Anda di halaman 1dari 55

1.

TEMPLATE SOAL PERAWAT (beri warna hijau pada item yang sesuai pada kolom
jabaran)
ID soal (diisi kode identitas soal oleh panitia)
Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis
Pengetahuan aplikasi prosedural (prosudural knowlwgde)
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik /
Manajemen /DKKD
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi / Lain-
lain
Tinjauan 5 Promotif /Preventif/ nursing treatment/ rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Eliminasi / aktivitas & istirahat/ Aman
&.nyaman / Psikosisial / Seksual / komunikasi/belajar /nilai dan keyakinan
Tinjauan 7 : Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/sistem kesehatan Jiwa / Sistem manajemen
Kasus (vignete)
Seorang anak perempuan umur 1 tahun, dibawa oleh orangtuanya ke Rumah Sakit karena
mengalami pembesaran kepala sejak 1 bulan yang lalu, setelah di lakukan pemeriksaan fisik,
didapatkan hasil: lingkar kepala 59 cm, berat badan 6,5 kg, tinggi badan 67 cm, terdapat sunset
sign, belum bisa berjalan, aktifitas fisik hanya di tempat tidur atau digendong oleh orangtuanya.

Pertanyaan soal
Apakah masalah keperawatan utama pada kasus diatas?

Pilihan jawaban
a. Gangguan pertumbuhan dan perkembangan
b. Gangguan nutrisi kurang dari kebutuhan
c. Resiko tinggi gangguan integritas kulit
d. Resiko gangguan cairan dan elektrolit
e. Kurangnya pengetahuan orangtua

Kunci Jawaban: A
Referensi: The Amarican Academy Of Pediatric. 2005. (Alih Bahasa : Surya
Satyanegara & Anton CW) Panduan Lengkap Perawatan Bayi dan Balita.
Jakarta, Arcan.
Nama pembuat Ali Musthofa, S.Kep., Ners
Institusi/bagian STIKes Dharma Husada Bandung/Anak

2. TEMPLATE SOAL PERAWAT (beri warna hijau pada item yang sesuai pada kolom
jabaran)
ID soal (diisi kode identitas soal oleh panitia)
Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis
Pengetahuan aplikasi prosedural (prosudural knowlwgde)
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik /
Manajemen /DKKD
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi / Lain-
lain
Tinjauan 5 Promotif /Preventif / nursing treatment/ rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi/ Eliminasi / aktivitas & istirahat/ Aman
&.nyaman / Psikosisial / Seksual / komunikasi/belajar /nilai dan keyakinan
Tinjauan 7 : Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/sistem kesehatan Jiwa / Sistem manajemen
Kasus (vignete)
Seorang anak laki-laki berusia2 tahun dibawa orang tuanya ke Poli Anak dengan keluhan buang
air besar 4 kali dalam 1 hari, muntah 3 kali dalam satu hari, tidak ada napsu makan dan tidak
bisa tidur. Hasil pengkajian didapatkan suhu 38’ c, turgor jelek, mukosa kering.

Pertanyaan soal
Apakah masalah keperawatan utama pada kasus tersebut?

Pilihan jawaban
A. Gangguan Nutrisi
B. Gangguan istirahat
C. Gangguan hospitalisasi
D. Gangguan rasan nyaman
E. Gangguan cairan dan elektrolit

Kunci Jawaban: E
Referensi: Sodikin. 2011. Asuhan Keperawatan Anak : Gangguan Sistem
Gastrointestonal dan Hepatobilier. Jakarta, Salemba Medika.
Nama pembuat Ali Musthofa, S.Kep., Ners
Institusi/bagian STIKes Dharma Husada Bandung/Anak

3. TEMPLATE SOAL PERAWAT (beri warna hijau pada item yang sesuai pada kolom
jabaran)
ID soal (diisi kode identitas soal oleh panitia)
Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis
Pengetahuan aplikasi prosedural (prosudural knowlwgde)
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik /
Manajemen /DKKD
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi / Lain-
lain
Tinjauan 5 Promotif /Preventif/ nursing treatment/ rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi/ Eliminasi / aktivitas & istirahat/ Aman
&.nyaman / Psikosisial / Seksual / komunikasi/belajar /nilai dan keyakinan
Tinjauan 7 : Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/sistem kesehatan Jiwa / Sistem manajemen
Kasus (vignete)
Seorang ibu sedang cemas melihat bayinya yang berusia 8 bln, sesak dan nafas bunyi “grok-
grok”. Setelah dilakukan pemeriksaan fisik didapatkan : Nadi 92 kali/mnt, Suhu 38.5’C,
Pernapasan 52 kali/mnt, bunyi napas ronkhi tampak tarikan dinding dada kedalam dan
pernapasan cuping hidung.

Pertanyaan soal
Apakah tindakan kolaboratif yang utama pada bayi tersebut ?

Pilihan jawaban
A. Nebulizer
B. Antiperetik
C. Broncodilator
D. Obat ekspektoran
E. Oksigen 2 ltr/mnt

Kunci Jawaban: E
Referensi: Somantri, Irman. 2012. Asuhan Keperawatan Pada Klien dengan
Gangguan Sistem Pernapasan Jakarta, Salemba Medika.
Nama pembuat Ali Musthofa, S.Kep., Ners
Institusi/bagian STIKes Dharma Husada Bandung/Anak

4. TEMPLATE SOAL PERAWAT (beri warna hijau pada item yang sesuai pada kolom
jabaran)
ID soal (diisi kode identitas soal oleh panitia)
Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis
Pengetahuan aplikasi prosedural (prosudural knowlwgde)
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik /
Manajemen /DKKD
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi / Lain-
lain
Tinjauan 5 Promotif / Preventif /nursing treatment/ rehabilitatif
Tinjauan 6 Oksigen /Cairan &.elektrolit / Nutrisi / Eliminasi / aktivitas & istirahat/ Aman
&.nyaman / Psikosisial / Seksual / komunikasi/belajar /nilai dan keyakinan
Tinjauan 7 : Sistem Kardiovaskuler / Sistem Respirasi/ Sistem Imuno-hematologi / Sistem
Neurobehaviour/ Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal/ Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/sistem kesehatan Jiwa / Sistem manajemen
Kasus (vignete)
Seorang bayi laki-laki baru saja lahir di Rumah Sakit, kondisi bayi 5 menit setelah lahir setelah
dilakukan penghisapan lendir adalah badan merah kaki biru, detak jantung 88 x/mnt, menangis
lemah, ekstrimitas sedikit fleksi, tonus otot kurang baik dan usaha bernafas lambat/lemah.

Pertanyaan soal
Berapa nilai APGAR Score pada bayi tersebut ?

Pilihan jawaban
A. 4
B. 5
C. 6
D. 7
E. 8
Kunci Jawaban: B
Referensi: Donna L Wong (et all). 2009. (Alih Bahasa : Sutarna, Agus (et all). Buku
Ajar Keperawatan Pediatrik . Jakarta, EGC.
Nama pembuat Ali Musthofa, S.Kep., Ners
Institusi/bagian STIKes Dharma Husada Bandung/Anak

5. TEMPLATE SOAL PERAWAT (beri warna hijau pada item yang sesuai pada kolom
jabaran)
ID soal (diisi kode identitas soal oleh panitia)
Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis
Pengetahuan aplikasi prosedural (prosudural knowlwgde)
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik /
Manajemen /DKKD
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi / Lain-
lain
Tinjauan 5 Promotif /Preventif/ nursing treatment/ rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit/ Nutrisi/ Eliminasi / aktivitas & istirahat/ Aman
&.nyaman / Psikosisial / Seksual / komunikasi/belajar /nilai dan keyakinan
Tinjauan 7 : Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi/ Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/sistem kesehatan Jiwa / Sistem manajemen
Kasus (vignete)
Seorang anak laki-laki berusia 12 bulan,dibawa ibunya ke Poli Anak dengan keluhan ± 8 jam
yang lalu anak mengalami panas tinggi disertai kejang terjadi 1 kali dengan waktu ± 2 menit,
setelah itu klien muntah dan batuk yang berulang. Hasil pemeriksaan didapatkan nadi 110
kali/menit, respirasi 40 kali/menit, suhu 39,5 ‘c, Hasil laboratorium leukosit 14.200/ mm3.

Pertanyaan soal
Apakah diagnosa keperawatan utama pada anak tersebut ?

Pilihan jawaban
A. Gangguan istirahat
B. Gangguan rasa aman
C. Gangguan pola napas
D. Gangguan termogulasi
E. Resiko gangguan nutrisi

Kunci Jawaban: D
Referensi: Carpenitto.LJ. 2000. Diagnosa KeperawatanAplikasi Pada Praktek Klinis.
Ed 6. EGC. Jakarta
Nama pembuat Ali Musthofa, S.Kep., Ners
Institusi/bagian STIKes Dharma Husada Bandung/Anak

.
6. TEMPLATE SOAL PERAWAT (beri warna hijau pada item yang sesuai pada kolom
jabaran)
ID soal (diisi kode identitas soal oleh panitia)
Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis
Pengetahuan aplikasi prosedural (prosudural knowlwgde)
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik /
Manajemen /DKKD
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi / Lain-
lain
Tinjauan 5 Promotif /Preventif / nursing treatment/ rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit/ Nutrisi/ Eliminasi / aktivitas & istirahat/ Aman
&.nyaman / Psikosisial / Seksual / komunikasi/belajar /nilai dan keyakinan
Tinjauan 7 : Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/sistem kesehatan Jiwa / Sistem manajemen
Kasus (vignete)
Seorang anak perempuan berusia 12 bulan dirawat di bangsal anak dengan diagnose keperawatan
Ganguan pemenuhan kebutuhan nutrisi kurang dari kebutuhan tubuh, dimana dari hasil
pemeriksaan fisik Konjungtiva anemis, klien muntah 3 kali, klien makan habis 3 sendok, HB
10,3 gr/dl, Ht 39%, BB sebelum sakit 8,5 kg, BB saat ini 7 kg, BB ideal anak 1 tahun : 10 kg,
nafsu makan klien menurun.

Pertanyaan soal
Apakah intervensi utama yang paling tepat pada kasus tersebut ?

Pilihan jawaban
A. Observasi TTV setiap 4 jam sekali
B. Diskusikan dengan orang tua klien gizi seimbang
C. Lakukan pendidikan kesehatan tentang pola makan
D. Berikan pendekatan setiap akan melakukan prosedur
E. Anjurkan klien untuk makan dalam porsi kecil tapi sering

Kunci Jawaban: E
Referensi: Doengoes,2000. Asuhan Keperawatan Maternal/ Bayi. EGC. Jakarta
Nama pembuat Ali Musthofa, S.Kep., Ners
Institusi/bagian STIKes Dharma Husada Bandung/Anak
7. TEMPLATE SOAL PERAWAT (beri warna hijau pada item yang sesuai pada kolom
jabaran)
ID soal (diisi kode identitas soal oleh panitia)
Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis
Pengetahuan aplikasi prosedural (prosudural knowlwgde)
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik /
Manajemen /DKKD
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi / Lain-
lain
Tinjauan 5 Promotif /Preventif/ nursing treatment/ rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Eliminasi / aktivitas & istirahat/ Aman
&.nyaman / Psikosisial / Seksual / komunikasi/belajar /nilai dan keyakinan
Tinjauan 7 : Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/sistem kesehatan Jiwa / Sistem manajemen
Kasus (vignete)
Seorang bayi laki-laki berusia 5 bulan, dibawa ibunya ke Poli Ortopedidengan keluhan ada
kelainan pada kaki. Hasil pengkajian didapatkan diagnose medis clubfoot, pada telapak kaki
sudah keras dan kaku.

