunci untuk
obat pribadi yang berhasil (Geistlinger dan
Ahnert, 2005). Korelasi faktor lingkungan,
faktor perilaku, faktor genomik dan proteomik
(termasuk faktor farmakogenomik dan metabolomik
tors), dan dapat diamati secara fenotipikal
populasi tetap merupakan tantangan intensif data yang menakutkan
lenge Namun, farmakogenetika dan farmakogenomik
berdampak pada pengobatan modern.
Variasi Genomik Manusia yang Mempengaruhi
Farmakokinetik Obat
Variasi genetik terkait dengan metabolisme obat
dan transportasi obat, proses yang dihasilkan dari produk
ekspresi gen (enzim metabolisme dan transportasi
protein, masing-masing) memainkan peran penting dalam penentuan
konsentrasi obat dalam bentuk aktifnya di
situs aksinya dan juga di lokasi yang kemungkinan beracun
aksi. Sehingga memiliki konsekuensi klinis yang signifikan
quences, luas farmakogenetik dan farmakogen
analisis nomik dari metabolisme obat dan obat
transportasi adalah menemukan nilai dalam pemahaman dan
memprediksi pengaruh variasi genetik pada obat
efektivitas dan keamanan (Frye, 2004; Kroetz dan
Nguyen, 2004; Gurwitz dan Manolopoulis, 2007).
Dipahami bahwa obat spesifik
fenotip lizer dapat menyebabkan reaksi obat yang merugikan.
Sebagai contoh, beberapa pasien kekurangan enzimatis
bentuk aktif, memiliki tingkat berkurang, atau memiliki a
versi modifikasi dari CYP2D6 (a sitokrom P450
alel) dan akan memetabolisme kelas farmasi tertentu
agen ceutical berbeda dengan pasien lain mengekspresikan
enzim aktif asli. Semua poli farmakogenetik
morfisme yang diteliti sampai saat ini berbeda dalam frekuensinya
di antara kelompok ras dan etnis. Sebagai contoh,
Kekurangan enzim CYP2D6 dapat terjadi pada £ 2%
Pasien Asia, £ 5% pasien kulit hitam dan £ 11% berkulit putih
pasien (Freeman, 2001). Tes diagnostik untuk mendeteksi
Kekurangan CYP2D6 dapat digunakan untuk mengidentifikasi pasien
obat yang tidak boleh dimetabolisme
didominasi oleh CYP2D6. Juga, farmakogenetika
merupakan salah satu dari banyak respons genetik terhadap
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
143
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 162
dampak lingkungan yang mempengaruhi biokimia manusia
dan aksi narkoba. Tabel 2 memberikan beberapa pilihan
contoh-contoh metabolisme obat umum polymorph-
isme dan konsekuensi farmakokinetik mereka.
Dengan pemahaman yang berkembang tentang
genetika metabolisme warfarin, antikoagulan warfarin
terapi lation menjadi pemimpin dalam pharmacoge-
analisis genetik untuk prediksi farmakokinetik
(Cavallari, 2004). ADR untuk akun warfarin sebesar 15%
dari semua ADR di Amerika Serikat, kedua setelah
digoxin. Dosis warfarin disesuaikan dengan tujuan
mencapai INR (rasio Normalisasi Internasional =
rasio waktu protrombin pasien dibandingkan dengan
bahwa kontrol normal) dari 2.0 ke 3.0. Klinis
tantangannya adalah membatasi perdarahan, ADR primer,
sambil mencapai tingkat perlindungan optimal
melawan tromboemboli. Deviasi dalam INR telah
terbukti menjadi faktor risiko terkuat untuk pendarahan
komplikasi. Rute utama metabolisme
warfarin adalah dengan CYP2C9 dan CYP3A4. Beberapa
senyawa, yang telah diidentifikasi mempengaruhi
positif atau negatif, INR warfarin termasuk:
simetidin, clofibrate, propranolol, celecoxib (sebuah
penghambatan petitif CYP2C9), fluvoxamine (an
inhibitor beberapa enzim CYP), berbagai antifun-
gals dan antibiotik (mis., mikonazol, flukonazol,
erythromycin), omeprazole, alkohol, ginseng, dan
Bawang putih. Peneliti telah menentukan mayoritas
variasi individu pasien diamati secara klinis di
respon terhadap terapi warfarin bersifat genetik,
dipengaruhi oleh variabilitas genetik dari metabolisme
enzim, enzim siklus vitamin K, dan mungkin
protein pengangkut. Genotipe CYP2C9
morfisme saja menjelaskan sekitar 10% dari variabilitas
diamati dalam dosis pemeliharaan warfarin.
Banyak penelitian di kedua penelitian dasar dan
tingkat klinis melibatkan efek transportasi obat
protein pada profil farmakokinetik obat
(Kroetz dan Nguyen, 2004; Gurwitz dan Manolopoulis,
2007). Beberapa bidang studi aktif tentang efek genetik
variasi pada efektivitas klinis termasuk eflux trans-
protein porter (untuk ketersediaan hayati, paparan SSP, dan
resistensi tumor) dan transkrip neurotransmitter
kuli angkut (sebagai target obat yang valid). Transporter baru
protein masih diidentifikasi sebagai hasil dari
HGP dan penelitian proteomik berikutnya. Lebih banyak belajar
diperlukan pada karakterisasi ekspresi,
regulasi, dan sifat fungsional yang diketahui dan
protein transporter baru untuk menilai potensi dengan lebih baik
untuk prediksi tanggapan obat yang diubah berdasarkan
genotipe pengangkut.
Variasi Genomik Manusia yang Mempengaruhi
Farmakodinamik Obat
Variasi genomik mempengaruhi tidak hanya farmakoksi
profil obat, juga sangat mempengaruhi
profil farmakodinamik obat melalui obat
target. Untuk memahami kompleksitas sebagian besar obat
tanggapan, faktor yang mempengaruhi ekspresi
target protein secara langsung dengan obat yang berinteraksi
harus dipelajari. Sasaran termasuk reseptor obat
terlibat dalam respons serta protein
terkait dengan risiko penyakit, patogenesis, dan / atau
toksisitas (Johnson, 2004; Gurwitz dan Manolopoulis,
2007). Ada peningkatan jumlah yang menonjol
contoh pengaruh polimorfisme turunan
farmakodinamik obat. Untuk mengikuti warfarin
contoh di atas, mayoritas pasien individu
variasi yang diamati secara klinis sebagai respons terhadap anti-
terapi oagulan bersifat genetik. Namun demikian
Polimorfisme genotipe CYP2C9 sendiri hanya menjelaskan
sekitar 10% dari variabilitas yang diamati pada warfarin
Enzim
Umum
varian
Potensi
konsekuensi
CYP1A2
CYP1A2 * 1F
Meningkat
inducibility
CYP1A2
CYP1A2 * 1K
Menurun
metabolisme
CYP2A6
CYP2A6 * 2
Menurun
metabolisme
CYP2B6
CYP2B6 * 5
Tidak berpengaruh
CYP2B6
CYP2B6 * 6
Meningkat
metabolisme
CYP2B6
CYP2B6 * 7
Meningkat
metabolisme
CYP2C8
CYP2C8 * 2
Menurun
metabolisme
CYP2C9
CYP2C9 * 2
Afinitas yang berubah
CYP2C9
CYP2C9 * 3
Menurun
metabolisme
CYP2D6
CYP2D6 * 10
Menurun
metabolisme
CYP2D6
CYP2D6 * 17
Menurun
metabolisme
CYP2E1
CYP2E1 * 2
Menurun
metabolisme
CYP3A7
CYP3A7 * 1C
Meningkat
metabolisme
Mengandung flavin
monooxygenase-3
FMO3 * 2
Menurun
metabolisme
Mengandung flavin
monooxygenase-3
FMO3 * 4
Menurun
metabolisme
Tabel 2 n Beberapa contoh terpilih dari metabo- obat umum
lism polimorfisme dan konsekuensi farmakokinetiknya.
144
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 163
dosis pemeliharaan. Efektivitas warfarin berpengaruh
ditimbulkan oleh variabilitas genetik dari siklus vitamin K
enzim juga. Reseptor obat untuk warfarin adalah
umumnya dikenal sebagai vitamin K epoksida reduktase,
enzim yang mendaur ulang vitamin K dalam koagulasi
riam. Vitamin K epoksida reduktase kompleks1
(VKORC1) telah ditentukan sebagai varian yang sangat tinggi
dengan sebanyak 50% dari variabilitas klinis
diamati untuk warfarin yang dihasilkan dari polimorfisme
enzim ini.
