Anda di halaman 1dari 97

BukuPromosiKesehataninimenyajikaninformasitentangberbagai

aspek dalam promosi kesehatan dari berbagai bidang ilmu terkait.


Setiapbabdalambukuinimenjelaskansecararingkastentangbagian
daribidangilmuyangberkenaandenganpelaksanaanupayapromosi
kesehatan.Bukuinidisusundenganmenggunakanberbagaisumber
referensi dan dikemas dalam bahasa yang mudah dipahami bagi
masyarakat umum tentang promosikesehatan.

Buku ini berbeda dengan buku lain yang ada di pasaran karena
secaralugasmerangkumberbagaitopikyangterkaitdenganupaya
promosikesehatandiberbagaisetting.Materitentangpendidikan,
penyuluhan, metode dan media, antropologi sosiologi, psikologi,
konsepbelajardanperilakudalamkesehatanmerupakansebagian
materidari11babyangadadalambukuini.Padaakhirbukuinijuga
telahdisediakansoallatihanuntukmengukurpemahamanpembaca
tentang informasi yang telahdisampaikan.

Penulisbukuinimerupakanparapenelitidanpengajardikesehatan
masyarakat dengan gelar S2 dan S3 yang telah melakukan
berbagaipublikasidijurnalnasionalmaupuninternasional.Penulis
utama buku ini menuliskan informasi tentang promosi kesehatan
berdasarkan informasi yang diperoleh selama tinggal di Belanda
dalammemperolehgelarMasterofPublicHealth(MPH)danselama
tinggal di Amerika Serikat dalam memperoleh gelar PhD in Health
Promotion. Buku ini dapat menjadi referensi bagi para pembaca
yang membutuhkan informasi tentang promosi kesehatan secara
menyeluruhtetapidisajikansecaralugasdanpadatdenganbahasa
yang mudahdipahami.

ISBN 978-602-473-040-6

9 786024 730406
Pasal 113 Undang-Undang Nomor 28 Tahun 2014 tentang Hak Cipta:

(1) SetiapOrangyangdengantanpahakmelakukanpelanggaranhakekonomi
sebagaimana dimaksud dalam Pasal 9 ayat (1) huruf i untuk Penggunaan
SecaraKomersialdipidanadenganpidanapenjarapalinglama1(satu)tahun
dan/ataupidanadendapalingbanyakRp100.000.000(seratusjutarupiah).

(2) Setiap Orang yang dengan tanpa hak dan/atau tanpa izin Pencipta atau
pemegang Hak Cipta melakukan pelanggaran hak ekonomi Pencipta
sebagaimana dimaksud dalam Pasal 9 ayat (1) huruf c, huruf d, huruff,
dan/atau huruf h untuk Penggunaan Secara Komersial dipidana dengan
pidana penjara paling lama 3 (tiga) tahun dan/atau pidana denda paling
banyakRp500.000.000,00(limaratusjutarupiah).

(3) Setiap Orang yang dengan tanpa hak dan/atau tanpa izin Pencipta atau
pemegang Hak Cipta melakukan pelanggaran hak ekonomi Pencipta
sebagaimana dimaksud dalam Pasal 9 ayat (1) huruf a, huruf b, hurufe,
dan/atau huruf g untuk Penggunaan Secara Komersial dipidana dengan
pidana penjara paling lama 4 (empat) tahun dan/atau pidana denda paling
banyakRp1.000.000.000,00(satumiliarrupiah).

(4) SetiapOrangyangmemenuhiunsursebagaimanadimaksudpadaayat(3)
yangdilakukandalambentukpembajakan,dipidanadenganpidanapenjara
paling lama 10 (sepuluh) tahun dan/atau pidana denda paling banyak
Rp4.000.000.000,00(empatmiliarrupiah).
PROMOSI
KESEHATAN
IRANURNALA,SKN.,NPH.,Ph.D
FAUZIERAHNAN,SKH.,NPH
ADI NUGROHO, SKN., N.Kes., N.Sc., Ph.D(Cand)
NEKA ERLYANI, S.Psi., N.Psi., Psikolog
NUR LAIL?, SKN., N.Kes.
VINA YULIA ANHAR, SKN., NPH

niversity

Universitas Airlangga
Promosi Kesehatan
Ira Nurmala [et al.]

Perpustakaan Nasional RI. Data Katalog Dalam Terbitan (KDT)

Nurmala, I.
Promosi Kesehatan/Ira Nurmala [et al.] -- Surabaya: Airlangga University Press, 2018.
viii, 116 hlm. ; 23cm

ISBN978-602-473-040-6

1. Promosi Kesehatan. I. Judul.

353.627 4

Penerbit
Kampus C Unair, Mulyorejo Surabaya 60115
AIRLANGGA UNIVERSITY PRESS Telp. (031) 5992246, 5992247
No.IKAPI:001/JTI/95 Fax. (031) 5992248
No.APPTI:001/KTA/APPTI/X/201 E-mail: adm@aup.unair.ac.id
2 AUP779.6/10.18(0.03)
Cover:Erie;Layout:Djaiful;Editor:Zadina

Bekerja sama dengan


Pusat Inovasi Pembelajaran dan Sertifikasi (PIPS) UNAIR
Kampus C Unair, Gedung Kahuripan Lt. 2, Ruang 203, Mulyorejo Surabaya 60115
Telp. (031) 59204244 Fax. (031) 5920532 E-mail: adm@pips.unair.ac.id

Dicetak oleh:
Pusat Penerbitan dan Percetakan Universitas Airlangga (AUP)
(RK328/07.18/AUP-A3E)

Cetakan pertama —2018

Dilarang mengutip dan/atau memperbanyak tanpa izin tertulis dari


Penerbit sebagian atau seluruhnya dalam bentuk apa pun.
Prakata

Puji syukur kami panjatkan ke hadirat Allah SWT., berkat rahmat dan
petunjuk-Nya kami dapat menyelesaikan penyusunan buku referensi
tentang promosi kesehatan yang diharapkan dapat menjadi panduan bagi
parapendidik,praktisi,dankhalayakumumuntukmengenal,mempelajari, dan
memahami konsep dasar promosi kesehatan dalam lingkup yang luas.
Bukureferensiinijugadilengkapidenganrangkumandansoallatihandalam
rangka lebih memaksimalkan pemahaman pembaca dan menjadi lebih
aplikatifdalammenjalankanupayapromosikesehatandisetiapsetting.
Semogabukuinimemberikanmanfaatbesardalammeningkatkan
pemahamantentangkonseppromosikesehatan.Kamiucapkanterima
kasihkepadasemuapihakyangtelahmendorongdanmemberikanmotivasi
penyusunanbukureferensiini.
Akhirnyagunapenyempurnaanbukuini,kamitetapmemohonmasukan,
kritik,dansaranagarnantinyaterwujudsebuahbukureferensiyangpraktis,
informatif,penuhmanfaat,danmenjadirujukandalammemahamikonsep
pendidikandanpenyuluhankesehatanbagimasyarakatumum.

Surabaya,Februari2018

TimPenyusun
v
Daftar Isi

Prakata......................................................................................... v

Bab1 KonsepdanPrinsipPromosiKesehatan................. 1
Bab2 Konsep dan Prinsip Pendidikan Kesehatan
Masyarakat.................................................................. 23
Bab 3 Antropologi dan Sosiologi dalam Kesehatan
Masyarakat.................................................................. 33
Bab 4 Psikologi dalam Pendidikan Kesehatan.................. 39
Bab 5 KonsepPerilakudanPerilakuKesehatan............... 43
Bab 6 Proses Belajar dalam Pendidikan Kesehatan
Masyarakat.................................................................. 58
Bab 7 MetodePenyuluhanKesehatan............................... 63
Bab 8 Pembuatan Perencanaan PenyuluhanKesehatan.. 67
Bab 9 Metode,AlatBantu,danMediaPenyuluhan......... 73
Bab 10 Pendekatan Edukatif dalam Peningkatan Derajat
Kesehatan .................................................................... 77
Bab 11 PromosiKesehatanpadaBerbagaiSetting............. 83

SoalLatihan.............................................................................. 88
DaftarPustaka......................................................................... 109
vii
Bab

1 Konsep dan Prinsip Promosi


Kesehatan

SEJARAH PROMOSI KESEHATAN


Sebelumistilahpromosikesehatandiperkenalkan,masyarakatlebih
mengenalistilahpendidikankesehatan.Pendidikankesehatanmenurut
Green(1980)adalah“anycombinationoflearning’sexperiencesdesignedto
facilitatevoluntaryadaptationsofbehaviorconducivetohealth”(kombinasidari
pengalamanpembelajaranyangdidesainuntukmemfasilitasiadaptasi
perilakuyangkondusifuntukkesehatansecarasukarela).Definisipendidikan
kesehatantersebutmenunjukkanbahwapendidikankesehatantidakhanya
sekedarmemberikaninformasipadamasyarakatmelaluipenyuluhan.
Definisipendidikankesehatantersebutmenunjukkanbahwapengalaman
pembelajaranmeliputiberbagaimacampengalamanindividuyangharus
dipertimbangkanuntukmemfasilitasiperubahanperilakuyangdiinginkan.
Istilahpendidikankesehatantersebutseringkalidisalahartikanhanya
meliputipenyuluhankesehatansajasehinggaistilahtersebutsaatinilebih
populerdiperkenalkandenganistilahpromosikesehatan.
Tahun 1984, World Health Organization (WHO) mengubah istilah
pendidikan kesehatan menjadi promosi kesehatan. Perbedaan kedua istilah
tersebut yaitu pendidikan kesehatan merupakan upaya untuk mengubah
perilakusedangkanpromosikesehatanselainuntukmengubahperilakujuga
mengubahlingkungansebagaiupayauntukmemfasilitasikearahperubahan
perilakutersebut.IstilahHealthPromotion(promosikesehatan)inisecara
resmidisampaikanpadaKonferensiInternasionaltentangHealthPromotiondi
Ottawa,Kanadapadattahunm1986.PadaKonferensitersebuthealthpromotion
didefinisikansebagai“theprocessofenablingpeoplestoincreasecontrolsover,
andtoimprovedtheirhealth”yaituprosesyangmemungkinkanseseorang
untuk mengontrol dan meningkatkan kesehatan. Definisi ini mengandung
pemahamanbahwaupayapromosikesehatanmembutuhkanadanyakegiatan

1
pemberdayaanmasyarakatsebagaicarauntukmemelihara,meningkatkan
danmelindungikesehatanbaikperoranganmaupunmasyarakat.
Padatahun1994IndonesiamendapatkunjungandariDirekturHealth
PromotionWHOyaituDr.IlonaKickbush.KemudianIndonesiaditunjuk
sebagai penyelenggara Konferensi Internasional Health Promotion yang
keempat sehingga Depkes berupaya untuk menyamakan konsep dan
prinsip tentang promosi kesehatan serta mengembangkan beberapa daerah
menjadidaerahpercontohan.Dengandemikian,penggunaanistilahpromosi
kesehatan di Indonesia pada dasarnya mengacu pada perkembangan dunia
internasional.Konseppromosikesehatantersebutternyatajugasesuaidengan
perkembangan pembangunan kesehatan di Indonesia yaitu mengarah pada
paradigmasehat(Nurianti,2015).
Visi,misi,danstrategipromosikesehatandiIndonesiasudahsangat
yangjelassebagaisuatulembagaatauinstitusiatausuatuprogram.Melalui
visidanmisitersebutlembagaatauprogrammemilikiarahdantujuanyang
akandicapai.Olehkarenaitu,visipromosikesehatandiIndonesiatidak
terlepasdarivisipembangunankesehatandiIndonesia,sepertiyangterdapat
dalamUndang-UndangKesehatanRINo.366Tahun2009,yaitu:

“Meningkatkan kesadaran, kemauan dan kemampuan hidup sehat bagi setiap


orang agar terwujud derajat kesehatan masyarakat yang setinggi–tingginya,
sebagai investasi sumber daya manusia yang produktif secara sosial dan
ekonomi”.

Promosikesehatanyangmenjadibagiandariprogramkesehatanmasyarakat di
Indonesia harus mampu mewujudkan visi pembangunan kesehatan di
Indonesia, sehingga promosi kesehatan dapat dirumuskan sebagai
“Masyarakat yang mau dan mampu memelihara dan meningkatkan
kesehatannya”. Adapun visi promosi kesehatan menurut Fitriani (2011),
yaitu:

a) Mau(willingness)memeliharadanmeningkatkankesehatannya
b) Mampu(ability)memeliharadanmeningkatkankesehatannya
c) Meningkatkan kesehatan, berarti mau dan mampumeningkatkan
kesehatannya.

Memeliharakesehatanartinyamaudanmampudalammelakukan
pencegahan penyakit serta melindungi diri darigangguan-gangguan
2 PromosiKesehatan
kesehatan.Selainitu,kesehatanperluditingkatkankarenaderajatkesehatan,
baikindividu,kelompok,maupunmasyarakatitubersifatdinamis‘tidak
statis’.
Diperlukan upaya untuk mewujudkan visi promosi kesehatan
tersebutagarmasyarakatmaudanmampumemeliharadanmeningkatkan
kesehatannya.Upaya-upayayangharusdilakukanuntukmencapaivisi
tersebutdisebutmisipromosikesehatan.