Pertanyaan soal
Apakah tindakan kolaborasi utama untuk mengatasi permasalahan pada kasus tersebut ?
Pilihan jawaban
a. Fisoterapi sendi
b. Penggunaan sepatu khusus
c. Melakukan bedah orthopedi ringan pada kaki anak
d. Menganjurkan kekeluarga untuk menjaga bayi agar jangan sampai cidera
e. Melakukan serangkaian therapy gips selama periode 3 sampai dengan 6 minggu

Kunci Jawaban: E
Referensi: The Amarican Academy Of Pediatric. 2005. (Alih Bahasa : Surya
Satyanegara & Anton CW) Panduan Lengkap Perawatan Bayi dan Balita.
Jakarta, Arcan.
Nama pembuat Ali Musthofa, S.Kep., Ners
Institusi/bagian STIKes Dharma Husada Bandung/Anak

Format Soal Uji Kompetensi (1)

ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jabaran
Tinjauan 1 Praktik professional, etis, legal dan peka budaya

Perawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 K ognitif

Pengetahuan aplikasi prosedural (prosudural knowledge)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/Maternitas/Anak/Jiwa/Keluarga/Gerontik/Manajemen/Gadar

Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Aman dan Nyaman/ Eliminasi /


Aktifitas dan istirahat/ Psikososial / Komunikasi/ Seksual / Nilai dan
Keyakinan

Tinjauan 7 Pernafasan / Jantung Pembuluh Darah dan Sistem Limfatik / Pencernaan


dan Hepatobilier / Saraf dan Perilaku/ Endokrin dan Metabolisme/

Muskuloskeletal / Ginjal dan Saluran Kemih / Reproduksi / Integumen /


Darah dan Sistem Kekebalan Tubuh / Penginderaan

Vignette

Seorang bayi laki-laki baru lahir dengan BB 2 Kg, lingkar kepala 34 cm, kulit tipis transparan, lanugo
cbanyak terutama pada dahi, pelipis, telinga dan lengan, lemak kulit kurang, ekstremitas nampak
kebiruan, akral teraba dingin. Pada pemeriksaan tanda vital diperoleh frekuensi nafas 60 x/menit,
frekuensi nadi 120 x/menit, suhu 35,80C

Pertanyaan soal

Apakah diagnose keperawatan prioritas dari kasus diatas ?

Pilihan Jawaban

a. Infeksi
b. Hipotermi
c. Pola nafas tidak efektif
d. Tidak efektif perfusi jaringan
e. Resti ketidakseimbangan cairan dan elektrolit
Kunci B

Referensi Pengantar ilmu keperawatan anak 1, A. Azis Alimul Hidayat

Nama pembuat K. Dewi Budiarti, S.Kp., M.Kep

Institusi/bagian STIKes Karsa Husada Garut

Format Soal Uji Kompetensi (4)

ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jawaban

Tinjauan 1 Praktik professional, etis, legal dan peka budaya

Perawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 K ognitif
Pengetahuan aplikasi prosedural (prosudural knowledge)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/Maternitas/Anak/Jiwa/Keluarga/Gerontik/Manajemen/Gadar

Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Aman dan Nyaman/ Eliminasi /


Aktifitas dan istirahat/ Psikososial / Komunikasi/ Seksual / Nilai dan
Keyakinan

Tinjauan 7 Pernafasan / Jantung Pembuluh Darah dan Sistem Limfatik / Pencernaan


dan Hepatobilier / Saraf dan Perilaku/ Endokrin dan Metabolisme/

Muskuloskeletal / Ginjal dan Saluran Kemih / Reproduksi / Integumen /


Darah dan Sistem Kekebalan Tubuh / Penginderaan

Vignette

Seorang ibu datang ke RS membawa bayi berusia 3 hari dengan keluhan kuning. Pada pemeriksaan
fisik diperoleh BB 2 Kg, bayi tidak mau menetek. Pada pemeriksaan tanda-tanda vital diperoleh
frekuensi nadi 120 x/menit, frekuensi nafas 50 x/menit, suhu 37 0. Pada pemeriksaan laboratorium
diperoleh kadar bilirubin serum 13 mg%.

Pertanyaan soal

Apakah tindakan perawat yang harus dilakukan pada pasien diatas?

Pilihan Jawaban

a. Melakukan fototherapy
b. Memberikan therapy cairan
c. Mengobservasi tanda-tanda vital
d. Memasukkan klien ke dalam inkubator
e. Menjaga keseimbangan suhu tubuh klien

Kunci A

Referensi Pengantar ilmu keperawatan Anak 1


Nama pembuat K. Dewi Budiarti, S.Kp., M.Kep

Institusi/bagian STIKes Karsa Husada Garut

ID soal 2
Tinjauan Jabaran
Tinjauan 1 Praktik profesional, etis, legal dan peka budaya
Asuhan keperawatandan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/ Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis/ Perencanaan / Implementasi/ Evaluasi
Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &elektrolit / Nutrisi / Eliminasi / Aman & nyaman / aktifitas&
istirahat/ komunikasi/ belajar/ seksual/nilai dan keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler/ Sistem Respirasi / Sistem Imun dan Hematologi/ Sistem
: Neurobehavior / Sistem Endokrin / Sistem Pencernaan/ Sistem Muskuloskeletal /
Sistem Integumen/ Sistem Perkemihan / Sistem Reproduksi/ Sistem penginderaan/
lain-lain
Kasus (vignete)
Seorang anak laki-laki berusia 3 tahun dibawa ke Poli Tumbuh Kembang oleh Ibunya dengan
keluhan belum bisa bicara dan berjalan.. Hasil pemeriksaan diperoleh : TB 95 cm, BB 13 Kg, , Suhu
37 oC, Nadi 96 x / menit, pernapasan 24 x / menit, Lingkar lengan 17 cm (kiri), lingkar kepala 50 cm.

Pertanyaan soal :
Apakah tindakan keperawatan utama pada kasus tersebut ?

Pilihan jawaban :
A. Menganjurkan ibu untuk selalu melatih anak bicara
B. Melatih anak untuk mengucapkan kata yang sederhana
C. Mendiskusikan tentang cara orangtua melatih anak berjalan
D. Mengkaji tingkat perkembangan berdasarkan panduan di KIA
E. Memberikan penjelasan tentang perkembangan yang harus sudah dilalui untuk anak usia 3 tahun
Kunci Jawaban: D
Referensi: Wilkinson, Judith M. 2007. Buku Saku Diagnosis Keperawatan dengan
Intervensi NIC dan kriteria hasil NOC. Jakarta : EGC
Nama pembuat WennyNugrahatiCarsita, S.Kep.,Ns
Institusi/bagian NersSTIKesIndramayu
ID soal 4
Tinjauan Jabaran
Tinjauan 1 Praktik profesional, etis, legal dan peka budaya
Asuhan keperawatandan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/ Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis/ Perencanaan / Implementasi / Evaluasi
Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &elektrolit / Nutrisi / Eliminasi / Aman & nyaman / aktifitas &
istirahat/ komunikasi/ belajar/ seksual/nilai dan keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler/ Sistem Respirasi / Sistem Imun dan Hematologi/ Sistem
: Neurobehavior/ Sistem Endokrin / Sistem Pencernaan/ Sistem Muskuloskeletal /
Sistem Integumen/ Sistem Perkemihan / Sistem Reproduksi/ Sistem penginderaan/
lain-lain
Kasus (vignete)
Seorang bayi baru lahir di rawat di ruang Perinatologi karena tidak mengeluarkan mekonium selama
28 jam. Kemudian perawat melakukan pemeriksaan fisik didapatkan hasil : terdapat distensi
abdomen, muntah setelah diberikan ASI. Pada pemeriksaan rectal toucher tidak terdapat anus.

Pertanyaan soal :
Apakah tindakan utama yang dilakukan pada kasus di atas?

Pilihan jawaban :
A. Pemasangan infus
B. Pemasangan NGT
C. Pasien dipuasakan
D. Kolaborasi Kolostomi
E. Pemasangan pipa rektal
Kunci Jawaban: D
Referensi: Ngastiyah, 2001.Perawatan Anak Sakit. Jakarta : EGC
Nama pembuat WennyNugrahatiCarsita, S.Kep.,Ns
Institusi/bagian NersSTIKesIndramayu

ID soal 6
Tinjauan Jabaran
Tinjauan 1 Praktik profesional, etis, legal dan peka budaya
Asuhan keperawatandan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/ Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis/ Perencanaan / Implementasi/ Evaluasi
Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &elektrolit / Nutrisi / Eliminasi / Aman & nyaman / aktifitas &
istirahat/ komunikasi/ belajar/ seksual/nilai dan keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler/ Sistem Respirasi / Sistem Imun dan Hematologi/ Sistem
: Neurobehavior/ Sistem Endokrin / Sistem Pencernaan/ Sistem Muskuloskeletal /
Sistem Integumen/ Sistem Perkemihan / Sistem Reproduksi/ Sistem penginderaan/
lain-lain
Kasus (vignete)
Seorang anak perempuanberusia 5 bulan dibawa oleh orang tuanya ke Rumah Sakit dengan alasan
sudah seminggu menderita demam. Pasien juga mengalami kejang 8 jam yang lalu. Hasil
pemeriksaan fisik diperoleh kesadaran compomentis, nadi 140 x/mnt, suhu 38,5 oC, pernafasan 40
x/mnt teratur.

Pertanyaan soal :
Apakah diagnosa keperawatan yang tepat pada kasus tersebut?

