Anda di halaman 1dari 174

PENINGKATAN HASIL BELAJAR BAHASA INDONESIA

MATERI MENEMUKAN IDE POKOK PARAGRAF MELALUI


MODEL CIRC (COOPERATIVE INTEGRATED READING AND
COMPOSITION)
PADA SISWA KELAS V SDN SRONDOL KULON 01
KECAMATAN BANYUMANIK KOTA SEMARANG
TAHUN PELAJARAN 2018/2019

SKRIPSI

DisusunGunaMemperolehGelar

SarjanaPendidikan

TRI INDAH TELOGOWATI

115-14-045

PROGRAM STUDI PENDIDIKAN GURU MADRASAH IBTIDAIYAH

FAKULTAS TARBIYAH DAN ILMU KEGURUAN

INSTITUT AGAMA ISLAM NEGERI

SALATIGA

2018

i
PERSETUJUAN PEMBIMBNG

Setelah dikoreksi dan diperbaiki, maka skripsi saudara :

Nama : Tri Indah Telogowati

NIM : 115-14-045

Fakultas : Tarbiyah dan Ilmu Keguruan

Prodi : Pendidikan Guru Madrasah Ibtidaiyah (PGMI)

Judul :”PENINGKATAN HASIL BELAJAR BAHASA INDONESIA


MATERI MENEMUKAN IDE POKOK PARAGRAF
DENGAN MENGGUNAKAN MODEL CIRC
(COOPERATIVE INTEGRETED READING AND
COMPOSITION) PADA SISWA KELAS V SDN SRONDOL
KULON KECAMATAN BANYUMANIK KOTA
SEMARANG TAHUN PELAJARAN 2018/2019”

Telah kami setujui untuk dimunaqosahkan.

Salatiga, 13 September 2018

Dosen Pembimbing

Dr. Wahyudhiana ,M.M.Pd


NIP.19550320 198203 100
PERNYATAAN KEASLIAN TULISAN

Saya yang bertanda tangan dibawah ini :

Nama : Tri Indah Telogowati

NIM : 115-14-045

Jurusan : Pendidikan Guru Madrasah

Ibtidaiyah Fakultas : Tarbiyah dan IlmuKeguruan

Menyatakan bahwa skripsi yang saya tulis ini benar- benar merupakan hasil karya

saya sendiri, bukan jiplakan hasil karya orang lain, pendapat atau temuan orang

lain yang terdapat dalam skrpisi ini dikutip dan dirujuk berdasarkan kode etik

ilmiah. Skripsi ini diperkenankan dipublikasikan pada e-repository IAIN

SALATIGA.
KEMENTERIAN AGAMA
INSTITUT AGAMA ISLAM NEGERI SALATIGA
LEMBAGA PENELITIAN DAN PENGABDIAN KEPADA MASYARAKAT
Website : www.iainsalatiga.ac.id., E-
mail: lp2miainsalatiga@gmail.com

SKRIPSI
’’PENINGKATAN HASIL BELAJAR BAHASA INDONESIA
MATERI MENEMUKAN IDE POKOK PARAGRAF MELALUI
MODEL CIRC (COOPERATIVE INTEGRATED READING AND COMPOSITION)
PADA SISWA KELAS V SDN SRONDOL KULON 01
KECAMATAN BANYUMANIK KOTA SEMARANG
TAHUN PELAJARAN 2018/2019’’

DisusunOleh

TRI INDAH TELOGOWATI


NIM: 11514045

Telah dipertahankan didepan Panitia Dewan Penguji Skripsi Jurusan Pendidikan


Guru Madrasah Ibtidaiyah. Fakultas Tarbiyah dan Ilmu Keguruan Institut Agama
Islam Negeri (IAIN) Salatiga, pada 2 Oktober 2018 dan telah dinyatakan
memenuhi syarat guna memperoleh gelar Sarjana Pendidikan.
MOTTO

“Kesuksesan Tidak Akan Mampu Kita Raih Tanpa Adanya Perjuangan”


PERSEMBAHAN

Kupersembahkan skripsi ini untuk :

1. Ibuku yang telah membimbing, mendidik dan memotivasiku untuk

terus belajar, terima kasih atas do’a dan kasih sayangnya. Alm. Ayahku

yang telah menginspirasiku untuk menjadi anak yang berbakti dan

membaggakan.

2. Suamiku tercinta yang mendukung, mendoakan dan memotivasiku

dalam menyelesaikan skripsi ini.

3. Kakak- kakak dan adekku yang telah memotivasiku agar

terselesaikan skripsi ini. Terima kasih atas dukungannya.

4. Calon buah hatiku yang selalu menginspirasi untuk segera

menyelesaikan skripsi ini.

5. Sahabat- sahabatku Khafidhotul Laila dan Catur Nila Ratna Sari

yang telah meluangkan waktunya untuk membantu dan menemani

penulis menyusun skripsi ini.

6. Teman- teman seperjuangan PGMI yang telah banyak membantu.


KATA PENGANTAR

Bismillahirohmanirrohim

Alhamdulillah puji syukur kehadirat Allah SWT yang senantiasa

melimpahkan rahmat dan hidayahnya sehingga peneliti dapat menyelesaikan

skripsi ini guna memenuhi syarat meraih gelar Sarjana Pendidikan (S.Pd) di

Fakultas Tarbiyah dan Ilmu Keguruan Jurusan Pendidikan Guru Madrasah

Ibtidaiyah (PGMI) di IAIN Salatiga dengan judul’’Peningkatan Hasil Belajar

Bahasa Indonesia Materi Menemukan Ide Pokok Paragraf Melalui Model

CIRC (Cooperative Integrated Reading And Composition) Pada SiswaKelas V

SDN Srondol Kulon 01 Kecamatan Banyumanik Kota Semarang Tahun

Pelajaran 2018/2019’’

Peneliti menyadari bahwa sebagai manusia tidak lepas dari kesalahan.Hal

ini menyadarkan peneliti bahwa tanpa bantuan dari berbagai pihak skripsi ini

mungkin tidak terselesaikan dengan baik. Pada kesempatan ini penulis

menyampaikan terimakasih kepada :

1. Bapak Dr. Rahmat Hariyadi, M. Pd. selaku Rektor Institut Agama

Islam Negeri (IAIN) Salatiga

2. Bapak Suwardi, M. Pd. selaku Dekan Fakultas Tarbiyah dan Ilmu

Keguruan

3. Ibu Peni Susapti, M. Si. Selaku Ketua Jurusan Pendidikan Guru

Madrasah Ibtidaiyah (PGMI) .


4. Bapak Dr. Wahyudhiana, M.M. Pd. Selaku pembimbing yang telah

memberikan bimbingan kepada peneliti, sehingga peneliti dapat

menyelesaikan skripsi ini.

5. Bapak dan ibu dosen yang telah memberikan ilmu pengetahuannya

kepada peneliti.

6. Ibu Kurniawati, S. Pd. selaku Kepala Sekolah SDN Srondol Kulon 01

Semarang, ibu Nur Irianah, S. Pd. selaku guru kelas V, beserta semua

dewan guru SDN Srondol Kulon 01 Semarang yang telah membantu

peneliti menyelesaikan skripsi.

7. Ibuku tercinta serta saudaraku tersayang yang telah memberikan

motivasi dan dorongan untuk menyelesaikan skripsi.

8. Suamiku tercinta yang telah memberikan do’a bahkan dukungannya

dan calon buah hatiku yang telah memotivasi, terselesaikannya skripsi

ini.

9. Sahabat- sahabatku yang selalu memberikan motivasi, dan

dukungannya. Dan semua pihak yang telah membantu terselesaikannya

skripsi ini.

Semoga Allah SWT selalu melimpahkan rahmat- Nya kepada kita semua dan

semoga skripsi ini bermanfaat bagi peneliti dan bagi semuanya. Amin

Salatiga, September 2018

Tri Indah Telogowati


ABSTRAK

Telogowati, Tri Indah,2018. ’’PeningkatanHasilBelajar Bahasa Indonesia


Materi Menemukan Ide Pokok Paragraf Melalui Model CIRC (Cooperative
Integrated Reading And Composition) Pada Siswa Kelas V SDN Srondol Kulon
01 Kecamatan Banyumanik Kota Semarang Tahun Pelajaran 2018/2019’’.
Fakultas Tarbiyah dan Ilmu Keguruan. Jurusan Pendidikan Guru Madrasah
Ibtidaiyah.Institut Agama Islam Negeri Salatiga. Dosen Pembimbing Dr.
Wahyudhiana, M.M. Pd.

Kata Kunci: Hasil Belajar, Bahasa Indonesia, Model CIRC (Cooperative


Integrated Reading And Composition).

Penelitian ini bertujuan untuk meningkatkan kemampuan mencari ide


pokok paragraph pada siswa kelas V. Penelitian ini adalah Penelitian Tindakan
Kelas (PTK) yang dilaksanakan melalui 2 siklus dengan tahapan perencanaan,
pelaksanaan, observasi, refleksi. Berdasarkan hasil observasi dilapangan
kemampuan siswa dalam menemukan ide pokok paragraph masih rendah.
Sebagian besar guru belum menggunakan model pembelajaran yang
menyenangkan.
Keadaan tersebut berpotensi menimbulkan kejenuhan serta menurunkan
minat belajar siswa. Berdasarkan uraian diatas melalui penelitian ini diharapkan
mampu meningkatkan hasil belajar siswa dan meningkatkan kreativitas guru
dalam mengajar. Penelitian ini menggunakan model pembelajaran CIRC
(Cooperative Integrated Reading And Composition).
Penelitian ini dilaksanakan di SDN Srondol Kulon Kecamatan
Banyumanik Kota Semarang pada siswa kelas V dengan jumlah 30 siswa yang
terdiri dari 18 siswa laki- laki dan 12 siswa perempuan. Berdasarkan hasil
penelitian yang dilakukan dengan menggunakan model pembelajaran CIRC
terjadi peningkatan terhadap aktivitas dan hasil belajar siswa dalam menemukan
ide pokok paragraph selama proses pembelajaran berlangsung mulai dari siklus I
sampai dengan siklus
II. Hal ini dibuktikan, pada siklus I masih banyak siswa yang masih merasa
kebingungan dalam menemukan ide pokok paragraph diperoleh pada siklus I 17
siswa (90%) yang tuntas dan 13 siswa (10%) belum tuntas dengan nilai rata- rata
62,6. Siklus II meningkat menjadi 27(90%) siswa yang tuntas dan yang belum
tuntas 3 (10%) siswa dengan perolehan nilai rata- rata 74,6. Dari pelaksanaan
PTK siklus 1 dan siklus II dapat disimpulkan bahwa pembelajaran dengan
menggunakan model CIRC dapat meningkatkan hasil belajar dan aktivitas siswa
dalam mata pelajaran Bahasa Indonesia pada siswa kelas V SDN Srondol Kulon
01 Kecamatan Banyumanik Kota Semarang.
DAFTAR ISI

HALAMAN SAMPUL
LEMBAR LOGO IAIN
JUDUL....................................................................................................................i

PERSETUJUAN PEMBIMBING........................................................................ii
PERNYATAAN KEASLIAN TULISAN
iv
MOTTO
v
PERSEMBAHAN
vi
KATA PENGANTAR
vii
ABSTRAK
ix
DAFTAR ISI
x
DAFTAR TABEL
xiv
DAFTAR GAMBAR
xv
DAFTAR LAMPIRAN
xvi
BAB I PENDAHULUAN
A. Latar Belakang Masalah........................................................................1
B. Rumusan Masalah..................................................................................5
C. Tujuan Penelitian...................................................................................6
D. Kegunaan Penelitian..............................................................................6
E. Hipotesis Tindakan dan Indikator Keberhasilan....................................7
F. Metode Penelitian..................................................................................8
1. Rancangan Penelitian.......................................................................8
2. Lokasi, Waktu dan Subjek Penelitian..............................................9
3. Langkah- Langkah Penelitian
............................................................................................................
10
4. Teknik Pengumpulan Data
............................................................................................................
12
5. Instrumen Penelitian……………
............................................................................................................
13
6. Definisi Operasional
............................................................................................................
14
7. Analisis Data
............................................................................................................
17
G. Sistematika Penulisan
..................................................................................................................
17
BAB II KAJIAN PUSTAKA
A. Hasil Belajar
...................................................................................................................
19
1. Pengertian Hasil Belajar
...................................................................................................................
19
2. Prinsip- Prinsip Belajar
...................................................................................................................
20
3. Tujuan Belajar
...................................................................................................................
24
4. Faktor Yang Mempengaruhi Hasil Belajar
...................................................................................................................
28
B. Model CIRC
...................................................................................................................
29
1. Pengertian Model
...................................................................................................................
29
2. Model CIRC
...................................................................................................................
29
C. Bahasa Indonesia
...................................................................................................................
32
1. Pengertian Bahasa Indonesia
...................................................................................................................
32
2. Hakekat Pembelajaran Bahasa Indonesia di SD/MI
...................................................................................................................
33
3. Prinsip Pembelajaran Bahasa Indonesia
...................................................................................................................
34
D. Materi Menemukan Ide Pokok Paragraf
...................................................................................................................
35
1. Membaca
...................................................................................................................
35
2. Paragraf
...................................................................................................................
36
3. Menemukan Ide Pokok Pragraf
...................................................................................................................
37
E. Hubungan Model Pembelajaran CIRC dengan Bahasa Indonesia
...................................................................................................................
39
BAB III PELAKSANAAN PENELITIAN
A. Deskripsi Kondisi
..................................................................................................................
41
B. Deskripsi Pelaksanaan Siklus I
..................................................................................................................
42
1. Perencanaan Tindakan
............................................................................................................
44
2. Pelaksanaan Tindakan
............................................................................................................
45
3. Pengamatan dan Observasi
............................................................................................................
46
4. Refleksi
............................................................................................................
50
C. Deskripsi Siklus II
1. Perencanaan Tindakan
............................................................................................................
51
2. Pelaksanaan Tindakan
............................................................................................................
52
3. Pengamatan dan Observasi
............................................................................................................
54
4. Refleksi
............................................................................................................
58
BAB IV HASIL DAN PEMBAHASAN
A. Deskripsi Hasil Penelitian
..................................................................................................................
60
1. Deskripsi Pra Siklus
............................................................................................................
60
2. Deskripsi Data SiklusI
............................................................................................................
62
3. Deskripsi Data SiklusII
............................................................................................................
64
B. Pembahasan
..................................................................................................................
66
1. Siklus I
............................................................................................................
67
2. Siklus II
............................................................................................................
72
BAB V PENUTUP
A. Kesimpulan
..................................................................................................................
80
B. Saran
..................................................................................................................
81

DAFTAR PUSTAKA
LAMPIRAN- LAMPIRAN
DAFTAR RIWAYAT HIDUP
DAFTAR TABEL

Tabel 1.1 Nilai Ulangan Harian Bahasa Indonesia

....................................................................................................................................

Tabel3.1 Nilai Ulangan Harian Bahasa Indonesia

....................................................................................................................................