PENGERTIAN PROMOSI KESEHATAN


MenurutWHO(dalamFitriani,2011),promosikesehatansebagai“Theprocess
ofenablingindividualsandcommunitiestoincreasescontroloverthedeterminantsof
healthandtherebyimprovetheirhealth” (prosesyangmengupayakanindividu dan
masyarakat untuk meningkatkan kemampuan mereka mengendalikan faktor
kesehatan sehingga dapat meningkatkan derajatkesehatannya).
Promosikesehatanmerupakanrevitalisasidaripendidikankesehatan
padamasayanglalu,dimanadalamkonseppromosikesehatantidak
hanyamerupakanprosespenyadaranmasyarakatdalamhalpemberian
danpeningkatanpengetahuandalambidangkesehatansaja,tetapijuga
sebagaiupayayangmampumenjembataniperubahanperilaku,baikdi
dalammasyarakatmaupundalamorganisasidanlingkungannya.Perubahan
lingkunganyangdiharapkandalamkegiatanpromosikesehatanmeliputi
lingkunganfisik-nonfisik,sosial-budaya,ekonomi,danpolitik.Promosi
kesehatanadalahperpaduandariberbagaimacamdukunganbaikpendidikan,
organisasi,kebijakan,danperaturanperundang-undanganuntukperubahan
lingkungan(Mubarakdkk.,2007).
Promosikesehatanmerupakanistilahyangsaatinibanyakdigunakan
dalamkesehatanmasyarakatdantelahmendapatkandukungankebijakandari
pemerintahdalammelaksanakankegiatannya.Definisipromosikesehatan
jugatertuangdalamKeputusanMenteriKesehatanNomor1148/MENKES/
SK/VII/2005tentangPedomanPelaksanaanPromosiKesehatandiDaerah,
disebutkanbahwapromosikesehatanadalah“upayauntukmeningkatkan
kemampuanmasyarakatmelaluipembelajarandari,oleh,untukdanbersama
masyarakat,agarmerekandapatmenolongdirisendiri,sertamengembangkan
kegiatanyangbersumberdayamasyarakat,sesuaisosialbudayasetempatdan
didukungkebijakanpublikyangberwawasankesehatan”.
Bab 1 – Konsep dan PrinsipPromosiKesehatan 3
TUJUAN DAN STRATEGI PROMOSI KESEHATAN
Tujuan promosi kesehatan adalah meningkatkan kemampuan baik
individu,keluarga,kelompokdanmasyarakatagarmampuhidupsehat
danmengembangkanupayakesehatanyangbersumbermasyarakatserta
terwujudnyalingkunganyangkondusifuntukmendorongterbentuknya
kemampuantersebut(Notoatmodjo,2012).
Upayauntukmewujudkanpromosikesehatandapatdilakukanmelalui
strategiyangbaik.Strategiadalahcarayangdigunakanuntukmencapai
tujuanyangdiinginkandalampromosikesehatansebagaipenunjangdari
program-programkesehatanyanglainnya,sepertikesehatanlingkungan,
peningkatanstatusgizimasyarakat,pemberantasanpenyakitmenular,
pencegahanpenyakittidakmenular,peningkatankesehatanibudananak,
sertapelayanankesehatan(Notoatmodjo,2012).
Berdasarkan Piagam Ottawa (1984), misi promosi kesehatan dapat
dilakukan menggunakan 3 strategi yang dijelaskan sebagai berikut.

1) Advokasi(advocate)
Kondisipolitik,ekonomi,sosial,budaya,lingkungan,perilakudanfaktor
biologisdapatmemengaruhikesehatanseseorang.Promosikesehatan
berupayauntukmengubahkondisitersebutsehinggamenjadikondusif
untukkesehatanmasyarakatmelaluiadvokasi.Kegiatanadvokasiini
tidakhanyadapatdilakukanolehtenagakesehatan,tetapijugadapat
dilakukanolehmasyarakatsasarankepadaparapemangkukebijakandari
berbagaitingkatatausektorterkaitdengankesehatan.Tujuankegiatan
iniadalahuntukmeyakinkanparapemangkukebijakanbahwaprogram
kesehatanyangakandijalankantersebutpentingdanmembutuhkan
dukungankebijakanataukeputusandaripejabattersebut.
2) Mediasi(mediate)
Promosi kesehatan juga mempunyai misi sebagai mediator atau
menjembataniantarasektorkesehatandengansektoryanglainsebagai
mitra.Halinidikarenakanfaktoryangmemengaruhikesehatantidak
hanyamenjaditanggungjawabsektorkesehatansaja.Promosikesehatan
membutuhkanupayabersamadarisemuapihakbaikdaripemerintah,
sektorkesehatan,sektorekonomi,lembaganonprofit,industri,dan
media. Dengan kata lain promosi kesehatan merupakan perekat
kemitraandibidangpelayanankesehatan.Kemitraansangatpenting
sebabtanpakemitraansektorkesehatantidakakanmampumenangani
4 PromosiKesehatan
masalahkesehatanyangbegitukompleksdanluas.Promosikesehatan
disinibertanggungjawabuntukmemediasiberbagaikepentingan
berbagaisektoryangterlibatuntukmeningkatkanstatuskesehatan
masyarakat.Sehingga,strategidanprogrampromosikesehatanharus
mempertimbangkankebutuhanlokaldanmemungkinkanberbagaisektor
baikdilingkupregional,nasionalmaupuninternationaluntukdapat
terlibatdidalamnya.
3) Memampukan(enable)
Promosikesehatanberfokuspadakeadilandanpemerataansumberdaya
kesehatanuntuksemualapisanmasyarakat.Halinimencakupmemastikan
setiaporangdimasyarakatmemilikilingkunganyangkondusifuntuk
berperilakusehat,memilikiaksespadainformasiyangdibutuhkanuntuk
kesehatannya,danmemilikiketerampilandalammembuatkeputusan
yangdapatmeningkatkanstatuskesehatanmereka.Prinsippromosi
kesehatandisiniadalahmasyarakatmampuuntukmemilikicontrol
terhadapdeterminanyangdapatmemengaruhikesehatanmereka.Sesuai
denganvisipromosikesehatanyaitumaudanmampumemeliharaserta
meningkatkankesehatannya,promosikesehatanmempunyaimisiutama
untukmemampukanmasyarakat.Haliniberarti,dalamkegiatanpromosi
kesehatanharusdapatmemberikanketerampilan-keterampilankepada
masyarakatagarmerekamampumandiridibidangkesehatanbaiksecara
langsungataumelaluitokoh-tokohmasyarakat.Telahdiketahuibersama
bahwakesehatandipengaruhiolehbanyakfaktordariluarkesehatan,
sepertisosial,pendidikan,ekonomi,dansebagainya.Olehsebabitu,
keterampilanmasyarakatdibidangekonomi(pertanian,peternakan,
perkebunan),pendidikandansosiallainnyajugaperludikembangkan
melaluipromosikesehatandalamrangkamemberdayakanmasyarakat
dibidangkesehatan.

StrategipromosikesehatanmenurutWHO(1994)secaraglobalterdiridari4 hal
sebagaiberikut.

a. Advokasi(advocacy)
Advokasimerupakankegiatanmembuatkeputusansebagaibentuk
memberikanbantuankepadamasyarakatdaripenentukebijakandalam
bidangkesehatanmaupunsektorlaindiluarkesehatanyangmempunyai
pengaruhterhadapmasyarakat.
Bab 1 – Konsep dan PrinsipPromosiKesehatan 5
Advokasiadalahupayauntukmeyakinkanoranglainagarmembantuatau
mendukungterhadaptujuanyangdiinginkan.Dalamkontekspromosi
kesehatan,advokasiadalahpendekatankepadaparapembuatkeputusan
ataupenentukebijakandiberbagaisektordantingkatsehinggapara
pejabattersebutmaumendukungprogramkesehatanyangkitainginkan.
Dukungandariparapejabatpembuatkeputusandapatberupakebijakan-
kebijakanyangdikeluarkandalambentukundang-undang,peraturan
pemerintah,suratkeputusan,suratinstruksi,dansebagainya.
Kegiatan advokasi memiliki bermacam-macam bentuk, baik formal
maupun informal. Advokasi dalam bentuk formal seperti penyajian
atau presentasi dan seminar tentang usulan program nyang diharapkan
mendapat dukungan dari pejabat terkait. Sedangkan kegiatan advokasi
dalambentukinformalsepertimengunjungipejabatyangrelevandengan
programnyangdiusulkan,yangsecaratidaklangsungbermaksuduntuk
memintadukungan,baikdalambentukkebijakan,dan/ataufasilitaslain.
Berdasarkan uraian di atas, dapati disimpulkan bahwa advokasi adalah
kegiatanuntukmendapatkandukungandariparapejabatbaikeksekutif
danlegislatifdiberbagaitingkatdansektoryangterkaitdenganmasalah
kesehatan.
b. Dukungan sosial(social support)
Promosikesehatanakanmudahdilakukanjikamendapatdukungandari
berbagailapisanyangadadimasyarakat.Dukungandarimasyarakat
dapatberasaldariunsurinformal,sepertitokohagamadantokohadat
yangmempunyaipengaruhdimasyarakatsertaunsurformal,seperti
petugaskesehatandanpejabatpemerintah.
Tujuanutamanyaagarparatokohmasyarakatsebagaiperantaraantara
sektorkesehatansebagaipelaksanaprogramkesehatandanmasyarakat
sebagai penerima program kesehatan. Dengan kegiatanmencari
dukungan sosial melalui tokoh masyarakat pada dasarnya adalah
untukmensosialisasikanprogram-programkesehatanagarmasyarakat
menerimadanmauberpartisipasiterhadapprogramtersebut.
Olehsebabitu,strategiinijugadapatdikatakansebagaiupayamembina
suasana yang kondusif terhadap kesehatan. Bentuk kegiatan dukungan
sosial ini antara lain: pelatihan-pelatihan tokoh masyarakat, seminar,
lokakarya,bimbingankepadatokohmasyarakatdansebagainya.Dengan
demikian,sasaranutamadukungansosialataubinasuasanaadalahpara
tokohmasyarakatdiberbagaitingkat.
6 PromosiKesehatan
c. Pemberdayaan masyarakat(empowerment)
Pemberdayaan adalah strategi promosi kesehatan yangditujukan
kepadamasyarakatsecaralangsung.Tujuanutamapemberdayaan
adalahmewujudkankemampuanmasyarakatdalammemeliharadan
meningkatkankesehatanmerekasendiri(visipromosikesehatan).Kegiatan
pemberdayaandimasyarakatseringdisebutgerakanmasyarakatuntuk
kesehatan.Bentukkegiatanpemberdayaandapatdiwujudkandengan
berbagaikegiatan,antaralainpenyuluhankesehatan,pengorganisasian
danpengembanganmasyarakatdalambentukkoperasiataupelatihan-
pelatihanuntukkemampuanpeningkatanpendapatankeluarga(incomes
generatingskill).Denganmeningkatkankemampuanekonomikeluarga,
akanberdampakterhadapkemampuandalampemeliharaankesehatan,
sebagaicontohyaituterbentuknyaposobatdesa,terbentuknyadana
sehati,berdirinyapolindes,dansebagainya.Berdasarkanuraiantersebut
dapatdisimpulkanbahwasasaranpemberdayaanmasyarakatadalah
masyarakatitusendiri.
Strategi dalam melaksanakan upaya promosi kesehatan juga telah
dirumuskan dalam Ottawa Charter ‘Piagam Ottawa’. Dalam Piagam
Ottawatersebutdisebutkanbahwaupayameningkatkanstatuskesehatan
masyarakatdilakukanmelaluikegiatansebagaiberikut.
1) Kebijakanberwawasankesehatan(healthypublicpolicy)
Kegiatanpromosikesehatantidakhanyamenyangkutkegiatanyang
dilakukanolehsektorkesehatan.Promosikesehatanmembutuhkan
semua upaya yang ada untuk bermuara ke kesehatan.Dengan
katalain,arahkebijakandalambentukperaturan,perundangan,
maupunsurat-suratkeputusanyakniagarselaluberwawasanatau
berorientasikepadakesehatanmasyarakat.Contohnyaadalahadanya
peraturan atau undang-undang yang mengatur adanya analisis
dampaklingkunganuntukmendirikanperusahaan,rumahsakit,dan
sebagainya.Setiapkebijakanyangdikeluarkanolehpejabatpublik
harusmemerhatikandampaknyaterhadaplingkungankesehatan
masyarakat.
2) Lingkunganyangmendukung(supportingenvironment)
Setiapaktivitasyangdilakukanolehmasyarakatharusmemerhatikan
dampakpadalingkungansekitaragarmempermudahpelaksanaan
kegiatanpromosikesehatan.Lingkunganyangdimaksudbukan
Bab 1 – Konsep dan PrinsipPromosiKesehatan 7
Bab

2 Konsep dan Prinsip Pendidikan


Kesehatan Masyarakat

PENDIDIKAN KESEHATAN MASYARAKAT


Padabagianiniakandijabarkankonsepsecaraumumterkaitpendidikan
kesehatanmasyarakatyangterdiridari:

Pendapat Para Ahli Terkait Pengertian tentang Pendidikan Kesehatan

Beberapaahlitelahmerumuskanberbagaimacamdefinisiterkaitpendidikan
kesehatan berdasarkan paradigma masing-masing, di antaranya sebagai
berikut.