Pilihan jawaban :
A. Hipertermi
B. Resiko cedera
C. Pola nafas tidak efektif
D. Resiko kejang berulang
E. Ketidakefektifan perfusi jaringan cerebral

Kunci Jawaban: A
Referensi: Ngastiyah, 2001.Perawatan Anak Sakit. Jakarta : EGC
Nama pembuat WennyNugrahatiCarsita, S.Kep.,Ns
Institusi/bagian NersSTIKesIndramayu

ID soal 7
Tinjauan Jabaran
Tinjauan 1 Praktik profesional, etis, legal dan peka budaya
Asuhan keperawatandan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/ Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis/ Perencanaan / Implementasi/ Evaluasi
Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &elektrolit / Nutrisi / Eliminasi / Aman & nyaman / aktifitas &
istirahat/ komunikasi/ belajar/ seksual/nilai dan keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler/ Sistem Respirasi / Sistem Imun dan Hematologi/ Sistem
: Neurobehavior/ Sistem Endokrin / Sistem Pencernaan/ Sistem Muskuloskeletal /
Sistem Integumen/ Sistem Perkemihan / Sistem Reproduksi/ Sistem penginderaan/
lain-lain
Kasus (vignete)
Seorang bayi berusia 5 hari dirawat di ruang NICU dengan keluhan kulit tampak berwarna kuning.
Hasil pengkajian diperoleh frekuensi napas 42x/ menit, nadi 135x/ menit, suhu 37,9 0 C, warna kulit
kuning (ikterik), reflek hisap kurang, bibir tampak pucat, membran mukosa kering, kulit teraba
hangat, Bilirubin total 39,12 mg/dl, leukosit : 13.400 mm3, SGOT : 98 U/I, SGPT : 33 U/I.

Pertanyaan soal :
Apakah diagnosa keperawatan yang utama pada kasus tersebut?

Pilihan jawaban :
A. Hipertermi
B. Resiko tinggi cidera
C. Kerusakan integritas kulit
D. Ketidakefektifan pola nafas
E. Ketidakseimbangan cairan dan elektrolit

Kunci Jawaban: B
Referensi: Ngastiyah, 2001.Perawatan Anak Sakit. Jakarta : EGC
Nama pembuat WennyNugrahatiCarsita, S.Kep.,Ns
Institusi/bagian NersSTIKesIndramayu

ID soal 8
Tinjauan Jabaran
Tinjauan 1 Praktik profesional, etis, legal dan peka budaya
Asuhan keperawatandan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/ Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis/ Perencanaan / Implementasi/ Evaluasi
Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &elektrolit / Nutrisi / Eliminasi / Aman & nyaman / aktifitas &
istirahat/ komunikasi/ belajar/ seksual/nilai dan keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler/ Sistem Respirasi / Sistem Imun dan Hematologi/ Sistem
: Neurobehavior/ Sistem Endokrin / Sistem Pencernaan/ Sistem Muskuloskeletal /
Sistem Integumen/ Sistem Perkemihan / Sistem Reproduksi/ Sistem penginderaan/
lain-lain
Kasus (vignete)
Seorang anak perempuan berusia 3 tahun dirawat di Ruang Anak sejak dua hari yang lalu dengan
keluhan pilek, batuk berdahak kental berwarna hijau, dan nafsu makan menurun. Berdasarkan hasil
pengkajian diperoleh suara nafas gargling, frekuensi nafas 37x/ menit,nadi 100x/ menit, suhu 38 0 C ,
pasien tampak gelisah.

Pertanyaan soal :
Apakah diagnosa keperawatan utama pada kasus tersebut?

Pilihan jawaban :
A. Hipertermi
B. Kerusakan pertukaran gas
C. Ketidakefektifan pola nafas
D. Ketidakefektifan bersihan jalan nafas
E. Perubahan nutrisi kurang dari kebutuhan tubuh
Kunci Jawaban: D
Referensi: Wilkinson, Judith M. 2007. Buku Saku Diagnosis Keperawatan dengan
Intervensi NIC dan kriteria hasil NOC. Jakarta : EGC
Nama pembuat WennyNugrahatiCarsita, S.Kep.,Ns
Institusi/bagian NersSTIKesIndramayu

ID soal 10
Tinjauan Jabaran
Tinjauan 1 Praktik profesional, etis, legal dan peka budaya
Asuhan keperawatandan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis (salah)
Pengetahuan prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/ Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis/ Perencanaan / Implementasi / Evaluasi
Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &elektrolit / Nutrisi / Eliminasi / Aman & nyaman / aktifitas &
istirahat/ komunikasi/ belajar/ seksual/nilai dan keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler/ Sistem Respirasi / Sistem Imun dan Hematologi/ Sistem
: Neurobehavior/ Sistem Endokrin / Sistem Pencernaan/ Sistem Muskuloskeletal /
Sistem Integumen/ Sistem Perkemihan / Sistem Reproduksi/ Sistem penginderaan/
lain-lain
Kasus (vignete)
Seorang bayi perempuan berusia 9 bulan dibawa oleh ibunya ke Posyandu terdekat untuk melakukan
imunisasi. Pemeriksaan didapatkan berat badan 9 kg, pernapasan 25x/ menit, suhu 37ºC, sebelumnya
telah mendapatkan imunisasi DPT dan Polio .

Pertanyaan soal :
Imunisasi apa yang sekarang harus diberikan?
Pilihan jawaban :
A. Campak
B. Hepatitis B
C. BCG Ulangan
D. DPT 3, Polio 4
E. DPT 2, Polio 3
Kunci Jawaban: A
Referensi: Mansjoer, Arif dkk. 2000. Kapita Selekta Kedokteran Jilid II. Media
Aesculapius : Jakarta
Nama pembuat WennyNugrahatiCarsita, S.Kep.,Ns
Institusi/bagian NersSTIKesIndramayu

ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jabaran

Tinjauan 1 Praktik professional, etis, legal dan peka budaya

Perawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 K ognitif

Pengetahuan aplikasi prosedural (prosudural knowledge)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/Maternitas/Anak/Jiwa/Keluarga/Gerontik/Manajemen/Gadar/Komunita
s

Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Aman dan Nyaman/ Eliminasi /


Aktifitas dan istirahat/ Psikososial / Komunikasi/ Seksual / Nilai dan Keyakinan

Tinjauan 7 Pernafasan / Jantung Pembuluh Darah dan Sistem Limfatik / Pencernaan dan
Hepatobilier / Saraf dan Perilaku/ Endokrin dan Metabolisme/

Muskuloskeletal / Ginjal dan Saluran Kemih / Reproduksi / Integumen / Darah


dan Sistem Kekebalan Tubuh / Penginderaan / Lain-lain
Vignette

Nurul datang ke RS untuk memeriksakan adiknya yang berumur 3 tahun. Nurul memberi tahu perawat
bahwa adiknya BAB cair 8x/hari sudah 3 hari, tidak mau minum, mata cekung dan lemas. Dari
pemeriksaan fisik Suhu 38,5C, frekwensi pernapasan 110x/menit.

Pertanyaan soal

Apakah masalah keperawatan utama yang muncul kasus tersebut ?

Pilihan Jawaban

A. Cemas
B. Gangguan nuutrisi
C. Tindak nyaman nyeri
D. Pola napas tidak efektif
E. Kekurang volume cairan

Kunci E

Referensi Buku contoh soal komprehensif keperawatan. Online.

Nama pembuat

Institusi/bagian FIK UNAI

ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jabaran

Tinjauan 1 Praktik professional, etis, legal dan peka budaya

Perawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 K ognitif

Pengetahuan aplikasi prosedural (prosudural knowledge)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/Maternitas/Anak/Jiwa/Keluarga/Gerontik/Manajemen/Gadar/Komunita
s

Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Aman dan Nyaman/ Eliminasi /


Aktifitas dan istirahat/ Psikososial / Komunikasi/ Seksual / Nilai dan Keyakinan

Tinjauan 7 Pernafasan / Jantung Pembuluh Darah dan Sistem Limfatik/ Pencernaan dan
Hepatobilier / Saraf dan Perilaku/ Endokrin dan Metabolisme/

Muskuloskeletal / Ginjal dan Saluran Kemih / Reproduksi / Integumen / Darah


dan Sistem Kekebalan Tubuh / Penginderaan / Lain-lain

Vignette

Seorang anak berumur 9 tahun datang ke Unit Gawat Darurat diantar orang tuanya dengan keluhan
demam ±4 hari , mengalami mimisan 2 kali, mual, muntah, dan diare. Hasil lab platelet 13.000/mm 3,
trombisit 60.000 /mm3,hasil pemeriksaan fisik, conjungtiva pucat, suhu 39◦C, frekfensi nadi 85
kali/menit, terdapat petekie pada lelangan atas.

Pertanyaan soal

Apakah diagnosa keperawatan utama yang paling tepat untuk kasus diatas ?

Pilihan Jawaban

a. Perdarahan
b. Hipertermi
c. Resiko kekurangan nutrisi
d. Resiko Shock hypovolemik
e. Kekurangan volume cairan
Kunci A

Referensi Alkperkaltara.ac.id

Nama pembuat

Institusi/bagian FIK UNAI


ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jabaran

Tinjauan 1 Praktik professional, etis, legal dan peka budaya

Perawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 K ognitif

Pengetahuan aplikasi prosedural (prosudural knowledge)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/Maternitas/Anak/Jiwa/Keluarga/Gerontik/Manajemen/Gadar

Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Aman dan Nyaman/ Eliminasi /


Aktifitas dan istirahat/ Psikososial / Komunikasi/ Seksual / Nilai dan
Keyakinan

Tinjauan 7 Pernafasan / Jantung Pembuluh Darah dan Sistem Limfatik / Pencernaan


dan Hepatobilier / Saraf dan Perilaku/ Endokrin dan Metabolisme/

Muskuloskeletal / Ginjal dan Saluran Kemih / Reproduksi / Integumen /


Darah dan Sistem Kekebalan Tubuh / Penginderaan

Vignette

Seorang bayi laki-laki lahir dengan BB 2300 gram, kulit tipis transparan, lanugo banyak terutama pada
dahi, pelipis, telinga dan lengan, lemak kulit kurang, ekstremitas nampak kebiruan, testis belum turun.
Pada pemeriksaan tanda vital diperoleh frekuensi nafas 60 x/menit, frekuensi nadi 100 x/menit, suhu
35,80C

Pertanyaan soal

Apakah diagnose keperawatan utama dari kasus diatas ?

Pilihan Jawaban

f. Risiko infeksi b.d imaturitas imunoglobulin


g. Gangguan pola nafas b.d imaturitas organ pernafasan
h. Inefektifitas jalan nafas b.d imaturitas organ pernafasan
i. Hipotermi b.d proses adaptasi dengan lingkungan luar rahim
j. Risiko kekurangan volume cairan dan elektrolit b.d peningkatan penguapan panas
tubuh

Kunci D

Referensi Pengantar ilmu keperawatan anak 1, A. Azis Alimul Hidayat

Nama pembuat K. Dewi Budiarti, S.Kp., M.Kep

Institusi/bagian STIKes Karsa Husada Garut

Format Soal Uji Kompetensi (2)

ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jawaban

Tinjauan 1 Praktik professional, etis, legal dan peka budaya

Perawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 K ognitif

Pengetahuan aplikasi prosedural (prosudural knowledge)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/Maternitas/Anak/Jiwa/Keluarga/Gerontik/Manajemen/Gadar
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Aman dan Nyaman/ Eliminasi /


Aktifitas dan istirahat/ Psikososial / Komunikasi/ Seksual / Nilai dan
Keyakinan

Tinjauan 7 Pernafasan / Jantung Pembuluh Darah dan Sistem Limfatik / Pencernaan


dan Hepatobilier / Saraf dan Perilaku/ Endokrin dan Metabolisme/

Muskuloskeletal / Ginjal dan Saluran Kemih / Reproduksi / Integumen /


Darah dan Sistem Kekebalan Tubuh / Penginderaan/lain-lain

Vignette

Seorang anak usia 3 tahun di rawat di RS. Anak nampak ketakutan, terus menangis dan tidak mau
ditinggal ibunya.