41

Tabel 3.2 Data Keadaan Siswa

....................................................................................................................................

42

Tabel 3.3 Lembar Observasi Guru Siklus I

....................................................................................................................................

46

Tabel 3.4 Lembar Pengamatan Kegiatan Pembelajaran Dengan Model CIRC

....................................................................................................................................

47

Tabel 3.5 Lembar Observasi Siswa Yang Tidak Aktif

....................................................................................................................................

48

Tabel 3.6 Nilai Evaluasi Siklus I

....................................................................................................................................

49
Tabel 3.7 Lembar Observasi Guru Siklus II

....................................................................................................................................

54

Tabel 3.8 Lembar Pengamatan Kegiatan Pembelajaran Dengan Model CIRC

....................................................................................................................................

55

Tabel 3.9 Lembar Observasi Siswa Siklus II

....................................................................................................................................

56

Tabel 3.10 Nilai Evaluasi Siklus II

....................................................................................................................................

57

Tabel 4.1 Nilai Ulangan Harian (PraSiklus

....................................................................................................................................

61

Tabel 4.2 Nilai Evaluasi Siklus I

....................................................................................................................................

62

Tabel 4.3 NilaiEvalusiSiklus II

....................................................................................................................................

64
Tabel 4.4 Hasil Rekapitulasi Nilai Siswa Per Siklus

....................................................................................................................................

66

Tabel 4.5 Lembar Observasi Guru Siklus I

....................................................................................................................................

68

Tabel 4.6 Lembar Observasi Guru Siklus I

....................................................................................................................................

73

Tabel 4.7 Rekapitulasi PraSiklus, Siklus I dan Siklus II

....................................................................................................................................

77

DAFTAR GAMBAR

Gambar4.1 PresentaseNilaiEvaluasiSiklus I

....................................................................................................................................

68

Gambar 4.2 PresentaseNilaiEvaluasiSiklus II

....................................................................................................................................

73
Gambar 4.3 Ketuntasan Hasil Belajar SiswaPraSiklus, Siklus I danSiklus II

....................................................................................................................................

78
DAFTAR LAMPIRAN

Lampiran 1 RPP Siklus I

Lampiran 2 RPP Siklus II

Lampiran 3 DaftarNilai Ulangan Harian (PraSiklus)

Lampiran 4 Lembar Observasi Aktivitas Guru Siklus I

Lampiran 5 Lembar Observasi Siswa Yang Tidak Aktif Siklus I

Lampiran 6 Lembar Pengamatan kegiatan Pembelajaran dengan Model CIRC

Siklus I

Lampiran 7 Lembar Observasi Aktivitas Guru Siklus II

Lampiran 8 Lembar Observasi Siswa Yang Tidak Aktif Siklus II

Lampiran 9 Lembar Pengamatan kegiatan Pembelajaran dengan Model CIRC


Siklus II
Lampiran 10 Dokumentasi

Lampiran 11 Profil SDN Srondol Kulon 01

Lampiran 12Surat Tugas Pembimbing Skripsi

Lampiran 13 Surat Ijin Penelitian

Lampiran 14 Surat Keterangan Melakukan Penelitian

Lampiran 15Lembar Konsultasi Skripsi

Lampiran 16 Daftar Nilai SKK

Lampiran 17 Daftar Riwayat Hidup


BAB I

PENDAHULUA

A. Latar Belakang

Bahasa Indonesia merupakan salah satu mata pelajaran dasar pada jenjang

pendidikan formal yang sangat penting.Setiap peserta didik diharuskan mampu

menguasai Bahasa Indonesia dengan baik.Selain mata pelajaran yang diikutkan

dalam ujian nasional, Bahasa Indonesia merupakan bahasa Nasional yang sering

digunakan dalam bahasa sehari- hari.Salah satu ketrampilan dasar yang harus

dikuasai oleh siswa adalah ketrampilan membaca.Karena dengan membaca siswa

mampu memahami ide pokok dalam suatu bacaan. Bahkan sesungguhnya Islam

pun telah mengajarkan masalah berhitung, yang tertera dalam Al- Qur’an surat

Al- Alaq ayat 1 :

Artinya : “ Bacalah dengan (menyebut) nama Rabbmu Yang menciptakan “.

Dengan memahami ayat yang terkandung dalam surat Al- Alaq ayat 1,

membaca merupakan kegiatan yang dianjurkan dalam agama islam. Membaca

bukan hanya sekedar teori semata, akan tetapi manusia dituntut untuk mampu

menerapkannya dalam kehidupan sehari- hari dengan benar dan memahami ide

pokok dalam suatu bacaan.

Pembelajaran Bahasa Indonesia Sekolah Dasar kajian teoritis kearah

implementasi pembelajaran Bahasa Indonesia sebagai alat pemahaman guru SD


1
dalam melaksanakan pembelajaran Bahasa Indonesia secara benar.

Pengembangan melalui pendidikan formal, dimulai dari Sekolah Dasar. Jenjang

sekolah ini berfungsi sebagai pusat budaya dan pembudayaan baca tulis (Zulela,

2012:1)

Proses belajar telah dimulai sejak kecil, pada umur 1,6 s.d 7 tahun. Masa

ini menurut Ph. A. Kohnstamm adalah masa estetik/ masa keindahan, anak

memandang dan mengamati dunia sekelilingnya dengan suatu keindahan. Ia asyik

tenggelam dan bermain, mendengar cerita yang sesuai dengan fantasinya, dan

mencoba mengenal benda- benda yang ada disekitarnya dan tertarik terhadap

benda- benda yang warna mencolok, aneh menurutnya, dan berusaha untuk

mengenalinya (Yamin, 2008: 122).

Dalam pembelajaran Bahasa Indonesia guru merupakan pihak yang

berhubungan langsung dengan peserta didik, sehingga dalam memberikan

evaluasi diharapkan lebih akurat, objektif, dan mengoptimalkan pembelajaran.

Dalam hal itu guru akan menemukan berbagai masalah, misalnya masalah

kepribadian guru, kecakapan mengajar yang meliputi ketepatan pemilihan metode,

pendekatan, motivasi, sampai penggunaan media yang menarik. Banyak guru

yang mengeluh akan rendahnya kemampuan peserta didik dalam menentukan ide

pokok paragraf. Hal ini terlihat dari banyaknya kesalahan peserta didik dalam

menentukan ide pokok paragraf sehingga mengakibatkan terjadinya kesalahan-

kesalahan dalam mengerjakan soal dan menjadikan rendahnya hasil belajar

peserta didik (skor) pada ulangan harian, ulangan semester, maupun ujian akhir

sekolah.

Sesuai hasil wawancara yang telah dilakukan peneliti dengan guru kelas V
SDN Srondol Kulon 01 Kecamatan Banyumanik Kota Semarang pada tanggal 23
Juli 2018 ditemukan beberapa masalah dalam pembelajaran Bahasa Indonesia

salah satunya kurangnya kemampuan siswa dalam memahami ide pokok suatu

paragrafyang telah dibaca. Sehingga kemampuan siswa dalam menentukan ide

pokok belum sesuai dengan yang diharapkan.Hal ini dibuktikan dengan hasil

ulangan siswa kelas V yang diperoleh dari guru menunjukkan masih banyaknya

siswa yang mendapatkan nilai dibawah KKM (Kriteria Ketuntasan Minimal) yang

telah ditetapkan yaitu 70. Secara klasikal nilai ulangan siswa belum memenuhi

KKM, dari 30 siswa hanya 11 siswa yang dapat memenuhi KKM sedangkan

sisanya masih berada dibawah KKM.

Tabel 1.1

Nilai Ulangan Bahasa Indonesia kelas V

No. Nama Siswa L/P Nilai Keterangan


1 Satriyo Bagus Prakoso L 60 Tidak Tuntas
2 Widya Atania Zulfa P 55 Tidak Tuntas
3 Permata Sari P 70 Tuntas
4 Ahnaf Fairus Rizqullah L 65 Tidak Tuntas
5 Al Azhar Kirana P 40 Tidak Tuntas
6 Diandra Amalia R. P 60 Tidak Tuntas
7 Farel Army W. L 40 Tidak Tuntas
8 Joyata Mazaya P 75 Tuntas
9 M. Ricky Maulana L 40 Tidak Tuntas
10 R. Dwi Kresna L 75 Tuntas
11 Risky Putra A. L 55 Tidak Tuntas
12 Tiandika Nanda P. L 65 Tidak Tuntas
13 Aditya Putra P. L 40 Tidak Tuntas
14 Almira Risandini P 70 Tuntas
15 Arkan Shalif S. L 45 Tidak Tuntas
16 Dewi Anggi A. P 35 Tidak Tuntas
17 Diva Septian H. L 70 Tuntas
18 Hilmiya Hazimah P 75 Tuntas
19 Laella Oktaviana S. P 55 Tidak Tuntas
20 M. Hafiz Saifullah L 50 Tidak Tuntas
21 Muhammad Khadaffi L 30 Tidak Tuntas
22 Raka Fernando L 60 Tuntas
23 Satriya Maulana L 55 Tidak Tuntas
24 Teguh Saputro Dwi U. L 75 Tuntas
25 Vannya Dwi Haddi P 75 Tuntas
26 Zahnuba Aulia R. P 80 Tuntas
27 Tegar Alief Nugroho L 70 Tuntas
28 Muhammad Farhan L 45 Tidak Tuntas
29 Shafira Nurhasanah S. P 40 Tidak Tuntas
30 Yoga Whisnu Pratama L 60 Tidak Tuntas

Menurut keterangan yang tertera pada tabel diatas dapat dilihat bahwa

peserta didik yang belum tuntas sebanyak 19 siswa sedangkan peserta didik yang

tuntas hanya 11 siswa. Keterangan tersebut didapat dari Bu Nur Irianah, S. Pd.

Selaku wali kelas V.

Berdasarkan diskusi yang telah dilakukan oleh guru kelas V SDN Srondol

Kulon 01, faktor yang mempengaruhi siswa masih mendapatkan nilai dibawah

KKM (Kriteria Ketuntasan Minimal), antara lain : Siswa kurang memperhatikan

saat pembelajaran berlangsung, kurangnya minat siswa dalam membaca.

Faktor lain yang mempengaruhi siswa mendapat nilai dibawah KKM

antara lain, kurangnya kreatifitas guru dalam mengajar sehingga siswa cenderung

pasif bahkan kurangnya minat siswa dalam membaca, kurangnya bimbingan guru

dalam mengarahkan siswa untuk memahami suatu paragraf. Dalam hal ini guru

dituntut memiliki kreatifitas dalam mengajar agar siswa merasa senang dan

tertarik untuk mengikuti pembelajaran .

Melihat beberapa faktor yang mempengaruhi rendahnya kebenaran siswa

dalam menemukan ide pokok paragraf, peneliti dan Bu Nur Irianah, S. Pd

melakukan diskusi mengenai model pembelajaran yang tepat dalam mengatasi

permasalahan tersebut, sehingga siswa dapat meningkatkan kemampuannya dalam


menemukan ide pokok paragraf dengan tepat dan mendapatkan nilai yang

mencapai KKM. Peneliti dan Bu Nur Irianah, S. Pd memutuskan untuk

menggunakan model pembelajaran CIRC(Cooperative Integrated Reading And

Composition) sebagai solusi untuk mengatasi permasalahan pembelajaran Bahasa

Indonesia di SDN Srondol Kulon 01 Kecamatan Banyumanik Kota Semarang.

Penerapan model pembelajaran CIRC diharapkan siswa mampu mengikuti

pembelajaran dengan antusias sehingga dapat meningkatkan kemampuan siswa

dalam memahami ide pokok dalam suatu paragraf .Selain itu diharapkan dapat

mengatasi kejenuhan siswa selama proses pembelajaran berlangsung sehingga

hasil belajar siswa meningkat.

Untuk itu dalam mengatasi masalah diatas penuluis mengangkat judul

‘’PENINGKATAN HASIL BELAJARBAHASA INDONESIA MATERI

MENEMUKAN IDE POKOK PARAGRAF MELALUI MODEL CIRC

(COOPERATIVE INTEGRATED READING AND COMPOSITION) PADA

SISWA KELAS V SDN SRONDOL KULON 01 KECAMATAN

BANYUMANIK KOTA SEMARANG TAHUN PELAJARAN 2018’’.

B. Rumusan Masalah

Dalam penelitian ini rumusan masalah yang akan dibahas adalah : Apakah

penggunaan Metode CIRC (Cooperative Integrated Reading And Composition)

dapat meningkatkan kemampuan siswa dalam menemukan ide pokok dalam

sebuah paragraf pada siswa kelas V SDN Srondol Kulon Kecamatan Banyumanik

Kota Semarang tahun pelajaran 2018?


C. Tujuan Penelitian

Adapun tujuan peneliti adalah untuk mengetahui apakah Metode CIRC

(Cooperative Integrated Reading And Composition) dapat meningkatkan

kemampuan siswa dalam menemukan ide pokok paragraf pada mata pelajaran

Bahasa Indonesia di SDN Srondol Kulon 01 Kecamatan Banyumanik Kota

Semarang.

D. Kegunaan Penelitian

Penelitian ini diharapkan memberi manfaat baik dari segi teoritis maupun

praktis yaitu:

1. Manfaat Teoritis

Hasil dari penelitian ini diharapkan dapat memberikan informasi

dalam dunia pendidikan berupa gambaran mengenai sebuah teori yang

menyatakan bahwa peningkatan hasil belajar Bahasa Indonesia pada

pemahaman ide pokok paragraf dengan menggunakan metode CIRC

terhadap siswa sekolah dasar sangat bermanfaat bagi siswa.

2. Manfaat Praktis

a) Bagi siswa

1) Meningkatkan hasil belajar siswa pada pelajaran Bahasa Indonesia.

2) Meningkatkan kemampuan siswa dalam menemukan ide pokok

paragraf.

b) Bagi guru
1) Guru dapat menganalisis terjadinya permasalahan pembelajaran

dan mampu mengatasinya.

2) Diperoleh strategi yang sesuai dengan pembelajaran.

c) Bagi lembaga

1) Dapat meningkatkan mutu pendidikan sekolah.

2) Menciptakan kondisi pembelajaran yang efektif dan menyenangkan.

d) Bagi peneliti

Dapat memberikan pengalaman kepada peneliti untuk terjun ke bidang

pendidikan.

E. Hipotesis Tindakan dan Indikator Keberhasilan

Hipotesis adalah jawaban sementara terhadap suatu permasalahan, sebagai

alternative tindakan yang dipandang paling tepat untuk memecahkan masalah

yang telah dipilih untuk diteliti melalui sebuah Penilitian Tindakan Kelas

(Mulyasa, 2011:63).

Dalam penelitian tindakan kelas ini penulis mengambil hipotesis tindakan

yaitu : “Penggunaan Metode CIRC (Cooperative Integrated Reading And

Composition) dapat meningkatkan kemampuan siswa dalam menentukan ide

pokok paragraf pada kelas V SDN Srondol Kulon 01Kecamatan Banyumanik

Kota Semarang.