1) Wood(1926)(dalamSulihadkk.,2001)secaragarisbesarberpendapat
bahwapendidikankesehatanadalahserangkaianpengalamanyang
memengaruhisikap,pengetahuan,maupunhabituasiseorangindividu
berkaitandenganhidupsehat,baikdalamlevelindividu,masyarakat
maupunsuaturas.
2) Stuart (1986) secara garis besar berpendapat bahwa pendidikan
kesehatan merupakan bagian dari program kesehatan dan kedokteran.
Pendidikankesehatanmerupakansuatuupayaterencanayangbertujuan
memodifikasi sudut pandang, sikap maupun perilaku suatu individu,
kelompok maupun masyarakat ke arah pola hidup yang lebih sehat,
melaluiprosespromotif,preventif,kuratifdanrehabilitatif(Stuartdalam
Suliha dkk.,2001).
3) Nyswander(1974)secaragarisbesarberpendapatbahwasebenarnya
pendidikankesehatanbukanlahsuatukumpulanproseduratauproses
pentransferanmateridarisuatuindividukeindividulainnya.Akantetapi,
pendidikankesehatanlebihmengarahkepadasuatuprosesdinamisterkait
perubahanperilaku.Perubahanperilakuyangbersifatdinamisiniyaitu,
prosesseseorangakanmemilihuntukmenolakataumenerimaterhadap

23
suatu informasi maupun aktivitas yang bersifat baru baginya, dengan
tujuan untuk mencapai derajat kesehatan secara optimal (Nyswander
dalam Notoatmodjo,2003).
4) Green(1980)secaragarisbesarberpendapatbahwapendidikankesehatan
merupakansuatuprosesyangterencanauntukmencapaitujuankesehatan
dengan mengombinasikan berbagai macam cara pembelajaran (Green
dalam Notoatmodjo,2012).
5) Committee President on Health Education (1997) secara garis besar
mendefinisikan pendidikan kesehatan sebagai proses yang mampu
membantu merevitalisasi kesenjangan yang terjadi antara informasi
yang didapatkan dan praktik kesehatan. Melalui proses ini, diharapkan
seseorangdapattermotivasiuntukmenjauhkandiridarikebiasaanyang
burukdanmengimplementasikanpolahidupyanglebihmenguntungkan bagi
kesehatan (Committee President on Health Education dalam
Notoatmodjo,2003).
6) Craven&Hirnle(1996)secaragarisbesarberpendapatbahwapendidikan
kesehatanmerupakanprosespembelajaranyangbersifatpraktikmaupun
instruksidengantujuanuntukmemberikanberbagaiinformasimaupun
motivasi kepada seseorang sehingga diharapkan terjadi peningkatan
wawasan serta keterampilan untuk mengimplementasikan pola hidup
sehat(Craven&HirnledalamSulihadkk.,2001).

Beberapadefinisitersebutmenunjukkanbahwapendidikankesehatan
merupakansuatuprosespembelajaranyangterencanadanbersifatdinamis.
Tujuandariprosespembelajaraniniadalahuntukmemodifikasiperilaku
melaluipeningkatanketerampilan,pengetahuan,maupunperubahansikap
yangberkaitandenganperbaikanpolahidupkearahyanglebihsehat.
Perubahanyangdiharapkandalampendidikankesehatandapatdiaplikasikan
padaskalaindividuhinggamasyarakat,sertapadapenerapanprogram
kesehatan.
Prosespembelajaranpadakonseppendidikankesehataninidapat
dipraktikkan oleh siapa pun, di mana pun, dan kapan pun. Menurut
Mubarakdkk.(2007),adanyaperubahandaritidaktahumenjaditahudan
daritidakmampumelakukanmenjadimampumerupakanciriperubahan
dariseseorangyangsedangmelakukanprosespembelajaran.
24 PromosiKesehatan
Berbagaiunsurdalamkomponenpendidikankesehatandiantaranya
adalahparapendidikdansasarandidiksebagaibagianinput,implementasi
berbagaikerangkakegiatanyangtelahdirencanakansebagaiupayauntuk
membuatperubahanperilaku(proses),sertahasil(output)yangdiharapkan
darikegiatanyangtelahdiupayakan.Adanyaperubahanperilakuhidupsehat
secaramandirimerupakanhasilyangdiharapkandarikegiatanpendidikan
maupunpromosikesehatan(Notoatmodjo,2003).

Beberapa Tujuan dari Pendidikan Kesehatan

Tujuan umum pendidikan kesehatan adalah membuat perubahan perilaku


padatingkatindividuhinggamasyarakatpadaaspekkesehatan(WHOdalam
Notoatmodjo,2003).Adapuntujuanlainnya,yaitu

1) Mengubahpolapikirmasyarakatbahwakesehatanmerupakansesuatu
yangbernilaibagikeberlangsunganhidup.
2) Memampukanmasyarakat,kelompokatauindividuagardapatsecara
mandiri mengaplikasikan perilaku hidup sehat melalui berbagai
kegiatan.
3) Mendukungpembangunandanpemanfaatansaranaprasaranapelayanan
kesehatansecaratepat.

Secaraoperasional,tujuandariadanyapendidikankesehatanadalah(Wong
dalamSulihadkk.,2001)

1) Menumbuhkanrasatanggungjawabuntukmenjagakesehatandiri
sendiri,sertalingkungansekitar
2) Melakukantindakanpreventifmaupunrehabilitatifagartercegah
daripeningkatankeparahansuatupenyakitmelaluiberbagaikegiatan
positif
3) Memunculkanpemahamanyanglebihtepatterkaitkeberadaandan
perubahanyangterjadipadasuatusistem,sertacarayangefisiendan
efektifdalampenggunaannya
4) Memampukan diri agar secara mandiri dapat mempelajari dan
mempraktikkanhalyangmampudilakukansendirisehinggatidakselalu
memintabantuanpadasistempelayananformal.
Bab 2 – Konsep dan Prinsip PendidikanKesehatanMasyarakat 25
Bab

3 Antropologi dan Sosiologi


dalam Kesehatan Masyarakat

RUANG LINGKUP ANTROPOLOGI DAN SOSIOLOGI DALAM PENDIDIKAN


KESEHATAN MASYARAKAT
Dalam mempelajari kesehatan masyarakat, tidak terlepas dari mempelajari
kebudayaan manusia yang berhubungan dengan penyakit dan kesehatan
(Sarwono,1993).Koentjaraningrat(1987)mengatakanbahwaantropologitidak
hanyamempelajaribudayajugamempelajariaspekfisikdansosialmanusia.
Kedua pengertian tersebut didukung oleh yang disampaikan oleh Foster&
Anderson(dalamDjekky,2002)bahwaterdapatduakutubdalammempelajari
antropologi kesehatan yaitu kutub biologi dan kutub sosial budaya yang
dihubungkandenganmasalahkesehatandanpenyakit.
Sementara,.sosiologidimaknaisebagaisebuahpenelaahanterhadap
kehidupansosialmanusiasecarailmiah.Lebihlanjut,menurutHorton&
Hunt(1993)sosiologimemusatkanpenelaahannyapadakehidupankelompok,
produkkehidupankelompok,danprodukkehidupantersebut.Seorang
antropologdansosiologkesehatandapatmengarahkanpisauanalisisnya
terhadap program kesehatan yang diluncurkan pemerintah, perilaku
masyarakatdalammenumbuhkembangkanbudayasehat,sampaipada
masalahkonfliksosialyangterjadidimasyarakat.
Antropologikesehatanataumedicineanthropologyberawaldari
sebuahtulisandariScotch&Paulyangdidalamartikelnyamembahas
tentangpengobatandankesehatanmasyarakat.Didalamartikeltersebut,
faktorbiologisdansosialbudayamendapatkanperhatiandariparaahli
antropologiterutamadalamkaitannyadenganterjadinyapenyakitdan
bagaimanaperilakumanusiaberkontribusipadatimbulnyapenyakittersebut
(Joyomartono,2011).
33
PERAN ILMU ANTROPOLOGI DAN SOSIOLOGI DALAM PENDIDIKAN
KESEHATAN MASYARAKAT
Antropologikesehatanmemilikiperanuntukmembuatdeskripsiyang
lengkapsertamemberiinterpretasipadahubunganantarafaktorbiologisdan
budayadariperilakuyangdilakukanmanusiadengankeparahanpenyakit
yangdideritabaikdimasalalumaupunmasasekarang.Hubunganantara
faktorbiologisdansosialbudayainiharusdipahamisecaramendalamagar
dapatmemberikankontribusibermaknapadaprogrampeningkatanderajat
kesehatanmasyarakatmelaluipembentukanperilakuyangdiinginkan
(Joyomartono,2011).
Ilmu kesehatan masyarakat memiliki peranan dalam antropologi
kesehatan terutama dalam menjelaskan bagaimana pemahaman, sikap, dan
kebiasaan yang ada di suatu masyarakat yang berkontribusi pada kejadian
penyakit atau masalah kesehatan lainnya. Bidang ilmu lainnya yang juga
memiliki kontribusi di antropologi kesehatan adalah ilmu psikiatri, yang
memberikan pemahaman tentang proses psikologis yang melatarbelakangi
perilaku masyarakat. Ilmu linguistik juga memberikan kontribusi dalam
antropologi kesehatan dalam kaitannya dengan kajian berbagai asal dari
bahasa yang digunakan di masyarakat tersebut (Koentjaraningrat, 1987).
Peningkatankualitaspelayanankesehatandapatdiupayakansalah
satunyaolehbidangilmuantropologikesehatanmelaluipemahamanbudaya
masyarakatterutamadalamkaitannyadenganpemberianpelayanankesehatan
yangtepatdengankebutuhanmasyarakat.Untukdapatmelaksanakanhal
tersebut,seorangantropologkesehatanharusmemilikicukuppemahaman
tentangbudayamasyarakattersebut,mendapatkanpelatihandanpengalaman
yangcukupintensif,danmemilikinaluridansimpatiterhadappermasalahan
oranglain(Nova,2014).
Selainantropologi,bidangilmulainyangjugapentinguntukmembantu
pemahamanterhadappermasalahandikesehatanmasyarakatadalahbidang
ilmusosiologi.Peransosiologikesehatandiantaranyadapatmemberikan
ramalan-ramalansosiologisnyaterhadapdatastatistikatautrenperubahan
sosialsehinggadapatdijadikanbahanpertimbangandalammerumuskan
kebijakankesehatan,baiksebagaikonsultananalisiskebijakan,teknisi
perencanaandanpelaksanaanprogram,maupundalammemahamisifat,
karakter,ataunormamasyarakatyangberlaku(Djekky,2002).
34 PromosiKesehatan
Nova(2014)menyebutkanbeberapaistilahdalamsosiologikesehatan
yangmenunjukkanperansosiologidalambidangkesehatan.

a. Sociologyinmedicine,merupakanistilahyangdigunakanketikamasalah
kesehatan dihubungkan dengan kondisi sosial masyarakat. Dalam
identifikasi gangguan kesehatan maupun pada perawatan pasien,
seorang sosiolog dapat terlibat langsung mengingat masalah kesehatan
seseorangtidakhanyadisebabkankarenaadanyavirusataubakteritetapi juga
karena disebabkan kondisi sosial yang ada dan pola tingkah laku
merekadalamlingkungansosialnya.Pemahamantentangilmusosiologi
kesehatan ini juga dapat bermanfaat pada saat pasien sudah selesai
dirawatdankembalikemasyarakat.
b. Sociology of medicine, berhubungan dengan bagaimana pelayanan
kesehatan yang ada dipandang oleh masyarakat di sekitarnya sebagai
sebuah organisasi. Nilai yang dianut oleh pelayanan kesehatan dan
kepercayaan masyarakat terhadap pelayanan yang diberikan juga
merupakanpembahasandalamsociologyofmedicine.Haliniterutama
karena pelayanan kesehatan yang ada adalah cerminan dari perilaku
manusia di dalamnya dan bagaimana mereka memandang pelatihan
kapasitassebagaibentukpembangunankesehatan.
c. Sociologyformedicine,berhubungandenganbagaimanailmusosiologi
memberikankontribusidalammengukurderajatkesehatanmasyarakat
melaluipengukuranskalasikapyangmemengaruhiperilakukesehatan
denganpengembanganberbagaimacamalatukursepertiThurstone,Likert,
danGuttman.
d. Sociologyfrommedicineyaitumelihatlingkungansosialdariperilakuorang
didalamnya,misalnyatentangpolapendidikanyangditerimaolehpelajar di
bidang medis sampai bagaimana gaya hidup setelah mereka selesai
menempuh pendidikantersebut.
e. Sociologyatmedicine,melihatbagaimanakondisipolitikdanideologiyang
adadapatmemengaruhipolapelayanankesehatanyangdiberikanyang
padaakhirnyamengubahpolainteraksidimasyarakatuntukkesehatan
mereka.
f. Sociologyaroundmedicine,menjelaskanbagaimanailmusosiologitidak
terpisahkan dari keilmuan lain seperti antropologi, ekonomi, etnologi,
etik,filosofi,hukum,maupunbahasayangbersama-samaberkontribusi
Bab 3 – Antropologi dan Sosiologi dalamKesehatanMasyarakat 35
Bab