Pertanyaan soal

Apakah Intervensi keperawatan yang dapat diberikan untuk mengurangi dampak


hospitalisasi pada anak tersebut?
Pilihan Jawaban

a. Melakukan negosiasi dengan anak


b. Membangun komunikasi dengan orangtua.
c. Membina hubungan saling percaya dengan anak
d. Memberikan permainan sesuai dengan usianya
e. Memberikan dukungan pada anggota keluarga lain

Kunci D

Referensi Ilmu Keperawatan Anak

Nama pembuat K. Dewi Budiarti, S.Kp., M.Kep

Institusi/bagian STIKes Karsa Husada Garut


Format Soal Uji Kompetensi (3)

ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jabaran

Tinjauan 1 Praktik professional, etis, legal dan peka budaya

Perawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 K ognitif

Pengetahuan aplikasi prosedural (prosudural knowledge)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/Maternitas/Anak/Jiwa/Keluarga/Gerontik/Manajemen/Gadar

Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Aman dan Nyaman/ Eliminasi /


Aktifitas dan istirahat/ Psikososial / Komunikasi/ Seksual / Nilai dan
Keyakinan

Tinjauan 7 Pernafasan / Jantung Pembuluh Darah dan Sistem Limfatik / Pencernaan


dan Hepatobilier / Saraf dan Perilaku/ Endokrin dan Metabolisme/

Muskuloskeletal / Ginjal dan Saluran Kemih / Reproduksi / Integumen /


Darah dan Sistem Kekebalan Tubuh / Penginderaan

Vignette

Seorang anak laki-laki berusia 6 tahun datang bersama ibunya ke RS dengan keluhan sejak 2
minggu yang lalu badannya panas menggigil disertai pusing dan nafsu makan menurun. Pada
pemeriksaan fisik diperoleh BB turun hingga 20%, klien tampak pucat, mukosa bibir kering,
nyeri ulu hati skala 4 dari 10, diare lebih dari 10x/hari, muntah lebih dari 4x/hr.Pada
pemeriksaan tanda vital diperoleh suhu= 380C. TD= 90/60 mmHg, frekuensi nadi = 104x/mnt.
Hasil Pemeriksaan Diagnostik:
Pemeriksaan darah tepi: staphylococcus positif
Pertanyaan soal

Apakah Masalah keperawatan utama yang mungkin muncul?

Pilihan Jawaban

a. Defisit cairan dan elektrolit


b. Ketidakseimbangan nutrisi
c. Intoleransi aktifitas
d. Hipertermi
e. Nyeri akut

Kunci A

Referensi

Nama pembuat K. Dewi Budiarti, S.Kp., M.Kep

Institusi/bagian STIKes Karsa Husada Garut

SOAL KEPERAWATAN ANAK

ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jabaran
Tinjauan 1 Praktik Profesional, etik, legal dan peka budaya

Asuhan keperawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis

Pengetahuan aplikasi prosedural (prosedural knowlwgde)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/ Maternitas / Anak / Jiwa / Keluarga /Komunitas/ Gerontik / Gadar / Manajemen

Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi /

Tinjauan 5 Promotif / Preventif / Kuratif / rehabilitatif

Tinjauan 6 Oksigenenasi / Cairan &.elektrolit / Nutrisi / Eliminasi / Aman &.nyaman / aktifitas &
istirahat / Seksual / nilai dan keyakinan / Psikosisial/belajar/ komunikasi

Tinjauan 7 : Sistem pernafasan / Sistem Kardiovaskuler &limfatik/ Sistem Pencernaan& hepatobilier /


Sistem saraf dan perilaku / Sistem Endokrin / Muskuloskeletal / Sistem Ginjal dan saluran
kemih / Sistem Reproduksi/ Sistem Integument / Sistem Imuno-hematologi / Sistem
Penginderaan/ kesehatan mental/ pelayanan kesehatan

Kasus (vignete)

Seorang bayi baru lahir berjenis kelamin laki-laki, lahir secara spontan dengan kondisi badan berwarna merah
namun ekstremitasnya kebiruan dan fleksi. Bayi tampak menyeringai. Frekuensi nadi 86 kali/menit dan
pernafasan 35 kali/menit

Pertanyaan soal

Apakah masalah yang terjadi pada bayi tersebut?

Pilihan jawaban

a. Asfiksia
b. Asfiksia berat
c. Asfiksia ringan
d. Asfiksia sedang
e. Asfiksia sangat berat

Kunci Jawaban: D
Referensi: Buku ajar keperawatan maternitas Brunner & Suddrath edisi 8 vol 3 2002, Maternity
Nursing 2010

Nama pembuat

Institusi/bagian STIKes Cirebon


ID soal (diisi kode identitas soal oleh panitia)

Tinjauan Jabaran

Tinjauan 1 Praktik Profesional, etik, legal dan peka budaya

Asuhan keperawatan dan manajemen asuhan keperawatan

Pengembangan professional

Tinjauan 2 Kognitif: pengetahuan comprehensive / berpikir kritis

Pengetahuan aplikasi prosedural (prosedural knowlwgde)

Pengetahuan afektif (konatif)

Tinjauan 3 KMB/ Maternitas / Anak / Jiwa / Keluarga /Komunitas/ Gerontik / Gadar / Manajemen

Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi /

Tinjauan 5 Promotif / Preventif / Kuratif / rehabilitatif

Tinjauan 6 Oksigenenasi / Cairan &.elektrolit / Nutrisi / Eliminasi / Aman &.nyaman / aktifitas &
istirahat / Seksual / nilai dan keyakinan / Psikosisial/belajar/ komunikasi

Tinjauan 7 : Sistem pernafasan / Sistem Kardiovaskuler &limfatik/ Sistem Pencernaan& hepatobilier /


Sistem saraf dan perilaku / Sistem Endokrin / Muskuloskeletal / Sistem Ginjal dan saluran
kemih / Sistem Reproduksi/ Sistem Integument / Sistem Imuno-hematologi / Sistem
Penginderaan/ kesehatan mental/ pelayanan kesehatan

Kasus (vignete)

Seorang bayi baru lahir berjenis kelamin laki-laki, dilakukan pemeriksaan fisik oleh perawat di ruang
Perinatologi. Saat pemeriksaan reflex, perawat meletakkan jarinya pada telapak tangan bayi

Pertanyaan soal

Apakah nama refleks yang dimaksud pada kasus di atas ?

Pilihan jawaban

a. Moro
b. Crawling
c. Babinsky
d. Tonic neck
e. Palmar Graps
Kunci Jawaban: E

Referensi: Buku ajar keperawatan maternitas Brunner & Suddrath edisi 8 vol 3 2002, Maternity
Nursing 2010

Nama pembuat

Institusi/bagian STIKes Cirebon

ID soal #4(diisi kode identitas soal oleh panitia)


Tinjauan Jabaran
Tinjauan 1 Praktik Profesional, Etik, legal dan peka budaya
Asuhan keperawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif : pengetahuan comprehensif/ berfikir kritis
Pengetahuan aplikasi prosedur (procedural knowledge)
Pengetahuan afektif (konatif)
Tinjauan 3 KMB / Maternitas / Anak / Jiwa / Keluarga / Komunitas / Gerontik/
Gadar / Manajemen
Tinjauan 4 Pengkajian/ Penentuan diagnosis/ Perencanaan/ Implementasi/ Evaluasi/
Lain-lain
Tinjauan 5 Promotif/ Preventif/ Kuratif/ Rehabilitatif
Tinjauan 6 Oksigen/ Cairan & Elektrolit/ Nutrisi/ Eliminasi/ komunikasi/
Aman.&.Nyaman/ Aktivitas & Istirahat / seksual / nilai dan keyakinan /
Psikososial / komunikasi
Tinjauan 7 Sistem pernafasan / Sistem Kardiovaskuler & limfatik / sistem pencernaan
& hepatobilier / sistem saraf dan perilaku / sistem endokrin /
muskuloskeletal / sistem ginjal dan saluran kemih / sistem reproduksi /
sistem integumen / sistem imuno-hematologi / sistem penginderaan /
kesehatan mental / pelayanan kesehatan
Kasus (vignete)
Seorang bayi laki-laki usia 3 bulan belum pernah di imunisasi dengan alasan jika di imunisasi akan
menimbulkan sakit dan cacat, ayah bayi tersebut menderita TBC. saat petugas kesehatan datang
kerumah dan memberikan penyuluhan kesehatanakhirnya orang tua bersedia anaknya diberikan
imunisasi.
Pertanyaan Soal
Apakah tindakan yang harus dilakukan petugas sebelum imunisasi dilakukan?

Pilihan Jawaban :
a. Menyiapkan vaksin
b. Memberikan vaksin
c. Melakukan tes mantoux
d. Memberikan penyuluhan TBC
e. Memberikan penyuluhan efek samping vaksin

Kunci jawaban: C
Referensi: Abraham M Rudolf, 2007, Buku Ajar Pediatrik Volume 1 s.d 3, Jakarta: EGC
Pots & Mondleco, Pediatric Nursing: Caring for Children and their Families
Wong, Hockenberry, 2009, Buku Ajar Keperawatan Pediatrik, Jakarta: EGC

Nama Pembuat Ns. Elfina Yulidar, S.Kep


Institusi/bagian STIKes Faletehan/ S-1 Keperawatan

ID soal #6(diisi kode identitas soal oleh panitia)


Tinjauan Jabaran
Tinjauan 1 Praktik Profesional, Etik, legal dan peka budaya
Asuhan keperawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif : pengetahuan comprehensif/ berfikir kritis
Pengetahuan aplikasi prosedur (procedural knowledge)
Pengetahuan afektif (konatif)
Tinjauan 3 KMB / Maternitas / Anak / Jiwa / Keluarga / Komunitas / Gerontik/
Gadar / Manajemen
Tinjauan 4 Pengkajian/ Penentuan diagnosis/ Perencanaan/ Implementasi/ Evaluasi/
Lain-lain
Tinjauan 5 Promotif/ Preventif/ Kuratif/ Rehabilitatif
Tinjauan 6 Oksigen/ Cairan & Elektrolit/ Nutrisi/ Eliminasi/ komunikasi/
Aman.&.Nyaman/ Aktivitas & Istirahat / seksual / nilai dan keyakinan /
Psikososial / komunikasi
Tinjauan 7 Sistem pernafasan / Sistem Kardiovaskuler & limfatik / sistem pencernaan
& hepatobilier / sistem saraf dan perilaku / sistem endokrin /
muskuloskeletal / sistem ginjal dan saluran kemih / sistem reproduksi /
sistem integumen / sistem imuno-hematologi / sistem penginderaan /
kesehatan mental / pelayanan kesehatan
Kasus (vignete)
Seorang anak perempuan usia 10 tahun datang ke Poliklinik dengan keluhan sesak, Pada saat
pemeriksaan terdapat suara wheezing, pada saat diauskultasi terdapat suara ronchi di kedua paru.
Frekuensi nafas 33x/menit, nadi 100x/menit.
Pertanyaan Soal
Apakah Intervensi keperawatan yang utama pada kasus tersebut?