Penerapan metode CIRCini dikatakan efektif apabila indikator yang

diharapkan tercapai. Adapun indikator yang dapat dirumuskan penulis sebagai

berikut :
a. Ada peningkatan hasil belajar berkelanjutan dari siklus pertama ke siklus

kedua.

b. Nilai siswa kelas V memenuhi Kriteria Ketuntasan Minimal (KKM)

sebesar 70serta tercapainya ketuntasan klasikal yang besarnya ≥ 85%

dalam pembelajaran Bahasa Indonesia.

F. Metode Penelitian

1. Rancangan Penelitian

Penelitian ini menggunakan Penelitian Tindakan Kelas

(PTK).Penlitian Tindakan Kelas adalah suatu bentuk kajian yang bersifat

reflektif oleh pelaku tindakan yang dilakukan untuk meningkatkan

kemantapan rasional dari tindakan yang dilakukan, serta memperbaiki

kondisi dimana praktik pembelajaran tersebut dilakukan (Mansur, 2012:

9). Penelitian Tindakan Kelas (PTK) sebagai upaya perbaikan suatu

praktik pendidikan berdasarkan refleksi dari pemberian tindakan pada

penelitian ini dengan memberikan suatu tindakan pada subjek yang diteliti

dengan menggunakan metode CIRC .Penelitian Tindakan Kelas yang

digunakan adalah jenis kolaboratif, dimana peneliti bertindak sebagai

pengamat. Proses belajar mengajar tetap dilakukan oleh guru dan siswa.

Hal ini bertujuan agar proses belajar mengajar berjalan secara alami

sehingga data yang diperoleh valid. Alasan peneliti mengggunakan

penelitian tindakan kelas kolaboratif karena peneliti ikut berperan dalam

proses

pembelajaran.
a. Perencanaan (Planning)

b. Tindakan (acting) danObservasi (Observation)

c. Refleksi (Reflecting)

Gambar 1.1 Siklus Penelitian

2. Lokasi, Waktu dan Subjek Penelitian

a. Lokasi Penelitian

Penelitian ini dilakukan di SDN Srondol Kulon 01 Kecamatan

Banyumanik Kota Semarang tahun 2018. Sekolah ini dipilih menjadi

tempat penelitian karena memerlukan pengembangan strategi

pembelajaran yang akan meningkatkan hasil kinerja guru dan siswa.

Dengan demikian tujuan pembelajaran dapat tercapai dengan optimal.

b. Waktu Penelitian
Penelitian tindakan kelas ini dilakukan dari bulan April- Juli

2018 di SDN Srondol Kulon Kecamatan Banyumanik Kota Semarang.

c. Subjek Penelitian

Dalam penelitian ini yang menjadi subjek penelitian adalah

guru dan siswa kelas V SDN Srondol Kulon 01 Kecamatan

Banyumanik Kota Semarang tahun 2018 dengan jumlah siswa 30 yaitu

18 siswa laki-laki dan 12 siswa perempuan. Penelitian ini dikhususkan

pada mata pelajaran Bahasa Indonesia materi mencari ide pokok

paragraf dengan menggunakan metodeCIRC.

3. Langkah-langkah Penelitian

a. Perencanaan

1) Membuat rencana pelaksanaan pembelajaran menggunakan metode

CIRC (Cooperative Integrated Reading And Composition)

2) Mempersiapkan fasilitas dan sarana pendukung yang diperlukan saat

proses pembelajaran berlangsung dengan menggunakan metode CIRC

3) Mempersiapkan lembar observasi guru untuk mengetahui

keterampilan guru dalam proses pembelajaran dengan menggunakan

metode CIRC

4) Perencanaan tindakan pembelajaran menggunakan metode CIRC

5) Menyiapkan instrument untuk menggali data hasil belajar siswa

berupa lembar tes.

6) Melakukan evaluasi terhadap pembelajaran menggunakan Metode

CIRC.

b. Pelaksanaan
Pelaksanaan tindakan hendaknya dituntun oleh rencana PTK yang

telah dibuat, tetapi perlu diingat bahwa tindakan itu tidak secara mutlak

dikendalikan oleh rencana, mengingat dinamika proses pembelajaran

dikelas menuntut penyesuaian atau adaptasi. Oleh karena itu, peneliti,

(guru) perlu bersikap fleksibel siap mengubah rencana tindakan sesuai

keadaan yang ada. Menerapkan tindakan juga harus mengacu pada

scenario pembelajaran yang telah direncanakan sebelumnya dan lembar

kerja siswa (Kunandar,2008: 97 ).

c. Observasi dan Pengamatan

Pengamatan dalam penelitian tindakan kelas merupakan

pengamatan yang dilakukan oleh peneliti. Pengamatan ini dilakukan

dengan cara mengamati guru pada proses pembelajaran dengan

menggunakan lembar observasi serta tes evaluasi untuk menggali data

hasil belajar siswa setelah dilakukan proses pembelajaran menggunakan

model CIRC.

d. Analisis atau Refleksi

Refleksi merupakan kegiatan analisis, interpretasi dan eksplanasi

terhadap semua informasi yang diperoleh dari observasi atas

pelaksanaan tindakan. Pada tahap refleksi meliputi: (1) mencatat hasil

observasi dan pelaksanaan pembelajaran, (2) evaluasi hasil observasi,

(3) analisis hasil pembelajaran.

4. Teknik Pengumpulan Data


Dalam penelitian tindakan kelas ini teknik yang akan digunakan

dalam pengumpulan data adalah:

a. Tes Tertulis

Teknik ini yangdigunakan peneliti untuk mengukur

ketuntasan dan peningkatan hasil belajar siswa terhadap materi

menemukan ide pokok paragraf yang diajarkan guru. Siswa

dikatakan telah mencapai tingkat penguasaan materi apabila telah

mencapai nilai minimal 70 dari target yang ditentukan. Tes ini

dilakukan setelah proses pembelajaran menggunakan model CIRC

berlangsung.

b. Observasi

Observasi merupakansuatu proses pengambilan informasi,

atau data melalui media pengamatan. Observasi ini dilakukan

terhadap peserta didik dan guru selama pembelajaran berlangsung

untuk mengetahui tingkat kelebihan dan kekurangan dalam

pembelajaran Bahasa Indonesia dengan menggunakan model

CIRC.

c. Dokumentasi

Peneliti menggunakan dokumentasi sebagai salah satu

teknik memperoleh data yang berupa foto. Dokumentasi ini

dilakukan pada saat proses pembelajran berlangsung, sehingga

aktivitas siswa dan guru selama pembelajaran Bahasa Indonesia


dengan model CIRC
dapat diabadikan. Dokumentasi foto dilakukan sebagai bukti visual

kegiatan pembelajaran selama penelitian berlangsung.Foto tersebut

merupakan sumber data yang dapat memperjelas data lainnya.

d. Wawancara

Wawancara dilakukan setelah kegiatan berlangsung dan

secara bebas, untuk mengungkap data dengan kata-kata secara lisan

tentang sikap, pendapat dan wawasan subjek penelitian mengenai

baik burukonya proses belajar yang telah berlangsung.

5. Instrumen Penelitian

Instrumen penelitian adalah alat bantu yang digunakan dalam

penelitian. Instrument yang digunakan dalam penelitian ini adalah sebagai

berikut:

a. Silabus Bahasa Indonesia Kelas V

b. Rencana Pelaksanaan Pembelajaran

c. Lembar tes mata pelajaran Bahasa Indonesia materi menentukan ide

pokok paragraf

d. Lembar observasi untuk mengamati guru terhadap penerapan model

CIRC

e. Pedoman Dokumentasi

Dokumentasi digunakan sebagai bukti pelaksanaan penelitian

yang berupa gambar atau foto yang menggunakan alat bantu berupa

kamera. Foto yang diabadikan melalui dokumentasi ini berisi peristiwa

yang menggambarkan aktivitas yang dilakukan siswa bersama guru


selama proses pembelajaran berlangsung. Foto yang diambil pada saat

proses pembelajaran merupakan sumber data yang dapat memperjelas

data yang lain. Aspek-aspek yang didokumentasikan adalah aktivitas

siswa dan guru dalam proses pembelajaran dengan menggunakan model

CIRC.

6. Definisi Operasional

Untuk memudahkan dan memperjelas pemahaman serta

menghindari kekeliruan terhadap maksud yang terdapat pada judul di atas,

maka perlu dijelaskan mengenai pembahasan masalah dan arti kata dalam

rangkaian judul di atas.

a. Peningkatan Hasil Belajar

Peningkatan merupakan suatu perubahan keaadaan menjadi

lebih baik.Upaya peningkatan merupakan usaha yang dilakukan

dalam rangka membuat perubahan kearah yang lebih baik.

Belajar adalah berubah, dalam hal ini dimaksudkan belajar

berarti usaha mengubah tingkah laku. Jadi, belajar akan membawa

suatu perubahan pada individu-individu yang belajar. Perbuahan itu

tidak hanya berkaitan dengan penambahan ilmu pengetahuan, tetapi

juga berbentuk kecakapan, ketrampilan sikap, pengertian, harga diri,

minat, watak, penyesuaian diri.Jelasnya menyangkut segala aspek

organism dan tingkah laku pribadi seseorang. Dengan demikian

belajar dapat dikatakan sebagai rangkaian kegiatan jiwa raga psiko-

fisik untuk menuju keperkembangan pribadi manusia seutuhnya,

yang
berarti menyangkut unsure cipta, rasa dan karsa, ranah kognitif

afektif dan psikomotorik (Sardiman, 1994: 21)

Secara sederhana, yang dimaksud dengan hasil belajar siswa

adalah kemampuan yang diperoleh anak setelah melalui kegiatan

belajar. Karena belajar itu sendiri merupakan suatu proses dari

seseorang yang berusaha untuk memeperoleh suatu bentuk

perubahan perilaku yang relatif menetap. Dalam kegiatan

pembelajaran atau kegiatan instruksional, biasanya guru menetapkan

tujuan belajar.Anak yang berhasil dalam belajar adalah yang berhasil

mencapai tujuan-tujuan pembelajaran atau tujuan instruksional

(Susanto, 2013:5).

b. Bahasa Indonesia

Menurut Halim (1976) Bahasa Indonesia memiliki dua

kedudukan yaitu sebagai bahasa nasional dan sebagai bahasa

negara. Sebagai bahasa nasiona bahasa Indonesia berfungsi:

sebagai lambang kebangsaan nasional, sebagai lambang identitas

nasional, sebagai alat pemersatu berbagai masyarakat yang

berbeda- beda latar belakang, social budaya dan bahasa, sebagai

alat perhubungan antarbudaya dan antar daerah. Dan dalam

kedudukannya sebagai bahasa Negara Indonesia berfungsi :

sebagai bahasa resmi Negara, sebagai bahasa pengantar resmi di

lembaga lembaga pendidikan, sebagai bahasa resmi didalam

perhubungan tingkat nasional untuk kepentingan perencanaan dan

pemerintahan dan sebagai bahasa


resmi di dalam pembangunan kebudayaan dan pemanfaatan ilmu

pengetahuan serta teknologi modern (Ramlan, dkk, 1994: 4).

c. Model CIRC (Cooperative Integrated Reading And Composition)

Model pembelajaran CIRC (Cooperative Integrated

Reading

And Composition) merupakan model pembelajaran yang dirancang

untuk dan ketrampilan berbahasa lainnya. CIRC dikembangkan

untuk menyongkong pendekatan pembelajaran tradisional berbasis

ketrampilan.Pada model pembelajaran CIRC siswa berpasang-

pasangan didalam kelompoknya (Faturrohman, 2015: 79).

Modelpembelajaran CIRC pertama kali dikembangkan oleh

Stevens, dkk (1987).Metode ini dapat dikategorikan sebagai

metode terpadu.Dalam pembalajaran CIRC, setiap siswa

bertanggung jawab terhadap tugas kelompok.Setiap anggota

kelompok saling mengeluarkan ide-ide untuk memahami suatu

konsep dan menyelesaikan tugas, sehingga terbentuk pemahaman

dan pengalaman belajar yang lama.Model pembelajaran ini terus

mengalami perkembangan mulai dari tingkat sekolah dasar hingga

menengah. Proses pembelajaran ini mendidik siswa berinteraksi

dengan lingkungan ( Huda, 2014: 221-222).

7. Analisis Data

analisis data adalah analisis yang telah terkumpul yang diperlukan untuk

merangkumkan apa yang telah diperoleh, menilai apakah data tersebut

berbasis kenyataan, ajek, dan benar (Sukmadinata, 2005: 155). Analisis


data
dilakukan dengan membandingkan antara skor nilai tiap siklus dengan

KKM yang telah ditentukan yaitu 70 (sesuai KKM yang berlaku di SDN

Srondol Kulon 01 Kecamatan Banyumanik Kota Semarang).Oleh karena

itu, siswa dikatakan tuntas belajarnya atau mencapai KKM jika nilai

perolehan siswa >70.Sebaliknya siswa dikatakan belum tuntas belajarnya

atau belum mencapai KKM jika nilai perolehan siswa <70.Analisis data

dapat dihitung menggunakan statistic sederhana untuk menghitung

ketuntasan klsasikal dengan menggunakan rumus presentase.

∑ 𝑠𝑖𝑠𝑤𝑎𝑦𝑎𝑛𝑔𝑡𝑒𝑙𝑎ℎ𝑡𝑢𝑛𝑡𝑎𝑠𝑏𝑒𝑙𝑎𝑗𝑎𝑟
P= ∑ 𝑠𝑖𝑠𝑤𝑎 X 100%

G. Sistematika Penulisan

Bagian awal yang meliputi sampul, lembar berlogo, judul persetujuan

pembimbing, pengesahan kelulusan, pernyataan keaslian tulisan, motto dan

persembahan, kata pengantar, abstrak, daftar isi, daftar tabel, daftar gambar, dan

daftar lampiran.

Bab I Pendahuluan berisi latar belakang masalah, rumusan masalah,

tujuan penelitian, manfaat penelitian, metode penelitian, definisi operasioanl,

dan sistematika penulisan.Metode penelitian mencakup rancangan penelitian,

subjek penelitian, langkah-langkah penelitian, instrumen penelitian,

pengumpulan data dan analisis data.

Bab II Kajian Pustaka mencakup: Hasil belajar, Bahasa Indonesia, Model

CIRC (Cooperative Integrated Reading And Composition).


Bab III Metodologi Penelitian berisi tentang deskripsi pelaksanaan pra

siklus meliputi rencana, pelaksanaan, pengamatan/pengumpulan data dan

refleksi.Deskripsi pelaksanaan siklus I, deskripsi pelaksanaan siklus II.

Bab IV Hasil Penelitian dan pembahasan meliputi deskripsi per siklus

yang membahas mengenai data dari hasil pengamatan atau wawancara, refleksi

keberhasilan dan kegagalan dan berisi pembahasan.

Bab V Penutup berisi kesimpulan dan saran.