4 Psikologi dalamPendidikan
Kesehatan

Ruang Lingkup Psikologi dalam Pendidikan Kesehatan Masyarakat

Psikologi diartikan secara umum sebagai ilmu jiwa. Psikologi berasaldari


istilahpsycheataujiwa,tetapisekaranglebihbanyakdiartikansebagaipsikis.
Psikologi digunakan untuk menjelaskan perilaku manusia sebagai sebuah
reaksiyangdilakukanmulaidariperilakusederhanasampaiperilakuyang sangat
kompleks. Menurut Boeree (2008), psikologi adalah kajiantentang
pikiran,seiringdenganaspek-aspekpikiransepertipersepsi,kognisi,emosi,
danperilaku.
Model hubungan perilaku menurut Kurt Lewin (dalam Azwar, 1995)
merupakan fungsi dari karakteristik individu (P) dan lingkungan (E) di
manaperilakutersebutterbentuk.Dalambukuyangsamadijelaskanbahwa
karakteristikindividuadalahvariabelmotif,nilai,sifatkepribadian,dansikap
dariindividutersebutyangdalamprosesnyaberinteraksidenganlingkungan
individu tersebut. Faktor lingkungan berperan besar dalam menentukan
perilakusehinggahalinimenyebabkanperilakudiprediksisebagaihalyang
kompleks.
Faktorlingkunganeratkaitannyadengandemografiswilayah,adat,
sertakebiasaanmanusia.Kebiasaanmanusiayangberhubungandengan
lingkunganseringdihubungkandenganperilakuhidupsehatnya.Salah
satucabangilmupsikologiyangmembahasperilakuhidupsehatadalah
psikologikesehatan.Sebelumistilahpsikologikesehatandiperkenalkan,
masyarakatmemahamipenyakitsebagaihalalamiahyangdialamimanusia.
Penyakitmenyerangtubuhmanusiadariluardanuntukmenyembuhkannya
dilakukanterapipadatubuhmanusiasaja.Padaawalabadke-20,terdapat
pergolakanpadapendekatanbiomediapadaabad19.Pergolakaninimeliputi
munculnyaberbagaiistilahpsychosomaticmedicine,behavioralhealthbehavioral
medicine, danhealth psychology.

39
Padasaatini,kitamenyadaribahwastatuskesehatanseseorangtidak
hanyaditentukanolehbiomedistetapijugaolehkondisipsikologisseseorang.
Hubungankondisipsikologisdankondisifisikseseorangyangdapat
memengaruhikesehatannyainitidakhanyasatuarahtapiduaarahyaitu
kondisifisikyangsakitdapatmemengaruhipsikologisseseorang,tetapijuga
kondisipsikologisseseorangdapatmenyebabkankondisifisiknyamudah
terserangpenyakit.
MenurutAmalia(2015),psikologikesehatanmencakupdefinisisebagai
berikut

a. Berkaitandenganbidangilmiahpsikologiyangmengkajihubungan
perilakumanusiadengankesehatandancarapenerapannya.
b. Peranperilakumanusiauntukmempromosikankesehatan(promosi
kesehatan dan pencegahan dasar) serta upaya menyembuhkan
penyimpangankesehatandapatdikategorikanpadalevelmikro,meso,
danmakro.
c. Beberapabidangpsikologilainnyayangmenyumbangtemuankepada
bidangpsikologikesehatan.

Definisiumumdaripsikologikesehatandalampsikologiklinis
menekankanpadakajiandanfungsikesehatanindividuterhadapdiriserta
lingkungannya,sertamenekankanpadapenyebabdarigangguankesehatan
tersebut.
Lebihlanjut,Amalia(2015)mendefinisikansecaraoperasionaltentang
psikologi kesehatanuntuk

a. Mengevaluasiperilakudalamhubungannyadenganetiologipenyakit;
b. Memprediksiperilakuyangtidakkondusifuntukkesehatan;
c. Memahamipengalamandarirasasakitdarisisipsikologisnya;
d. Mengevaluasiperananpsikologiuntukpenangananpenyakit;
e. Mempromosikanperilakusehatuntukpencegahansakitdilevelindividu
maupunkelompok,danmasyarakat.

PERAN PSIKOLOGI DALAM PENDIDIKAN KESEHATAN MASYARAKAT


Dalambidangkesehatan,psikologiberperandalammenjelaskanperilaku
yang berkontribusi pada peningkatan derajat kesehatan masyarakat.
Pengembangankeilmuaninidiarahkankepadaterapan,aspekpsikologis,
40 PromosiKesehatan
dansosialbudayadalampromosikesehatan.Wujudnyadapatberupametode untuk
perubahan sikap dan perilaku. Oleh karena itu, walaupun psikologi dalam
bidang kesehatan masih relatif baru sudah banyak memberikan
kontribusijugadalamprofesilaindiluarkesehatan(Notoatmodjo,2003).

a. Penerapanpsikologidalambimbingandanpenyuluhan
Psikologimempelajariteknikmelakukankonselingbaiksecaraindividu
maupunkelompok.Pengetahuantentangkonselingdapatdiaplikasikan
dalammemberikanbimbingandanpenyuluhan.Kegiatanbimbingandan
penyuluhandapatmembantuoranglainyangmengalamihambatanatau
kesulitanuntukmenemukanalternatifpemecahanmasalah.
b. Penerapanpsikologidalamhubungankemasyarakatan
Melaluipendekatanpsikologidapatdirancangprogrampendidikanbagi
masyarakat,beberapacontohnyaadalahprogrambelajarsambilbekerja
danprogrambacatulis.Psikologiberupayamenggalipotensimasyarakat
sehinggadapatdidayagunakanuntukmeningkatkankehidupandan
kemakmuranmasyarakat.

Para pekerja sosial mencari penyebab penyakit sosial sehingga


ditemukanjalankeluarmelaluiterapisosial.Masyarakatyangdiorganisasi untuk
mencapai status kesehatan masyarakat yang optimal pada dasarnya adalah
menghimpun potensi atau sumber daya masyarakat dalam upaya
preventif, kuratif, promotif, dan rehabilitatif terhadap kesehatan pribadi
(Notoatmodjo,2003).
Upaya menumbuhkan peran serta aktif masyarakatmemerlukan
pemahaman,kesadaran,danpenghayatanterhadapmasalahkesehatanpribadi,
danmemahamipemecahannya.Untukpengorganisasiandanpengembangan
masyarakatmemerlukanpendidikankesehatanmasyarakat.
Menurut Winslow (dalam Notoatmodjo, 2003) menyebutkan bahwa
kegiatan kesehatan masyarakat meliputi

a. Masyarakatmampumelakukansanitasilingkungan;
b. Masyarakatmampumemberantaspenyakit;
c. Terdapatpendidikankesehatan(hygiene)dimasyarakat;
d. Manajemen(pengorganisasian)pelayanankesehatan;
e. Pengembangan rekayasa sosial dalam rangka pemeliharaan kesehatan
masyarakat.
Bab 4 – Psikologi dalamPendidikan Kesehatan 41
Bab

5 Konsep Perilaku dan Perilaku


Kesehatan

PENGERTIAN PERILAKU DAN PERILAKU KESEHATAN


Perilaku merupakan hasil hubungan antara stimulus dengan respons atau
rangsangandenganrespons(Skinner,1938).Perilakuadalahtindakanyang dapat
diamati bahkan dipelajari, hasil totalitas penghayatan dan aktivitas
yangberasaldaripengaruhfaktorinternalmaupuneksternal(Notoatmodjo,
2003).
Perilakudapatberbentukperilakupasifdanperilakuaktif.Bentuk
pasif(responsinternal)adalahperilakuyangmasihtersembunyididalam
diri,tidakdapatdiamatisecaralangsungsepertipikiran,tanggapan,sikap
batindanpengetahuan,sedangkanbentukaktif(responseksternal),perilaku
inisudahmerupakantindakannyatadanmerupakanresponsyangsecara
langsungdapatdiobservasi(Mubarakdkk.,2007).Perilakupasifyangbelum
berubahmenjadiaktifdisebutsebagaisikap.
Perilaku kesehatan merupakan respons yang memengaruhi
kesehatannya, penyakit yang dideritanya, sistem pelayanan yang diterima
serta pola konsumsi di lingkungan sosialnya (Skinner dalamNotoatmodjo,
2003).Perilakukesehatandibagimenjaditiga,yaitu
a. Memeliharakesehatan,adalahperilakuuntukmenjagakesehatansecara
pribadiagartidakterserangrasasakitdanupayapenyembuhanterhadap
sakit
b. Mencaridanmenggunakansistemataufasilitaspelayanankesehatanatau
perilakupencarianpengobatan.Perilakuinimunculketikaseseorang
menderitapenyakitataukecelakaan
c. Kesehatanlingkungan.Responsterhadaplingkungannyabaikitufisik,
sosialdanbudayasehinggalingkungantidakmengganggukesehatannya,
keluargaataumasyarakat.

43
MenurutGreen(dalamMubarakdkk.,2007),kesehatanseseorang
dipengaruhi oleh faktor perilaku dan non perilaku. Faktor perilaku
menyebutkan bahwa perilaku dipengaruhi oleh pengetahuan, sikap,
kepercayaan,danadatatautradisi.Sedangkanfaktornonperilakuberupa
ketersediaanfasilitas,sikapdanperilakuparapetugaskesehatanyang
mendukungterbentuknyaperilaku(Mubarakdkk.,2007).

DOMAIN PERILAKU KESEHATAN


Bloom(1908)mengategorikanperilakuindividudalamtigadomaindalam
kaitannyadengantujuanpendidikan,yaitukognitif(cognitive),afektif
(affective),danpsikomotor(psychomotor).TeoriBloomkemudianberkembang
dandimodifikasisebagaialatpengukuranpendidikankesehatan.

Pengetahuan (knowledge)

Pengetahuan merupakan hasil tahu dan ini dihasilkan setelahorang


melakukan pengindraan terhadap suatu objek tertentu. Pengindraan
terjadimelaluipancaindramanusiayaituindrapenglihatan,pendengaran,
penciuman,rasa,danraba.Pengetahuanatauranahkognitifmerupakan
domainyangsangatpentingdalammembentuktindakanseseorang.Tingkat
pengetahuandidalamdomainkognitifmempunyaienamtingkatan.

1) Mengetahui(know),merupakanlevelterendahdidomainkognitif,dimana
seseorangmengingatkembali(recall)pengetahuanyangtelahdipelajari.
2) Memahami(comprehension),merupakanlevelyanglebihtinggidarihanya
sekedartahu.Padalevelinipengetahuandipahamidandiinterpretasi
secarabenarolehindividutersebut.
3) Aplikasi(application),merupakanleveldimanaindividutersebutdapat
menggunakanpengetahuanyangtelahdipahamidandiinterpretasi
denganbenarkedalamsituasiyangnyatadikehidupannya.
4) Analisis(analysis),merupakanleveldimanaindividutersebutmampu
untukmenjelaskanketerkaitanmateritersebutdalamkomponenyang
lebihkompleksdalamsuatuunittertentu.
5) Sintesis(synthesis),merupakanleveldimanakemampuanindividuuntuk
menyusunformulasiyangbarudariformulasiyangsudahada.
6) Evaluasi(evaluation),merupakanleveldimanaindividumampuuntuk
melakukanpenilaianterhadapmateriyangdiberikan.
44 PromosiKesehatan
Sikap (attitude)

Sikap digunakan sebagai predictor dari perilaku yang merupakan respons


seseorangketikamenerimastimulusdarilingkungannya.Sikaplebihbersifat
sebagai reaksi emosional terhadap rangsangan tersebut, yang dibagi dalam
beberapatingkatan.

1) Menerima(receiving),terjadijikaindividutersebutmemilikikemauan
untukmemperhatikanstimulusyangditerima.
2) Merespons(responding),terjadijikaindividutelahmemberikanreaksiyang
tampakpadaperilakunyaterhadapstimulusyangditerima.
3) Menghargai(valuing),terjadijikaindividumulaimemberikanpenghargaan
pada stimulus yang diterima dan meneruskan stimulus tersebut pada
orang yanglainnya.
4) Bertanggungjawab(responsible),terjadijikaindividutelahmenerima
segala konsekuensi dari pilihannya dan bersedia untuk bertanggung
jawab.