Pilihan Jawaban :
a. Suction
b. Nebulasi
c. Batuk efektif
d. Fisioterapi dada
e. Pemberian oksigen

Kunci B
jawaban:
Referensi: Abraham M Rudolf, 2007, Buku Ajar Pediatrik Volume 1 s.d 3, Jakarta: EGC
Pots & Mondleco, Pediatric Nursing: Caring for Children and their Families
Wong, Hockenberry, 2009, Buku Ajar Keperawatan Pediatrik, Jakarta: EGC

Nama Pembuat Ns. Elfina Yulidar, S.Kep


Institusi/bagia STIKes Faletehan/ S-1 Keperawatan
n

ID soal #7(diisi kode identitas soal oleh panitia)


Tinjauan Jabaran
Tinjauan 1 Praktik Profesional, Etik, legal dan peka budaya
Asuhan keperawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif : pengetahuan comprehensif/ berfikir kritis
Pengetahuan aplikasi prosedur (procedural knowledge)
Pengetahuan afektif (konatif)
Tinjauan 3 KMB / Maternitas / Anak / Jiwa / Keluarga / Komunitas / Gerontik/
Gadar / Manajemen
Tinjauan 4 Pengkajian/ Penentuan diagnosis/ Perencanaan/ Implementasi/ Evaluasi/
Lain-lain
Tinjauan 5 Promotif/ Preventif/ Kuratif/ Rehabilitatif
Tinjauan 6 Oksigen/ Cairan & Elektrolit/ Nutrisi/ Eliminasi/ komunikasi/
Aman.&.Nyaman/ Aktivitas & Istirahat / seksual / nilai dan keyakinan /
Psikososial / komunikasi
Tinjauan 7 Sistem pernafasan / Sistem Kardiovaskuler & limfatik / sistem pencernaan
& hepatobilier / sistem saraf dan perilaku / sistem endokrin /
muskuloskeletal / sistem ginjal dan saluran kemih / sistem reproduksi /
sistem integumen / sistem imuno-hematologi / sistem penginderaan /
kesehatan mental / pelayanan kesehatan
Kasus (vignete)
Seorang bayi usia 3 bulan dirawat di ruang rawat anak dengan diagnose medis hirschprung diseases.
Hasil pemeriksaan diperoleh distensi abdomen, suhu 37,3 oC, nadi 110 x/menit dan pernafasan : 42
x/menit. Pasien sering mengalami kesulitan BAB, Dokter menyarankan pasien dioperasi, orang tua
menolak karena faktor biaya. Perawat dan Dokter menyerahkan keputusan tindakan pada anak
kepada orang tuanya.

Pertanyaan Soal
Apakah bentuk aspek etik yang diperhatikan oleh perawat dan dokter dalam kasus tersebut ?

Pilihan Jawaban :
a. Justice
b. Fidelity
c. Beneficience
d. Non Maleficience
e. Respect for Autonomy

Kunci E
jawaban:
Referensi: Abraham M Rudolf, 2007, Buku Ajar Pediatrik Volume 1 s.d 3, Jakarta: EGC
Pots & Mondleco, Pediatric Nursing: Caring for Children and their Families
Wong, Hockenberry, 2009, Buku Ajar Keperawatan Pediatrik, Jakarta: EGC

Nama Pembuat Ns. Elfina Yulidar, S.Kep


Institusi/bagia STIKes Faletehan/ S-1 Keperawatan
n

ID soal #7(diisi kode identitas soal oleh panitia)


Tinjauan Jabaran
Tinjauan 1 Praktik Profesional, Etik, legal dan peka budaya
Asuhan keperawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif : pengetahuan comprehensif/ berfikir kritis
Pengetahuan aplikasi prosedur (procedural knowledge)
Pengetahuan afektif (konatif)
Tinjauan 3 KMB / Maternitas / Anak / Jiwa / Keluarga / Komunitas / Gerontik/
Gadar / Manajemen
Tinjauan 4 Pengkajian/ Penentuan diagnosis/ Perencanaan/ Implementasi/ Evaluasi/
Lain-lain
Tinjauan 5 Promotif/ Preventif/ Kuratif/ Rehabilitatif
Tinjauan 6 Oksigen/ Cairan & Elektrolit/ Nutrisi/ Eliminasi/ komunikasi/
Aman.&.Nyaman/Aktivitas & Istirahat / seksual / nilai dan keyakinan /
Psikososial / komunikasi
Tinjauan 7 Sistem pernafasan / Sistem Kardiovaskuler & limfatik / sistem pencernaan
& hepatobilier / sistem saraf dan perilaku / sistem endokrin /
muskuloskeletal / sistem ginjal dan saluran kemih / sistem reproduksi /
sistem integumen / sistem imuno-hematologi / sistem penginderaan /
kesehatan mental / pelayanan kesehatan
Kasus (vignete)
Seorang Anak Laki-laki berumur 16 tahun post appendiktomy cyto 2 hari yang lalu dirawat di ruang
rawat anak. Hasil pemeriksaan pasien menolak berubah posisi, pasien tampak meringis, pasien
mengeluh nyeri pada area luka post operasi seperti ditusuk-tusuk dengan skala nyeri 8 (1-10).
Tekanan Darah 130/90 mmHg, suhu 37,7 oC, pernafasan 22x/menit dan nadi 100 x/menit.

Pertanyaan Soal
Apakah intervensi utama yang akan anda lakukan untuk kasus tersebut?
Pilihan Jawaban :
a. Melakukan kompres hangat
b. Mengajarkan latihan mobilisasi post operasi
c. Melakukan kolaborasi pemberian antipiretik
d. Melakukan manajemen nyeri non farmakologis dan farmakologis
e. Memberikan pendidikan kesehatan pentingnya mobilisasi pasca operasi

Kunci D
jawaban:
Referensi: Abraham M Rudolf, 2007, Buku Ajar Pediatrik Volume 1 s.d 3, Jakarta: EGC
Pots & Mondleco, Pediatric Nursing: Caring for Children and their Families
Wong, Hockenberry, 2009, Buku Ajar Keperawatan Pediatrik, Jakarta: EGC

Nama Pembuat Ns. Elfina Yulidar, S.Kep


Institusi/bagia STIKes Faletehan/ S-1 Keperawatan
n

ID soal #8(diisi kode identitas soal oleh panitia)


Tinjauan Jabaran
Tinjauan 1 Praktik Profesional, Etik, legal dan peka budaya
Asuhan keperawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif : pengetahuan comprehensif/ berfikir kritis
Pengetahuan aplikasi prosedur (procedural knowledge)
Pengetahuan afektif (konatif)
Tinjauan 3 KMB / Maternitas / Anak / Jiwa / Keluarga / Komunitas / Gerontik/
Gadar / Manajemen
Tinjauan 4 Pengkajian/ Penentuan diagnosis/ Perencanaan/ Implementasi/ Evaluasi/
Lain-lain
Tinjauan 5 Promotif/ Preventif/ Kuratif/ Rehabilitatif
Tinjauan 6 Oksigen/ Cairan & Elektrolit/ Nutrisi/ Eliminasi/ komunikasi/
Aman.&.Nyaman/ Aktivitas & Istirahat / seksual / nilai dan keyakinan /
Psikososial / komunikasi
Tinjauan 7 Sistem pernafasan / Sistem Kardiovaskuler & limfatik / sistem pencernaan
& hepatobilier / sistem saraf dan perilaku / sistem endokrin /
muskuloskeletal / sistem ginjal dan saluran kemih / sistem reproduksi /
sistem integumen / sistem imuno-hematologi / sistem penginderaan /
kesehatan mental / pelayanan kesehatan
Kasus (vignete)
Seorang bayi perempuan berumur 4 bulan, datang ke Poliklinik anak untuk kontrol post colostomy 1
bulan yang lalu.. Hasil pemeriksaan, stoma terlihat kotor, kulit sekitar stoma berwarna kemerahan,
iritasi, timbul fistula, perawatan di rumah menggunakan popok , suhu 37,6 oC, RR 31 x/menit nadi
118 x/menit.

Pertanyaan Soal
Apakah diagnosa keperawatan yang tepat berdasarkan kasus tersebut?

Pilihan Jawaban :
a. Nyeri
b. Hipertermi
c. Resiko infeksi
d. Kerusakan integritas kulit
e. Kurang pengetahuan orangtua

Kunci D
jawaban:
Referensi: Abraham M Rudolf, 2007, Buku Ajar Pediatrik Volume 1 s.d 3, Jakarta: EGC
Pots & Mondleco, Pediatric Nursing: Caring for Children and their Families
Wong, Hockenberry, 2009, Buku Ajar Keperawatan Pediatrik, Jakarta: EGC

Nama Pembuat Ns. Elfina Yulidar, S.Kep


Institusi/bagia STIKes Faletehan/ S-1 Keperawatan
n

ID soal #10(diisi kode identitas soal oleh panitia)


Tinjauan Jabaran
Tinjauan 1 Praktik Profesional, Etik, legal dan peka budaya
Asuhan keperawatan dan manajemen asuhan keperawatan
Pengembangan professional
Tinjauan 2 Kognitif : pengetahuan comprehensif/ berfikir kritis
Pengetahuan aplikasi prosedur (procedural knowledge)
Pengetahuan afektif (konatif)
Tinjauan 3 KMB / Maternitas / Anak / Jiwa / Keluarga / Komunitas / Gerontik/
Gadar / Manajemen
Tinjauan 4 Pengkajian/ Penentuan diagnosis/ Perencanaan/ Implementasi/ Evaluasi/
Lain-lain
Tinjauan 5 Promotif/ Preventif/ Kuratif/Rehabilitatif
Tinjauan 6 Oksigen/ Cairan & Elektrolit/ Nutrisi/ Eliminasi/ komunikasi/
Aman.&.Nyaman/ Aktivitas & Istirahat / seksual / nilai dan keyakinan /
Psikososial / komunikasi
Tinjauan 7 Sistem pernafasan / Sistem Kardiovaskuler & limfatik / sistem pencernaan
& hepatobilier / sistem saraf dan perilaku / sistem endokrin /
muskuloskeletal / sistem ginjal dan saluran kemih / sistem reproduksi /
sistem integumen / sistem imuno-hematologi / sistem penginderaan /
kesehatan mental / pelayanan kesehatan
Kasus (vignete)
Anak usia 2 tahun sudah 2 hari dirawat di ruang anak, menurut ibu bayi dibawa ke RS dengan
keluhan sulit BAB, ada riwayat sering menggunakan pencahar supaya mudah BAB, BAB keluar sedikit
berbentuk pita, serta anak sulit makan, pemeriksaan fisik menunjukkan perut kembung, berat
badan 10 kg, frekuensi nafas 30x menit, frekuensi nadi 110x/menit.