Asosiasi telah terlibat di dalamnya
respons obat dan target variasi genetik untuk a
berbagai obat termasuk: antidepresan (G-protein
beta3), antipsikotik (dopamin D2, D3, D4; seroto-
nin 5HT2A, 5HT2C), sulfonylureas (sulfonylurea
protein reseptor), dan anestesi (resep ryanodine
tor) (Johnson, 2004). Selain itu, asosiasi serupa
telah dipelajari untuk keracunan obat dan penyakit
polimorfisme termasuk: abacavir (histocom mayor
protein patabilitas; risiko hipersensitivitas), cisapride
dan terfenadine (HERG, KvLQT1, Mink, MiRP1;
peningkatan risiko torsade de pointes yang diinduksi obat),
dan kontrasepsi oral (prothombin dan Factor V;
peningkatan trombosis vena dalam (Johnson, 2004).
Demikian juga, asosiasi serupa untuk kemanjuran diketahui
seperti: statin (apolipoprotein E; peningkatan kelangsungan hidup
perpanjangan dengan simvastatin) dan tacrine (apolipo-
protein E; perbaikan klinis Alzheimer
gejala) (Johnson, 2004).
Nilai Obat yang Dipersonalisasi dalam Penyakit
Karena peran intim genetika dalam karsinogenesis,
obat pribadi dengan cepat menjadi sukses
cerita dalam onkologi berdasarkan profil genetik menggunakan
analisis proteomik dari biopsi tumor. Seperti yang dijelaskan
di atas, terapi kanker yang ditargetkan seperti trastuzumab
(Herceptin) sukses dan dipandang sebagai jalannya
dari masa depan. Juga, polimorf penting secara klinis
isme memprediksi peningkatan toksisitas pada pasien dengan kanker
dirawat dengan obat kemoterapi, untuk
contoh 6-mercaptopurine (thiopurine methyltrans-
ferase (TPMT) * 2, * 3A, dan * 3C varian), 5-fluorour-
acil (5-FU) (dihydropyrimidine dehydrogenase * 2A
varian), dan irinotecan (alel UGT1A1 * 28; FDA
Invader UGT1A1 Diag- Assay Molecular Assag
tersedia untuk menyaring keberadaan alel ini
terkait dengan toksisitas irinotecan) (Kolesar, 2004).
Demikian juga, farmcogenetika penting secara klinis sebelum
kemanjuran dikt pada pasien onkologi yang diobati dengan 5-FU
(varian timidilat sintase * 2 dan * 3C).
Aplikasi klasik farmakogenetika adalah aplikasi kami
menyajikan pemahaman tentang hemato yang berpotensi fatal
toksisitas poietik yang terjadi pada beberapa pasien diberikan
dosis standar agen antileukemia
azathioprine, mercaptopurine dan thioguanine
(Zhou, 2006). Obat ini dimetabolisme oleh
enzim TPMT untuk produk S-metilasi aktif.
Mutasi gen (polimorfisme) dapat terjadi sebagai
sebanyak 11% dari pasien yang mengakibatkan penurunan TPMT-
metabolisme dimediasi obat thiopurine.
Tes diagnostik untuk TPMT sekarang tersedia dan digunakan
secara klinis. Pasien yang diidentifikasi dengan metabodi TPMT yang buruk
lism mungkin perlu dosis obat mereka diturunkan 10 hingga 15 kali lipat.
Mekanisme resistensi multidrug terhadap obat kanker
dipengaruhi oleh perbedaan genetik. Sejumlah
polimorfisme dalam pengkodean gen MDR-1 untuk
P-glikoprotein, penghabisan obat protein transmembran
pompa bertanggung jawab atas resistensi multi-obat, miliki
telah diidentifikasi. Satu, dikenal sebagai genotipe T / T dan
berkorelasi dengan penurunan ekspresi usus
P-glikoprotein dan peningkatan bioavailabilitas obat,
memiliki frekuensi alel 88% di Afrika-Amerika
populasi, namun hanya sekitar 50% di Kaukasia-
Populasi Amerika (Kolesar, 2004).
Analisis farmakogenetik dan farmakogenomik
sis pasien sedang dipelajari secara aktif di banyak
kondisi penyakit. Namun, diskusi terperinci berjalan
di luar apa yang diberikan pengantar ini. Itu
pembaca didorong untuk membaca lebih lanjut dalam yang disarankan
bacaan terdaftar di akhir bab ini. Beberapa
contohnya termasuk penyakit menular (kecenderungan genetik
posisi infeksi ke infeksi pada inang; Rogers,
2004), penyakit kardiovaskular (gen yang terkait dengan jantung
kegagalan dan mengobati hipertensi, antikoagulan
terapi oagulan, obat penurun lipid; Cavallari,
2004), psikiatri (peran dan metabolisme obat
ekspresi reseptor dalam tingkat respons obat untuk
depresan dan obat antipsikotik, penambahan berat badan
dari antipsikotik; Ellingrod dan Bishop, 2004),
asma (inhibitor leukotrien dan beta-agonis;
Lima dan Wang, 2004), dan transplantasi (cyclos-
metabolisme porine dan penghabisan resistensi multi-obat
meahanisme; Zheng dan Burckart, 2004).
Tantangan dalam Pengobatan Personalisasi
Ada banyak kunci kesuksesan untuk dipersonalisasi
obat yang bergantung pada kemajuan ilmiah lanjutan-
ment. Ada juga ekonomi, sosial, dan etis
masalah yang harus diatasi agar berhasil
dan apotek individual yang berbasis tes genetik
cotherapy. Adalah adil untuk menyatakan bahwa sebagian besar obat tidak akan
efektif pada semua pasien sepanjang waktu. Demikianlah
tekanan pembayar untuk pindah dari "pembayaran untuk
produk "ke" pembayaran untuk signifikan secara klinis
Model hasil kesehatan ”masuk akal. Penggunaan
teknologi kesehatan omic dan informatika kesehatan
pendekatan untuk stratifikasi populasi pasien untuk narkoba
efektivitas dan keamanan obat adalah tujuan yang patut dipuji.
Namun, teknologi saat ini cukup mahal.
dan prediktabilitas respon obat yang dihasilkan adalah
sekarang baru saja divalidasi secara klinis. Efektivitas biaya
dan analisis biaya-manfaat terbatas pada tanggal ini.
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
145
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 164
Juga, lingkungan yang dihasilkan dibuat oleh ini
teknologi dalam konteks harapan hasil
dan model akses / penggantian narkoba baru akan
memunculkan paradigma bisnis farmasi baru
yang masih berkembang dan belum dipahami dengan baik.
Pada tahun 2005, FDA menyetujui apa yang dirujuk oleh beberapa orang
sebagai “obat target ras pertama,” BiDil (iso-
sorbide / hydralzaine; dari NitroMed) (Branca, 2005).
Teknologi Omic umumnya tidak terlibat dalam
proses pengembangan dan persetujuan. Berdasarkan
analisis statistik kesehatan menunjukkan bahwa tingkat
kematian pada orang kulit hitam dengan penyakit jantung dua kali lebih tinggi
pada orang kulit putih pada kelompok usia 45 hingga 64 tahun, suatu uji klinis
kombinasi obat yang lebih tua ini di 1.050 orang Afrika-
Amerika dilakukan dan peningkatan 43%
dalam kelangsungan hidup dalam kelompok pengobatan menghasilkan FDA
persetujuan obat secara eksklusif di Afrika
Orang Amerika Namun, antropologi dan genetika modern
telah menunjukkan bahwa sementara ras memang ada sebagai sosial yang nyata
membangun, tidak ada yang dapat dibedakan secara genetik
kelompok ras manusia (Ossorio, 2004). Jadi, mengaitkan
mengamati perbedaan dalam hasil biomedis dan
pengamatan fenotipikal terhadap perbedaan genetik
di antara ras itu problematis dan menantang secara etis.
