Anda di halaman 1dari 11

TUBERKULOSIS

DISUSUN OLEH :
Haryogi Maulana
1765050372

Pembimbing :
dr. Linggom Kurniaty, Sp.FK

KEPANITERAAN KLINIK ILMU FARMASI DAN FARMAKOTERAPI


PERIODE 26 AGUSTUS 2019 – 28 SEPTEMBER 2019
FAKULTAS KEDOKTERAN
UNIVERSITAS KRISTEN INDONESIA
JAKARTA
A. Definisi
Tuberkulosisadalahsuatupenyakitmenular yang disebabkan oleh kuman
Mycobacterium tuberculosis. Terdapatbeberapaspesies Mycobacterium, antara lain: M.
tuberculosis, M. africanum, M. bovis, M. Leprae dsb. Yang juga
dikenalsebagaiBakteriTahanAsam (BTA). Kelompokbakteri Mycobacterium selain
Mycobacterium tuberculosis yang bisamenimbulkangangguan pada
salurannafasdikenalsebagai MOTT (Mycobacterium Other Than Tuberculosis) yang
terkadangbisamengganggupenegakan diagnosis dan pengobatan TBC. 1
Gejalautamapasien TBC paruyaitubatukberdahakselama 2 mingguataulebih.
Batukdapatdiikutidengangejalatambahanyaitudahakbercampurdarah, batukdarah,
sesaknafas, badan lemas, nafsumakanmenurun, berat badan menurun, malaise,
berkeringatmalamharitanpakegiatanfisik, demammerianglebihdarisatubulan. Pada
pasiendengan HIV positif, batuksering kali bukanmerupakangejala TBC yang khas,
sehinggagejalabatuktidakharusselaluselama 2 mingguataulebih. 1

B. Patofisiologi
C. Diagnosis

Gambar 1. Skema Alur Diagnosis TB paru pada orang dewasa

1.Anamnesis

Supek TB adalahseseorangdengangejalaatautanda TB. Gejalaumum TB


paruadalahbatukproduktif>2 minggu, yang disertai :
1. Gejalapernapasan (nyeri dada, sesaknapas, hemoptisis) dan/atau
2. Gejalasistemik (demam, tidaknafsumakan, penurunanberat badan keringatmalam
dan mudahlelah).
2. PemeriksaanFisik
Permeriksaanfisikkelainan pada TB parutergantungluaskelainanstrukturparu.
Pada awalpermulaanperkembanganpenyakitumumnyasulitsekalimenemukankelainan.
Pada auskultasiterdengarsuaranapas bronchial/amforik/ronkhibasah/suaranapas
melemah di apex paru, tanda-tandapenarikanparu, diafragma dan mediastinum.

3. PemeriksaanPenunjang

1. Darah: limfositosis/ monositosis, LED meningkat, Hb turun.


2. Pemeriksaanmikroskopiskuman TB (BakteriTahanAsam/BTA) atau kultur
kumandarispesimen sputum/dahaksewaktu-pagi-sewaktu.
3. Untuk TB non paru, spesimendapatdiambildaribilaslambung, cairanserebrospinal,
cairan pleura ataupunbiopsijaringan.
4. Radiologidenganfototoraks PA-Lateral/ top lordotik.
Pada TB, umumnya di apeksparuterdapatgambaranbercak-bercakawandenganbatas
yang tidakjelasataubiladenganbatasjelasmembentuktuberkuloma. Gambaran lain yang
dapatmenyertaiyaitu, kavitas (bayanganberupacincinberdinding tipis), pleuritis
(penebalan pleura), efusi pleura (sudutkostrofrenikustumpul).
4. Penegakkan Diagnosis (Assesment)

Diagnosis ditegakkan Berdasarkan anamnesis, pemeriksaanfisik dan pemeriksaan


penunjang (sputum untukdewasa, testuberkulin pada anak).