Pertanyaan Soal
Apakah implementasi untuk mengatasi masalah prioritas kasus di atas?

Pilihan Jawaban :
a. Lakukan washout
b. Pemberian infus cairan N4
c. Lakukan pemberian oksigen
d. Pemberian nutrisi yang lunak
e. Pemasangan naso gastric tube

Kunci A
jawaban:
Referensi: Abraham M Rudolf, 2007, Buku Ajar Pediatrik Volume 1 s.d 3, Jakarta: EGC
Pots & Mondleco, Pediatric Nursing: Caring for Children and their Families
Wong, Hockenberry, 2009, Buku Ajar Keperawatan Pediatrik, Jakarta: EGC

Nama Pembuat Ns. Elfina Yulidar, S.Kep


Institusi/bagia STIKes Faletehan/ S-1 Keperawatan
n

SOAL DALAM TEMPLATE

Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan profesional
Tinjauan 2 Kognitif: pengetahuan komprehensif/berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Sistem kardiovaskuler/sistem respirasi/ sistem imuno-hematologi / sistem
neurobehaviour / sistem endokrin / sistem pencernaan / sistem muskuloskeletal /
sistem integumen / sistem perkemihan / sistem reproduksi
Tinjauan 4 Oksigen /cairan & elektrolit/nutrisi/eliminasi/rekreasi/aman & nyaman/stres &
adaptasi/ seksual/ value & belief/ psikososial
Tinjauan 5 Promotif / preventif / kuratif / rehabilitatif
Tinjauan 6 Pengkajian / penentuan diagnosis/ perencanaan / implementasi/ evaluasi / lain-
lain
Tinjauan 7 Maternitas / anak/ KMB / gadar / Jiwa / keluarga / Komunitas / gerontik /
Manajemen

Kasus
Seorang anak laki-laki berusia 15 tahun, memilikiriwayatpenyakitpadasaluranpernafasanwaktuberusia 5 tahun. Saat
ini mengeluhbatukberdahak yang tidakkunjungsembuh selama 7 hari, anak tersebut minumobatbatuk.
Kondisilingkunganrumahsangatpadat, danIbuklienmengatakan keadaan rumahnya lembab serta tidak terkena
cahaya matahari .
Pertanyaan soal
Apakah pemeriksaandiagnostik utama yang dilakukan pada kasus tersebut ?

Pilihan jawaban
a. Skin test
b. Cek darah
c. Rontgen dada
d. Tesuji tuberculin
e. Pemeriksaan sputum

Kunci jawaban : C
Referensi : Smeltzer, Suzanne C. 2002. Buku Ajar Keperawatan Medikal Bedah
Brunner and Suddarth: Edisi 8. Jakarta: Penerbit Buku
Kedokteran EGC.
Price, Sylvia Anderson. 2006. Patofisiologi: KonsepKlinis Proses-proses
Penyakit: Edisi 6. Jakarta: Penerbit Buku Kedokteran EGC.
Nama Pembuat : Nur Amri Husna
Institusi/bagian : STIKes Mahardika Cirebon / Prodi Keperawatan

SOAL DALAM TEMPLATE

Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan profesional
Tinjauan 2 Kognitif: pengetahuan komprehensif/berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Sistem kardiovaskuler/sistem respirasi/ sistem imuno-hematologi / sistem
neurobehaviour / sistem endokrin / sistem pencernaan / sistem muskuloskeletal /
sistem integumen / sistem perkemihan / sistem reproduksi
Tinjauan 4 Oksigen /cairan & elektrolit/nutrisi/eliminasi/rekreasi/aman & nyaman/stres &
adaptasi/ seksual/ value & belief/ psikososial
Tinjauan 5 Promotif / preventif / kuratif / rehabilitatif
Tinjauan 6 Pengkajian / penentuan diagnosis/ perencanaan / implementasi/ evaluasi / lain-
lain
Tinjauan 7 Maternitas / anak/KMB / gadar / Jiwa / keluarga / Komunitas / gerontik /
Manajemen

Kasus
Seorang anak laki-laki berusia 4 tahun bersamadenganibunyadatangkerumahsakit. Ibunya mengeluh anaknya
mengatakannyeritenggorokansejak 3 hari yang lalu.Hasilpemeriksaanfisikdidapatkanadanyanyeripadapalpasiringan
di leher, tenggorokan kemerahan agak bau, danadasedikitpembengkakanpadanoduslimpha submandibular.

Pertanyaan soal
Apakah tindakan keperawatan utama yang perlu dilakukan pada kasus tersebut?

Pilihan jawaban
A. Kompreshangat
B. Memantau tanda-tanda vital
C. Menyarankanpasienistirahat
D. Kolaborasipemberiananalgesik
E. Membantuteknik hygiene padamulut

Kunci jawaban : E
Referensi : Smeltzer, Suzanne C. 2002. Buku Ajar Keperawatan Medikal Bedah
Brunner and Suddarth: Edisi 8. Jakarta: Penerbit Buku
Kedokteran EGC.
Price, Sylvia Anderson. 2006. Patofisiologi: KonsepKlinis Proses-proses
Penyakit: Edisi 6. Jakarta: Penerbit Buku Kedokteran EGC.
Nama Pembuat : Nur Amri Husna
Institusi/bagian : STIKes Mahardika Cirebon / Prodi Keperawatan

SOAL DALAM TEMPLATE

Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan profesional
Tinjauan 2 Kognitif: pengetahuan komprehensif/berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Sistem kardiovaskuler/sistem respirasi/ sistem imuno-hematologi / sistem
neurobehaviour / sistem endokrin / sistem pencernaan / sistem muskuloskeletal /
sistem integumen / sistem perkemihan / sistem reproduksi
Tinjauan 4 Oksigen /cairan & elektrolit/nutrisi/eliminasi/rekreasi/aman & nyaman/stres &
adaptasi/ seksual/ value & belief/ psikososial
Tinjauan 5 Promotif / preventif / kuratif / rehabilitatif
Tinjauan 6 Pengkajian /penentuan diagnosis/ perencanaan / implementasi/ evaluasi / lain-
lain
Tinjauan 7 Maternitas / anak/KMB / gadar / Jiwa / keluarga / Komunitas / gerontik /
Manajemen

Kasus
Seorang anak perempuan berusia 5 tahun mengalamilukabakarakibatrumahnyakebakaran. Anak mengalami luka
bakarpada area kepala, lengankanandankiri, serta area dada
danperut.Setelahdilakukanpengkajiandiadapatkanlukabakarderajat I danklienmengeluh sangat nyeri pada area dada.

Pertanyaan soal
Berapakah presentaselukabakar pada kasus tersebut?

Pilihan jawaban
a. 35 %
b. 40 %
c. 45 %
d. 50 %
e. 55 %

Kunci jawaban : C
Referensi : Smeltzer, Suzanne C. 2002. Buku Ajar Keperawatan Medikal Bedah
Brunner and Suddarth: Edisi 8. Jakarta: Penerbit Buku
Kedokteran EGC.
Price, Sylvia Anderson. 2006. Patofisiologi: KonsepKlinis Proses-proses
Penyakit: Edisi 6. Jakarta: Penerbit Buku Kedokteran EGC.
Nama Pembuat : Nur Amri Husna
Institusi/bagian : STIKes Mahardika Cirebon / Prodi Keperawatan

SOAL DALAM TEMPLATE

Tinjauan Jabaran
Tinjauan 1 Aspek etik, legal dan peka budaya
Perawatan dan manajemen asuhan keperawatan
Pengembangan profesional
Tinjauan 2 Kognitif: pengetahuan komprehensif/berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Sistem kardiovaskuler/sistem respirasi/ sistem imuno-hematologi / sistem
neurobehaviour / sistem endokrin / sistem pencernaan / sistem muskuloskeletal /
sistem integumen / sistem perkemihan / sistem reproduksi
Tinjauan 4 Oksigen /cairan & elektrolit/nutrisi/eliminasi/rekreasi/aman & nyaman/stres &
adaptasi/ seksual/ value & belief/ psikososial
Tinjauan 5 Promotif / preventif / kuratif / rehabilitatif
Tinjauan 6 Pengkajian /penentuan diagnosis/ perencanaan / implementasi/ evaluasi / lain-
lain
Tinjauan 7 Maternitas / anak/KMB / gadar / Jiwa / keluarga / Komunitas / gerontik /
Manajemen

Kasus
Seorang anak laki-laki berusia 10 tahun mengalamilukabakarderajat III. Setelahmendapatperawatan di Rumah Sakit
selama 7 hari, kondisilukaklienbelummengalamiperbaikan, berwarnakehitaman di semua area
lukabakar.Belumadatanda-tanda pemecahan secara alami.

Pertanyaan soal
Apakahtindakankolaborasi yang harusdilakukan pada kasus tersebut?

Pilihan jawaban
A. Graft
B. Wound care
C. Debridemenbedah
D. Debridemenmekanis
E. Pemberianantibiotiktopikal

Kunci jawaban : D
Referensi : Smeltzer, Suzanne C. 2002. Buku Ajar Keperawatan Medikal Bedah
Brunner and Suddarth: Edisi 8. Jakarta: Penerbit Buku
Kedokteran EGC.
Price, Sylvia Anderson. 2006. Patofisiologi: KonsepKlinis Proses-proses
Penyakit: Edisi 6. Jakarta: Penerbit Buku Kedokteran EGC.
Nama Pembuat : Nur Amri Husna
Institusi/bagian : STIKes Mahardika Cirebon / Prodi Keperawatan

Tinjauan Jabaran

Tinjauan 1 Aspek etik, legal dan peka budaya


Perawatan dan manajemen asuhan keperawatan
Pengembangan profesional
Tinjauan 2 Kognittif: pengetahuan komprehensif/berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Sistem kardiovaskuler/sistem respirasi/ sistem imuno-
hematologi / sistem neurobehaviour / sistem endokrin / sistem
pencernaan / sistem muskuloskeletal / sistem integumen /
sistem perkemihan / sistem reproduksi
Tinjauan 4 Oksigen /cairan & elektrolit/nutrisi/eliminasi/rekreasi/aman &
nyaman/stres & adaptasi/ seksual/ value & belief/ psikososial
Tinjauan 5 Promotif / preventif / kuratif / rehabilitatif
Tinjauan 6 Pengkajian / penentuan diagnosis/ perencanaan /
implementasi/ evaluasi / lain-lain
Tinjauan 7 Maternitas / anak/ KMB / gadar / Jiwa / keluarga /
Komunitas / gerontik / Manajemen
Kasus
Seorang anak laki-laki berusia 17 bulan didampingi ibunya berada di Ruang Radiologi Rumah
Sakit untuk dilakukan pemeriksaan rontgen. Anak tersebut menangis meronta-ronta dan
berpegangan erat pada ibunya. Menurut ibu baru pertama kali dilakukan pemeriksaan ini.
Pertanyaan soal
Apakah intervensi utama yang harus dilakukanpada kasus tersebut ?