Ras mungkin hanya penanda pengganti untuk
penyebab lingkungan dan genetik dari penyakit dan
Menanggapi farmakoterapi. Sekarang, faktor dalam
pengenalan teknologi omic secara luas ke dalam kesehatan-
perawatan dengan cara memisahkan populasi pasien
berdasarkan pada karakteristik genomik dan proteomik. ini
jelas bahwa teknologi modern ini menimbulkan
konsekuensi negatif untuk kebijakan publik (termasuk data
perlindungan, asuransi dan akses ke perawatan) dan ini
tantangan harus diatasi oleh pembuat keputusan,
ilmuwan, penyedia layanan kesehatan dan masyarakat untuk
obat pribadi untuk menjadi sukses (lihat Rothstein,
2003 dalam Bacaan Lebih Lanjut).
n Toksikogenomik
Toksikogenomik terkait dengan farmakogenomik,
menggabungkan toksikologi, genetika, biologi molekuler,
dan kesehatan lingkungan untuk menjelaskan tanggapan
organisme hidup ke lingkungan yang penuh tekanan atau beracun
agen (Rockett, 2003; Waring et al., 2004). Juga,
kandidat obat baru dapat disaring melalui a
kombinasi profil ekspresi gen dan toxicol-
ogy untuk memahami respons gen dan mungkin memprediksi
keamanan (Furness, 2002). Teknik genom digunakan
termasuk profil tingkat ekspresi gen dan
analisis polimorfisme nukleotida genetik
variasi individu yang umumnya menggunakan mikro-
teknologi array. Studi toksikogenomik berhubungan
terkait dengan efek toksikologis yang merugikan dalam uji klinis
sehingga biomarker cocok untuk efek samping ini
dapat dikembangkan. Dengan menggunakan metode seperti itu, itu akan terjadi
secara teoritis mungkin untuk menguji pasien secara individual
kerentanannya terhadap efek samping ini sebelumnya
pemberian obat. Pasien yang akan menunjukkan
penanda untuk efek buruk akan dialihkan ke a
obat yang berbeda. Namun pada saat ini, bidangnya ada di dalamnya
masa bayi.
n Glycomics dan Glycobiology
Bidang ilmiah baru glikomik, atau glikobiol-
ogy, dapat didefinisikan paling sederhana sebagai studi
struktur, sintesis dan fungsi biologis semua
glycans (dapat disebut sebagai oligosaccharides atau
polisakarida, tergantung pada ukuran) dan glikokonju-
gerbang dalam sistem yang sederhana dan kompleks (Varkin et al.,
1999; Fukuda dan Hindsgauld, 2000; Alper, 2001). Itu
aplikasi glikomik atau glikobiologi kadang-kadang
disebut glycotechnology untuk membedakannya dari bioteknologi-
nologi (merujuk pada glycans daripada protein dan
asam nukleat). Namun, banyak di arena biotek
pertimbangkan glikobiologi sebagai salah satu bidang penelitian
dicakup oleh istilah bioteknologi. Dalam
era postgenomik, seluk-beluk protein glikosilasi-
tion, mekanisme kontrol genetik, dan
faktor internal dan eksternal yang mempengaruhi luasnya
dan pola glikosilasi penting untuk
fungsi protein berdiri dan proteomik. Seperti
protein dan asam nukleat, glikans adalah biopolimer.
Sementara pernah disebut sebagai perbatasan terakhir
penemuan farmasi, kemajuan terbaru dalam
bioteknologi menemukan, kloning, dan memanfaatkan
enzim pembersih dan sintesis gula miliki
memungkinkan ahli glikobiologi untuk menganalisis dan memanipulasi
karbohidrat kompleks lebih mudah (Walsh dan
Jefferis, 2006).
Banyak protein yang diproduksi oleh sel-sel hewan
mengandung gula yang melekat, membuatnya glikosida
protein). Mayoritas obat berbasis protein
agen berisi beberapa bentuk moda pasca-translasi
ifikasi yang sangat dapat mempengaruhi biologis
aktivitas protein itu. Host bakteri untuk rekombinan
DNA dapat menghasilkan protein hewani
urutan asam amino yang identik atau hampir identik.
Bakteri, bagaimanapun, tidak memiliki "mesin" untuk
menempelkan gula gula ke protein (suatu proses yang disebut
glikosilasi). Banyak protein non-glikosilasi
berbeda dalam aktivitas biologis mereka dibandingkan dengan
glikoprotein asli. Produksi ternak
teins yang tidak memiliki glikosilasi memberikan
kesempatan yang diharapkan untuk mempelajari peran fungsional
molekul gula pada glikoprotein. Telah ada
kemajuan luas dalam glycoengineering ragi untuk
memanusiakan jalur N-glikosilasi yang mengakibatkan
ekspresi glikoprotein terapeutik dalam ragi (Wildt
dan Gerngross, 2005).
Kompleksitas bidang dapat digambarkan dengan baik
dengan meninjau blok bangunan glycans, yang sederhana
karbohidrat disebut sakarida atau gula dan mereka
146
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 165
turunannya (yaitu, gula amino). Karbohidrat sederhana
dapat melekat pada jenis molekul biologis lainnya
untuk membentuk glikokonjugat termasuk glikoprotein (pra-
dominan protein), glikolipid dan proteoglikan
(sekitar 95% polisakarida dan protein 5%). Sementara
kimia dan biologi karbohidrat telah aktif
bidang penelitian selama berabad-abad, kemajuan dalam bioteknologi-
Ogy telah memberikan teknik dan menambahkan energi ke Internet
studi tentang glycans. Oligosakarida ditemukan terkonjugasi
untuk protein (glikoprotein) dan lipid (glikolipid)
menampilkan keragaman struktural yang luar biasa. Keterkaitan
unit monomer dalam protein dan asam nukleat
umumnya konsisten di semua molekul tersebut. Glycans,
Namun, menunjukkan variabilitas yang jauh lebih besar dalam hubungan
antara unit monomer daripada yang ditemukan di yang lain
biopolimer. Sebagai contoh, Gambar 5 menggambarkan
situs tautan umum untuk membuat polimer glukosa.
Glukosa dapat dihubungkan pada empat posisi: C-2, C-3, C-4,
dan C-6 dan juga dapat mengambil satu dari dua kemungkinan anomer
konfigurasi di C-2 (a dan b). Efek berganda
pengaturan hubungan terlihat dalam estimasi Kobata
(Kobata, 1996). Dia memperkirakan itu untuk 10-mer
(oligomer dengan panjang 10) jumlah secara struktural
oligomer linier yang berbeda untuk masing-masing biopolimer adalah:
DNA (dengan 4 basis yang memungkinkan), 1,04 x 10 6 ; protein (dengan
20 kemungkinan asam amino), 1,28 x 10 13 ; dan oligosacchar-
ide (dengan delapan jenis monosakarida), 1,34 x 10 18 .
Glikosilasi dan Kedokteran
Pola glikosilasi mempengaruhi secara signifikan
aktivitas biologis protein (McAuliffe dan
Hindsgaud, 2000; Wildt dan Gerngross, 2005; Walsh
dan Jefferis, 2006). Banyak dari terapi yang digunakan
protein rekombinan yang dihasilkan adalah glikosik
termasuk erythropoietin, glucocerebrosidase
dan aktivator plasminogen jaringan. Tanpa persetujuan
melekat karbohidrat priate, tidak ada protein ini
akan berfungsi secara terapi seperti halnya orang tua
glikoprotein. Glycoforms (variasi dari glikosila-
pola glikoprotein) dari protein yang sama
mungkin berbeda secara fisikokimia dan biokimia
properti. Misalnya, erythropoietin memilikinya
O-linked dan tiga situs glikosilasi N-linked. Itu
penghapusan gula terminal di setiap situs menghancurkan
aktivitas in vivo dan menghapus semua hasil gula dalam a
lebih cepat dari molekul dan lebih pendek
paruh peredaran darah (Takeuchi et al., 1990). Namun, itu
efek sebaliknya diamati untuk deglikosilasi
makrofag granulosit sitokin hematopoietik
faktor perangsang koloni (GM-CSF) (Cebon et al.,
1990). Dalam hal ini, buang karbohidrat
residu meningkatkan aktivitas spesifik enam kali lipat. Itu
gula glikoprotein diketahui memainkan peran dalam
pengakuan dan pengikatan biomolekul dengan lainnya
molekul dalam keadaan penyakit seperti asma, rheuma-
radang sendi, kanker, infeksi HIV, flu dan lainnya
penyakit menular.
n "Omics" Teknologi Integrasi: Biologi Sistem
Upaya ilmiah besar-besaran yang terkandung dalam HGP dan
pengembangan teknologi bioinformatika miliki
memicu perubahan mendasar dalam praktik
biologi modern (Aderem dan Hood, 2001). Biologi
telah menjadi ilmu informasi yang mendefinisikan semua
unsur-unsur dalam sistem dan penempatan biologis yang kompleks
mereka dalam database untuk interpretasi komparatif. Sebagai
terlihat pada Gambar 2, hierarki pengumpulan informasi
jauh melampaui biodata yang terkandung di dalamnya
kode genetik yang ditranskripsi dan diterjemahkan. Saya t
melibatkan sistem interaktif yang kompleks. Sistem biol
ogy sering digambarkan sebagai teknologi yang tidak kompetitif
oleh industri farmasi (dasar
teknologi yang harus dikembangkan agar lebih berhasil
pada teknologi kompetitif penemuan obat dan
pengembangan). Ini adalah studi tentang interaksi
antara komponen sistem biologis, dan
bagaimana interaksi ini memunculkan fungsi dan
perilaku sistem itu. Sistem biologis mungkin
melibatkan enzim dan metabolit dalam metabolisme
jalur atau molekul biologis berinteraksi lainnya
mempengaruhi proses biologis. Ditandai dengan sebuah siklus
teori, pemodelan komputasi dan eksperimen untuk
menggambarkan secara kuantitatif sel atau proses sel, sistem
biologi adalah upaya intensif data (Klipp et al., 2005;
Rothberg et al., 2005). Karena tujuannya adalah model
semua interaksi dalam suatu sistem, eksperimen
teknik yang paling cocok dengan sistem biologi adalah mereka
yang sistem-lebar dan berusaha selengkap
mungkin. Teknologi omics throughput tinggi seperti
proteomik, farmakogenomik, transkriptomik, saya
tabolomik, dan toksikogenomik digunakan untuk mengumpulkan
data kuantitatif untuk konstruksi dan validasi
model sistem.