Kriteria Diagnosis Berdasarkan International Standars for Tuberculosis Care (ISTC


2014)

StandarDiagnosis

1. Untuk memastikan diagnosis lebih awal,


petugaskesehatanharuswaspadaterhadapindividu dan grupdenganfaktorrisiko TB
denganmelakukanevaluasiklinis dan pemeriksaaandiagnostik yang tepat pada
merekadengangejala TB.
2. Semuapasiendenganbatukproduktif yang berlangsungselama ≥ 2 minggu yang
tidakjelaspenyebabnya, harusdievaluasiuntuk TB.
3. Semua pasien yang didugamenderita TB dan mampumengeluarkandahak,
harusdiperiksamikroskopisspesimenapusan sputum/dahak minimal 2 kali atau 1
spesimen sputum untukpemeriksaanXpert MTB/RIF*, yang diperiksa di laboratorium
yang kualitasnyaterjamin, salah satudiantaranyaadalahspesimenpagi.
Pasiendenganrisikoresistensiobat, risiko HIV
atausakitparahsebaiknyamelakukanpemeriksanXpert MTB/RIF* sebagai uji
diagnostikawal. Uji serologidarah dan interferon- gamma release assay
sebaiknyatidakdigunakanuntukmendiagnosis TB aktif.
4. Semuapasien yang didugatuberkulosisekstraparu, spesimendari organ yang
terlibatharusdiperiksasecaramikrobiologis dan histologis. Uji Xpert MTB/RIF
direkomendasikansebagaipilihan uji mikrobiologisuntukpasienterduga meningitis
karenamembutuhkanpenegakan diagnosis yang cepat.
5. Pasienterduga TB denganapusandahaknegatif, sebaiknyadilakukanpemeriksaanXpert
MTB/RIF dan/atau kultur dahak. Jikaapusan dan uji Xpert MTB/RIF* negatif pada
pasien denga gejalaklinis yang mendukung TB, sebaiknyasegeradiberikanpengobatan
anti tuberkulosissetelahpemeriksaan kultur.
D. PilihanObat
Pengobatantuberkulosisterbagimenjadi 2 faseyaitufaseintensif (2-3 bulan) dan
faselanjutan 4 atau 7 bulan. Paduan obat yang digunakanterdiridaripaduanobatutama dan
tambahan. 1
Kategori I Kategori II
Paduan OAT Paduan OAT inidiberikanuntukpasien BTA
inidiberikanuntukpasienbaru: positif yang telahdiobatisebelumnya:
• Pasienbaru TB paru BTA positif • Pasienkambuh
• Pasien TB paru BTA • Pasiengagal
negatiffototorakspositif •
• Pasien TB ekstraparu Pasiendenganpengobatansetelahputusberobat
(default)

 Jenisobatutama (linipertama). 3

Paduan OAT yang digunakan oleh Program Nasional Penanggulangan TB di Indonesia:

a. Kategori1 : 2HRZE/4(HR)3.
b. Kategori2 :2(HRZE)S/(HRZE)/5(HR)3E3
 Kombinasidosistetap (Fixed dose combination). 3
a. Kategori 1

b. Kategori 2

1. Rifampisin (R)
Rifampisinadalah derivate semisintetikrifamisin B yaitu salah satuanggota
kelompok antibiotic makrosiklik yang disebutrifamisin. Rifampisinterutamaaktif
terhadapsel yang sedangbertumbuh. Kerjanyamenghambat DNA-dependent RNA
polymerase darimikobakteriadenganmenekanmulaterbentuknyarantaidalamsintesis
RNA. 4
2. Isoniazid (H)
Mekanismekerjabelumdiketahui, namunadabeberapahipotesis yang di ajukan.
Ada pendapatbahwaefekutamanyaialahmenghambatbiosintesisasammikolat yang
merupakanunsurpentingdindingselmikrobakterium. Isoniazid kadarrendahmencegah
perpanjanganrantaiasamlemak yang sangatpanjang yang merupakanbentukawal
molekulasammikolat.4