Pilihan jawaban
A. Memberikan mainan kesukaannya
B. Sediakan minuman dan makanan kesukaannya
C. Katakan “ibu akan menemani dan disampingmu”
D. Ajak mendengarkan music atau nonton film anak-anak
E. Jelaskan bahwa prosedur tindakan tidak akan menyakiti

Kunci jawaban : D

Referensi : Hockenberry, Marylin J, Wilson, Davidson. 2009.Wong’s


Essentials of Pediatric Nursing. Eighth edition. St. Louis,
Missaouri : Mosby Elsevier.
Nama Pembuat : Dwiyanti P

Institusi/bagian : STIKes Mahardika Cirebon

Tinjauan Jabaran

Tinjauan 1 Aspek etik, legal dan peka budaya


Perawatan dan manajemen asuhan keperawatan
Pengembangan profesional
Tinjauan 2 Kognittif: pengetahuan komprehensif/berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Sistem kardiovaskuler/sistem respirasi/ sistem imuno-
hematologi / sistem neurobehaviour / sistem endokrin / sistem
pencernaan / sistem muskuloskeletal / sistem integumen /
sistem perkemihan / sistem reproduksi
Tinjauan 4 Oksigen /cairan & elektrolit/nutrisi/eliminasi/rekreasi/aman &
nyaman/stres & adaptasi/ seksual/ value & belief/ psikososial
Tinjauan 5 Promotif / preventif / kuratif / rehabilitatif
Tinjauan 6 Pengkajian / penentuan diagnosis/ perencanaan /
implementasi/ evaluasi / lain-lain
Tinjauan 7 Maternitas / anak/ KMB / gadar / Jiwa / keluarga /
Komunitas / gerontik / Manajemen

Kasus
Seorang anak perempuan berusia 15 bulan datang ke poliklinik tumbuh kembang diantar oleh
ibunya, anak tersebut tampak bermain sendiri dengan bonekanya dan tidak menghiraukan
pemeriksa.
Pertanyaan soal
Apakah stimulasi utama yang diberikan padaanak tersebut ?
Pilihan jawaban
A. Bermain cilukba
B. Puzzle sederhana
C. Mennyusun kubus
D. Memanggil dan tersenyum
E. Bermain lempar-tangkap bola

Kunci jawaban : D

Referensi : Tim Penyusun. 2008. Pedoman Pelaksanaan Stimulasi Dini


Tumbuh Kembang Anak di Tingkat Pelayanan Kesehatan
Dasar. Jakarta: Depkes RI.
Nama Pembuat : Dwiyanti P

Institusi/bagian : STIKes Mahardika Cirebon

Tinjauan Jabaran

Tinjauan 1 Aspek etik, legal dan peka budaya


Perawatan dan manajemen asuhan keperawatan
Pengembangan profesional
Tinjauan 2 Kognittif: pengetahuan komprehensif/berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Sistem kardiovaskuler/sistem respirasi/ sistem imuno-
hematologi / sistem neurobehaviour / sistem endokrin / sistem
pencernaan / sistem muskuloskeletal / sistem integumen /
sistem perkemihan / sistem reproduksi
Tinjauan 4 Oksigen /cairan & elektrolit/nutrisi/eliminasi/rekreasi/aman &
nyaman/stres & adaptasi/ seksual/ value & belief/ psikososial
Tinjauan 5 Promotif / preventif / kuratif / rehabilitatif
Tinjauan 6 Pengkajian / penentuan diagnosis/ perencanaan /
implementasi/ evaluasi / lain-lain
Tinjauan 7 Maternitas / anak/ KMB / gadar / Jiwa / keluarga /
Komunitas / gerontik / Manajemen
Kasus
Seorang remaja perempuan berusia 16tahun dating ke Poli Anak , remaja tersebut mengalami anemia sel sabit
sejak usia 5 tahun. Hasil pengkajian diperoleh bibir pucat, konjungtiva anemis, membrane mukosa mulut dan kulit
pucat, kapilari refill time 6 detik, dan terdapat clubbing finger.

Pertanyaan soal
Apakah masalah keperawatan prioritas pada kasus diatas ?

Pilihan jawaban
a. Cemas
b. Risiko perdarahan
c. Gangguan perfusi jaringan
d. Gangguan pembentukan eritrosit
e. Gangguan transportasi oksigen

Kunci jawaban : C

Referensi : Hockenberry, Marylin J, Wilson, Davidson. 2009.Wong’s


Essentials of Pediatric Nursing. Eighth edition. St. Louis,
Missaouri : Mosby Elsevier.
Nama Pembuat : Dwiyanti P

Institusi/bagian : STIKes Mahardika Cirebon

Tinjauan Jabaran

Tinjauan 1 Aspek etik, legal dan peka budaya


Perawatan dan manajemen asuhan keperawatan
Pengembangan profesional
Tinjauan 2 Kognittif: pengetahuan komprehensif/berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Sistem kardiovaskuler/sistem respirasi/ sistem imuno-
hematologi / sistem neurobehaviour / sistem endokrin / sistem
pencernaan / sistem muskuloskeletal / sistem integumen /
sistem perkemihan / sistem reproduksi
Tinjauan 4 Oksigen /cairan & elektrolit/nutrisi/eliminasi/rekreasi/aman &
nyaman/stres & adaptasi/ seksual/ value & belief/ psikososial
Tinjauan 5 Promotif / preventif / kuratif / rehabilitatif
Tinjauan 6 Pengkajian / penentuan diagnosis/ perencanaan /
implementasi/ evaluasi / lain-lain
Tinjauan 7 Maternitas / anak/ KMB / gadar / Jiwa / keluarga /
Komunitas / gerontik / Manajemen
Kasus
Seorang bayi perempuan berusia 12 bulan, dibawa ibunya ke Poli Anak untuk diimunisasi campak, saat dilakukan
imunisasi anak tersebut meronta-ronta, menangis dan menjerit dengan keras.
Pertanyaan soal
Apakah tindakan keperawatan utama pada kasus tersebut ?

Pilihan jawaban
A. Terus melanjutkan penyuntikan imunisasi
B. Meminta ibu dari anak tersebut untuk menyusui anaknya
C. Meminta bantuan ibunya/perawat lain untuk mengambilkan benda kesayangan anak
D. Tersenyum pada anaknya, mengelus kepala dan menghentikan kegiatan sementara
E. Berhenti sejenak dan meminta bantuan ibunya untuk memegangi tangan dan kaki anak tersebut
Kunci jawaban : B

Referensi : Hockenberry, Marylin J, Wilson, Davidson. 2009.Wong’s


Essentials of Pediatric Nursing. Eighth edition. St. Louis,
Missaouri : Mosby Elsevier.
Nama Pembuat : Dwiyanti P

Institusi/bagian : STIKes Mahardika Cirebon

SOAL 2

ID Soal

Tinjauan 1 Aspek etik, legal dan peka budaya

Asuhan keperawatandan manajemen keperawatan


Pengembangan professional

Tinjauan 2 Kognitif : pengetahuan comprehensive/berfikir kritis

Pengetahuan aplikasi prosedural (Pengetahuan afektif/konatif)

Tinjauan 3 Sistem Kardiovaskuler/Sistem respirasi/Sistem imuno-


hematologi/Sistem Neurobehaviour/Sistem
endokrin/SistemPencernaan/Sistem Muskuloskeletal/Sistem
Integumen/Sistem Perkemihan/Sistem Reproduksi

Tinjauan 4 Oksigen/Cairan dan Elektrolit/Nutrisi/Eliminasi/Rekreasi/Aman &


nyaman /stress &adaptasi/seksual/value & belief/psikososial

Tinjauan 5 Promotif/preventif/kuratif/rehabilitative

Tinjauan 6 Pengkajian/Penentuandiagnosis/perencanaan/Implementasi/Evaluasi
/dan lain-lain

Tinjauan 7 Maternitas/Anak/KMB/Gadar/Jiwa/Keluarga/Komunitas

/Gerontik/manajeman

Kasus (Vignete)

Seorang anak laki-laki berumur 6 bulan dengan diare dirawat di rumah sakit. Ibu klien mengatakan klien
buang air sudah 8x perhari selama 5 hari, muntah dan tidak mau minum ASI, mata cekung, mukosa bibir
kering, ubun-ubun cekung,apatis. Frekuensi nadi 110 x/menit, frekuensi nafas 36 x/menit.

Pertanyaan Soal

Apakah intervensi keperawatan utama pada kasus diatas?

Pilihan Jawaban

a. Pasang NGT
b. Berikan cairan oralit
c. Berikan cairan intravena
d. Berikan diet yang bervariasi
e. Teruskan pemberian ASI saja

Kunci Jawaban C

Referensi Wong L Donna (2004) Keperawatan Pediatrik

Nama Pembuat Rima Novianti Utami,S.Kep,Ners

Institusi/bagian Prodi S1 Keperawatan STIKES Kota Sukabumi

SOAL 5

ID Soal

Tinjauan 1 Aspek etik, legal dan peka budaya

Asuhan keperawatandan manajemen keperawatan

Pengembangan professional

Tinjauan 2 Kognitif : pengetahuan comprehensive/berfikir kritis

Pengetahuan aplikasi prosedural (Pengetahuan afektif/konatif)

Tinjauan 3 Sistem Kardiovaskuler/Sistem respirasi/Sistem imuno-


hematologi/Sistem Neurobehaviour/Sistem
endokrin/SistemPencernaan/Sistem Muskuloskeletal/Sistem
Integumen/Sistem Perkemihan/Sistem Reproduksi

Tinjauan 4 Oksigen/Cairan dan Elektrolit/Nutrisi/Eliminasi/Rekreasi/Aman &


nyaman /stress &adaptasi/seksual/value & belief/psikososial
Tinjauan 5 Promotif/preventif/kuratif/rehabilitative

Tinjauan 6 Pengkajian/Penentuandiagnosis/perencanaan/Implementasi/Evaluasi
/dan lain-lain

Tinjauan 7 Maternitas/Anak/KMB/Gadar/Jiwa/Keluarga/Komunitas

/Gerontik/manajeman

Kasus (Vignete)

Seorang Anak berusia 1 tahun masuk RS dengan diare. Ibu klien mengatakan klien BAB sudah 6x/ hari
sejak 4 hari yang lalu,berat badan klien sebelum sakit 11,5 kg dan sesudah sakit 10 kg, mata cekung,
mukosa bibir kering, turgor kulit> 3 detik,apatis

Pertanyaan Soal

Berapa jumlah kehilangan cairan dilihat dari berat badan pada kasus diatas?