BAB II

KAJIAN PUSTAKA

A. Hasil Belajar

a. Pengertian Hasil Belajar

Belajar merupakan proses orang memperoleh kecakapan

ketrampilan, dan sikap. Belajar dimulai dari masa kecil sampai akhir hayat

seseorang. Rasulallah SAW menyatakan dalam salah satu hadisnya bahwa

manusia harus belajar sejak dari ayunan hinggaw liang lahat. Orang tua

wajib membelajarkan anak-anaknya agar kelak dewasa ia mampu hidup


mandiri dan menggembankan dirinya, demikian juga sebuah syair islam

dalam baitnya berbunyi: “ belajar diwaktu kecil ibarat melukis diatas

batu”. Neisse (1976) menyebut bahwa anak- anak membutuhkan

pengetahuan awal, dan memiliki keyakinan, kepercayaan yang semu,

disamping itu anak- anak memiliki banyak pengharapan akan sesuatu,

pada saat itu anak- anak membutuhkan banyak belajar dan memungkinkan

member pengetahuan kepadanya (Yamin, 2008: 120).

Menurut R. Gagne (1989), belajar dapat didefinisikan sebagai

suatu proses dimana suatu organisme berubah perilakunya sebagai akibat

pengalaman, belajar dan mengajar merupakan dua konsep yang tidak dapat

dipisahkan satu sama lai. Dua konsep ini menjadi terpadu dalam satu

kegiatan dimana terjadi interaksi antara guru dan siswa, serta siswa dengan

siswa pada saat pemebelajaran berlangsung (Susanto, 2013: 1).

Piaget berpendapat bahwa pengetahuan dibentuk oleh

individu.sebab individu melakukan interaksi terus- menerus dengan

lingkungan.Lingkungan tersebut mengalami perubahan.Dengan adanya

interaksi dengan lingkungan maka fungsi intelek semakin

berkembang.Belajar pengetahuan meliputi tiga fase.Fase- fase itu adalah

fase eksplorasi, pengenalan konsep, dan aplikasi konsep.Dalam fase

eksplorasi, siswa mempelajari gejala dengan bimbingan.Dalam fase

pengenalan konsep, siswa mengenal konsep yang ada hubungannya

dengan gejala. Dalam fase aplikasi konsep, siswa menggunakan konsep

untuk meneliti gejala lain lebih lanjut (Dimyati 2006: 13-14).


b. Prinsip- prinsip belajar

Banyak teori dan prinsip- prinsip belajar yang dikemukakan oleh

para ahli yang satu dengan yang lain memiliki persamaan dan juga

perbedaan. Dari berbagai prinsip belajar tersebut terdapat beberapa prinsip

yang relative berlaku umum yang dapat kita pakai sebagai dasatr dalam

upaya poembelajaran, baik bagi siswa yang perlu meningkatkan upaya

belajarnya maupun bagi guru dalam upaya meningkatkan

mengajarnya.Prinsip- prinsip itu berkaitan dengan perhatian dan motivasi,

keaktifan keterlibatan langsung/ berpengalaman, pengulangan, tantangan,

balikan dan penguatan, serta perbuatan individual.

1. Perhatian dan motivasi

Perhatian merupakan peranan penting dalam kegiatan

belajar. Dari kajian teori belajar pengolahan informasi terungkap

bahwa tanpa adanya perhatian tak mungkin terjadi belajar (Gagne

dan Berliner,1984: 335). Perhatian terhadap pelajaran akan

timbulpada siswa apabila bahan pelajaran sesuai dengan

kebutuhannya. Apabila bahan pelajaran itu dirasakan sebagai

sesuatu yang dibutuhkan, diperlukan untuk belajar lebih lanjut atau

diperlukan dalam kehidupan sehari- hari, akan membangkitkan

motivasi untuk mempelajarinya.

2. Keaktifan

Menurut teori kognitif, belajar menunjukkan adanya jiwa

yang sangat aktif, jiwa mengolah informasi yang kita terima, tidak
sekadar menyimpannya saja tanpa mengadakan transformasi.

(Gagne dan Berliner,1984: 267), Menurut teori ini anak memiliki

sifat aktif, kiontruktif, dan mampu merencanakan sesuatu. Anak

mampu untuk mencari, menemukan, dan menggunakan

pengetahuan yang telah diperolehny. Dalam proses belajar-

mengajar, mencari dan menemukan fakta, menganalisis,

menafsirkan, dan menarik kesimpulan.

Dalam setiap proses belajar, siswa selalu menampakkan

keaktifan, keaktifan itu beraneka ragam bentuknya. Mulai dari

legiatan fisik yang mudah kita amati sampai kegiatan psikis yang

susah diamati. Kegiatan fisik bisa berupa membaca, mendegar,

menulis, berlatih ketrampilan- ketrampilan.Contoh kegiatan psikis

misalnya menggunakan khasanah pengetahuan yang dimiliki dalam

memecah masalah yang dihadap, memnandingkan satu konsep

dengan lainnya.

3. Keterlibatan langsung berpengalaman

Belajar haruslah dilakukan sendiri oleh siswa, belajar

adalah mengalami, belajar tidak bisa dilimpahkan kepada orang

lain. Edgar Dale dalam penggolongan pengalaman belajar yang

dituangkan dalam kerucut pengalamannya mengemukakan

bahwabelajar yang paling baik adalah belajar melalui pengalaman

langsung. Dalam belajar pengalaman langsung siswa tidak sekedar

mengamati secara
langsung tetapi ia harus menghayati, terlibat langsung dalam

perbuatan dan bertanggung jawab terhadap hasilnya.

Keterlibatan siswa didalam belajar jangan diartikan

keterlibatan fisik semata, namun lebih dari itu terutama adalah

keterlibatan emosional, keterlibatan dengan kegiatan kognitif

dalam pencapaian dan perolehan pengetahuan, dalam penghayatan

intermilisasi nilai- nilai dalam pembentukan sikap dan nilai, dan

juga pada saat menadakan latihan-latihan dalam pembentukan

ketrampilan.

4. Pengulangan

Pentingnya prinsip pengulangan dalam belajar walaupun

dengan tujuan yang berbeda.Yang pertama pengulangan untuk

melatih daya- daya jiwa sedangkan yang kedua dan ketiga

pengulangan untuk membentuk respon yang benar dan membentuk

kebiasaan- kebiasaan.Prinsip pengulangan masih relevan sebagai

dasar pembelajaran.Dalam belajar masih tetap diperlukan latihan/

pengulangan.

5. Tantangan

Teori Medan (Fielg Thery) dari Kurt Levin mengemukakan

bahwa siswa dalam situasi belajar berbeda dalam suatu medan atau

lapangan psikologis. Dalam situasi belajar siswa menghadapi suatu

tujuan yang ingin dicapai, tetapi selalu terdapat hambatan yaitu

mempelajari bahan belajar, maka timbulah motif untuk mengatasi


hambatan itu yaitu dengan mempelajari bahan belajar tersebut.

Apabila hambatan itu telah diatasi, artinya tujuan belajar telah

dicapai, maka ia akan masuk dalam medan baru atau tujuan baru.

Agar pada anak timbul motif yang kuat untuk mengatasi hambatan

dengan baik maka bahan belajar haruslah menantang.Tantangan

yang dihadapi dalam bahan belajar membuat siswa bergairah untuk

mrngatasinya.Bahan belajar yang baru, yang banyak mengandung

masalah yang perlu dipecahkan membuat siswa tertantang untuk

mempelajarinya. Pelajaran yang member kesempatan pada siswa

untuk menemukan konsep- konsep, prinsip- prinsip dan

generalisasi yang akan menyebabkan siswa berusaha mencari dan

menemukan konsep- konsep prinsip- prinsip dan generalisasi

tersebut. Bahan belajar yang telah diolah secara tuntas oleh guru

sehingga siswa tinggal menelan saja kurang menarik bagi siswa.

6. Balikan dan penguatan

Prinsip belajar berkaitan dengan balikan dan penguatan

terutama ditekankan oleh teori belajar Operant Conditioning dari

B. F Skinner. Siswa akan belajar lebih bersemangat apabila

mengetahui dan mendapatkan hasil yang baik. Hasil yang baik

merupakan balikan yang menyenangkan dan berpengaruh baik bagi

usaha belajar selanjutnya.Namun dorongan belajar itu menurut B. F

Skinner tidak saja oleh penguatan yang menyenangkan tetapi juga


yang tidak menyenangkan. Atau dengan kata lain penguatan positif

atau negative dapat memperkuat belajar.

7. Perbedaan individual

Siswa merupakan individual yang unik artinya tidak ada

dua orang siswa yang sama, tiap siswa memiliki perbedaan satu

dengan yang lain. Perbedaan itu terdapat pada karakteristik psikis,

kepribadian, dan sifat- sifat. Perbedaan individual berpengaruh

pada cara dan hasil belajar siswa.

c. Tujuan Belajar

Belajar merupakan peristiwa sehari- hari disekolah.Belajar

merupakan hal yang kompleks.Kompleksitas belajar tersebut dapat

dipandang dari dua subjek, yaitu siswa dan guru. Dari segi siswa, belajar

dialami sebagai suatu proses. Siswa mengalami proses mental dan

menghadapi bahan belajar. Bahan belajar tersebut merupakan keadaan

alam, hewan, tumbuh- tunbuhan, manusia dan bahan yang telah dihimpun

dalam buku- buku pelajaran.Dari segi guru, proses belajar tersebut tampak

sebagai perilaku belajar tentang suatu hal.

Belajar merupakan proses internal yang kompleks. Yang terlibat

dalam proses internal tersebut adalah seluruh mental yang meliputi ranah-

ranah kognitif, afektif dan psikomotorik. Tujuan belajar adalah sebagai

berikut:

1. Untuk mendapatkan pengetahuan


Pengetahuan dan kemampuan berfikir tidak dapat

dipisahkan. Pengetahuan dan kemampuan berfikir sangat

berhubungan karena kemampuan berfikir seseorang akan

berkembang jika terdapat bahan pengetahuan dan sebaliknya

dengan kemampuan berfikir seseorang akan memperkaya

pengetahuan.

2. Penanaman konsep dan ketrampilan

Penanaman konsep memerlukan ketrampilan.Ketrampilan

yang diperlukan berupa ketrampilan jasmani dan rohani.

Ketrampilan jasmani adalah ketrampilan yang dapat dilihat,

diamati sehingga akan menitikberatkan pada ketrampilan gerak/

penampilan dari anggota tubuh seseorang yang sedang belajar.

Ketrampilan rohani menyangkut persoalan penghayatan dan

ketrampilan berfikir.

3. Pembentukan sikap

Dalam kegiatan belajar mengajar guru akan selalu diamati,

dilihat, didengar, ditiru semua perilakunya oleh siswa. Dalam

kegiatan belajar siswa mungkin meniru perilaku gurunya. Guru

diharapkan memiliki perilaku yang baik agar bisa dicontoh dan

diamalkan oleh siswa.

d. Pengertian Hasil Belajar

Pengertian hasil belajar Suprijono (2011: 5) Hasil belajar adalah

pola- pola perbuatan, nilai- nilai, pengertian, sikap, apresiasi dan

ketrampilan. Pada umumnya hasil belajar dapat dikelompokkan menjadi


tiga ranah, yaitu ranah kognitif, psikomotorik, afektif. Secara eksplisit
ketiga ranah ini tidak dapat dipisahkan satu sama lain. Menurut Taksonomi

Bloom hasil belajar adalah perubahan perilaku yang meliputi tiga ranah

tersebut sebagai berikut :

1. Ranah kognitif

Berhubungan erat dengan kemampuan berfikir, termasuk

kemampuan menghafal, memahami, mengaplikasi, menganalisis,

menyintesis, dan kemampuan mengevaluasi.

2. Ranah afektif

Mencakup watak perilaku seperti sikap, minat, konsep diri,

nilai dan moral.Ranah afektif meliputi tujuan belajar yang

berhubungan dengan perubahan sikap yang menyangkut emosional

dalam diri seseorang. Keberasilan belajar akan menjadikan

seseorang berperilaku positif yang relative menetap dan otomatis.

3. Ranah psikomotorik

Berhubungan erat dengan hasil belajar yang pencapaiannya

melalui ranah ketrampilan dengan hasil belajar yang

pencapaiannya melalui ketrampilan manipulasi, yang melibatkan

oto dan kekuatan fisik. Ranah psikomotor adalah ranah yang

berhubungan dengan aktifitas fisik, misalnya menulis memukul,

melompat.

Tujuan aspek kognitif berorientasi pada kemampuan

berfikir yang menckup kemampuan intelektual yang lebih

sederhana, yaitu mengingat, sampai pada kemampuan

memecahkan masalah.Dengan demikian menurut Elis Ratna


Wulan, (2015: 58) aspek kognitif
adalah subtaksonomi yang menggungkapkan tentang kegiatan

mental yang sering berawal dari tingkat pengetahuan sampai

tingkat yang paling tinggi yaitu evaluasi.

Jika pentingnya evaluasi dalam pendidikan, maka seorang

guru dihadapkan pada persoalan pengukuran hasil belajar yang

nyata.Untuk dapat melakukan dengan baik seorang guru harus

mengetahui teori serta asumsi yang melandasi pengukuran

tersebut.Namun, ini tdak disadari orang.Mungkin karena

pengukuran dianggap sesuatu yang biasa.

Menurut Hartley(1967), sering hal ini tidak mendapat

perhatian yang cukup dan sungguh- sungguh, walaupun program

didalamnya yang sangat rinci (Ivor,1987: 306).

e. Faktor Yang Mempengaruhi Hasil Belajar

Dalam belajar keberhasilan tidak hanya dipengaruhi pada potensi dari

diri seorang individu saja, namun dapat juga dipengaruhi factor lain yang

berasal dari luar diri yang belajar. Dalam menentukan keberhasilan belajar

dapat dipengaruhi factor internal dan factor eksternal.

1. Faktor internal

Menurut Susanto (2013: 12) merupakan factor yang bersumber

dari dalam diri, siswa yang mempengaruhi kemampuan

belajarnya.Factor internal meliputi kondisi fisik, kesehatan,

kecerdasan, minat, perhatian dan kebiasaan belajar.


2. Faktor eksternal

Kesulitan belajar yang berasal dari luar diri individu.Factor

eksternal terdir dari factor non social dan factor social.Menurut Sriyati

(2013: 25) factor non social adalah factor diluar individu yang berupa

kondisi fisik yang ada dilingkungan belajar. Sedangkan factor social

adalah kedekatan hubungan antara anak dengan orang lain, kehadiran

orang dalam belajar.

a. Faktor sosial

Lingkungan sosial sekolah seperti para guru, para staf

administrasi, dan teman-teman sekelas dapat mempengaruhi

semangat belajar seorang siswa.Para guru yang selalu menunjukkan

sikap dan perilaku yang simpatik dan memperlihatkan suri teladan

yang baik dan rajin khususnya dalam hal belajar, misalnya rajin

membaca dan berdiskusi, dapat menjadi daya dorong yang positif

bagi kegiatan belajar siswa.

b. Faktor nonsosial

Faktor-faktor yang termasuk lingkungan nonsosial ialah

gudung sekolah dan letaknya, rumah tempat tinggal keluarga siswa

dan letaknya, alat-alat belajar, keadaan cuaca dan waktu belajar

yang digunakan siswa.Faktor-faktor ini dipandang turut

menentukan qtingkat keberhasilan belajar siswa.