Praktik atau Tindakan (practice)

Praktik mempunyai beberapa tingkatan, yaitu

1) Respons terpimpin (guided response), dilakukan oleh individudengan


mengikuti panduan yang ada sesuai urutan yang benar dalam panduan
tersebut
2) Mekanisme(mechanism),dilakukanolehindividutanpamelihatpanduan
karenasudahmenjadikebiasaanyangdilakukan
3) Adopsi(adoption),dilakukanolehindividuyangsudahmelakukandengan
baiksehinggaperilakutersebutdapatdilakukanmodifikasisesuaikondisi
atausituasiyangdihadapi.

PEMBENTUKAN PERILAKU
MenurutFitriani(2011),prosespembentukanperilakudapatdipengaruhioleh
faktoryangberasaldalamdiriindividuyangdijelaskansebagaiberikut.

Susunan SarafPusat
a. Susunansarafpusatberperandalammeneruskanstimulusyangditerima
darisatusarafkesaraflainnyadimanaperpindahantersebuttampak
padaperilakunya.
Bab 5 – Konsep Perilaku danPerilaku Kesehatan 45
Bab

6 Proses Belajar dalam Pendidikan


Kesehatan Masyarakat

KONSEP BELAJAR DALAM PENDIDIKAN KESEHATAN MASYARAKAT


Programkesehatanmasyarakattidakterlepasdariadanyaprosespendidikan yang
berkelanjutan, baik untuk masyarakat maupun untuk tenaga
pendidiknya.ProsesBelajarinitanpadibekalikemampuanuntukbelajar,dan
dukungan teknologi tidak akan dapat dicapai dengan hasil yang optimum.
Perkembangan terjadi dikarenakan adanya kemampuan untuk belajar yaitu
mengalamiperubahan,mulaisaatlahirsampaitua.Namun,semuaperubahan
yangdialamitidaksemuadariprosesbelajar.Berdasarkankesadarantentang
peranan belajar dalam perkembangan anak didik, masyarakat modern,
mendirikan lembaga-lembaga secara khusus yang disebut sekolah atau
institusiformal(Notoatmodjo,2003).
Dasarpembelajaranini,menurutNotoatmodjo(2003)melibatkan
berbagaimacamunsurmanusiawi,material,fasilitas,perlengkapan,dan
proseduryangsalingmemengaruhidalamprosespembelajaran.Semua
unsuryangterlibatdalamprosespembelajarantersebuttidakterbataspada
pembelajarandalamkelassajamelainkanjugapembelajarankarenaadanya
interaksidenganorganisasidankomponenlaindilingkungansosialpeserta
didik(Notoatmodjo,2003).
Notoatmojo(2003)dalambukunyajugamengatakanbahwaproses
belajaryangdilakukanolehindividuakanmembawaperubahankepada
individutersebut,dimanaperubahantersebutakantampakkepadaperilaku
pembelajar.Prosesbelajarselaindilihatdariadanyaperubahan,juga
menunjukkanbeberapaciri(Djumarah,2002),antaralain
a) Adanyakesadaranbahwatelahterjadiperubahanpadaindividuyang
belajaryangminimaldisadariolehindividutersebut;
b) Adanyaperubahanyangbergunabagikehidupanindividuyangbelajar
secaraberkelanjutan;

58
c) Adanyaperubahanyangaktifdanpositifyangberartiperubahantersebut
akanselalubertambahdanlebihbaikdarisebelumnya;
d) Adanyaperubahanyangbersifatmenetapdanpermanen;dan
e) Adanyaperubahanyangmenyeluruhbaikdaripengetahuan,sikap,
maupunketerampilan.

JENIS PROSES BELAJAR DALAM PENDIDIKAN KESEHATAN MASYARAKAT


Blockberpendapatbahwasebagianberpengaruhpadapembagianaspek-
aspekkepribadiansebagaiberikut.

a. Bentuk-bentukbelajarmenurutfungsipsikis,terdiridaribelajardinamika/
konatif,afektif,kognitif,dansenso-motorik.
1) Belajar dinamika/konatif, ciri pembelajaran ini adalah belajar
berkehendaksesuatusecarawajar.
2) Belajarafektif,ciripembelajaraniniadalahbelajardalammenghayati
nilaiobjekmenggunakanperasaan.
3) Belajarkognitif,yaitubelajardalammendapatkandanmenggunakan
objekagardapatdigunakansebagairepresentasiobjeklainyangakan
dihadapi.
4) Belajar senso-motorik, yaitu belajar dengan melalui mengamati,
bergerak, danberketerampilan.
b. Bentukbelajarmenurutmateriyangdipelajari
1) Belajar teoritis, tujuan dari pembelajaran ini adalah untuk
menempatkaninformasiyangdiperolehuntukdigunakandalam
memecahkanmasalahyangdihadapi.
2) Belajar bermasyarakat, tujuan dari pembelajaran ini adalah
untuk mengekang dan kecenderungan spontan, dan memberikan
kelonggarankepadaoranglaindemikehidupanbersama.
3) Belajarestetik,tujuandaripembelajaraniniadalahuntukmendapatkan
kemampuan artistik dalam menghasilkan dan menghayati hasil
ciptaannyatersebut.
c. Bentukbelajaryangtidakdisadari
1) Belajarinsidental,merupakanbentukbelajardimanapembelajaran
itudilakukandengantidakdisengajatanpaadaniatsebelumnya.
Bab 6 – Proses Belajar dalam PendidikanKesehatanMasyarakat 59
2) Belajar dengan mencoba-coba, merupakan bentuk belajar di mana
materi yang dipelajari adalah berupa verbal yang akan digunakan
kembalisetelahdisimpandalamingatan.
3) Belajartersembunyi,merupakanbentukbelajardimanapembelajaran
dilakukantidaksecaraterang-terangan.

PRINSIP BELAJAR MENGAJAR DALAM PENDIDIKAN KESEHATAN


MASYARAKAT
Notoatmodjo (2003) membagi prinsip belajar menjadi delapan hal.

a. Belajarmerupakanprosesyangterjadidalamdiripembelajarberupa
pengalamanyangdiaktifkansendiridanbukanolehoranglain.
b. Belajaradalahpenemuandirisendiri,berartiprosespengalihanide-ide
untukmenentukankebutuhandalampencapaiantujuanbaikyangterkait
dengandirisendirimaupunmasyarakatumum.
c. Belajaradalahsuatuakibatdarisebuahpengalamanuntukbertanggung
jawabpadatugasyangdiemban.
d. Belajaradalahsebuahprosesbekerjasamayangbertujuanuntuk
memperkuatprosesbelajaritusendiri.
e. Belajaradalahprosesevolusi(bukanrevolusi)karenaperubahanakibat
dariprosesbelajartersebuttidakberlangsungcepatdanterkadang
memakanwaktuyanglama.
f. Belajaradakalanyamerupakanprosesyangtidakmenyenangkankarena
membuatindividutersebutmengubahjalanhidupnya.
g. Belajarmerupakanprosesyangdipengaruhisecarakeseluruhanoleh
emosionaldanintelektualindividuyangbersangkutan.
h. Belajar tidak bisa digeneralisasikan karena setiap orang memilikigaya
dan keunikantersendiri.

STRATEGI PROSES BELAJAR DALAM PENDIDIKAN KESEHATAN


MASYARAKAT
Menurut Notoatmodjo (2003), dalam menentukan strategi proses belajar,
terdapat beberapa dasar klasifikasi, antara lain sebagai berikut.

a. Pengaturangurudansiswa,strategiinimeliputipenentuanapakahproses
belajartersebuthanyaakandiberikanolehsatupengajarataudiberikan
60 PromosiKesehatan
Bab

7 Metode Penyuluhan Kesehatan

PENGERTIAN PENYULUHAN KESEHATAN


Perubahan perilaku bisa dilakukan dengan berbagai macam strategi, yang
didahului oleh perubahan pengetahuan dan sikap. Perubahan pengetahuan
ini dilakukan salah satunya dengan metode penyuluhan kesehatan.
Penyuluhan kesehatan merupakan kegiatan yang dilakukan menggunakan
prinsip belajar sehingga masyarakat mendapatkan perubahan pengetahuan
dankemauan,baikuntukmencapaikondisihidupyangdiinginkanataupun
untukmendapatkancaramencapaikondisitersebut,secaraindividumaupun
bersama-sama(Sulihadkk.,2001).SedangkanDepkesRI(2002)menyatakan
bahwa penyuluhan kesehatan merupakan peningkatan pengetahuan dan
kemampuan yang bertujuan untuk perubahan perilaku hidup sehat pada
individu,kelompokmaupunmasyarakatyangdiberikanmelaluipembelajaran
atauinstruksi.
Kegiatanpenyuluhandapatdilakukandengankomunikasiduaarah
dimanakomunikator(penyuluh)memberikankesempatankomunikan
untukmemberifeedbackdarimateriyangdiberikan.Diskusiinteraktifpada
komunikasiduaarahinidiharapkandapatmemicuterjadinyaperubahan
perilakuyangdiinginkan.Keberhasilanpenyuluhankesehataninitidak
hanyaditentukanolehmateriyangdisampaikantetapijugapadahubungan
interpersonalantarkomunikatordankomunikan.Indikatorkeberhasilan
penyuluhanyangdapatdiukursecaracepatadalahadanyakesamaanarti
ataupemahamandariyangdisampaikanolehkomunikatordanditerima
olehkomunikan(Effendy,2003).
Kegiatanpenyuluhanmenyampaikanpendidikandanmengajaksasaran
tentangidebaruyangdiperkenalkan.Halinimenekankanpadapentingnya
materitersebuttidakhanyauntukkomunikatortetapijugauntukkomunikan

63
sehingga terjadi kesesuaian minat dan motivasi dalam memicu perubahan
perilaku. (Notoatmodjo,2007).
Penyuluhan kesehatan ini dilakukan tidak hanya untuk membentuk
perilaku yang baru, tetapi juga memelihara perilaku sehat yang telah ada
dariindividu,kelompokdanmasyarakatdalamlingkunganyangsehatuntuk
derajat kesehatan yang optimal. Perilaku sehat yang merupakan hasil dari
penyuluhan kesehatan dapat menurunkan angka kesakitan dan kematian
karena perilaku individu, kelompok dan masyarakat telah sesuai dengan
konsepsehat,baiksecarafisik,mentaldansosialnya(Notoatmodjo,2007).

METODE PENYULUHAN KESEHATAN


MenurutEffendy(2003)terdapatduametodedalampenyuluhankesehatan,
yaitumetodedidaktikdansokratik.

1) Metode didaktik adalah merupakan metode di mana penyuluhan


dilakukansatuaraholehpematerikepadapesertayangmendengarkan
tetapitidakdiberikankesempatanuntukmengemukakanpendapatnya.
2) Metodesokratikadalahmerupakanmetodeyangmemberikankesempatan
pada peserta untuk berpartisipasi aktif dalam mengemukakan
pendapatnya.

Selainitu,Notoatmodjo(2007)membedakanmetodepenyuluhanberdasarkan
sasarannyamenjadidua,yaitupenyuluhanindividualdankelompok.

1) Penyuluhanindividual,metodeinimerupakanmetodeuntukmengubah
perilakuindividuyangdisesuaikandengankebutuhandankemampuan
individutersebut.
2) Penyuluhankelompok
a. Kelompokbesar
Sebuahkelompokdikatakanbesarketikajumlahpesertanyamelebihi
15orang.Untukkelompokbesarini,metodeyangdapatdigunakan
misalnyaadalahceramah,seminardandemonstrasi.
a) Ceramah, dilakukan kepada sasaran dengan memberikan
informasisecaralisandarinarasumberdisertaitanyajawab
setelahnya.Ciridarimetodeceramahiniadalahadanyakelompok
sasaranyangtelahditentukan,adapesanyangakandisampaikan,
adanyapertanyaanyangbisadiajukanwalaupundibatasisetelah
64 PromosiKesehatan
ceramah,sertaadanyaalatperagajikakelompoksasarannya
jumlahnyasangatbanyak.Keuntungandarimetodeiniadalah
biayayangdikeluarkanrelatiftidakbanyakdanmudahuntuk
dilakukan, waktu yang dibutuhkan juga dapatdisesuaikan
dengankebutuhansasarandanbisaditerimadenganmudah
olehhampirsemuakelompokmasyarakatwalaupuntidakbisa
membacadanmenulis.
b) Metodeseminar,dilakukanuntukmembahassebuahisudengan
dipanduolehahlidibidangtersebut.
c) Metodedemonstrasilebihmengutamakanpadapeningkatan
kemampuan(skill)yangdilakukandenganmenggunakanalat
peraga.
b. Kelompokkecil
a) Metodediskusikelompokkecilmerupakandiskusi5–15peserta
yangdipimpinolehsatuorangmembahastentangsuatutopik.
b) Metodecurahpendapatdigunakanuntukmencarisolusidari
semuapesertadiskusidansekaligusmengevaluasibersama
pendapattersebut.
c) Metode Panel melibatkan minimal 3 orang panelis yang
dihadirkandidepankhalayaksasaranmenyangkuttopikyang
sudahditentukan.
d) Metode Bermain peran digunakan untukmenggambarkan
perilakudaripihak-pihakyangterkaitdenganisutertentudan
digunakansebagaibahanpemikirankelompoksasaran.