-D-glukosa
Anomer
C-6
C-4
C-3
C-2
C-2  Anomer
HO
HAI
HAI
HAI
HAI
HAI
Salah satu
OH 2 C
Gambar 5 n Ilustrasi situs tautan umum yang akan dibuat
biopolimer glukosa. Keterkaitan di empat posisi: C-2, C-3, C-4
dan C-6 dan juga dapat mengambil satu dari dua kemungkinan anomer
konfigurasi di C-2 (a dan b).
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
147
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 166
n Teknologi “Omics” Lainnya
Bidang genomik, proteomik yang sedang berkembang, dll.
telah melahirkan jumlah yang terus meningkat dari
disiplin ilmu dan bidang studi khusus terkait. Itu
kompleksitas dalam terminologi untuk teknologi "omic"
telah diperkuat lebih jauh dengan pengenalan
istilah-istilah seperti interaktomik, proteogenomik, nutrisi-
genomik, dll. Interactomics adalah data intensif
studi sistem yang luas dari interaksi, yang merupakan
interaksi antara protein dan molekul lainnya
dalam sel. Proteogenomik telah digunakan sebagai
secara luas mencakup istilah untuk menggambarkan penggabungan
genomik, proteomik, molekul kecil, dan informasi
matics. Nutrigenomics adalah bidang baru yang mengevaluasi
respon organisme hidup terhadap keberadaan atau
tidak adanya nutrisi penting. Lipidomik adalah
jelas studi skala besar dari semua yang tidak larut dalam air
metabolit lipid dalam suatu organisme. Eksploitasi “omics”
Sion akan berlanjut.
HEWAN DAN TANAMAN TRANSGENIK
Selama ribuan tahun, manusia dibiakkan secara selektif
hewan dan tumbuhan baik untuk meningkatkan atau menciptakan
sifat yang diinginkan dalam banyak spesies. Peledak
pengembangan teknologi DNA rekombinan dan
teknik biologi molekuler lainnya telah membuatnya
mungkin untuk merekayasa spesies yang memiliki spesies tertentu
karakteristik genetik yang unik dan membedakan.
Bahan genetik hewan atau tumbuhan bisa jadi
dimanipulasi sehingga gen tambahan dapat dimasukkan
(Transgen), diganti (yaitu, homolog gen manusia
pengkodean untuk protein manusia terkait), atau dihapus
(pukulan knockout). Secara teoritis, pendekatan ini memungkinkan
pengenalan hampir semua gen ke dalam gen apa pun
organisme. Pemahaman yang lebih besar tentang gen spesifik
regulasi dan ekspresi akan berkontribusi penting
penemuan baru yang dibuat dalam model hewan yang relevan.
Spesies yang diubah secara genetis tersebut telah menemukan kegunaan dalam a
segudang penelitian dan aplikasi komersial potensial
termasuk generasi model manusia
penyakit, produksi obat protein, pembuatan organ
dan jaringan untuk xenotransplantasi, sejumlah agricul-
penggunaan tural, dan penemuan obat (Dunn et al., 2005).
n transgenik Hewan
Gordon dan Ruddle pertama kali menggunakan istilah "transgenik"
pada tahun 1981 untuk menggambarkan binatang di mana DNA asing
segmen (transgen) dimasukkan ke dalam mereka
genom. Kemudian, istilah itu diperpanjang juga untuk memasukkan
hewan di mana DNA genom endogen mereka miliki
struktur molekulnya dimanipulasi (Gordon dan
Ruddle, 1981; Isola dan Gordon, 1991). Meskipun ada
beberapa kesamaan antara teknologi transgenik dan
terapi gen (lihat Bab 8), penting untuk
membedakan dengan jelas di antara mereka. Secara teknis berbicara-
ing, pengenalan urutan DNA asing ke dalam
sel hidup disebut transfer gen. Jadi, satu metode untuk
membuat hewan transgenik melibatkan transfer gen
(Transgen dimasukkan ke dalam genom). Gene
terapi juga merupakan prosedur transfer gen dan, dalam
akal, menghasilkan manusia transgenik. Dalam transgenik
Namun, hewan, gen asing dipindahkan
tanpa pandang bulu ke semua sel, termasuk garis kuman
sel. Proses terapi gen berbeda secara umum
dari transgenesis karena melibatkan transfer
gen yang diinginkan sedemikian rupa sehingga hanya melibatkan spesifik
sel somatik dan hematopoietik, dan bukan sel kuman.
Jadi tidak seperti dalam terapi gen, perubahan genetik pada
organisme transgenik dilestarikan pada keturunan apa pun
sesuai dengan aturan umum Mendel
warisan.
Produksi hewan transgenik bukan
teknologi baru (Dunn et al., 2005). Mereka telah
diproduksi sejak tahun 1970-an. Namun, bioteknologi modern
nology telah sangat meningkatkan metode induksi
transformasi genetik. Sementara mouse telah
spesies hewan yang paling banyak dipelajari, teknologi transgenik
ogy telah diterapkan pada sapi, ikan (khususnya
Ikan zebra), kambing, unggas, kelinci, tikus, domba, babi,
dan berbagai bentuk hewan rendah. Hewan transgenik
telah memberikan kontribusi penelitian yang berharga bagi
studi yang melibatkan regulasi ekspresi gen, the
fungsi sistem kekebalan tubuh, penyakit genetik, virus
penyakit, penyakit kardiovaskular, dan gen
bertanggung jawab untuk perkembangan kanker. Transgenik
hewan telah terbukti sangat diperlukan dalam memimpin obat
identifikasi, optimasi timbal, obat praklinis
pengembangan, dan pemodelan penyakit.
Produksi Hewan Transgenik oleh DNA
Mikroinjeksi dan Penambahan Gen Secara Acak
Produksi hewan transgenik paling banyak
biasanya melibatkan microinjection (juga disebut
transfer gen) 100 hingga 200 salinan eksogen
DNA transgen menjadi pria yang lebih besar dan lebih terlihat
pronukleus (dibandingkan dengan pronukleus wanita) dari
embrio yang dibuahi penerima (Gbr. 6). Transgen
mengandung kedua DNA yang menyandikan target yang diinginkan
urutan asam amino bersama dengan urutan peraturan
yang akan memediasi ekspresi gen yang ditambahkan.
Telur yang diinfeksi mikro kemudian ditanamkan ke dalam
saluran reproduksi wanita dan dibiarkan berkembang
menjadi embrio. DNA asing umumnya menjadi
dimasukkan secara acak di satu situs di salah satu saja
host kromosom (yaitu, hewan transgenik pendiri
heterozigot). Demikianlah setiap pendiri transgenik
hewan (hewan transgen positif) adalah
spesies yang unik. Keturunan keturunan transgenik pendiri
hewan di mana transgen telah dimasukkan
148
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 167
ke dalam sel benih dapat menyebabkan kelahiran a
progeny homozigot menyediakan transgen transgen
Porasi tidak menyebabkan mutasi yang esensial
gen endogen. Semua sel hewan transgenik
akan mengandung transgen jika penyisipan DNA terjadi
sebelum pembelahan sel pertama. Namun, biasanya hanya
20% hingga 25% dari keturunannya mengandung level yang terdeteksi
dari transgen. Pemilihan hewan neonatal
memiliki transgen yang tergabung bisa dengan mudah
dicapai baik dengan identifikasi langsung
urutan DNA atau mRNA tertentu atau dengan pengamatan
karakteristik fenotipik kotor.