B. Model CIRC (Cooperative Integrated Reading And Composition )

1. Pengertian Model

Istilah model hamper sama dengan strategi, menurut Sagala istilah

model dapat dipahami sebagai suatu kerangka konseptual yang digunakan

sebagai pedoman untuk melakukan suatu kegiatan. Model dirancang untuk

mewakili realitas yang sesungguhnya walaupun model itu sendiri bukanlah

realitas dari dunia yang sebenarnya.Oleh karenanya, model pembelajaran

adalah kerangks konseptual yang digunakan sebagai pedoman dalam

melakukan kegiatan pembelajaran (Faturrohman. 2015:29).

2. ModelCIRC (Cooperative Integrated Reading And Composition )

Dalam pembelajaran CIRC, setiap siswa bertanggung jawab

terhadap tugas kelompok.Setiap anggota kelompok mengeluarkan ide-ide

untuk memahami suatu konsep dan menyelesaikan tugas sehinngga

membentuk pemahaman dan pengalaman belajar yang lama (Huda, 2014:

221).

Menurut Faturrohman (2015: 79) CIRC dikembangkan untuk

menyokong pendekatan pembelajaran tradisional pada mata pelajaran

bahasa yang disebut “kelompok membaca berbasis ketrampilan ”. setiap

kelompok diminta untuk saling membantu untuk menunjukkan aktivitas

pengembangan ketrampilan berbahasa.

a. Langkah- langkah penerapan model CIRC


Menurut Steven,dkk dalam Huda (2014: 222) model CIRC

memiliki langkah-langkah penerapan sebagai berikut:

1) Guru membentuk yang masing- masing terdiri dari 4 siswa.

2) Guru memberikan wacana sesuai dengan topic pembelajaran.

3) Siswa bekerja sama saling membacakan dan menemukan ide

pokok kemudian memberikan tanggapan terhadap wacana yang

ditulis pada lembar kertas.

4) Siswa mempresentasikan/ membacakan hasil diskusi kelompok.

5) Gurumemberikan penguatan.

6) Guru dan siswa bersama-sama memberikan kesimpulan.

Dari setiap fase diatas menurut Huda,(2014: 222-223) dapat

dilihat beberapa tahap sebagai berikut:

1) Pengenalan konsep

Pada fase ini guru mulai mengenalkan suatu konsep atau

istilah baru yang mengacu pada hasil penemuan selama

eksplorasi.

2) Eksplorasi dan Aplikasi

Memberikan peluang kepada siswa untuk mengungkapkan

pengetahuan awal, mengembangkan pengetahuan baru dan

menjelaskan fenomena alami yang mereka alami dengan

bimbingan guru.

3) Publikasi
Pada fase ini, siswa mampu mengkomunikasikan hasil

temuan- temuan serta membuktikan dan memperagakan

materi yang telah dibahas.

b. Kelebihan dan kekurangan model CIRC (Cooperative Integrated

Reading And Composition).

1) Kelebihan model CIRC

Menurut Saifulloh dalam Huda (2014: 221) model

CIRC memiliki 8 kelebihan diantaranya adalah:

a) Pengalaman dan kegiatan belajar siswa akan selalu relevan

dengan tingkat perkembangan anak.

b) Kegiatan yang dipilih sesuai dengan minat dan kebutuhan

siswa.

c) Seluruh kegiatan pembelajaran lebih bermakna sehingga

hasil belajar siswa akan bertahan lebih lama.

d) Dapat menumbuhkan ketrampilan berfikir siswa.

e) Bermanfaat sesuai dengan permasalahan yang sering

timbul dalam lingkungan siswa.

f) Dapat menumbuhkembangkan interaksi sosial siswa.

g) Menumbuhkan motivasi belajar siswa.

h) Memperluas wawasan siswa dan aspirasi guru dalam

mengajar.

2) Kelemahan model CIRC


a) Model ini kurang tepat jika diterapkan pada peserta didik

yang kurang mampu dalam membaca.

b) Jika diterapkan terlalu sering siswa akan merasa bosan.

c) Peserta didik merasa jenuh jika harus membaca

terlalubanyak(http://www.kajianpustaka.com2017/10Mod

elPembelajaranCIRC diakses pada 25 Juli 2018 15:30).

C. Bahasa Indonesia

1. Pengertian Bahasa Indonesia

Menurut Halim dalam Ramlan, dkk (1994:4) Bahasa Indonesia

memiliki dua kedudukan yaitu sebagai bahasa nasional dan sebagai bahasa

negara. Sebagai bahasa nasiona bahasa Indonesia berfungsi: sebagai

lambang kebangsaan nasional, sebagai lambang identitas nasional, sebagai

alat pemersatu berbagai masyarakat yang berbeda- beda latar belakang,

social budaya dan bahasa, sebagai alat perhubungan antarbudaya dan antar

daerah.

2. Hakekat Pembelajaran Bahasa Indonesia di SD/MI

Belajar bahasa Indonesia pada hakekatnya adalah belajar

komunikasi.Oleh karena itu, pembelajaran bahasa diarahkan pada

meningkatkan kemampuan pembelajar dalam berkomunikasi, baik secara

lisan maupun tulisan (Depdikbud, 1995).Menurut Basiran dalam Imam


(2017: 61) tujuan pembelajaran bahasa adalah ketrampilan komunikasi

dalam berbagai kontek komunikasi.

Pembelajaran merupakan upaya membelajarkan siswa (Degeng

1989).Kegiatan pengupayaan ini mengakibatkan siswa mampu belajar

secara efektif dan efisien.Upaya yang dilakukan dapa berupa analisis

tujuan dan karakteristik studi dan siswa, analisis sumber belajar, strategi

penyampaian pembelajaran, menetapkan strategi pengorganisasian, isi

pembelajaran, strategi penyampaian pembelajaran, strategi pengelolaan

pembelajaran, dan prosedur hasil pembelajaran.

Pembelajaran Bahasa Indonesia di SD/MI berdasarkan kurikulum

2013 menganut pendekatan komunikatif.Maksudnya adalah implementasi

pembelajaran Bahasa Indonesia harus lebih menekankan pada aspek

komunikatif (Imam, 2017:60).

3. Prinsip Pembelajaran Bahasa Indonesia di SD/MI

Tugas pendidik hanyalah memberikan penghargaan dan penguatan

kepada siswa yang mendekat model atau bentuk yang dikehendaki dalam

proses pembelajaran. Pembelajaran Bahasa Indonesia yang tercantum

dalam kurikulum terutama dalam merencanakan kegiatan belajar mengajar

harus dilandasi pada prinsip sebagai berikut : humanisme, progresifisme,

dan rekontruktivisme Aminudin dalam Imam (2017: 65).

Pembelajaran Bahasa Indonesia selain komunikatif, juga harus

dilaksanakan secara terpadu dan tematik.Pendekatan terpadu merupakan

seperangkat wawasan dan aktifitas guru dalam merancang butir- butir


pembelajaran yang diharapkan mampu mengurai tema, konsep, maupun

pemahaman dan ketrampilan.

D. Materi Menentukan Ide Pokok Paragraf

1. Membaca

a.Pengertian membaca

Membaca adalah salah satu dari empat kertrampilan berbahasa.

Membaca juga adalah suatu proses yang dilakukan serta digunakan oleh

pembaca untuk memperoleh pesan, yang hendak disampaikan oleh penulis

melalui media kata- kata atau bahasa tulis. Suatu proses yang menuntut

agar kelompok kata yang merupakan suatu kesatuan akan terlihat dalam

suatu pandangan sekilas dan makna kata- kata secara individual akan dapat

diketahui. Kalau ini tidak terpenuhi pesan yang tersirat dan tersurat tidak

akan tertangkap dan dipahami (Guntur, 2008: 7).

Membaca tak terbatas usia, kemampuan belajarpun tak terbatas

usia, melainkan bergantung sepanjang hayat. Membaca adalah suatu

ketrampilan. Jika sudah memiliki ketrampilan dalammembaca maka

lambat laun akan memahaminya (Subyantoro, 2011: 9)

Menurut Tampubolon (TT: 5) pada tingkatan membaca permulaan

proses pengubahan harus dibina dan dikuasai. Khususnya pada tahun

permulaan di skolah.Maksudnya adalah proses permulaan ini mencakup

pengenalan huruf- huruf sebagai lambang bunyi- bunyi bahasa.Setelah


penguasaan permulaan dikuasai barulah lanjut ketahap pemahaman isi

bacaan.

b. Tujuan Membaca

Tujuan setiap pembaca adalah memahami bacaan yang dibacanya.

Pemahaman terhadap bacaan dapat dipandang sebagai suatu proses yang

bergulir, terus- menerus dan berkelanjutan. Oleh sebab itu, agar

peningkatan pemahaman dalam diri siswa itu terjadi, guru perlu

menciptakan kondisi yang memungkinkan interaksi antara beberapa pihak

dapat terjadi.Untuk itu, harus membuat perencanaan yang matang.

2. Paragraf

Paragraf adalah serangkaian kalimat yang sering bertalian untuk

membentuk sebuah gagasan (ide). Dalam hierarkis kebahasaan, paragraph

merupakan satuan yang lebih tinggi atau lebih luas dari kalimat.Paragraf

berguna untuk menandai pembukaan topic baru, memisahkan gagasan pokok

yang satu dengan yang lainnya.Dengan demikian pembaca dapat memahami

isi paragraf secara utuh.Dalam penulisannya paragraf dimulai dengan spasi.

Panjang paragraf tidak dibatasi bergantung pada cara pengembangannya

(wijayanti, 2013: 97).

Menurut Tampubolon (TT: 85) paragraph merupakan satuan terkecil

dari suatu karangan. Sebagai satuan terkecil paragraph mengandung pokok

pikiran.Pokok pikiran inikah yang dikembangkan, oleh kalimat- kalimat yang

membentuk paragraf itu.Selain itu pikiran pokok disebut juga berhubungan


dengan pokok pikiran dari paragraf lainnya dari karangan bersangkutan.Maka

paragraf disebut juga sebagai satuan pengembangan.

Fungsi paragraf yaitu sebagai penampung dari sebagian kecil jalan

pikiran atau ide pokok keseluruhan karangan, memudahkan pemahaman

pikiran atau ide pokok, memungkinkan pengarang melahirkan jalan pikiran

secara sistematis.Bagi para pembaca kalimat- kalimat yang tarsusun secara

sistematis itu sangat memudahkan pembaca.

3. Menemukan Ide Pokok Paragraf

Ide pokok adalah inti dari sebuah bacaan, baik dalam bentuk paragraph

ataupun wacana.Menemukan ide pokok merupakan cara yang baik bagi

pembaca ketika mencoba menambah wawasan pengetahuan melalui bacaan.

Jika siswa mampu menemukan ide pokok dengan baik, maka pemahamannya

melalui bacaan tersebut akan baik pula. Hal ini akan menambah dampak

positif bagi pembaca dari informasi yang didapat dari bacaan tersebut.

Dalam membaca paragraf, yang terutama harus ditemukan adalah

pokok pikiran atau ide pokok dalam suatu paragraf.Pokok pikiran yang

terkandung dalam paragraf biasanya terkandung dalam kalimat pertama atau

kalimat terakhir. Jika kalimat pokok terdapat pada kalimat pertama, maka

dapat dipahami bahwa pengarang mrnggunakan cara berfikir deduktif.

Sedangkan jika pikiran pokok terdapat pada akhir paragraf, penulis

menggunakan cara berfikir induktif (Tampubolon, TT: 85).

Menemukan informasi yang terkandung didalam suatu bacaan,

pembaca harus menemukan ide pokok yang terdapat disetiap paragraf.Selain

menentukan
ide pokok siswa dituntut untuk menemukan permasalahan yang terdapat suatu

wacana untuk lebih memahami suatu bacaan.

Tarigan (2009:3) mengatakan bahwa ide pokok suatu wacana perlu

mendapat perhatian secara tersendiri karena berhubungan erat dengan tema,

persoalan persoalan yang terkandung dalam suatu wacana.

E. Hubungan Model pembelajaran CIRC dengan Bahasa Indonesia.

Bahasa Indonesia merupakan salah satu kurikulum yang memiliki peranan

penting dalam membantu siswa mengembangkan aspek dasar dalam pembelajaran

Bahasa Indonesia yaitu: mendengarkan, berbicara, membaca dan menulis.

Menurut Imam(2017:45), siswa diharapkan mampu memiliki kompetensi sikap,

ketrampilan dan pengetahuan yang jauh lebih baik. Selain itu siswa diharapkan

tidak menjadi sosok yang asal menerima atau belajar untuk hafal.

Salah satu ketrampilan bahasa untuk anak SD/MI dalam pembelajaran

Bahasa Indonesia adalah membaca. Hal ini masih banyak siswa yang hanya

sekedar membaca tanpa mengetahuan pokok pikiran yang terkandung dalam suatu

bacaan/ paragraf.Banyak factor yang menyebabkan siswa masih belum mampu

menemukan pokok pikiran dalam pargraf dengan tepat salah satunya adalah

pembelajaran masih berpusat pada guru.Perlu adanya perubahan dalam cara

mengajar guru kepada siswa agar siswa merasa nyaman, tidak jenuh, bahkan

mampu menemukan pokok pikiran dalam suatu paragraph dengan tepat tanpa

merasas kesulitan. Oleh sebab itu, diperlukan sebuah model pembelajaran yang

dapat memberikan pengetahuan. Salah satunya adalah model pembelajaran CIRC

(Cooperative Integrated Reading And Composition).


Merujuk pada penelitian yang terdahulu yang dilakukan oleh Rahmawati

(2012), Berdasarkan hasil penelitian yang dilakukan dengan menerapkan model

CIRC menyatakan bahwa terjadi peningkatan terhadap aktivitas dan hasil belajar

siswa dalam menemukan ide pokok dan ide penjelas selama pembelajaran

berlangsung, mulai dengan siklus I sampai dengan siklus II. Hal ini dibuktikan

pada siklus I masih banyak siswa yang kebingungan dalam menemukan ide

pokok, sehingga aktivitas siswa dalam menemukan ide pokok diperoleh rata- rata

64,2 dan hasil belajar siswa diperoleh rata- rata 58,23 dengan siswa yang tuntas

sebanyak 11 siswa (26%). Sedangkan pada siklus II banyak siswa yang sudah

paham dan bisa menemukan ide pokok dengan tepat dan benar. Sehingga aktivitas

siswa dalam menemukan ide pokok diperoleh rata- rata 88 dan hasil belajar siswa

diperoleh rata- rata 85 dengan siswa yang tuntas sebanyak 38 siswa (90%).

Simpulan dari penelitian ini adalah model CIRC sangat efektif diterapkan

dalam pembelajaran Bahasa Indonesia khususnya membaca dan menemukan ide

pokok, karena model CIRC dapat melatih siswa bekerja sama dalam kelompok

yaitu saling membacakan dan bertukar pendapat dalam menemukan ide pokok.