Pilihan Jawaban

a. 5%
b. 10%
c. 13%
d. 14%
e. 15%

Kunci Jawaban C

Referensi Wong L Donna (2004) Keperawatan Pediatrik

Nama Pembuat Rima Novianti Utami,S.Kep,Ners

Institusi/bagian Prodi S1 Keperawatan STIKES Kota Sukabumi


Template Soal Perawat

(Tandai pada item yang sesuai pada kolom jabaran)

ID SOAL (diisi kode identitas soal oleh panitia)

TINJAUAN JABARAN

Tinjauan 1 Praktek profesional, legal, etis dan peka budaya, Pemberian keperawatan dan
manajemen keperawatan ,Pengembangan professional, personal dan kualitas

Tinjauan 2 Proses keperawatan :

Pengkajian / Penentuan masalah dan diagnosis / Perencanaan / Implementasi /


Evaluasi

Tinjauan 3 Domain :

Kognitif/afektif/prosedural, Pengetahuan aplikasi prosedural (Pengetahuan


afektif (konatif

Tinjauan 4 Upaya :
Promotif/ Preventif / Kuratif / Rehabilitatif

Tinjauan 5 Keilmuan :

Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik

Tinjauan 6 Sistem :

Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem


Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem Reproduksi

Tinjauan 7 Kebutuhan :

Oksigen / Cairan &.elektrolit / Nutrisi / Eliminasi /Aktivitas & sitirahat/ Rekreasi /


Aman & nyaman /Stress.&.adaptasi /Seksual /Value & belief /spiritual-culture

KASUS (vignete):

Seorang anak laki-laki usia 2 tahun dibawa ibunya ke Posyandu untuk memeriksakan
kesehatannya, ibu mengeluh bahwa anak tersebut suka mainan faesesnya jika tidak
ketahuan, hasil pemeriksaan berat badan 12 kilo gram, tinggi badan 80 cm, anak kooperatif
tetapi pemalu.

Pertanyaan soal:

Apakah pendidikan kesehatan utama kepada orang tua untuk mengatasi permasalahan
kasus tersebut?

Pilihan jawaban
A. Penggunaan diaper
B. Perineal higiene
C. Toilet training
D. Bersosialisasi
E. Cuci tangan

Kunci Jawaban C

Referensi Wong, 2006

Nama Pembuat Sri Janatri

Institusi/ Bagian STIKes Kota Sukabumi


Template Soal Perawat
ID SOAL 03 (diisi kode identitas soal oleh panitia)
TINJAUAN JABARAN
Tinjauan 1 Aspek etik, legal dan peka budaya
Penanganan keperawatan dan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/
Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi /
Lain-lain
Tinjauan 5 Promotif / Preventif/ Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Eliminasi / Aman
&.nyaman / aktifitas & istirahat/ komunikasi/ belajar/ seksual/nilai dan
keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/penginderaan/ lain-lain

KASUS (vignete):
Seorang bayi laki-laki usia 8 bulan dibawa oleh ibunya ke Puskesmas untuk dilakukan imunisasi.
Sebelumnya anak telah mendapatkan imunisasi Polio 2, BCG, dan DPT I.

Pertanyaan soal:
Apakah Imunisasi yang akan diberikan sekarang?

Pilihan jawaban:
A. BCG dan Polio II
B. DPT II dan Polio III
C. DPT II dan Polio IV
D. DPT III dan Polio IV
E. Hepatitis dan Polio III
Kunci
B
Jawaban
Referensi Riyadi Sujono ( 2009 ) Askep Pada Anak : Graha Ilmu, Yogyakarta
Nama Pembuat Tatang Kusmana
Institusi/ Bagian STIKes Muhammadiyah Tasikmalaya
Prodi SI Keperawatan

Template Soal Perawat


ID SOAL 04 (diisi kode identitas soal oleh panitia)
TINJAUAN JABARAN
Tinjauan 1 Aspek etik, legal dan peka budaya
Penanganan keperawatan dan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/
Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi /
Lain-lain
Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi/ Eliminasi / Aman
&.nyaman / aktifitas & istirahat/ komunikasi/ belajar/ seksual/nilai dan
keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/penginderaan/ lain-lain

KASUS (vignete):
Seorang anak laki-laki usia 1 tahun, dibawa oleh orangtuanya ke Puskesmas karena mengalami
pembesaran kepala sejak usia 2 bulan.Hasil pemeriksaan fisik didapatkan hasil: lingkar kepala 59
cm, berat badan 7 kg, tinggi badan 62 cm, terdapat sunset sign, anak belum bisa mengucapkan suku
kata, berjalan dan sering digendong oleh orangtuanya.

Pertanyaan soal:
Apakah masalah keperawatan utama pada kasus diatas?

Pilihan jawaban:
A. Resiko cedera
B. Gangguan mobilisasi
C. Gangguan komunikasi verbal
D. Gangguan pertumbuhan dan perkembangan
E. Gangguan pemenuhan kebutuhan nutrisi: kurang dari kebutuhan

Kunci
D
Jawaban
Referensi Riyadi Sujono ( 2009 ) Askep Pada Anak : Graha Ilmu, Yogyakarta
Nama Pembuat Tatang Kusmana
Institusi/ Bagian STIKes Muhammadiyah Tasikmalaya
Prodi SI Keperawatan

Template Soal Perawat


ID SOAL 05 (diisi kode identitas soal oleh panitia)
TINJAUAN JABARAN
Tinjauan 1 Aspek etik, legal dan peka budaya
Penanganan keperawatan dan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/
Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi /
Lain-lain
Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif
Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Eliminasi / Aman
&.nyaman / aktifitas & istirahat/ komunikasi/ belajar/ seksual/nilai dan
keyakinan / Psikososial
Tinjauan 7 Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem
Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/penginderaan/ lain-lain

KASUS (vignete):
Seorang anak usia 2 tahun oleh Ibunya dibawa kepuskesmas dengan keluhan anak belum bisa
berjalan.Hasil pemeriksaan didapatkan: berat badan 7 kilo gram, tinggi 65 Cm dan anak hanya
bisa merangkak.

Pertanyaan Soal
Apakah jenis keterlambatan perkembangan yang dialami oleh anak ?
Pilihan jawaban:
a. Sosial

b. Perilaku

c. Bahasa

d. Motorik kasar

e. Motorik halus

Kunci
D
Jawaban
Referensi Riyadi Sujono ( 2009 ) Askep Pada Anak : Graha Ilmu, Yogyakarta
Nama Pembuat Tatang Kusmana
Institusi/ Bagian STIKes Muhammadiyah Tasikmalaya
Prodi SI Keperawatan
Template Soal Perawat

ID SOAL 06 (diisi kode identitas soal oleh panitia)

TINJAUAN JABARAN

Tinjauan 1 Aspek etik, legal dan peka budaya

Asuhan keperawatan dan manajemen keperawatan

Pengembangan professional

Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis


Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/
Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi /
Lain-lain

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Eliminasi /Aman

&.nyaman/ aktifitas & istirahat/ komunikasi/ belajar/ seksual/nilai dan keyakinan


/ Psikososial

Tinjauan 7 Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem


Neurobehaviour/ Sistem Endokrin / Sistem Pencernaan / Sistem Muskuloskeletal
/ Sistem Integument / Sistem Perkemihan / Sistem Reproduksi/penginderaan/
lain-lain
KASUS (vignete):

Seorang anak usia 4 tahun dibawa oleh ibunya ke poli klinik. Hasil pengkajian didapatkan: anak
terlihat lemah, frekuensi nafas lebih dari 30x/ menit,iramanya kadang dangkal dan dalam,suara
nafas ronchi basah, pada faring terlihat sekret kental dan waktu pengisian kapiler lebih dari 3
detik.

Pertanyaan soal:

Apakah diagnose keperawatan utama untuk kasus diatas ?

Pilihan jawaban:

A. Gangguan pertukaran gas berhubungan dengan peningkatan tekanan pembuluh kapiler paru
B. Resiko gangguan perfusi jaringan berhubungan dengan penurunan asupan oksigen dari luar.
C. Tidak efektifnya pola nafas berhubungan dengan meningkatnya volume darah balik dalam
paru
D. Intoleransi aktivitas berhubungan dengan ketidakseimbangan antara suplai dan kebutuhan
oksigen.
E. Tidak efektifnya bersihan jalan nafas berhububgan dengan penumpukan sekret
ditrakheobronchial.

Kunci Jawaban E

Referensi Riyadi Sujono ( 2009 ) Askep Pada Anak : Graha Ilmu, Yogyakarta

Nama Pembuat Sri Mulyanti

Institusi/ Bagian STIKes Muhammadiyah Tasikmalaya

Prodi SI Keperawatan

Template Soal Perawat

ID SOAL 07 (diisi kode identitas soal oleh panitia)

TINJAUAN JABARAN

Tinjauan 1 Aspek etik, legal dan peka budaya


Asuhan keperawatan dan manajemen keperawatan
Pengembangan professional
Tinjauan 2 Kognitif: pengetahuan comprehensif / berpikir kritis
Pengetahuan aplikasi prosedural
Pengetahuan afektif (konatif)
Tinjauan 3 Maternitas / Anak / KMB/ Gadar / Jiwa / Keluarga/Komunitas/ Gerontik/
Manajemen
Tinjauan 4 Pengkajian / Penentuan diagnosis / Perencanaan / Implementasi / Evaluasi /
Lain-lain

Tinjauan 5 Promotif / Preventif / Kuratif / Rehabilitatif

Tinjauan 6 Oksigen / Cairan &.elektrolit / Nutrisi / Eliminasi / Aman

&.nyaman / aktifitas & istirahat/ komunikasi/ belajar/ seksual/nilai dan


keyakinan / Psikososial

Tinjauan 7 Sistem Kardiovaskuler / Sistem Respirasi / Sistem Imuno-hematologi / Sistem


Neurobehaviour / Sistem Endokrin / Sistem Pencernaan / Sistem
Muskuloskeletal / Sistem Integument / Sistem Perkemihan / Sistem
Reproduksi/penginderaa/ lain-lain

KASUS (vignete):

Seorang anak laki-laki berusia 10 tahun dirawat karena mengalami penambahan berat badan sejak
seminggu yang lalu disertai edema pada wajah, sembab disekitar mata timbul saat pagi, dan
berkurang di siang hari. Pasien juga mengalami asites, kesulitan bernafas, pembengkakan scrotal
dan gatal pada kulit.

Pertanyaan soal :

Apakah intervensi keperawatan yang utama untuk masalah kasus diatas ?

Pilihan jawaban:

A. Kaji masukan yang relative terhadap keluaran


B. Atur masukan cairan dengan cermat
C. Pantau infuse intra vena
D. Berikan perawatan kulit
E. Pantau tanda vital

Kunci Jawaban A

Referensi Wong,Donna L (2003), Pedoman klinis keperawatan pediatric : EGC , Jakarta

Nama Pembuat Sri Mulyanti

Institusi/ Bagian STIKes Muhammadiyah Tasikmalaya

Prodi SI Keperawatan