DNA asing yang diinginkan
(DNA transgen eksogen)
Hewan yang dipupuk
donor embrio
Embrio hewan yang dibuahi
sebelum fusi pronuklei
Mikroinjeksi DNA asing yang diinginkan
menjadi pronukleus jantan dari embrio yang dipanen
DNS yang diinginkan dalam microinjector
Transfer embrio yang disuntikkan ke dalam reproduksi
traktat untuk ibu pengganti
DNA yang diinginkan (dalam sel ES di
blastosit) dimasukkan ke dalam
ibu pengganti
sistem reproduksi
Progeny TIDAK mengandung
DNA yang diinginkan
Panen embrio
Mengandung keturunan transgenik homozigot
DNA yang diinginkan
Pilih keturunan, berkembang biak dan lanjutkan
garis kuman
Transgenik heterozigot
keturunan mengandung yang diinginkan
DNA (Pendiri)
Kelahiran keturunan
Gambar 6 n Representasi skematis dari produksi hewan transgenik oleh microinjection DNA.
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
149
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.
Halaman 168
Produksi Hewan Transgenik oleh
Infeksi retroviral
Produksi laboratorium pertama yang diubah secara genetik
embrio tikus adalah dengan menyisipkan transgen
melalui vektor retroviral yang dimodifikasi. Non-replikasi
vektor virus berikatan dengan sel inang embrionik,
memungkinkan transfer dan penyisipan berikutnya
transgen ke dalam genom inang. Banyak pengalaman
percobaan terapi gen mental manusia menggunakan hal yang sama
vektor virus (lihat Bab 8 untuk rincian lebih lanjut tentang
penggunaan dan jenis vektor virus). Keuntungan dari ini
metode produksi transgen mudah dengan
di mana gen dapat dimasukkan ke dalam embrio
berbagai tahapan perkembangan, dan karakteristik
bahwa hanya satu salinan transgen yang biasanya
diintegrasikan ke dalam genom. Kerugiannya termasuk
mungkin rekombinasi genetik dari vektor virus dengan
virus lain hadir, batasan ukuran
memperkenalkan DNA (hingga 7 kb DNA, kurang dari
ukuran beberapa gen), dan kesulitan dalam persiapan
vektor virus tertentu.
Produksi Hewan Transgenik oleh Homolog
Berikut rekombinasi dalam sel induk embrionik berikut
Mikroinjeksi DNA
Hewan transgenik juga dapat diproduksi oleh
perubahan genetik in vitro embrionik pluripotent
sel induk (ES) (Gbr. 7) (Sedivy dan Joyner, 1992). ES
teknologi sel lebih efisien dalam menciptakan
genetika dari protokol injeksi mikro. Sel-sel ES, a
garis sel yang dikultur berasal dari massa sel bagian dalam
(blastokista) dari blastosit (praimplantasi awal
embrio), mampu memiliki DNA genomik mereka
dimodifikasi sambil mempertahankan kemampuan mereka untuk berkontribusi
baik garis keturunan sel somatik dan kuman. Gen yang diinginkan
dimasukkan ke dalam sel ES dengan salah satu dari beberapa metode
seperti injeksi mikro. Ini diikuti oleh pengantar
tion dari sel ES yang dimodifikasi secara genetik ke dalam
blastokista dari embrio preimplantasi awal, seleksi
dan kultur sel ES target yang
dipindahkan ke saluran reproduksi
hewan inang pengganti. Keturunan yang dihasilkan adalah
disaring untuk bukti bahwa genetik yang diinginkan
modifikasi hadir dan dipilih dengan tepat.
Pada tikus, proses menghasilkan sekitar 30% dari
progeny yang mengandung jaringan diturunkan secara genetik
dari sel ES yang dimasukkan. Keturunan dari
hewan pendiri yang dipilih dapat menghasilkan spesies homo-
zygous untuk mutasi.
Sementara mentransformasikan sel induk embrionik adalah
lebih efisien daripada teknik injeksi mikro
dijelaskan terlebih dahulu, gen yang diinginkan masih harus dimasukkan
ke dalam genom sel induk berbudaya untuk akhirnya
menghasilkan hewan transgenik. Penyisipan gen
dapat terjadi secara acak atau dalam proses yang ditargetkan. Non-
rekombinasi homolog, proses acak,
mudah terjadi jika DNA yang diinginkan dimasukkan
genom sel ES melalui proses rekombinasi gen
yang tidak memerlukan urutan homologi antara
DNA genom dan DNA asing. Sementara kebanyakan ES
Sel-sel gagal memasukkan DNA asing, beberapa melakukannya. Itu
yang dipilih dan disuntikkan ke dalam sel
massa blastokista hewan dan akhirnya
menyebabkan spesies transgenik. Dalam sel ES yang masih jauh lebih sedikit,
rekombinasi homolog terjadi secara kebetulan.
Segmen urutan basa DNA dalam vektor ditemukan
urutan homolog dalam genom inang dan
wilayah antara urutan homolog ini menggantikan
daerah yang cocok dalam DNA inang. Signifikan
maju dalam produksi hewan transgenik di ES
sel adalah munculnya target rekombinasi homolog
teknik tion.
Rekombinasi homolog, sementara banyak lagi
jarang sampai pada titik ini dalam penelitian transgenik daripada non-
rekombinasi homolog, bisa disukai bila
peneliti dengan hati-hati merancang (insinyur)
membuat DNA memiliki homologi urutan tertentu
DNA endogen di situs integrasi yang diinginkan
dan juga dengan hati-hati memilih kondisi transfer vektor
tions. Ini ditargetkan rekombinasi homolog di a
posisi kromosom yang tepat memberikan pendekatan
untuk modifikasi genetik hewan yang sangat halus
atau dapat digunakan untuk menghasilkan tikus KO (menjadi
dibahas nanti).
Modifikasi prosedur melibatkan penggunaan
sel induk sumsum tulang hematopoietik daripada
sel induk embrionik pluripoten. Penggunaan sel ES
menghasilkan perubahan pada seluruh baris kuman, sementara
sel punca hematopoietik yang dimodifikasi secara tepat adalah
diharapkan untuk mengisi kembali garis sel somatik tertentu atau
baris (lebih mirip dengan terapi gen).
Ilmu kloning dan etika yang dihasilkan
perdebatan di sekitarnya jauh di luar cakupan ini
bab. Namun penting untuk menempatkan konsep
kloning hewan dalam farmasi penting
konteks produksi hewan transgenik. Teknologi-
que microinjection (dan variasinya) telah terbentuk
dasar untuk produksi hewan transgenik komersial
tion. Meskipun berhasil, proses microinjection adalah
terbatas pada penciptaan hanya sejumlah kecil
hewan transgenik dalam kelahiran tertentu. Prosesnya lambat
pemuliaan konvensional transgenik yang dihasilkan
keturunan harus mengikuti untuk menghasilkan jumlah yang lebih besar
hewan transgenik dengan transgen yang sama dengan
organisme asli. Untuk menghasilkan kawanan (atau kawanan domba, dll.),
pendekatan alternatif akan menguntungkan. Itu
teknik transfer nuklir, penggantian
DNA genom nuklir dari oosit (telur yang belum matang) atau
embrio yang dibuahi sel tunggal dengan itu dari donor
sel adalah suatu metodologi pemuliaan alternatif.
"Kloning" hewan dapat dihasilkan dari transfer nuklir ini
teknologi. Ilmu yang dinilai paling penting
150
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 169
terobosan tahun 1997 (Sailor, 1997), menciptakan domba
Dolly, mamalia hasil kloning pertama, dari sel tunggal a
Betina berumur 6 tahun adalah prestasi yang banyak orang pikirkan
mustahil. Dolly lahir setelah transfer nuklir
genom dari sel kelenjar susu dewasa. Sejak
Pengumuman ini, komersial dan eksplorasi
memiliki teknologi transfer nuklir
berkembang pesat dengan berbagai spesies dikloning. ini
Penting untuk dicatat bahwa Dolly adalah domba hasil kloning
BUKAN binatang transgenik. Sementara Dolly adalah tiruan dari
betina dewasa, dia tidak memiliki transgen.
Namun, kloning dapat digunakan untuk membiakkan klon
Sel ES transfect
dengan DNA yang diinginkan
Memanen sel ES
Kultur sel ES,
clone dan pilih
Donor hewan sel ES
DNA asing yang diinginkan
Mikroinjeksi sel-sel ES yang mengandung
DNA asing yang diinginkan menjadi blastokista
Mentransfer blastokista (mengandung sel ES) ke
saluran reproduksi ibu pengganti
Kelahiran keturunan
Keturunan transgenik chimeric
mengandung kedua DNA yang diinginkan
dan DNA inang
Pilih keturunan, berkembang biak dan lanjutkan
garis kuman
Mengandung keturunan transgenik homozigot
DNA yang diinginkan
Progeny TIDAK mengandung
DNA yang diinginkan
DNA yang diinginkan (dalam sel ES di
blastokista) dimasukkan ke dalam
ibu pengganti
sistem reproduksi
+
Gambar 7 n Skema representasi dari produksi hewan transgenik dengan metodologi sel induk embrionik pluripotent.