F. Kriteria Ketuntasan Minimal (KKM)

1. Pengertian KKM

Salah satu prinsip penilaian pada kurikulum berbasis kompetensi adalah

menggunakan acuan kriteria, yakni menggunakan kriteria tertentu dalam

menentukan kelulusan peserta didik. Kriteria paling rendah untuk menyatakan

peserta didik mencapai ketuntasan dinamakan Kriteria Ketuntasan Minimal

(KKM).Kriteria ketuntasan minimal ditetapkan oleh satuan pendidikan


berdasarkan hasil musyawarah guru mata pelajaran di satuan pendidikan atau

beberapasatuan pendidikan yang memiliki karakteristik yang hampir sama.

Pertimbangan pendidik atau forum MGMP secara akademis menjadi

pertimbangan utama penetapan KKM.

Untuk menentukan ketuntasan belajar individual dapat dengan

menggunakan persamaan sebagai berikut:

a. Menghitung rata- rata kelas

∑X
M= 𝑁 M = Mean

∑𝑥 = Jumlah semua siswa

N = Jumlah siswa

b. Menghitung ketuntasan belajar siswa (individual)


𝑇
KB =
𝑇1 x 100 KB = Ketuntasan Belajar

T = Jumlah skor yang diperoleh siswa

T1 = Jumlah skor total

c. Menghitung ketuntasan belajar klasikal


𝐹
P = x 100 P = Nilai dalam persen
𝑁

F = Frekuensi siswa tuntas

KKM N = Jumlah keseluruhan

2. Prosedur Penetapan KKM

a. Guru atau kelompok guru menetapkan KKM mata pelajaran dengan

mempertimbangkan tiga aspek kriteria, yaitu kompleksitas, daya dukung,


dan intake peserta didik dengan skema sebagai berikut: Hasil penetapan

KKM indikator berlanjut pada KD, SK hingga KKM mata pelajaran.

b. Hasil penetapan KKM oleh guru atau kelompok guru mata pelajaran

disahkan oleh kepala sekolah untuk dijadikan patokan guru dalam

melakukan penilaian.

c. KKM yang ditetapkan disosialisaikan kepada pihak-pihak yang

berkepentingan, yaitu peserta didik, orang tua, dan dinas pendidikan.

d. KKM dicantumkan dalam LHB pada saat hasil penilaian dilaporkan

kepada orang tua/wali peserta didik.


BAB III
PELAKSANAAN PENELITIAN

A. Deskripsi Kondisi

1. Perolehan Nilai Ulangan Harian Mata Pelajaran Bahasa Indonesia

Pada tahap ini peneliti menggunakan nilai ulangan harian mata

pelajaran Bahasa Indonesia untuk mengetahui kemampuan awal siswa

kelas V SDN Srondol Kulon 01 Kecamatan Banyumanik Kota Semarang

tahun 2018. Dibawah ini adalah hasil dari nilai ulangan harian sebelum

menggunakan model pembelajaran CIRC (Cooperative Integrated

Reading And Composition ).

Tabel 3.1

Nilai Ulangan Harian Bahasa Indonesia kelas V

No. Nama Siswa L/P Nilai Ketuntasan


1 Satriyo Bagus P. L 60 Tidak Tuntas
2 Widya Atania Z. P 55 Tidak Tuntas
3 Permata Sari P 70 Tuntas
4 Ahnaf Fairus R. L 65 Tidak Tuntas
5 Al Azhar Kirana P 40 Tidak Tuntas
6 Diandra A.R. P 60 Tidak Tuntas
7 Farel Army W. L 40 Tidak Tuntas
8 Joyata Mazaya P 75 Tuntas
9 M. Ricky M. L 40 Tidak Tuntas
10 R. Dwi Kresna L 75 Tuntas
11 Risky Putra A. L 55 Tidak Tuntas
12 Tiandika N. P. L 65 Tidak Tuntas
13 Aditya Putra P. L 40 Tidak Tuntas
14 Almira R. P 80 Tuntas
15 Arkan Shalif S. L 45 Tidak Tuntas
16 Dewi Anggi A. P 35 Tidak Tuntas
17 Diva Septian H. L 70 Tuntas
18 Hilmiya H. P 75 Tuntas
19 Laella O. S. P 55 Tidak Tuntas
20 M. Hafiz S. L 50 Tidak Tuntas
21 M. Khadaffi L 30 Tidak Tuntas
22 Raka Fernando L 60 Tuntas
23 Satriya M. L 55 Tidak Tuntas
24 Teguh Saputro L 75 Tuntas
25 Vannya Dwi H. P 75 Tuntas
26 Zahnuba Aulia R. P 80 Tuntas
27 Tegar Alief N. L 70 Tuntas
28 M. Farhan L 45 Tidak Tuntas
29 Shafira N. S. P 40 Tidak Tuntas
30 Yoga Whisnu P. L 60 Tidak Tuntas
Rata- rata 54,6

Keterangan:

KKM 70

Tuntas : 11 siswa

Tidak Tuntas : 19 siswa

2. Data keadaan siswa

Siswa kelas V SDN Srondol Kulon 01 Kecamatan Banyumanik Kota

Semarang tahun pelajaran 2018 berjumlah 30 siswa yaitu terdiri dari 18

laki- laki dan 12 siswa perempuan. Berikut adalah data siswa :

Tabel 3.2 Data Keadaan Siswa

No. Nama Siswa L/P


1 Satriyo Bagus Prakoso L
2 Widya Atania Zulfa P
3 Permata Sari P
4 Ahnaf Fairus Rizqullah L
5 Al Azhar Kirana P
6 Diandra Amalia R. P
7 Farel Army W. L
8 Joyata Mazaya P
9 M. Ricky Maulana L
10 R. Dwi Kresna L
11 Risky Putra A. L
12 Tiandika Nanda P. L
13 Aditya Putra P. L
14 Almira Risandini P
15 Arkan Shalif S. L

16 Dewi Anggi A. P

17 Diva Septian H. L

18 Hilmiya Hazimah P

19 Laella Oktaviana S. P

20 M. Hafiz Saifullah L

21 Muhammad Khadaffi L

22 Raka Fernando L

23 Satriya Maulana L

24 Teguh Saputro Dwi U. L

25 Vannya Dwi Haddi P

26 Zahnuba Aulia R. P

27 Tegar Alief Nugroho L

28 Muhammad Farhan L

29 Shafira Nurhasanah S. P

30 Yoga Whisnu Pratama L

Keterangan :

Laki- laki 18

Perempuan 12

3. Pelaksanaan Penelitian

Penelitian dilaksanakan pada mata pelajaran Bahasa Indonesia materi

menemukan ide pokok paragraf. Penelitian ini menggunakan model

pembelajaran CIRC (Cooperative Integrated Reading And Composition ).


Dilaksanakan sebanyak 2 siklus. Waktu pelaksanaan penelitian sebagai

berikut:

a. Kegiatan siklus 1 dilaksanakan pada tanggal 8 Agustus 2018

b. Kegiatan siklus 2 dilaksanakan pada tanggal 15 Agustus 2018

B. Deskripsi Pelaksanaan Siklus 1

1. Perencanaan Tindakan

Dalam tahap perencanaan tindakan kegiatan yang dilaksanakan

peneliti adalah sebagai berikut:

a. Menyusun Rencana Pelaksanaan Pembelajaran (RPP) mata

pelajaran Bahasa Indonesia yang memuat serangkaian kegiatan

belajar mengajar menggunakan model pembelajaran CIRC

(Cooperative Integrated Reading And Composition ). Adapun

materi yang dibahas adalah menemukan ide pokok paragraf.

b. Mempersiapkan fasilitas dan sarana pendukung seperti media

pembelajaran (buku tema siswa)

c. Menyiapkan materi ajar tentang menemukan ide pokok paragraf.

d. Menyiapkan lembar pengamatan untuk mengetahui

keterampilan guru dalam proses pembelajaran menggunakan

model pembelajaran CIRC (Cooperative Integrated Reading

And Composition)

e. Menyiapkan instrumen untuk menggali data hasil belajar siswa

berupa lembar tes.


f. Peneliti berkoordinasi dengan guru selaku kolaborator untuk

melaksanakan proses pembelajaran dengan model pembelajaran

CIRC (Cooperative Integrated Reading And Composition).

2. Pelaksanaan Tindakan

a. Guru melaksanakan pembelajaran sesuai dengan rencana

pelaksanaan pembelajaran yang telah dibuat sebelumnya.

b. Guru mengawali pembelajaran dengan salam dan berdoa.

c. Guru menanyakan kabar dan mengabsen siswa.

d. Guru memberikan motivasi sebelum masuk ke dalam materi

pembelajaran.

e. Guru mengajukan pertanyaan yang mengaitkan materi

pembelajaran dengan kehidupan sehari-hari.

f. Guru menyampaikan tujuan pembelajaran.

g. Guru menjelaskan tentang materi menemukan ide pokok paragraf.

h. Guru mendemonstrasikan langkah kegiatan Cooperative Integrated

Reading And Composition

i. Guru membagi siswa dalam 7 kelompok setiapkelompok terdiri

dari 4-5 siswa.

j. Guru membagikan lembar soal kepada masing-masing kelompok.

k. Siswa diminta untuk mendiskusikan soal-soal yang telah dibagikan

tiap-tiap kelompok dan menentukan jawaban yang paling tepat.


l. Setiap kelompok mempresentasikan hasil jawaban dari soal yang

telah dikerjakan secara berkelompok.

m. Guru mengulang kegiatan tersebut sampai 5 soal terjawab oleh

semua kelompok.

n. Siswa diminta mengubah tempat duduk seperti semula.

o. Sebagai bahan evaluasi guru memberikan soal dan siswa diminta

mengerjakannya.

p. Setelah siswa mengerjakan soal evaluasi guru menyimpulkan

materi yang telah dipelajari.

q. Guru menutup pembelajaran dengan berdoa dan salam.

3. Pengamatan atau observasi

Selama proses pembelajaran, peneliti secara langsung

melakukan pengamatan untuk mengetahui ketrampilan guru dalam

proses pembelajaran dengan menggunakan model pembelajaran

Cooperative Integrated Reading And Composition dalam

meningkatkan hasil belajar. Aspek- aspek yang diamati adalah sebagai

berikut:

a. Lembar Observasi Guru

Tabel 3.3 Lembar Observasi GuruSiklus 1

NO. KEGIATAN 4 3 2 1
1. Apersepsi v
2. Penjelasan Materi v
3. Penjelasan model v
pembelajaran CIRC
4. Teknik Pembagian v
Kelompok
5. Penguasaan kelas v
6. Pengelolaan kegiatan v
Diskusi
8. Bimbingan kepada v
Kelompok
9. Pemberian pertanyaan v
atau kuis
10. Kemampuan
melakukan v
Evaluasi
11. Memberikan
penghargaan v
individu dan kelompok
12. Menentukan nilai v
individu dan kelompok
13. Menyimpulkan materi v
Pembelajaran
14. Menutup pembelajaran v

KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

b. Lembar Pengamatan kegiatan Pembelajaran dengan model


CIRC

Tabel 3.4 Lembar Pengamatan kegiatan Pembelajaran


dengan model CIRC Siklus I

No Nama siswa Minat Partisipasi Presentasi


.
4 3 2 1 4 3 2 1 4 3 2 1
1. Satriyo Bagus P. v v v
Widya Atania Z. v v v
Permata Sari v v v
Ahnaf Fairus R. v v v
2. Al Azhar Kirana v v v
Diandra A.R. v v v
Farel Army W. v v v
Joyata Mazaya v v v
3. M. Ricky M. v v v
R. Dwi Kresna v v v
Risky Putra A. v v v
Tiandika N. P. v v v
4. Aditya Putra P. v v v
Almira R. v v v
Arkan Shalif S. v v v
Dewi Anggi A. v v v
5. Diva Septian H. v v v
Hilmiya H. v v v
Laella O. S. v v v
M. Hafiz S. v v v
6. M. Khadaffi v v v
Raka Fernando v v v
Satriya M. v v v
Teguh Saputro v v v
Vannya Dwi H. v
7. Zahnuba Aulia R. v v v
Tegar Alief N. v v v
M. Farhan v v
Shafira N. S. v v v
Yoga Whisnu P. v v v

KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

c. Lembar responden siswa siklus I

Tabel 3.5 Lembar Observasi Siswa Yang Tidak Aktif

Kegiatan
No. Nama Siswa 1 2 3 4 5 6 7 8 9 10
1 Satriyo Bagus P. v v
2 Widya Atania Z. v
3 Permata Sari
4 Ahnaf Fairus R. v
5 Al Azhar Kirana
6 Diandra A.R.
7 Farel Army W. v
8 Joyata Mazaya
9 M. Ricky M. v v
10 R. Dwi Kresna
11 Risky Putra A. v v
12 Tiandika N. P.
13 Aditya Putra P. v v
14 Almira R.
15 Arkan Shalif S. v
16 Dewi Anggi A.
17 Diva Septian H. v
18 Hilmiya H.
19 Laella O. S.
20 M. Hafiz S.
21 M. Khadaffi
22 Raka Fernando
23 Satriya M. v v
24 Teguh Saputro v
25 Vannya Dwi H.
26 Zahnuba Aulia R.
27 Tegar Alief N. v
28 M. Farhan
29 Shafira N. S.
30 Yoga Whisnu P. v

Keterangan :
1. Mengantuk 9. “Nyletuk”
2. Mengerjakan tugas lain 10. Pindah- pindah tempat
duduk
3. Berisik
4. Keluar masuk kelas
5. Mengganggu siswa lain
6. Melamun
7. Usil
8. Corat- coret di kertas

d. Nilai evaluasi siklus I

Tabel 3.6 Nilai Evaluasi Siklus I

No. Nama Siswa Nilai Ketuntasan Keterangan


1 Satriyo B. P. 60 Tidak Tuntas
2 Widya A. Z. 60 Tidak Tuntas
3 Permata S. 70 Tuntas
4 Ahnaf F. R. 70 Tuntas
5 Al Azhar K. 50 Tidak Tuntas
6 Diandra A.R. 70 Tuntas
7 Farel A.W. 50 Tidak Tuntas
8 Joyata M. 70 Tuntas
9 M. Ricky M. 40 Tidak Tuntas Terendah
10 R. Dwi K. 70 Tuntas
11 Risky P. A. 70 Tuntas
12 Tiandika N. P. 70 Tuntas
13 Aditya P. P. 60 Tidak Tuntas
14 Almira R. 80 Tuntas Tertinggi
15 Arkan S.S. 50 Tidak Tuntas
16 Dewi A. A. 50 Tidak Tuntas
17 Diva S. H. 70 Tuntas
18 Hilmiya H. 70 Tuntas
19 Laella O. S. 60 Tidak Tuntas
20 M. Hafiz S. 70 Tuntas
21 M. Khadaffi 50 Tuntas
22 Raka F. 70 Tuntas
23 Satriya M. 60 Tidak Tuntas
24 Teguh S. 70 Tuntas
25 Vannya D.H. 70 Tuntas
26 Zahnuba A. R. 70 Tuntas
27 Tegar A. N. 70 Tuntas
28 M. Farhan 70 Tuntas
29 Shafira N. S. 50 Tidak Tuntas
30 Yoga W. P. 50 Tidak Tuntas
Rata- rata 63

KKM 70

4. Refleksi

Kegiatan ini bertujuan untuk menilai seluruh kegiatan

pembelajaran menggunakan Cooperative Integrated Reading And

Composition. Pada siklus I menunjukkan bahwa, terdapat peningkatan

pada hasil belajar siswa. Siswa terlihat antusias dalam melaksanakan

proses pembelajaran dengan menggunakan melalui Cooperative

Integrated Reading And Composition.Guru berperan sebagai

fasilitator, motivator dan pusat pembelajaran berada pada siswa.