3. Pirazinamid (Z)
Mekanismekerjaobatinibelumdiketahui. Pirazinamid di dalamtubuhdi
hidrolisisoehenzimpirazinamidasemenjadiasampirazinoat yang
aktifsebagaituberkulostatikhanya pada media yang bersifatasam.4
4. Ethambutol (E)
Obatinitetapmenekanpertumbuhankuman tuberculosis yang telahresistenterhadap
isoniazid dan sterptomisin.
Kerjanyamenghambatsintesismetabolitselsehinggametabolismeselterhambat dan selmati.
Karena ituobatinihanyaefektifterhadapsel yang bertumbuhdenganefektuberkulostatik.4
5. Streptomisin (S)
Setelah diserapdaritempatsuntikan, hampirsemuastreptomisinberadadalam
plasma. Hanyasedikitsekali yang masukkedalameritrosit.
Streptomisinkemudianmenyebarkeseluruhcairan
ekstrasel.4Mekanismekerjanyaadalahdengancaramenginhibisisintesis protein bakteri.

E. EfekSamping3
F. InteraksiObat
1. Rifampisin
Pemberian
PASbersamarifampisinakanmenghambatabsorpsirifampisinsehinggakadarnyadalamda
rahtidakcukup. Rifampisinmerupakanpemacumetabolismeobat yang cukupkuat,
sehinggaberbagaiobathipoglikemik oral, kortikosteroid, dan kontrasepsi oral
dapatberkurangefektifitasnyabiladiberikanbersamarifampisin. Rifampisinmungkin
juga mengganggu metabolism vitamin D
sehinggadapatmenimbulkankelainantulangberupaosteomalasia. Disulfiram dan
probenesiddapatmenghambatekskresirifampisinmelaluiginjal.4
2. Isoniazid5
- Isoniazid dapatmeningkatkanefekdariobatberikut:
 warfarin
 karbamazepin
 fenitoin, mephenytoin
 benzodiazepinseperti alprazolam, diazepam, lorazepam
 teofilin
- Antasida. Garam aluminiumakanmenurunkanaksi isoniazid
- Isoniazid dapatmenurunkankerjaobatantijamurketokonazolitrakonazol. Oleh
karenaitu, infeksijamurmungkintidakdiobatisecaramemadai
3. Pirazinamid
- Mengonsumsiberbarengandenganrifampisindapatmeningkatkanrisikokerusakanhat
i
- Probenacidjikadikonsumsibersamaandenganpirazinamiddapatmenimbulkanefekan
tagonis, sehinggadapatmengurangiefektifitaspirazinamid.
- Mengurangiefektifitasobatkontrasepsi
- Penggunaanbersamaandengansiklosporindapatmeningkatkankonsentrasisiklospori
ndalamdarah.

4. Etambutol
- Obat-obatantasida yang mengandungalumuniumhidroksidamengurangiabsorpsi
ethambutol.
5. Streptomisin 4
- Interaksidapatterjadidenganobatpenghambat neuromuscular
berupapotensialpenghambatan. Selainituinteraksi juga terjadidenganobat lain yang
bersifatototoksik (misalnya furosemide) dan yang bersifatnefrotoksi.
DAFTAR PUSTAKA

1. Panduan PraktikKlinis. Edisirevisitahun 2014.


2. Asma “Pedoman Diagnosis &Penatalaksanaan di Indonesia”. PerhimpunanDokterParu
Indonesia.2006.
3. Departemen Farmakologi dan TerapeutikFakultasKedokteran Indonesia.Farmakologi
dan Terapi. 2016. Edisi ke-6. hal. 345-65.
4. Katzung, B.G. dan Trevor, A.J., 2017. Basic and Clinical Pharmacology.McGraw- Hill
Education.