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
151
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 170
hewan transgenik, atau untuk langsung menghasilkan transgenik
binatang (jika sebelum transfer nuklir, transgen adalah
dimasukkan ke dalam genom donor kloning). Untuk
misalnya, faktor manusia IX (protein faktor darah)
domba transgenik dihasilkan oleh transfer nuklir
dari transfusi janin fibroblast (Schniecke et al.,
1997). Beberapa keturunan yang dihasilkan ditunjukkan
menjadi transgenik (yaitu, memiliki faktor manusia IX
gen) dan satu bernama Polly. Dengan demikian, kloning hewan
dapat dimanfaatkan tidak hanya untuk pembibitan, tetapi juga untuk
produksi protein terapeutik manusia yang potensial
dan produk farmasi bermanfaat lainnya.
n Tanaman Transgenik
Berbagai teknologi rekayasa genetika bioteknologi
niques telah dipekerjakan untuk menciptakan kekayaan
spesies tanaman transgenik: kapas, jagung, kedelai,
kentang, petunia, tembakau, pepaya, mawar, dan lainnya.
Peningkatan pertanian telah dihasilkan oleh
tanaman neering agar lebih toleran terhadap herbisida, serangga
tahan, tahan jamur, tahan virus, dan stres
toleran (Baez, 2005; Andrawiss, 2006; Fox, 2006). Dari
penting bagi kesehatan manusia dan farmasi
bioteknologi, teknologi transfer gen secara rutin
digunakan untuk memanipulasi produksi protein massal manusia di Indonesia
berbagai macam spesies tanaman transgenik. ini
Penting untuk dicatat bahwa tanaman transgenik menarik
bioreaktor massal karena moda pasca-terjemahan mereka
proses ifikasi sering menghasilkan turunan tanaman
protein manusia rekombinan dengan glikosilasi yang lebih besar
kesamaan pola dengan yang ditemukan dalam korespondensi
ing protein manusia asli dari yang akan diamati di
sistem produksi mamalia yang sesuai. Itu
benih transgenik akan menghasilkan bibit yang mampu
mengekspresikan protein manusia. Transplantasi ke
bidang diikuti oleh pertumbuhan normal, panen
biomassa, dan isolasi dan protein hilir
pemurnian menghasilkan tanaman alternatif yang berharga untuk
pertanian. Ladang tembakau memproduksi farmasi
antibodi manusia tingkat (kadang-kadang disebut sebagai
"Plantibodies") dan vaksin yang dapat dimakan yang terkandung dalam
kentang transgenik dan tomat tidak futuristik
visi, tetapi proyek penelitian saat ini di bidang akademik dan
laboratorium perusahaan. Ladang petani bukan satu-satunya
situs untuk produksi protein manusia dari flora. Untuk
Contohnya, biakan alukoma eukariotik juga sedang terjadi
dikembangkan menjadi sistem ekspresi yang bermanfaat, khususnya
untuk antibodi manusia dan manusiawi (Mayfield dan
Franklin, 2005). Dengan terapi berbasis target antibodi
apeutika menjadi semakin penting, penggunaan
tanaman transgenik akan terus berkembang.
Produksi Protein Biofarmasi dalam Transgenik
Hewan dan Tumbuhan: “Biofarmasi”
Penggunaan hewan dan tumbuhan transgenik sebagai bioreaktor
untuk produksi penting secara farmasi
protein dapat menjadi salah satu kegunaan yang paling penting
spesies rekayasa (Powell, 2003; Baez, 2005;
Klimyuk et al., 2005). Tabel 3 memberikan daftar beberapa
contoh biofarmasi terpilih dari trans-
hewan dan tanaman genik. Memanfaatkan konvensional
teknik agronomi dan pertanian, hewan transgenik
dan tanaman menawarkan kesempatan untuk berproduksi secara praktis
biofarmasi dalam jumlah tak terbatas.
Teknik untuk menghasilkan hewan transgenik
telah digunakan untuk mengembangkan strain hewan yang mengeluarkan
tingkat tinggi protein penting di berbagai ujung
organ seperti susu, darah, urin dan jaringan lainnya.
Selama "peternakan gen," hewan besar tersebut
hewan transgenik berfungsi sebagai bioreaktor untuk disintesis
jumlah yang dapat dipulihkan dari program yang bermanfaat secara terapi
teins. Di antara kelebihan mengekspresikan protein dalam
susu hewan adalah protein yang umumnya diproduksi
dalam jumlah yang cukup besar dan dapat dipanen secara manual atau
secara mekanis dengan hanya memerah susu hewan. Protein
pemurnian dari susu membutuhkan pemisahan biasa
teknik seperti yang dijelaskan pada Bab 3. Secara umum,
gen rekombinan yang mengkode protein yang diinginkan
produk menyatu dengan urutan peraturan
gen penghasil susu hewan. Hewan-hewan tidak
terancam punah oleh penyisipan gen rekombinan.
Fusi logis dari gen produk protein dengan
gen penghasil susu menargetkan transkripsi dan
terjemahan produk protein secara eksklusif di
jaringan susu yang biasanya terlibat dalam produksi susu
dan tidak mengizinkan aktivasi gen di
jaringan penghasil susu pada hewan. Transgenik
strain terbentuk dan diabadikan dengan pemuliaan
binatang sejak keturunan asli
hewan transgenik (hewan pendiri) biasanya juga
menghasilkan protein rekombinan yang diinginkan.
Produksi obat-obatan protein diproduksi
secara transgenik diperkirakan 10-100 kali lebih besar
daripada yang dicapai dalam kultur sel rekombinan
(Echelard et al., 2005). Protein dihasilkan dari transgenik
hewan umumnya baik [perkiraan konservatif
1 gram / Liter (g / L) dengan efisiensi pemurnian 30%]
dengan hasil susu dari berbagai spesies per tahun
diperkirakan pada: sapi = 10.000L; domba = 500L; kambing =
400L; dan babi = 250L (Rudolph, 1995). PPL
Terapi telah memperkirakan bahwa biaya untuk menghasilkan
protein terapi manusia dalam bioreak hewani besar
torsi bisa 75% lebih murah daripada sel
budaya. Selain itu, sebaiknya protein target yang diinginkan
memerlukan modifikasi pasca-terjemahan, yang besar
mamalia digunakan dalam produksi susu obat-obatan
akan menjadi bioreaktor yang mampu menambahkan kelompok-kelompok itu
(tidak seperti kultur bakteri rekombinan).
Beberapa contoh peptida panjang manusia dan
protein dalam pengembangan dalam susu transgenik
hewan termasuk hormon pertumbuhan, interleukin-2, calci-
tonin, faktor pertumbuhan seperti insulin, alfa 1 antitrypsin,
152
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 171
Faktor pembekuan VIII, Faktor pembekuan IX, plasma jaringan
aktivator nogen (tPA), laktoferin, lipase lambung,
vaksin yang berasal dari toksin Escherichia coli LtB
subunit, protein C dan berbagai monoklonal manusia
antibodi (MAbs) (seperti yang dari
Xenomouse) (Garner dan Colman, 1998; Rudolph,
2000). Biofarmasi pertama yang disetujui dari
hewan transgenik adalah antitrom manusia rekombinan
bin (nama dagang ATryn, lihat Echelard et al., 2005).
Diproduksi dalam kawanan kambing perah transgenik, rhAT adalah
dinyatakan dalam tingkat tinggi dalam susu. Manusia AT
transgen dirakit dengan menghubungkan AT cDNA ke a
urutan protein susu normal (situs XhoI kambing
vektor kasein beta). Lihat Tabel 3 untuk tambahan
contoh.
Menggunakan teknik rekayasa genetika untuk menciptakan
tanaman transgenik, "pharming" untuk obat-obatan
memproduksi daftar obat yang terus berkembang dan
agen diagnostik yang berasal dari gen manusia (Baez,
2005; Andrawiss, 2006; Fox, 2006). Beberapa contoh
peptida dan protein manusia dalam pengembangan di
tanaman transgenik termasuk TGF-beta, virtonectin, thyr-
reseptor hormon perangsang-oid, insulin, glukoser-
ebrosidase, dan apoplipoprotein A-1. Lihat Tabel 3 untuk
contoh tambahan.
n Xenotransplantation: Transgenable Transgenic
Organ Hewan
Penggunaan transgenik yang inovatif untuk produksi
protein yang berguna adalah generasi secara klinis
organ hewan transgenik yang dapat ditransplantasikan. Kesuksesan
transplantasi manusia ke manusia dari jantung, ginjal,
hati, dan organ vaskularisasi lainnya (allotransplan-
tation) menciptakan harapan dan kebutuhan yang signifikan
untuk organ donor. Transplantasi primata ke manusia
(Transplantasi berhasil, tetapi etis
masalah dan terbatasnya jumlah hewan donor
hambatan signifikan. Diakui ahli bedah transplantasi
sejak awal organ-organ dari babi itu rasional
pilihan untuk xenotransplantasi (karena fisiologis,
alasan anatomi, etika, dan penawaran) jika
penolakan hiperakut serius bisa diatasi.