PENENTUAN SASARAN/KHALAYAK
(Effendy)2003menyebutkanbahwasasaranpenyuluhankesehatanterdiri
dariempatunsur,antaralain

a. Individu
b. Keluarga
c. Kelompoksasarankhusus,seperti
1) Kelompokberdasarkanpertumbuhan,mulaidarianaksampai
manula;
2) Kelompokyangmemilikiperilakumerugikankesehatan;dan
3) Kelompokyangmemilikipenyakitkronis.
Bab 7 – MetodePenyuluhanKesehatan 65
Bab

8 Pembuatan Perencanaan
Penyuluhan Kesehatan

PEMBUATAN PERENCANAAN
Penyusunanrencanapenyuluhandilakukandenganbeberapalangkahyang
diuraikansebagaiberikut.

Penetapan Tujuan

Tujuandaripenyuluhankesehatan,yaitumelakukanperubahanterhadap
pengetahuan,pengertianataukonsepyangsudahada,sertaperubahan
terhadappandangandankeyakinandalamupayamenempatkanperilaku
yangbarusesuaidenganinformasiyangditerima.Penyuluhandengan
tujuanyangditetapkanolehtimpelaksanaakanmembedakanjenismedia
danalatperagayangdigunakan,semakinrumittujuanyangakandicapai,
semakinbanyakdanbervariasimediadanalatperagayangdigunakan.
Misalkan,mediadanalatperagayangdirancanguntukkegiatanpeningkatan
pengetahuansasarantentangpermasalahankesehatanakanberbedadengan
mediadanalatperagayangdisiapkanolehpelaksanaprogramyangbertujuan
untukpeningkatanketerampilanuntukmelakukanintervensiterhadap
permasalahankesehatan.
Beberapapenelitianmenunjukkanbahwamediadanalatperaga
memilikiperanpentingdalamtersampaikannyapesanpadaprosespemberian
informasi.Sasaranpenyuluhanakanmenyerapinformasilebihsedikitketika
sasaranhanyamendengarkanpemaparandaripemateri.Sebaliknya,ketika
sasaranmelihatdanmendengarmateriyangdisampaikanmakasasaran
penyuluhanakanmendapatkanlebihbanyakinformasi.Pernyataanini
sejalandenganpenelitianZulkarnainbahwakelompokyangmendapatkan
penyuluhandenganmediaflipchartmengalamipeningkatansikapsebesar
91,66%,sedangkanpadakelompokyangmendapatkanpenyuluhandengan

67
mediapemutaranVCDseluruhrespondennya(100%)mengalamipeningkatan
sikap (Zulkarnain dkk., 2011).

Penentuan Sasaran

Faktor yang menjadi penentu kesuksesan dari kegiatan penyuluhan adalah


ketepatan dalam penentuan sasaran kegiatan. Hal ini disebabkan oleh
indikator keberhasilan kegiatan penyuluhan adalah apabila pesan dapat
diterimadenganbaiksertaadanyaumpanbalikyangdiberikanolehsasaran
kegiatansesuaidengantujuanyangditetapkanolehpenyuluh.Effendy(1998)
menyebutkanfaktoryangberpengaruhterhadapkeberhasilankegiatanyang
dilakukan sebagaiberikut.

1) Pendidikan
Pendidikanberpengaruhterhadappolapikirdanpandanganmengenai
pesankesehatanyangditerimaolehsasaranpenyuluhankesehatan.
Artinya,apabilasasaranmemilikipendidikanyanglebihtinggimaka
akanlebihmudahdalampenerimaandanpenanamanpesankesehatan
yangdisampaikanolehpenyuluh.
2) Tingkat sosialekonomi
Sasaranpenyuluhandengantingkatsosialekonomiyangtinggiakan
mempermudahpenerimaanpesankesehatanyangbarudisampaikan
olehpenyuluhdibandingdengansasarandengantingkatsosialekonomi
yanglebihrendah.
3) Adatistiadat
Adatistiadatdarisasaranpenyuluhanmemberikanpengaruhterhadap
penerimaaninformasibaru.Halinidisebabkanolehmasyarakatyang
menjadisasarankegiatantetapmemerhatikandanmenghormatitradisi
yangberkembangdimasyarakat.
4) Keyakinan
Sasaranpenyuluhanyangmenjadifokuskegiatanakanmenerimadan
meyakinipesankesehatansertamaumelaksanakanpesantersebutapabila
pesanyangdiberikanberasaldariorangdengankedekatantersendiri
dengansasarandansudahdipercayaolehsasaranpenyuluhan.
5) Kesiapanwaktupelaksanaan
Pemberianpesankesehatansebaiknyamengindahkandanmemikirkan
baik-baikkesiapanwaktuyangdimilikiolehsasaranagarbisaberhadir
68 PromosiKesehatan
dalamkegiatanpenyampaianpesankesehatan,sehinggapesanyang
dibuatakansampaipadasasaranyangberhadir.

Penyusunan Materi Atau Isi Penyuluhan

Materiatauisipenyuluhanyangdisusunsertaarahpemberianmaterimenjadi
faktorpentingkeberhasilanpenyuluhankesehatanyangdilaksanakan.
Pematerisebaiknyamemperhatikanmateriyangdibawakansertateknik
pemberianmaterimelaluiperencanaanmateriyangtepatdanpenyusunan
materipresentasiyangmemilikidayatariksehinggapesanyangakan
disampaikandapatlebihmudahdipahamiolehsasaranpenyuluhan.

Penentuan Jenis Alat Peraga (Media)

Alatperaga(media)berfungsiuntukmembantupenyuluhkesehatandalam
menyampaikanpesankesehatansehinggasasaranpenyuluhanmendapatkan
materidaninformasidenganjelasdanlebihterarah.Kegunaandarialat
peraga(media),antaralain

1) Meningkatkanketertarikansasaranpenyuluhan;
2) Menjangkausasaranyanglebihluas;
3) Mengurangihambatanpenggunaanbahasa;
4) Mempercepatpenerimaaninformasiolehsasaran;dan
5) Meningkatkanminatsasaranuntukmenerapkanisipesankesehatan
dalamberperilakukesehatan.

Jenis alat peraga (media) dalam penyuluhan, antara lain sebagai berikut.
a. Alatperaga(media)lihat(visualaids)
Alatperaga(media)lihatmemilikifungsiuntukmenstimulasiindralihat
padasaatpenyampaianmateri(pesan)kesehatanyangdiberikan.Alatini ada
2bentuk:
1) Alatperaga(media)proyeksi,misalnyalembartransparan(slide)dan
film strip.
2) Alatperaga(media)nonproyeksi,misalnyaposter,petapenyebaran
penyakit,boladunia,danbonekatangan.
b. Alat peraga (media) dengar (audioaids)
Alat peraga (media) dengar berfungsi membantu stimulasiindra
pendengaransaatprosespenyampaianmateripenyuluhan.Contohnya
piringanhitam,siaranradio,danpitasuara.
Bab 8 – Pembuatan PerencanaanPenyuluhanKesehatan 69
Bab

9 Metode, Alat Bantu, dan Media


Penyuluhan

PERENCANAAN PEMBUATAN DAN PENGGUNAAN ALAT PERAGA


Gambarantentangsasaranpenyuluhanyangakanditujudenganmenggunakan
alatperagapentinguntukdipahamidalamprosespersiapanyangdilakukan.
Artinyapenggunaanalatperagaharusdidasarkanpadapengetahuanyang
dimilikiolehsasaranpenyuluhan.Berikutiniadalahbeberapahalyangharus
diketahuitentangsasarandalamkegiatanpenyuluhan(Guswar,2009).

1) Individu (personal) atau kelompok (masyarakat atau komunitas


tertentu).
2) Penggolongan sasaran, misalnya kependudukan (demografi) dan sosial
ekonomi.
3) Bahasayangdigunakanolehsasaran.
4) Adatistiadatsertakebiasaanyangberlakudimasyarakat.
5) Minatdanperhatiansasaran.

Pesandalammediayangdigunakanbertujuanuntukmemengaruhisasaran
sertamengajakkhalayakuntukmengimplementasikanideyangdiberikan
kesasaran.

1) ImbauanRasional
Imbauanrasionalyangdisampaikandenganalasansasaranpenyuluhan
merupakanmakhlukrasional.Misalnyaimbauanberisiajakanuntuk
datangkeposyandu,“Datanglahkeposyanduuntukmengimunisasikan
anak.”Ibuterkadangmemahamipesantersebut,tetapitidakbertindak
sesuaianjuranpesanolehsebabragudenganmanfaatimunisasi.
2) ImbauanEmosional
Pesan dengan menggunakan imbauan emosional kemungkinan
berhasil
lebihtinggidibandingdenganimbauandenganbahasarasional.Halini

73
disebabkanolehpemikiransasaranpenyuluhankhususnyaibucenderung
berdasarkan pada emosi dari hasil pemikiran rasional.
3) ImbauanKetakutan
Penyampaianimbauanpesanyangmenimbulkanketakutanharus
digunakandenganhati-hatitergantungdarikaraktersasaranyang
dituju.Sasarandengankepribadiankuatkurangefektifdengandiberikan
imbauanemosionaldibandingkanpadasasarandengantingkatkecemasan
tinggi.
4) ImbauanGanjaran
Penyampaianinformasidenganimbauanganjaranditujukanuntuk
memberikanpernyataankesediaandankesanggupanuntukmelakukan
halyangmenjadiharapanpenerimainformasi.Metodeiniakanberdaya
gunapadasasaranyangmauperilakunyaapabilamemperolehimbalan
sesuaiharapan.
5) ImbauanMotivasional
Penyampaianinformasidilakukandalambentukdoronganyangmengena
dansampaipadasasaranpesan.Sasaranakantergerakmelaluidorongan
kebutuhanyangmenjadidasardalampemenuhankesejahteraanhidup.

PEMBUATANMEDIASEDERHANA(POSTER,LEAFLET,BOOKLET)UNTUK
PENYULUHAN
Guswar(2009)jugamenyampaikancarapembuatanmediaposterdapat
dilakukandengan7caraberikut.

a. Penentuaninformasiyangakandisampaikankepadasasaranyangdituju,
sepertiupayapencegahanpernikahanusiadinipadamasyarakatdi
wilayahbantaransungai.
b. Pendeskripsian informasi melalui bentuk ilustrasi dan desain yang
mewakili isiinformasi.
c. Penyampaianinformasidenganmenggunakanhuruf,warnadankata-kata
yangmencolokdankontras,singkatdanpadat,besar,sertaterlihatdengan
jarak6meter.Seperti:“HindariPerilakuSeksBebasSejakDini.”
d. Penguranganatributdandesainyangtidakmewakiliisipesanagarisi
informasiterarahdantidakmeluas.
e. Penggunaan ilustrasi sederhana dan disesuaikan dengan sasaran
poster.
74 PromosiKesehatan
f. Penggunaanhuruf,jarakantarhuruf,bentuk,danukurandisesuaikan
denganukuranposteryangdirancang.
g. Ujicobaposterpadakelompokyangmemilikikarakteristikyangsama
dengansasaranutamayangakanmenerimapesandariposter.Halini
dilakukanagarketikaposterdigunakanmakasasaranutamamemahami
isiposteryangdisampaikan.

Komponen yang harus diperhatikan dalam pembuatan poster secara


umum,yaitu(a)headline(judul)dapatterbacajelaspadajarak6meter,mudah
untukdipahamidandiingat.(b)sub-headline(subjudul),(c)copy-writingharus
menjelaskanheadline,melengkapiheadline danmenjelaskansecarasingkat
tujuanposter,dan(d)logodanidentitas.Pembuatanposterjugamemerlukan
adanya Ilustrasi yang menarik baik dari segi warna, bentuk, format dan
desainilustrasisertaberhubunganeratdenganheadline,danterpadusecara
keseluruhan (Notoatmodjo,2012).
Sedangkan dalam pembuatan leaflet yang perlu diperhatikan antara lain
a. Penentuantargetyangakanditujudalampemberianleaflet;
b. Penentuantujuanyangdicapaipadaakhirketikatargetmembacaisi
leaflet;
c. Penentuanisimaterisecarasingkatyangakanditulisdalamleaflet;
d. Pengumpulan data dan ilustrasi tentang subjek yang akan
disampaikan;
e. Pembuatan garis-garis besar penyajian pesan, termasuk desain tulisan,
gambar,sertatataletakdidalamleaflet;
f. Penyusunandraftakhirkonsepleafletsebelumdilakukanujicoba;
g. Uji coba konsep pada kelompok sasaran yang memiliki kesamaan
karakteristik dengan kelompok sasaran utama. hal ini dilakukan untuk
memastikantingkatpemahamandarikelompokyangmenerimaisipesan
dalam leaflet;dan
h. Revisiisikonsepdanilustrasiyangdisesuaikandenganisidanhasiluji
cobayangdilakukansehinggaleafletakhirmenjadileafletyangaplikatif
untuk sasaranutama.