Model
pembelajaran ini membuat siswa aktif di mana setiap siswa saling

mengajukan pendapatnya dalam menyelesaikan soal, saling

menghargai pendapat teman dalam kelompoknya dan bertanggung

jawab terhadap dirinya dan kelompoknya.

Selama pengamatan berlangsung masih ditemukan masalah-

masalah, yaitu ada beberapa siswa yang belum memahami penjelasan

dari guru. Hal tersebut menyebabkan seorang siswa tidak ikut

mengerjakan seperti yang diharapkan oleh guru dan membiarkan

siswa lain mengerjakan soal. Dengan adanya masalah-masalah

tersebut, maka peneliti akan melakukan tindakan pada siklus II untuk

memperbaiki hasil belajar pada siklus I.

C. Deskripsi siklus II

1. Perencanaan Tindakan

Berdasarkan refleksi yang diperoleh dari pengamatan nilai siklus I,

maka siklus II merupakan perbaikan dari siklus I. Rencana

pelaksanaan yang dilakukan oleh peneliti adalah sebagai berikut :

a. Menyusun Rencana Pelaksanaan Pembelajaran (RPP) mata

pelajaran Bahasa Indonesia yang memuat serangkaian

kegiatan belajar mengajar menggunakan model

Cooperative Integreted Reading and Composition. Adapun

materi yang dibahas adalah menemkan ide pokok dalam

paragraf.

b. Mempersiapkan fasilitas dan sarana pendukung seperti

buku tema siswa kelas V dan lembar soal untuk


pelaksanaan
kegiatan pembelajaran menggunakan modelCooperative

Integrated Reading And Composition.

c. Menyiapkan materi ajar tentang menemukan ide pokok

dalam paragraf.

d. Menyiapkan lembar pengamatan untuk mengetahui

keterampilan guru dalam proses pembelajaran

menggunakan modelCooperative Integrated Reading And

Composition.

e. Menyiapkan instrumen untuk menggali data hasil belajar

siswa berupa lembar tes.

f. Peneliti berkoordinasi dengan guru selaku kolaborator

untuk melaksanakan proses pembelajaran dengan

modelCooperative Integrated Reading And Composition.

2. Pelaksanaa Tindakan

Guru melaksanakan pembelajaran sesuai dengan rencana

pelaksanaan yang telah dibuat sebelumnya.

a. Guru melaksanakan pembelajaran sesuai dengan rencana

pelaksanaan pembelajaran yang telah dibuat sebelumnya.

b. Guru mengawali pembelajaran dengan salam dan berdoa.

c. Guru menanyakan kabar dan mengabsen siswa.

d. Guru memberikan motivasi sebelum masuk ke dalam materi

pembelajaran.

e. Guru mengajukan pertanyaan yang mengaitkan materi

pembelajaran dengan kehidupan sehari-hari.


f. Guru menyampaikan tujuan pembelajaran.

g. Guru menjelaskan tentang materi menemukan ide pokok

paragraf.

h. Guru mendemonstrasikan langkah kegiatan Cooperative

Integrated Reading And Composition

i. Guru membagi siswa dalam 7 kelompok setiapkelompok

terdiri dari 4-5 siswa.

j. Guru membagikan lembar soal kepada masing-masing

kelompok.

k. Siswa diminta untuk mendiskusikan soal-soal yang telah

dibagikan tiap-tiap kelompok dan menentukan jawaban yang

paling tepat.

l. Setiap kelompok mempresentasikan hasil jawaban dari soal

yang telah dikerjakan secara berkelompok.

m. Guru mengulang kegiatan tersebut sampai 5 soal terjawab

oleh semua kelompok.

n. Siswa diminta mengubah tempat duduk seperti semula.

o. Sebagai bahan evaluasi guru memberikan soal dan siswa

diminta mengerjakannya.

p. Setelah siswa mengerjakan soal evaluasi guru menyimpulkan

materi yang telah dipelajari.

q. Guru menutup pembelajaran dengan berdoa dan salam.


3. Pengamatan dan Observasi

Selama proses pembelajaran, peneliti secara langsung

melakukan pengamatan untuk mengetahui ketrampilan guru dalam

proses pembelajaran dengan menggunakan model Cooperative

Integrated Reading and Composition dalammeningkatkan hasil belajar

peserta didik. Aspek yang diamati adalah sebagai berikut :

a. Lembar Observasi guru

Tabel 3.7Lembar Observasi GuruSiklus II

NO. KEGIATAN 4 3 2 1
1. Apersepsi v
2. Penjelasan Materi v
3. Penjelasan model v
pembelajaran CIRC
4. Teknik Pembagian v
Kelompok
5. Penguasaan kelas v
6. Pengelolaan kegiatan v
Diskusi
8. Bimbingan kepada v
Kelompok
9. Pemberian pertanyaan v
atau kuis
10. Kemampuan
melakukan v
Evaluasi
11. Memberikan
penghargaan v
individu dan kelompok
12. Menentukan nilai v
individu dan
kelompok
13. Menyimpulkan materi v
Pembelajaran
14. Menutup pembelajaran v

KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

b. Lembar Pengamatan kegiatan Pembelajaran dengan model CIRC

Tabel 3.8 Lembar Pengamatan kegiatan Pembelajaran dengan


model CIRC Siklus II

No. Nama siswa Minat Partisipasi Presentasi


4 3 2 1 4 3 2 1 4 3 2 1
1. Satriyo Bagus P. v v v
Widya Atania Z. v v v
Permata Sari v v v
Ahnaf Fairus R. v v v
2. Al Azhar Kirana v v v
Diandra A.R. v v v
Farel Army W. v v v
Joyata Mazaya v v v
3. M. Ricky M. v v v
R. Dwi Kresna v v v
Risky Putra A. v v v
Tiandika N. P. v v v
4. Aditya Putra P. v v v
Almira R. v v v
Arkan Shalif S. v v v
Dewi Anggi A. v v v
5. Diva Septian H. v v v
Hilmiya H. v v v
Laella O. S. v v v
M. Hafiz S. v v v
6. M. Khadaffi v v v
Raka Fernando v v v
Satriya M. v v v
Teguh Saputro v v v
Vannya Dwi H. v v v
7. Zahnuba Aulia R. v v v
Tegar Alief N. v v v
M. Farhan v v v
Shafira N. S. v v v
Yoga Whisnu P. v v v
v
KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

c. Lembar observasi responden siswa siklus II

Tabel 3.9Lembar Observasi Siswa Yang Tidak Aktif

No. Nama Siswa Kegiatan


1 2 3 4 5 6 7 8 9 10
1 Satriyo Bagus P. v
2 Widya Atania Z.
3 Permata Sari
4 Ahnaf Fairus R.
5 Al Azhar Kirana
6 Diandra A.R.
7 Farel Army W.
8 Joyata Mazaya
9 M. Ricky M. v v
10 R. Dwi Kresna
11 Risky Putra A.
12 Tiandika N. P.
13 Aditya Putra P. v
14 Almira R.
15 Arkan Shalif S.
16 Dewi Anggi A.
17 Diva Septian H.
18 Hilmiya H.
19 Laella O. S.
20 M. Hafiz S.
21 M. Khadaffi
22 Raka Fernando
23 Satriya M.
24 Teguh Saputro v
25 Vannya Dwi H.
26 Zahnuba Aulia R.
27 Tegar Alief N. v
28 M. Farhan
29 Shafira N. S.
30 Yoga Whisnu P.

Keterangan :
9. Mengantuk 9. “Nyletuk”
10. Mengerjakan tugas lain 10. Pindah- pindah tempat
duduk
11. Berisik
12. Keluar masuk kelas
13. Mengganggu siswa lain
14. Melamun
15. Usil
16. Corat- coret di kertas

d. Nilai evaluasi siklus II

Tabel 3.10 Nilai Evaluasi Siklus II

No. Nama Siswa Nilai Ketuntasan Ket.


1 Satriyo B. P. 70 Tuntas
2 Widya A. Z. 80 Tuntas
3 Permata Sari 80 Tuntas
4 Ahnaf F. R. 80 Tuntas
5 Al Azhar K. 70 Tuntas
6 Diandra 80 Tuntas
A.R.
7 Farel W. 70 Tuntas
8 Joyata M. 90 Tuntas Tertinggi
9 M. Ricky M. 70 Tuntas
10 R. Dwi K. 80 Tuntas
11 Risky P.A. 80 Tuntas
12 Tiandika N. 80 Tuntas
P.
13 Aditya P. P. 70 Tuntas
14 Almira R. 80 Tuntas
15 Arkan S. S. 70 Tuntas
16 Dewi A. A. 50 Tidak Tuntas Terendah
17 Diva S .H. 80 Tuntas
18 Hilmiya H. 80 Tuntas
19 Laella O. S. 70 Tuntas
20 M. Hafiz S. 80 Tuntas
21 M. Khadaffi 70 Tuntas
22 Raka F. 80 Tuntas
23 Satriya M. 60 Tidak Tuntas
24 Teguh S. 70 Tuntas
25 Vannya D. 80 Tuntas
H.
26 Zahnuba 80 Tuntas
A.R.
27 Tegar A.N. 80 Tuntas
28 M. Farhan 70 Tuntas
29 Shafira N. S. 60 Tidak Tuntas
30 Yoga W. P. 80 Tuntas
Rata- rata 74,6

KKM 70

4. Refleksi

Hasil belajar siswa pada siklus II mengalami peningkatan yang

lebih baik dibandingkan dengan siklus 1.Hal ini dapat dilihat dari

antusias siswa dalam melaksanakan proses pembelajaran dengan

menggunakan model Cooperative Integreted Reading and

Composition.Semua siswa mampu mengikuti pembelajaran dengan baik,

bahkan siswa mampu mempresentasikan hasil belajar kelompok dengan

lebih baik. Siswa yang sebelumnya kurang memahami materi kini lebih

antusias dalam mengikuti pembelajaran.

Berdasarkan nilai evaluasi dapat disimpulkan bahwa nilai yang

diperoleh siswa lebih baik dari siklus I. Proses pembelajaran pada siklus

II telah mencapai tujuan yang diharapkan.Siswa lebih aktif dan tidak

merasa jenuh dalam membaca setiap paragraf dalam menentukan ide

pokoknya.Pembelajaran lebih menyenangkan dan hasil belajar

meningkat.Nilai yang diperoleh siswa telah mencapai KKM mencapai

klasikal 85% dari jumlah siswa.

Hal ini telah menunjukkan bahwa tindakan yang telah dilakukan

mencapai hasilyang lebih baik.Untuk itupenelitian ini dikatakan telah

berhasil dengan baik karena pertimbangan hasil dari presentase diatas.


BAB IV

HASIL PENELITIAN DAN PEMBAHASAN

A. Deskripsi Hasil Penelitian

Hasil penelitian ini diuraikan dalam tahapan berupa siklus- siklus

pembelajaran yang dilakukan dalam proses pembelajaran. Dalam

penelitian ini dilakukan dua siklus berikut pemaparannya :

1. Deskripsi Pra Siklus

Pada penelitian ini peneliti melaksanakan penelitian menggunakan

model pembelajaran Cooperative Integrated Reading And

Composition. Model pembelajaran ini baru digunakan oleh SDN

Srondol Kulon 01 Semarang.

Berdasarkan data nilai ulangan harian mata pelajaran Bahasa

Indonesia yang diperoleh siswa kelas V SDN Srondol Kulon 01

Kecamatan Banyumanik Kota Semarang menunjukkan bahwa KKM

untuk mata pelajaran Bahasa Indonesia adalah 70. Peneliti menggunakan

evaluasi formatif dalam penelitian tindakan kelas ini yaitu tes objektif

dan subjektif.Di bawah ini adalah hasil ulangan harian mata pelajaran

Bahasa Indonesia sebelum menggunakan model pembelajaran

Cooperative Integrative Reading and Composition.


Tabel 4.1 Nilai Ulangan Harian (Pra Siklus)

No. Nama Siswa L/P Nilai Ketuntasan


1 Satriyo Bagus P. L 60 Tidak Tuntas
2 Widya Atania Z. P 55 Tidak Tuntas
3 Permata Sari P 70 Tuntas
4 Ahnaf Fairus R. L 65 Tidak Tuntas
5 Al Azhar Kirana P 40 Tidak Tuntas
6 Diandra A.R. P 60 Tidak Tuntas
7 Farel Army W. L 40 Tidak Tuntas
8 Joyata Mazaya P 75 Tuntas
9 M. Ricky M. L 40 Tidak Tuntas
10 R. Dwi Kresna L 75 Tuntas
11 Risky Putra A. L 55 Tidak Tuntas
12 Tiandika N. P. L 65 Tidak Tuntas
13 Aditya Putra P. L 40 Tidak Tuntas
14 Almira R. P 80 Tuntas
15 Arkan Shalif S. L 45 Tidak Tuntas
16 Dewi Anggi A. P 35 Tidak Tuntas
17 Diva Septian H. L 70 Tuntas
18 Hilmiya H. P 75 Tuntas
19 Laella O. S. P 55 Tidak Tuntas
20 M. Hafiz S. L 50 Tidak Tuntas
21 M. Khadaffi L 30 Tidak Tuntas
22 Raka Fernando L 60 Tuntas
23 Satriya M. L 55 Tidak Tuntas
24 Teguh Saputro L 75 Tuntas
25 Vannya Dwi H. P 75 Tuntas
26 Zahnuba Aulia R. P 80 Tuntas
27 Tegar Alief N. L 70 Tuntas
28 M. Farhan L 45 Tidak Tuntas
29 Shafira N. S. P 40 Tidak Tuntas
30 Yoga Whisnu P. L 60 Tidak Tuntas
Rata- rata 54,6

Keterangan:

KKM 70

Tuntas : 11 siswa

Tidak Tuntas : 19 siswa


Dari tabel diatas menunjukkan bahwa nilai ulangan harian (pra

siklus) menunjukkan bawa dari 30 siswa kelas VSDN Srondol Kulon 01

Kecamatan Banyumanik Kota Semarang tahun 2018 dengan Nilai

standar KKM 70 hanya 36,6% (11 siswa) yang tuntas, sedangkan 63,4%

(19 siswa) belum tuntas.