Beberapa kelompok penelitian di bidang akademik dan industri
telah mempelopori rekayasa transgenik babi
mengekspresikan kedua penghambatan komplemen manusia
protein serta protein kelompok darah utama manusia
(antigen) (Makowka, 1993; Fodor et al., 1994;
McCurry et al., 1995; Saadi dan Platt, 1997; Dunn
et al., 2005). Kloning sekarang menghasilkan transgenik
babi untuk xenotransplantasi. Sel, jaringan dan
organ-organ dari hewan transgenik ganda ini muncul
menjadi sangat tahan terhadap sistem kekebalan humoral
reaksi termediasi dari kedua primata dan kemungkinan
manusia. Temuan-temuan ini mulai membuka jalan bagi
potensi transplantasi hewan xenograft
komponen menjadi manusia dengan peluang berkurang
penolakan akut.
n Tikus Knockout
Sementara banyak spesies termasuk tikus, ikan zebra,
nemotodes, dll. telah ditransformasikan menjadi kehilangan genetik
berfungsi untuk studi penemuan obat dan penyakit
pemodelan, tikus telah terbukti menjadi yang paling berguna.
Tikus adalah spesies hewan laboratorium yang paling dekat
terkait dengan manusia di mana teknik KO bisa
mudah dilakukan, sehingga mereka adalah subjek favorit
percobaan knockout, Sementara mouse membawa
transgen yang diperkenalkan disebut tikus transgenik,
teknologi transgenik juga dapat menghasilkan KO
hewan (tikus adalah spesies hewan yang paling banyak dipelajari).
Mouse knockout, juga disebut mouse knockout gen
atau tikus knockout bertarget gen, adalah binatang di
yang merupakan gen endogen (alel tipe-liar genom)
telah secara khusus dinonaktifkan dengan menggantinya dengan a
null allele (Mak et al., 2001; Lesney, 2003; Sharpless dan
DePinho, 2006). Alel nol adalah alel nonfungsional
gen yang dihasilkan oleh penghapusan seluruh gen atau
mutasi gen yang menghasilkan sintesis suatu
protein tidak aktif. Kemajuan terbaru dalam gen intranuklear
menargetkan dan teknologi sel induk embrionik sebagai
dijelaskan di atas sedang memperluas kemampuan untuk
menghasilkan tikus knockout secara rutin untuk belajar tertentu
penyakit genetik manusia atau menjelaskan fungsi a
produk gen spesifik.
Prosedur untuk menghasilkan tikus KO
pada dasarnya melibatkan proses empat langkah. Alel nol
(Yaitu, knockout allele) dimasukkan ke dalam satu allele dari
sel ES murine. Penggabungan pada umumnya cukup rendah;
sekitar satu sel dalam sejuta memiliki yang dibutuhkan
penggantian gen. Namun, prosesnya dirancang
untuk memberikan resistensi neomisin dan gansiklovir hanya untuk
sel-sel ES di mana integrasi gen homolog
telah menghasilkan. Ini memfasilitasi pemilihan dan
gation dari sel ES yang direkayasa dengan benar. Itu
sel-sel ES yang dihasilkan kemudian disuntikkan ke tikus awal
embrio membuat tikus chimeric (heterozigot untuk
knockout allele) mengandung jaringan yang berasal dari keduanya
sel inang dan sel ES. Tikus chimeric dikawinkan dengan
mengkonfirmasi bahwa alel nol dimasukkan ke dalam
garis kuman. Tikus chimeric heterozigot yang dikonfirmasi
dibiakkan untuk homogenitas menghasilkan keturunan yang
tikus KO yang homozigot. Di seluruh dunia, tiga besar
program knockout mouse sedang berjalan dalam colla
Boration untuk membuat mutasi di masing-masing pendekatan
hampir 20.000 gen penyandi protein di mouse
genom menggunakan kombinasi gen trapping
dan penargetan gen pada batang embrionik tikus (ES)
sel (Staf, 2007). Ini termasuk: (1) KOMP
(Proyek KnockOut Mouse, http: //www.knockout-
mouse.org), didanai oleh NIH; (2) EUCOMM
(Mutagenesis Mouse Kebiasaan Eropa UE)
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
153
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 172
Program, http://www.eucomm.org), didanai oleh
Program FP6 dari Komisi Eropa; dan (3) NorCOMM (Utara
Proyek Mutagenesis Mouse COnditional Amerika,
http://norcomm.phenogenomics.ca/index.htm) adalah a
Proyek Kanada, didanai oleh Genome Kanada dan
mitra Hingga saat ini, hampir 4000 KO yang ditargetkan
gen telah tercapai. Komprehensif ini
dan sumber daya yang tersedia untuk umum akan membantu para peneliti
Jenis
Produk protein
Indikasi potensial
Sapi
Kolagen
Luka bakar, patah tulang
Sapi
Hormon kesuburan manusia
Infertilitas
Sapi
Albumin serum manusia
Operasi, luka bakar, syok, trauma
Sapi
Laktoferin
Infeksi bakteri GI
Kambing
a-1-anti-protease inhibitor
Kekurangan bawaan
Kambing
a-1-antitrypsin
Antiinflamasi
Kambing
Anti-trombin III (ATryn)
Komplikasi terkait dari defisiensi genetik atau didapat
Kambing
Hormon pertumbuhan
Dwarfisme hipofisis
Kambing
Hormon kesuburan manusia
Infertilitas
Kambing
Albumin serum manusia
Operasi, luka bakar, syok, trauma
Kambing
LAtPA2
Ulkus status vena
Kambing
Antibodi monoklonal
Kanker usus besar
Kambing
tPA2
Infark miokard, emboli paru
Babi
Faktor IX
Hemofilia
Babi
Faktor VIII
Hemofilia
Babi
Fibrinogen
Luka bakar, operasi
Babi
Hemoglobin manusia
Penggantian darah untuk transfusi
Babi
Protein C
Kekurangan, tambahan untuk tPA
kelinci
Faktor pertumbuhan seperti insulin
Penyembuhan luka
kelinci
Interleukin-2
Karsinoma sel ginjal
kelinci
Protein C
Kekurangan, tambahan untuk tPA
Domba
a – 1-antitrypsin
Antiinflamasi
Domba
Faktor VIII
Hemofilia
Domba
Faktor IX
Hemofilia
Domba
Fibrinogen
Terbakar
Domba
Protein C
Kekurangan, tambahan untuk tPA
Tembakau
IgG
Terapi sistemik (virus rabies, virus hepatitis B)
Tembakau
TGF-b2
Kanker ovarium
Tembakau
Virtonektin
Protease
Tembakau
Badak
Perpaduan protein adhesi manusia dan IgA manusia untuk flu biasa
Safflower
Insulin
Diabetes
Jagung
Meripase
Cystic fibrosis
Duckweed
Bakteri
Pelepasan a-interferon terkontrol untuk hepatitis B dan C
kentang
Vaksin unggas
Flu burung (H5N1)
Singkatan: tPA, aktivator plasminogen jaringan; LAtPA, aktivator plasminogen jaringan kerja panjang; TGF-b 3 , faktor pertumbuhan jaringan-beta.
Tabel 3 n Beberapa contoh protein manusia dalam pengembangan pada hewan dan tumbuhan transgenik.
154
SINDELAR
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.
Halaman 173
memeriksa peran masing-masing gen dalam fisiologi normal
dan pengembangan, dan menjelaskan patogenesis
fisiologi dan penyakit abnormal. Pembungkaman RNA
dan teknik interferensi (siRNA dan RNAi) adalah
berdampak pada produksi tikus KO dan
dibahas dalam Bab 9.
Penelitian sebelumnya yang luas telah menghasilkan dan
penemuan berkelanjutan dari tiga di seluruh dunia
konsorsium knockout mouse selanjutnya akan membuat lebih baik
model penyakit monogenik dan poligenik manusia
seperti kanker, diabetes, obesitas, kardiovaskular
penyakit, dan gangguan kejiwaan dan neurodegeneratif
memudahkan. Misalnya, tikus knockout telah
Gineered yang memiliki kolesterol sangat tinggi
level sambil dipertahankan pada diet chow normal
karena ketidakmampuan mereka untuk menghasilkan apolipoprotein E
(apoprotein E) (Zhang et al., 1992; Breslow, 1994).