SYARAT-SYARAT PEMBUATAN MEDIA SEDERHANA


Notoatmodjo (2012) mengemukakan syarat pembuatan media sederhana
khususnya poster, antara lain
Bab 9 – Metode, Alat Bantu, danMediaPenyuluhan 75
Bab

10 Pendekatan Edukatif dalam


Peningkatan Derajat Kesehatan

FILOSOFI PENDEKATAN EDUKATIF


Peningkatankesadaran,kemauandankemampuanhidupsehatsecaramandiri
merupakancita-citadaripembangunankesehatanmasyarakat.Pembangunan
kesehatan ditandai dengan masyarakat mampu mengimplementasikan
perilaku serta hidup pada kondisi lingkungan yang terjamin kesehatannya.
Selainitu,masyarakatdapatmengaksesberbagaijenispelayanankesehatan
secaraadil,meratadanterjaminkualitasnyajugamenjadiatensidalamrangka
meningkatkanderajatkesehatanmasyarakat(Setiyabudi,2007).
Pembangunan kesehatan dapat dilakukan melalui kegiatan
pemberdayaanmasyarakat.Kegiatanpemberdayaandapatdiawalipada
skalarumahtanggamelaluiupayapreventif.Adapunbentukupayapreventif
yangdapatdiaplikasikanadalahpenerapanprogramperilakuhidupbersih
&sehat(PHBS)dalamskalarumahtangga.Diharapkanmasyarakatmampu
mencegahrisikoterjadinyapenyakit,memeliharakesehatan,danaktifterlibat
dalamgerakanmasyarakatsehat(Setiyabudi,2007).
Pemberdayaan dapat dilakukan melalui pendekatan edukatif kepada
masyarakat sebagai sasaran primer program. Advokasi kepada pemangku
kebijakan(stakeholdersebagaisasarantersier)perludilakukanagarprogram
yang akan diimplementasikan mendapatkan dukungan dari pihak
berpengaruh.Selainstakeholder,parapembuatopiniatautokohpentinglainnya
yangdiseganiolehmasyarakat(sasaransekunder)sebagaisocialsupporter
jugaikutdilibatkanuntukmemperkuatlisensipengimplementasianprogram
pemberdayaan kesehatan. Keterlibatan para tokoh penting diharapkan
dapat meningkatkan kepercayaan diri masyarakat (sasaran primer) agar
berpartisipasiaktifdalamgerakanpemberdayaan(Mubarakdkk.,2007).
Masyarakatsendiriyangpalingmenyadarimasalahkesehatanyang
sedangdihadapisehinggamerekamemilikihakdanpotensiuntukmemilah

77
masalahyangpalingurgensi,sertamenemukansolusiagarproblemkesehatan
tersebutdapatteratasi.Pendekatanedukatifdalampemberdayaanmasyarakat
dapatberperansebagaistimulanagarpotensiyangdimilikidapatdigunakan untuk
mengidentifikasi dan menangani masalah kesehatan secara mandiri
(Notoatmodjo,2012).

PENGEMBANGAN PROVIDER
Seluruhaparatbaikdaridepartemenkesehatanmaupunlembagaswadaya
masyarakat(LSM)berperansebagaiproviderdanmemilikiprogramyang
melibatkanmasyarakatsecaralangsung.Tujuanpengembanganprovider
adalahagaradanyakesamaanpengertianantarsektorbahwamasyarakat
bukanobjektetapisubjekpembangunandankerjasamaantarsektor
terkoordinasidenganbaik.
Faktor-faktor yang memengaruhi terciptanya kerja sama antar sektor
adalah keterbukaan, adanya wadah antar sektor, saling menunjang,
menghormati kewenangan sektor lain, tujuan dan peran jelas, kepuasaan
masing-masing sektor, dan perencanaan yang terpadu. Tahapan
pengembangan provider di antaranya sebagai berikut.
a) Melakukan lobbying dan advokasi kepada pemangku kebijakan
(stakeholder)
Pendekatandimulaidaristakeholdertingkatpusatkemudiankebawah.
Strategiadvokasidimaksudkanagarmemperolehdukunganpolitis,
kemudiandi-inputdalamagendakebijakanhinggamenjelmamenjadi
bentuk peraturan pada level regional maupun nasional. Bentuk
pendekatanyangdapatdilakukandengancara
1) Formalmelaluisuratresmi;
2) Melakukan diskusi tatap muka antara provider dan tokoh
masyarakat;
3) Melakukankunjunganlangsungkerumahuntukmenjelaskantujuan
pengumpulandata;
4) Mengadakansuatupertemuanuntukmerumuskankebijakanatau
solusipemecahanmasalahmelaluiprosesperencanaan,pelaksanaan,
pemantauan,hinggaevaluasi;dan
5) Menciptakanhubungansosialdenganikutberpartisipasidalam
kegiatanmasyarakatsepertiperkawinan,upacaraagama,kerjabakti,
dansebagainya.
78 PromosiKesehatan
b) Melakukanpendekatankepadapihakpelaksanapadatingkatadministrasi
hinggatingkatdesa.Halinidilakukanagarpihakpelaksanadanprovider
memilikisatupemahamanyangsama,salingmendukungdanmerancang
kebijakan,sertapolapengimplementasianprogrampemberdayaan
masyarakat(pendekatanedukatif)secaramakro.Pendekatandapat
dilakukanmelalui
1) Kegiatanseminar;
2) Kegiatan lokakarya;dan
3) Pertemuantingkatdesa.

Pendekatantingkatdesadilakukanolehpihakpuskesmassertasektorlain
yangsalingbermitradalammewujudkanprogrampemberdayaankesehatan
masyarakat(pendekatanedukatif).Padatingkatdesa,pendekatanyangdapat
dilakukandijelaskansebagaiberikut.

a. Mengadakan pertemuan khusus untuk mendiskusikanpendekatan


edukatif.
b. Diskusipendekatanedukatifmelaluiagendapertemuanrutinmasyarakat,
sepertirembukdesabersamapimpinandesadanjajarannya,para
pengurusLembagaKetahananMasyarakatDesa(LKMD)sertapara
pemangkukepentinganlainnya.
c. Melakukanpengumpulaninformasisebagailangkahanalisissituasidan
masalahberdasarkandatadaripetugaskecamatan/tingkatdesa/provider.
Informasiyangperludikumpulkandiantaranyadataumumdankhusus
serta perilakumasyarakat.
1) Dataumum:kondisigeografisdaerah,karakteristikdemografi
pendudukdanstrukturorganisasipemukamasyarakatsetempat.
2) Datakhusus:kondisidansituasisektorpertanian,kesehatan,dan
lainnya
3) Perilakumasyarakatyangberhubungandenganmasalahyangsedang
terjadi.
d. Melakukanpengembanganmasyarakat
Adanyaberbagaipotensisumberdayapadasuatudesaperludikembangkan
agarmasyarakatmaudanmampumendeteksisertamengatasimasalah
kesehatansecaramandiri.Masyarakatperluterlibataktifdaritahapan
menentukanpermasalahan,merumuskanalternatif,melaksanakan
danmengevaluasiupayapemecahanmasalahyangdilakukansampai
Bab 10 – Pendekatan Edukatif dalam PeningkatanDerajatKesehatan 79
Bab

11 Promosi Kesehatan pada


Berbagai Setting

Snelling (2014) menguraikan beberapa informasi terkait promosi


kesehatan yang dilakukan pada berbagai situasi/tempat/setting.

KOMUNITAS
Komunitasberfungsisebagaitempatyangsangatbaikuntukmempromosikan
kesehatan. Strategi dan program yang dapat dikembangkan adalah

a. Pendidikan kesehatan melalui pameran dan seminar kesehatan


masyarakat’
b. Kesempatanbaruuntukmelakukanaktivitasfisikmelaluijalansehatdan fun
run, kawasan ruang hijau yang diperluas, jalur sepeda, dan trotoar
untukpejalankakiyanglebihlayakdigunakan;dan
c. Aksesyanglebihmudahuntukmendapatkanmakanansehatyang
ditanamdikebunmasyarakatataudijualdipasarolehpetanisetempat.

PUSAT PENDIDIKAN UNTUK ANAK USIA DINI (PAUD)


Pusatpendidikanuntukanakusiadinijugadapatmenawarkankesempatan
bagusdalamhalmemberikanmodeldankesempatanuntukmelakukan
berbagaikegiatanyangmenyehatkansehinggamenghasilkankebiasaan
hiduppositif.Karakteristikprogramanakusiadinipadakomponenpromosi
kesehatanmeliputi:

a. Validasistatuskesehatananaksaatinisebelummemasukiprogram
termasukriwayatkesehatandanimunisasiyangtepat;
b. Kepemimpinandarianggotastafyangmengajardanmemberikancontoh
perilakukesehatanpositiftermasukkebersihandankeamananyang
tepat;

83
c. Kesempatan bermain dengan melakukan aktivitas fisik yang tertanam
dalampengalamanprogramanakusiadini;
d. Menyajikanmakanansehat;dan
e. kesempatanuntukpemeriksaankesehatantermasukpenilaianterhadap
Kesehatanpenglihatandanpendengaran.

SEKOLAH
Penggunaansettingsekolahdasar,menengahdantinggisecarapositif
memengaruhikebiasaankesehatandankesuksesanmasadepanyangluar
biasabagisiswa,sertaguru,anggotamasyarakatsekolah.Perkembangan
awalperilakukesehatanyangpositifakanmengarahkanpadakesehatan
dankesejahteraanyanglebihbaiksehinggamemberikankeuntunganbagi
pelajardalambanyakhaltermasukkemampuanmerekauntukbelajardan
berprestasisecaraakademis(Chomitz,Slining,McGowan,Mitchell,Dawson,
&Hacker,2009).Karakteristikprogrampromosikesehatanberbasisafektif
meliputi:

a. Dukungandarikepalasekolahdandewanpengurusyangberkomitmen
terhadapkesehatan,pendidikandanpembangunanmasing-masinganak
melaluipengembangankebijakankesehatandankesejahteraan,struktur
kurikulum,dandanaprogrambeasiswa;
b. Bimbingandandukungandariparagurusaatmengajardanmemperkuat
kebiasaankesehatanpositifsepanjangharidisekolah;
c. Menerapkanprogrampendidikanjasmaniprogresifyangmengajarkan
keterampilankebugarandanistirahatyangcukup;
d. Menyediakanmakanansehatdikafetariasekolah;
e. Keterlibatanaktifolehperawatsekolahatautimperawatankesehatan
untukmemastikanbahwaanaktelahmelakukanpemeriksaanyang
sesuaidantelahdiidentifikasiuntukditindaklanjutiberdasarkanriwayat
kesehatanatauhasiltesfisikmereka;dan
f. Penggunaanbangunansekolahdanwaktusetelahjamsekolahselesai/
libursekolah(malamharidanakhirpekan)untukmendukungprogram
ekstrakurikuler,seperti,olahraga,rekreasi,dansebagainya.
84 PromosiKesehatan
PERGURUAN TINGGI
Siswayangmasukperguruantinggiatauuniversitasmenghadapibanyak
peluang baru termasuk keputusan tentang kesehatan pribadimereka,
dan pihak perguruan tinggi menyadari tanggung jawab mereka dan
kesempatanuntukmembimbingsiswamenujupilihangayahidupyang
positif.Karakteristikpromosikesehatankomprehensifberbasiskualitasdi
lingkunganperguruantinggimeliputi

a. Komitmen dari pihak perguruan tinggi untuk mengembangkan,


mendanai,melaksanakandanmengevaluasiprogramdanlayanan
promosikesehatan;
b. Adanyakerjasamadarisemuaaspekkehidupankampustermasuk
pusatkesehatansiswa,ruangmakan,klubdankegiatan,danolahraga
sertarekreasidalammengembangkanpendekatankolaboratifuntuk
memperbaikidanmendukungkebiasaansehatdilingkunganperguruan
tinggi;dan
c. Pengembangankampusuntukmendorongaktivitasfisikmelaluifasilitas
rekreasi,olahraga,trotoaryangaman,jalursepeda,dansebagainya.