Apoprotein E adalah komponen lipoprotein utama
sangat low-density lipoprotein (VLDL) yang bertanggung jawab
pembersihan hati VLDL. Tikus rekayasa ini adalah
sedang diperiksa sebagai model hewan aterosklerosis
berguna dalam penemuan dan pengembangan obat kardiovaskular
ment. Tabel 4 memberikan daftar beberapa tambahan
contoh terpilih dari model penyakit tikus knockout.
Mouse knockout menjadi alat dasar
bagi para peneliti untuk menentukan fungsi gen in vivo in
banyak sistem biologis. Misalnya, KO
teknologi mouse telah membantu mengubah pemahaman kami
berdiri dari respon imun (Mak et al., 2001). Itu
mempelajari hewan KO gen tunggal dan multipel
telah memberikan perspektif baru tentang pengembangan sel-T
ment, co-stimulasi dan aktivasi. “Manusiawi
tikus, ”Transgenic Severe Combined Immunodeficient
(SCID) tikus yang dicangkokkan dengan sel dan jaringan manusia
memungkinkan penelitian dalam kedokteran regeneratif, menular
penyakit, kanker, dan hematopoiesis manusia. Sebagai tambahan,
upaya sekuensing DNA throughput tinggi, posisi
program kloning, dan sel induk embrionik baru
semua daerah penelitian penemuan gen berbasis memanfaatkan
knockout mouse sebagai laboratorium mereka.
Model-model hewan yang direkayasa terbukti sangat berharga.
mampu melakukan penelitian farmasi sejak hewan kecil
model penyakit dapat dibuat dan divalidasi
meniru suatu penyakit pada pasien manusia. Mouse, tikus, dan
Zebrafish adalah model yang paling umum dieksplorasi dan
bekas. Rekayasa genetika dapat mempengaruhi hewan
untuk penyakit tertentu di bawah pengawasan dan
penyisipan gen manusia ke dalam hewan dapat dimulai
pengembangan penyakit yang lebih relevan secara klinis
kondisi. Dalam studi klinis manusia, penilaian
kemanjuran dan keamanan sering bergantung pada efek yang diukur untuk
pengganti biomarker dan pelaporan kejadian buruk.
Model hewan transgenik penyakit manusia yang disahkan
memungkinkan untuk studi paralel dan kemungkinan prediktabilitas
sebelum memasuki uji klinis. Juga dimungkinkan
menyaring calon obat potensial secara in vivo terhadap a
target reseptor manusia dimasukkan ke dalam model hewan.
Jumlah contoh model hewan transgenik
penyakit manusia yang berguna dalam penemuan obat dan
upaya pengembangan ini berkembang pesat (tidak berdaya
dan DePinho, 2006; Schultz et al., 2007). Model seperti itu
berpotensi meningkatkan efisiensi dan penurunan
biaya penemuan dan pengembangan obat oleh
mengurangi waktu yang dibutuhkan untuk memindahkan agen obat
dari penemuan menjadi uji klinis. Tabel 4 menyediakan a
daftar beberapa contoh terpilih rekayasa genetika
model hewan penyakit manusia.
Genetik
teknik
Gene (a)
Model penyakit
Pukulan knockout
BRCA1, BRCA2
Kanker payudara
Pukulan knockout
Apolipoprotein E
Aterosklerosis
Pukulan knockout
Glucocerebrosidase
Penyakit Gaucher
Pukulan knockout
HPRT
Lesch-Nyhan
sindroma
Pukulan knockout
Hexokinase A
penyakit Tay Sachs
Pukulan knockout
CFTR manusia
Cystic fibrosis
Pukulan knockout
P53
Penekan kanker
penghapusan gen
Pukulan knockout
P-glikoprotein
Resistensi multi-obat
(MDR)
Pukulan knockout
a-globin dan b-globin
Anemia sel sabit
Pukulan knockout
Oksidase urat
Encok
Pukulan knockout
Retinoblastoma-1
Retino Keluarga
blastoma
Transgen
c-neu onkogen
Kanker
Transgen
c-myc oncogene
Kanker
Transgen
Hormon pertumbuhan
Dwarfisme
Transgen
H-ras onkogen
Kanker
Transgen
Kompatibilitas Histok
antigen
Kekebalan auto
Transgen
Tat HIV
Sarkoma Kaposi
Transgen
APP manusia
Penyakit Alzheimer
Transgen
Manusia b-globin
Talasemia
Transgen
CD4 manusia
ekspresi
Infeksi HIV
Transgen
Manusia b-globin
mutan
Anemia sel sabit
Transgen
Manusia CETP
Aterosklerosis
Transgen
Akseptor LDL
Hiperkolesterolemia
Tabel 4 n Beberapa contoh rekayasa genetika terpilih
model penyakit hewan.
GENOMICS, TEKNOLOGI "OMICS" LAINNYA
155
Diunduh dari informahealthcare.com oleh Nyu Medical Center pada 18/06/18
Hanya untuk penggunaan pribadi.

Halaman 174
TEKNIK UNTUK MEMODIFIKASI DAN MEMPELAJARI PROTEIN DAN
PRODUK BIOTEKNOLOGI
n Rekayasa Protein
Banyak obat protein yang diproduksi bioteknologi awal
kandidat gagal dalam uji klinis karena kekurangan mereka
waktu paruh biologis, afinitas rendah untuk reseptornya, atau
imunogenisitas (McCafferty dan Glover, 2000).
Teknologi DNA rekombinan telah memungkinkannya
untuk insinyur khusus diubah atau baru dan baru
molekul protein yang memiliki bahan kimia dan
karakteristik biologis. Rekayasa protein yang disebut,
disengaja desain dan konstruksi yang unik
protein dengan sifat molekul ditingkatkan atau baru
adalah hasil dari menentukan urutan asam amino yang tepat
(struktur primer protein) dari protein itu (Narang,
1990; Richardson dan Richardson, 1990; Cleland dan
Craik, 1996). Ketika diterapkan pada enzim, prosesnya adalah
sering disebut rekayasa enzim.
Seperti dijelaskan dalam Bab 2, struktur utama
mempengaruhi konformasi protein. Konformasi
masing-masing dan setiap komponen asam amino hadir dalam
protein mempengaruhi protein kompleks tiga-
struktur dimensi (3-D). Pra konformasi yang
ferensi residu rantai protein menentukan
struktur sekunder protein termasuk a-heliks dan
b-sheet atau membalikkan terbalik. Struktur sekunder lokal
struktur dilipat menjadi struktur tersier 3-D yang dibuat
domain. Domain bukan hanya unit struktural,
tetapi juga unit fungsional sering mengandung utuh
pengikatan ligan (dalam reseptor) atau enzim katalitik
situs. Dengan demikian, rekayasa protein menyediakan pendekatan
untuk memodifikasi struktur protein asli secara khusus atau untuk
buat protein baru yang unik dengan protein tertentu
struktur. Rekayasa protein memiliki banyak kekuatan-
implikasi teoretis dan praktis untuk ujian-
ing dan memodifikasi struktur dan fungsi protein,
menggali mekanisme enzim, menyelidiki protein
lipat dan konformasi, meningkatkan stabilitas protein,
memperkenalkan kelompok yang dapat dideteksi menjadi protein sebagai
alat analisis, menghasilkan generasi kedua yang ditingkatkan
biofarmasi yang dirancang khusus, dan dalam hal
enzim, meningkatkan fungsi katalitik (Fothergill-
Gilmore, 1993; Nixon et al., 1998).
Protein rekayasa telah disiapkan oleh
banyak pendekatan berbeda. Sintetis kimia langsung
rute untuk protein kecil dengan asam amino yang dimodifikasi
urutan telah dirancang menggunakan salah satu solusi
dukungan kimia atau padat (kimia yang terjadi
sementara reaktan melekat pada manik-manik resin)
ques. Peptida synthesizer telah dirancang untuk
mengotomatiskan proses. Dugas memberikan yang bermanfaat
ikhtisar kimia rekayasa protein
(termasuk mutagenesis diarahkan-situs) (Dugas, 1999).
Sintesis fragmen gen yang mengkode untuk
mutasi adalah pendekatan lain untuk menghasilkan
protein rekayasa (Johnson dan Reitz, 1998).
Gen sepenuhnya sintetis sebanyak 100
kode nukleotida untuk mutasi yang diinginkan dapat berupa
dimasukkan ke dalam gen prokariotik (seperti Phage
M13) atau vektor ekspresi eukariotik. Hasilnya
gen mutan (gen hibrida) kemudian dikloning dan
menyatakan memproduksi protein hasil rekayasa. Itu
rute genetik ke protein rekayasa terbatas pada
daftar 20 asam amino alami, namun baru