TEMPATKERJA
Karakteristik promosi kesehatan di tempat kerja meliputi

a) Dukunganterusmenerusdaripimpinanorganisasi,termasukidentifikasi
kesehatan karyawan sebagai prioritas dan adanya alokasi dana, ruang,
dansumberdayalainnyauntukmenjalankanprogrampromosikesehatan
yangefektif;
b) Penciptaanbudayakesehatanyangmempromosikankesehatanyangdapat
meminimalkanrisikokesehatanditempatkerja(pencegahankecelakaan
industrial,perlindunganterhadappaparanlingkungankerjadanmateri
yangtidaksehat,peluanguntukistirahat,dansebagainya);
c) Kesempatanuntukberpartisipasidalamprogramdankegiatanyang
efektifsepertiolahraga,konselinggizi,penghentianmerokok,manajemen
stres,danpencegahancederapunggungbawah;
d) Sistempenilaiankesehatantermasukpanduankesehatanolehpelatih
kesehatanuntukmemastikanprogramyangditargetkanhasilnyadapat
diukuruntukmengecekstatuskesehatan;
Bab 11 – Promosi Kesehatan padaBerbagaiSetting 85
Soal Latihan

PETUNJUK MENGERJAKAN SOAL

I. BagianI
– Pilihlah satu jawaban pertanyaan yang paling tepat atau saudara
anggapbenardenganmemberikantandasilang(x)

II. BagianII
A = jika jawaban 1, 2 dan 3 benar
B = jika jawaban 1 dan 3 benar
C = jika jawaban 2 dan 4 benar
D = jika jawaban 4 saja benar
E = jika jawaban semua benar/salah

BAGIAN I

1. Sehatbagiseseorangberartisuatukeadaanyangnormal,wajar,nyaman,
dandapatmelakukanaktivitassehari-haridengangairah.Sedangkan
sakitdianggapsebagaisuatukeadaanbadanyangkurangmenyenangkan,
bahkandirasakansebagaisiksaansehinggamenyebabkanseseorang
tidakdapatmenjalankanaktivitassehari-harisepertihalnyaorangyang
sehat.
Hal tersebut merupakan nilai sehat berdasarkan...
a. MasyarakatTradisional
b. MasyarakatModern
c. Masyarakatperkotaan
d. MasyarakatPedesaan
88
2. Masyarakatbiasanyabaruakanberobatkepetugaskesehatankalau
penyakitnyatidaksembuhdenganpengobatansendiri(beliobatdi
warung)kemudianpenyakitbertambahparah.
Berdasarkankasustersebut,masyarakatdalammelakukanpengobatan
penyakit.Mempunyaikeyakinanutamadalamperubahanperilaku
kesehatanadalah…
a. Keyakinantentangkerentanankitaterhadapkeadaansakit
b. Keyakinantentangkeseriusanataukeganasanpenyakit
c. Keyakinantentangkemungkinanbiaya
d. Keyakinantentangefektivitastindakandenganadanyatindakan
alternatif

3. Masyarakatbiasanyabaruakanberobatkepetugaskesehatankalau
penyakitnyatidaksembuhdenganpengobatansendiri(beliobatdi
warung)danpenyakitbertambahparah.
Berdasarkankasusdiatas,masyarakatdalammelakukanpengobatan
menggunakanmodelperubahanperilakukesehatan…
a. Model KeyakinanSehat
b. ModelMekanik
c. Model PengambilanKeputusan
d. ModelKepercayaan

4. Pipiet (bukan nama sebenarnya) masih berusia 32 tahun dan sedang


mengandung anak kedua, ketika ia mendengar kabar suaminya telah
mengidapAIDScukupparah.DengananjurandokterdiRSUWamena
Papua, Pipiet turut menjalani tes HIV dan mendapati bahwa ia pun
telah terinfeksi HIV. Dokter segera memberinya obat yang dibutuhkan
selama kehamilannya, dan ia melahirkan anaknya lewat operasi Cesar.
Suaminyameninggalbeberapabulansetelahiamelahirkan,namunbayi laki-
lakinya telah dinyatakan bebas HIV ketika menjalani pemeriksaan
padausia19bulan.Pipietsekarangtinggaldisebuahshelteruntukorang
yanghidupdenganHIVdanAIDSselamamenjalaniperawatan.Kepala
DinasKesehatanKabupatenJayawijayamengatakanbahwadari800ibu
hamil yang melakukan tes HIV di Puskesmas dan rumah sakit umum
tahunini,palingtidak45dinyatakanpositif(atau6persendarijumlah
yangdites).
SoalLatihan 89
Berkacapadakasusdiatas,Puskesmasdanrumahsakityangditunjuk
diharuskanmemberikanlayanankonselingdantesHIVsukarelakepada
ibuhamilyangdatanguntukpemeriksaanantenatal.Programini
merupakanpendekatanpromosikesehatanyangberbentuk….
a. Preventiveapproach
b. Behavioralchange
c. Educational
d. Empowerment
e. Socialchange

5. Kampanyemelaluimediamassa,termasukmelaluisosialmedia,mengenai
dorongan terhadap para suami atau calon suami yang memiliki risiko
tinggiterinfeksiHIVuntukmelakukantesHIVdanadalahmerupakan
pendekatanpromosikesehatanyangberbentuk…
a. Preventiveapproach
b. Behavioralchange
c. Educational
d. Empowerment
e. Socialchange

6. Programpeningkatankapasitasdalambentukpendidikanketerampilan
untukperawatananakdenganHIV,pengelolaankasusHIV,pemberian
dukungansebaya,danpelatihankewirausahaanbagiparaiburumah
tangga yang hidup dengan HIV adalah promosi kesehatan yang
berbentuk…
a. Preventiveapproach
b. Behavioralchange
c. Educational
d. Empowerment
e. Socialchange

7. Masihdarikasusdiatas,seorangbidanpuskeSmasmengungkapkan
bahwamasihbanyakibuhamilyangtakutuntuktesHIVkarenakhawatir
suamimerekaakanmarahjikatahumerekapositifHIV.Padahalhasil
teshanyabolehdiberikankepadasiibuhamilsehinggakerahasiaannya
90 PromosiKesehatan
Daftar Pustaka

Ajzen, I. 1985. From intentions to actions: A theory of planned behavior. Dalam


Action-control: From cognition to behavior. Disunting oleh J. Kuhl & J.
Beckman. Heidelberg, Germany:Springer.
Amalia, F. 2015. Kegunaan psikologi dalam kesehatan masyarakat. Artikel Publikasi.
Padang: UniversitasAndalas.
Arali.2000.Perubahanperilakudanprosesperubahannya.Diaksesdarihttp//
arali2008.files.wordpress.com/2008/08/perubahan-perilaku-dan-proses
perubahannya.pdf
Bandura, A. 1986. Social foundations of thought and action: A social cognitive theory.
Englewood SLiffs, NJ: Prentice-Hall.
Bandura,A.2004.Healthpromotionbysocialcognitivemeans.HealthEducation and
Behavior, 31(2):143–164.
Bloom, B. 1908. Psikologi pendidikan. Jakarta: Pustaka Belajar.
Chomitz,V.R.,Slining,M.M.,McGowan,R.J.,Mitchell,S.E.,Dawson,G.F.& Hacker,
K.A. 2009. Is there a relationship between physical fitness and
academic achievement? positive results from public school children in
theNortheastUnitedStates.JournalofSchoolHealth,79:30–37.
Cottrell,R.,Girvan,J.T.&McKenzie,J.2011.Principlesandfoundationsofhealth
promotion and education. 5th edition. Upper Saddle River, NJ:Benjamin
Cummings.
Departemen Kesehatan RI. 2002. Pedoman penanggulangan TB. Cetakan ke-8.
Jakarta: DepkesRI.
DiClemente,C.C.,Schlundt,D.&Gemmell,L.2004.ReadinessandStagesof Change
in Addiction treatment. American Journal on Addictions, 13(2): 103–119.
Djekky,R.D.2002Penerapanilmuantropologikesehatandalampembangunan
kesehatanmasyarakatPapua.JurnalAntropologiPapua,1(1).

109
Djamarah,S.B.2002.Psikologibelajar;Gurudananakdidikdalaminteraksiedukatif suatu
pendekatan teoretis psikologis. Jakarta: RinekaCipta.
Effendy N. 2003 Dasar-dasar keperawatan kesehatan masyarakat. Edisi. ke-2.
Jakarta: EGC.
Fitriani, S. 2011. Promosi kesehatan. Yogyakarta: Graha Ilmu.
Glanz,K.,Rimer,B.K.&Viswanath,K.2008.Healthbehaviorandhealtheducation:
theory,researchandpractice.4thedition.SanFransisco:JosseyBass.
Green,L.1980.Healtheducationplanningdiagnosticapproach.Baltimore:Mayfield
PublishingCo.
GreenJ.,TonesK.,Cross,R.&Woodall,J.2015.Healthpromotion:planning&
strategies.3rdedition.London:SAGEPublicationsLtd.
Guswar.2009.BagaimanaMembuatMediaPromosiKesehatan(FieldBook).Diakses
dari:www.new.pamsimas.org.
Horton,P.B.&Chester,L.H.1993.Sosiologi.DiterjemahkandaribahasaInggris
oleh. Aminuddin Ram dan Tita Sobari, Jakarta: Penerbit Erlangga.
(Karyadalambahasaasliditerbitkanpada1984).
Joyomartono, M. 2011. Pengantar antropologi kesehatan. Semarang: UNNES
PRESS.
KeputusanMenteriKesehatanNomor1114/MENKES/SK/VII/2005tentang
PedomanPelaksanaanPromosiKesehatandiDaerah
Koentjaraningrat.1987.Sejarahteoriantropologi.Jilid1.Jakarta:Universitas
IndonesiaPress.
Kusumawardani, E. 2012. Pengaruh penyuluhan kesehatan terhadap tingkat
pengetahuan,sikapdanpraktikibudalampencegahandemamberdarahdengue
padaanak.KaryaTulisIlmiah.UniversitasDiponegoro.
Mubarak, W.I., Chayatin, N., Rozikin, K. & Supradi. 2007. Promosi kesehatan
sebuah pengantar proses belajar mengajar dalam pendidikan. Yogyakarta:
Graha Ilmu.
Notoatmodjo, S. 2003a. Ilmu kesehatan masyarakat (prinsip-prinsip dasar). Jakarta:
Rineka Cipta.
Notoatmodjo, S. 2003b. Pendidikan dan perilaku kesehatan. Jakarta: Rineka
Cipta.
Notoatmodjo, S. 2003c. Prinsip-prinsip dasar ilmu kesehatan masyarakat. Jakarta:
Rineka Cipta.
Notoatmodjo,S.2012.Promosikesehatandanperilakukesehatan.Jakarta:Rineka
Cipta.
110 PromosiKesehatan
Notoatmodjo, S. 2005. Promosi kesehatan teori dan aplikasi. Jakarta: Rineka
Cipta.
Notoatmodjo, S. 2010. Promosi kesehatan. Jakarta: Rineka Cipta.
Notoatmodjo, S. 2007. Promosi kesehatan dan ilmu perilaku. Jakarta: Rineka
Cipta.
Nova,M.2014.Bukuajarsosiologi&antropologikesehatan.Yogyakarta:Nuha
MedikaYogyakarta.
Purwanto, H. 1999. Pengantar perilaku manusia untuk keperawatan. Jakarta:
Penerbit Buku Kedokteran EGC.
Sarwono,S.1993.Sosiologikesehatan,beberapakonsepbesertaaplikasinya.Jakarta:
GajahMadaUniversityPress.
SetiawatidanDarmawan.2008.Prosespembelajarandalampendidikankesehatan.
Jakarta: Trans Info Media.
Setiyabudi, R. 2007. Pengantar Gizi Masyarakat. Jurnal Gizi. Diakses dari:
http://lib.ui.ac.id//2015-09/S52584.
Skinner. 1983. Ilmu kesehatan masyarakat. Jakarta: Rineka Cipta.
Smith, C. 2000. Healthy prisons: A contradiction in terms? Howard Journal of
Criminal Justice,39: 339–353.
Snelling,A.2014.Introduction tohealth promotion.1stedition.UnitedStatesof
America:Jossey-BassAWileyBrand.
Suliha, U., Herawani., Suiatai. & Resnayati, Y. 2001. Pendidikan kesehatan
dalam keperawatan. Jakarta: EGC.
Undang-Undang Kesehatan RI No. 36 Tahun 2009.
Whitehead, D. 2006. The Health Promoting Prison (HPP) and Its Imperative
for Nursing. International Journal of Nursing Studies, 43:123–131.
InternationalConferenceonHealthPromotion.1986.OttawaCharterforHealth
Promotion. Makalah prosiding The 1st International Conferenceon
Health Promotion yang diselenggarakan di Ottawa. Diadakan oleh
WHORegionalOfficeforEurope.Ottawa:WHORegionalOfficefor
Europe.
WHO.2017.ShanghaiDeclarationonpromotinghealthinthe2030Agenda for
Sustainable Development. Ninth Global Conference on Health
Promotion,Shanghai,21–24November2016.DiadakanolehWorld
HealthOrganization.Shanghai:WHO.
Daftar Pustaka
111
Woodall,J.2015.ControlandChoiceinThreeCategory-CEnglishPrison:
ImplicationsforTheConceptandPracticeofTheHealthPromoting
Prison.PhDthesis,LeedsMetropolitanUniversity,Leeds.
Zain,A.&Syaiful,B.D.2002.Strategibelajarmengajar.Jakarta:RinekaCipta.
Zulkarnain,E.R.,Leersia,Y.&Farida,N.2011.Perbedaanefektivitasantarametode
penyuluhan dengan flipchart dan menggunakan VCD dalam meningkatkan
pengetahuan dan sikap ibu hamil terhadap inisiasi menyusui dini. Seminar
Nasional Jampersal di Universitas Jember.
112 PromosiKesehatan