2. Deskripsi Data Siklus I

Hasil tes evaluasi pada silus I mengalami peningkatan apabila

dibandingkan dengan nilai pra siklus.Pada siklus I terdapat 17 siswa

yang tuntas dan 13 siswa yang belum tuntas. Dengan demikian baru

56,6 dari jumlah keseluruhan siswa yang mencapai KKM. Hal ini

menunjukkan bahwa hasil belajar siswa pada siklus I belum memenuhi

target yang peneliti tentukan yaitu 85 % dari jumlah seluruh siswa

yang mencapai nilai KKM. Hasil observasi siswa dalam proses belajar

mengajar selama siklus I dapat dilihat pada tabel berikut :

Tabel 4.2 Perolehan Nilai Evaluasi Siklus I

No. Nama Siswa L/P Nilai Ketuntasan


1 Satriyo Bagus P. L 60 Tidak Tuntas
2 Widya Atania Z. P 60 Tidak Tuntas
3 Permata Sari P 70 Tuntas
4 Ahnaf Fairus R. L 70 Tuntas
5 Al Azhar Kirana P 50 Tidak Tuntas
6 Diandra A.R. P 70 Tuntas
7 Farel Army W. L 50 Tidak Tuntas
8 Joyata Mazaya P 70 Tuntas
9 M. Ricky M. L 40 Tidak Tuntas
10 R. Dwi Kresna L 70 Tuntas
11 Risky Putra A. L 70 Tuntas
12 Tiandika N. P. L 70 Tuntas
13 Aditya Putra P. L 60 Tidak Tuntas
14 Almira R. P 80 Tuntas
15 Arkan Shalif S. L 50 Tidak Tuntas
16 Dewi Anggi A. P 50 Tidak Tuntas
17 Diva Septian H. L 80 Tuntas
18 Hilmiya H. P 70 Tuntas
19 Laella O. S. P 60 Tidak Tuntas
20 M. Hafiz S. L 70 Tuntas
21 M. Khadaffi L 40 Tuntas
22 Raka Fernando L 70 Tuntas
23 Satriya M. L 60 Tidak Tuntas
24 Teguh Saputro L 70 Tuntas
25 Vannya Dwi H. P 70 Tuntas
26 Zahnuba Aulia R. P 70 Tuntas
27 Tegar Alief N. L 70 Tuntas
28 M. Farhan L 70 Tuntas
29 Shafira N. S. P 50 Tidak Tuntas
30 Yoga Whisnu P. L 50 Tidak Tuntas
Rata- rata 62,6

Keterangan :

KKM 70

Tuntas : 17 Siswa

Belum Tuntas : 13 Siswa

Hasil observasi pada siklus I aktivitas guru masih tergolong

rendah, hal ini terlihat berdiri didepan kelas dan kurang memberikan

pengarahan kepada siswa bagmana melakukan pembelajaran yang sesuai

dengan model pembelajaran CIRC Cooperative Integreted Reading and

Composition. Sedangkan hasil evaluasi siklus I penguasaan siswa terhadap

materi pembelajaran masih tergolong kurang, nilai perolehan rata- rata

hanya mencapai 62,6%. Hal ini terjadi karena siswa dan guru belum

terbiasa dengan model pembelajaran CIRC Cooperative Integreted

Reading and Composition.Untuk memperbaiki kelemahan dan

mempertahankan
keberhasilan yang telah dicapai pada siklus I maka perlu adanya siklus

berikutnya hingga mencapai ketuntasan yang telah ditargetkan peneliti.

3. Deskripsi Data Siklus II

Hasil tes evaluasi pada siklus II mengalami peningkatan yang

cukup siknifikan dibandingkan dengan siklus I. Pada siklus II, telah

mencapai 90% dari seluruh siswa yang mencapai KKM yang telah

ditentukan sekolah. Terdapat 27 siswa yang tuntas dan 3 siswa yang

belum tuntas.Hasil belajar siswa sudah memenuhi target penelitian,

yaitu 85% dari seluruh jumlah siswa mencapai KKM. Berdasarkan

hasil belajar siswa tersebut maka model Cooperative Integreted

Reading and Composition dapat meningkatkan hasil belajar pada siswa

kelas V mata pelajaran Bahasa Indonesia materi menemukan ide

pokok paragraf. Hasil observasi siswa dalam proses belajar mengajar

selama siklus I dapat dilihat pada tabel berikut :

Tabel 4.3 Perolehan Nilai Evaluasi Siklus II

No. Nama Siswa L/P Nilai Ketuntasan


1 Satriyo Bagus P. L 70 Tuntas
2 Widya Atania Z. P 80 Tuntas
3 Permata Sari P 80 Tuntas
4 Ahnaf Fairus R. L 80 Tuntas
5 Al Azhar Kirana P 70 Tuntas
6 Diandra A.R. P 80 Tuntas
7 Farel Army W. L 70 Tuntas
8 Joyata Mazaya P 90 Tuntas
9 M. Ricky M. L 70 Tuntas
10 R. Dwi Kresna L 80 Tuntas
11 Risky Putra A. L 80 Tuntas
12 Tiandika N. P. L 80 Tuntas
13 Aditya Putra P. L 70 Tuntas
14 Almira R. P 80 Tuntas
15 Arkan Shalif S. L 70 Tuntas
16 Dewi Anggi A. P 50 Tidak Tuntas
17 Diva Septian H. L 80 Tuntas
18 Hilmiya H. P 80 Tuntas
19 Laella O. S. P 70 Tuntas
20 M. Hafiz S. L 80 Tuntas
21 M. Khadaffi L 70 Tuntas
22 Raka Fernando L 90 Tuntas
23 Satriya M. L 60 Tidak Tuntas
24 Teguh Saputro L 70 Tuntas
25 Vannya Dwi H. P 80 Tuntas
26 Zahnuba Aulia R. P 80 Tuntas
27 Tegar Alief N. L 80 Tuntas
28 M. Farhan L 70 Tuntas
29 Shafira N. S. P 50 Tidak Tuntas
30 Yoga Whisnu P. L 80 Tuntas
Rata- rata 74,6

Keterangan :

KKM 70

Tuntas 27

Tidak Tuntas 3

Hasil observasi pada siklus II guru sudah mampu menguasai

kelompok dan mulai memahami modelpembelajaran CIRC (Cooperative

Integreted Reading and Composition). Guru mampu memberikan

pengarahan kepada siswa bagaimana melakukan pembelajaran

menggunakan model CIRC. Selain aktivitas guru dalam proses

pembelajaran, penguasaan siswa terhadap materi pembelajaran sudah

sesuai dengan hasilyang diharapkan. Hal ini dapat dilihat dari hasil

evaluasi nilai siswa pada siklus II sudah mengalami peningkatan dari

siklus I.

B. Pembahasan
Penelitian tindakan kelas ini dilakukan dalam 2 siklus, dari data yang

telah diperoleh menunjukkan terjadinya peningkatan nilai yang cukup baik.

Selain itu siswa antusias siswa dalam mengikuti proses pembelajaran ikut

meningkat. Seingga jika dipadukan dengan model CIRC (Cooperative

Integreted Reading and Composition) dalam pembelajaran Bahasa Indonesia

dapat meningkatkan hasil belajar siswa kelas V SDN Srondol Kulon 01

Kecamatan Banyumanik Kota Semarang.Hal ini dapat dilihat dari hasil

rekapitulasi (hasil belajar) Bahasa Indonesia menggunakan model

pembelajaran CIRC (Cooperative Integreted Reading and Composition).

Tabel 4.4 Hasil Rekapitulasi Nilai Siswa Per Siklus

Nilai Pra Nilai Nilai


No. Nama Siswa Siklus Siklus I Siklus
II
1 Satriyo Bagus P. 60 60 70
2 Widya Atania Z. 55 60 80
3 Permata Sari 70 70 80
4 Ahnaf Fairus R. 65 70 80
5 Al Azhar Kirana 40 50 70
6 Diandra A.R. 60 70 80
7 Farel Army W. 40 50 70
8 Joyata Mazaya 75 70 90
9 M. Ricky M. 40 40 70
10 R. Dwi Kresna 75 70 80
11 Risky Putra A. 55 70 80
12 Tiandika N. P. 65 70 80
13 Aditya Putra P. 40 60 70
14 Almira R. 80 80 80
15 Arkan Shalif S. 45 50 70
16 Dewi Anggi A. 35 50 50
17 Diva Septian H. 70 70 80
18 Hilmiya H. 75 70 80
19 Laella O. S. 55 60 70
20 M. Hafiz S. 50 70 80
21 M. Khadaffi 30 50 70
22 Raka Fernando 60 70 80
23 Satriya M. 55 60 60
24 Teguh Saputro 75 70 70
25 Vannya Dwi H. 75 70 80
26 Zahnuba Aulia R. 80 70 80
27 Tegar Alief N. 70 70 80
28 M. Farhan 45 70 70
29 Shafira N. S. 40 50 60
30 Yoga Whisnu P. 60 50 80
Rata- rata 54,6 62,6 74,6

Berdasarkan tabel diatas dapat diketahui bahwa perolehan rata-rata nilai

pada siklus I meningkat menjadi 62,6 jika dibandingkan dengan nilai pra siklus

yang hanya 54,6. Pada siklus II meningkat menjadi 74,6. Maka dapat disimpulkan

bahwa pelaksanaan PTK dengan menggunakan model pembelajaran CIRC

berhasil meningkatkan hasil belajar siswa.Hasil dari penelitian tindakan kelas ini

memperoleh hasil seperti tabel diatas.Berikut ini penjabaran hasil penelitian per

siklus.

1. Siklus I

Proses pembelajaran pada siklus I, peneliti menggunakan model

pembelajaran CIRC (Cooperative Integreted Reading and Composition).

Adapun pada penelitian ini mencakup 4 tahap yaitu tahap perencanaan,

pelaksanaan, pengamatan atau observasi dan refleksi.Sebelu dilakukan

penelitian, peneliti melakukan observasi di SDN Srondol Kulon 01

Kecamatan Banyumanik Kota Semarang. Pada tahap ini hasil tes evaluasi

adalah 56,6 (17 siswa) yang tuntas dan yang tidak tuntas 46,6 (13 siswa).

Dengan demikian hasil belajar siswa pada siklus I mengalami peningkatan

sebesar 20% jika dibandingkan dengan pra siklus. Perolehan hasil tes

evaluasi siklus I dapat dilihat pada gambar dibawah ini


Gambar 4.1 Presentase Nilai Siklus I

Siklus I

Tuntas
Belum Tuntas

Berikut ini adalah lembar observasi guru yang peneliti gunakan

pada saat proses pembelajaran berlangsung:

Tabel 4.5 Lembar Observasi Guru Siklus I

NO. KEGIATAN 4 3 2 1
1. Apersepsi v
2. Penjelasan Materi v
3. Penjelasan model v
pembelajaran CIRC
4. Teknik Pembagian v
Kelompok
5. Penguasaan kelas v
6. Pengelolaan kegiatan v
Diskusi
8. Bimbingan kepada v
Kelompok
9. Pemberian pertanyaan v
atau kuis
10. Kemampuan
melakukan v
Evaluasi
11. Memberikan
penghargaan v
individu dan kelompok
12. Menentukan nilai v
individu dan kelompok
13. Menyimpulkan materi v
Pembelajaran
14. Menutup pembelajaran v

KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

Hasil observasi aktivitas guru dalam kegiatan belajar mengajar

pada siklus I masih tergolong cukup rendah dan belum mencapai batas

maksimal. Adapun penjelasan lebih lanjut mengenai aktivitas guru adalah

sebagai berikut :

a. Penilaian guru pada penjelasan materi berada pada skor 4 berpredikat

baik.

b. Penilaian guru pada penjelasan model CIRC berada pada skor 2

yang berpredikat cukup baik.

c. Penilaian guru pada teknik pembagian kelompok berada pada skor

3 berpredikat baik.

d. Penilaian penguasaan kelas berada pada skor 4 yang berpredikat

sangat baik.

e. Penilaian terhadap pengelolaan kegiatan diskusi berada pada skor

3 yang berpredikat baik.

f. Penilaian bimbingan terhadap kelompok berada pada skor 2

yang berpredikat cukup baik.


g. Penilaian terhadap pemberian pertanyaan atau kuis berada pada skor 3

yang berpredikat baik.

h. Penilaian terhadap kemampuan melakukan evaluasi berada pada

skor 3 yang berpredikat baik.

i. Penilaian terhadap pemberian penghargaan terhadap individu

atau kelompok berada pada skor 2 yang berpredikat cukup baik.

j. Penilaian terhadap menentukan nilai terhadap kelompok dan

individu berada pada skor 3 yang berpredikat baik.

k. Penilaian terhadap kemampuan guru dalam menyimpulkan

materi berada pada skor 3 yang berpredikat baik.

l. Penilaian terhadap kemampuan guru dalam menutup pembelajaran

berada pada skor 3 yang berpredikat baik.

Hasil pengamatan yang dilakukan peneliti pada saat guru

menggunakan model CIRC (Cooperative Integreted Reading and

Composition)adalah sebagai berikut:

a. Membuka pembelajaran

Guru membuka pelajaran dimulai dari memimpin doa, mengabsen

siswa dan memberikan motivasi kepada siswa serta menjelaskan tujuan

pembelajaran. Apersepsi yang dilakukan oleh guru sudah sesuai

dengan RPP.

b. Penguasaan Materi
Guru mampu menerangkan materi menemukan ide pokok

paragraf dengan jelas dan runtut. Sehingga, siswa mampu memahami

materi dengan baik.

c. Menyajikan materi

Dalam penyajian materi guru menjelaskan siswa dengan

memberikan pertanyaan atau kuis terlebih dahulu kepada siswa

sehingga memancing siswa untuk aktif selama proses pembelajaran

berlangsung.

d. Pengelolaan kelas

Pengelolaan kelasa yang dilakukan oleh guru sudah

mendekati dengan yang tercantumkan dalam RPP. Dimana siswa

sudah dibagi menjadi beberapa kelompok sesuai dengan model

CIRC. Namun pada siklus I ini guru masih belum sepenuhnya

sesuai dengan RPP yang telah disusun peneliti yang berkolaborasi

dengan guru kelas.

e. Ketepatan menggunakan model

Guru masih merasa asing dengan metode pembelajaran CIRC

sehingga sebelum pembelajaran guru sudah menerima RPP dari

peneliti untun dipahami terlebih dahulu mengenai model CIRC. Dalam

pelaksanaan model CIRC siswa masih belum terlibat aktif dalam

diskusi hal ini disebabkan karena siswa belum terbiasa menggunakan

model pembelajaran CIRC.Selain itu, guru kurang merata dalam

membimbing setiap kelompok sehingga siswa masih banyak yang

berpindah tempat
duduk dan bahkan bercerita dengan kelompoknya.Hal ini berpengaruh

terhadap tingkat pemahaman siswa yang diajarkan oleh guru.

f. Pelaksanaan evaluasi

Pelaksanaan Evaluasi belum berjalan dengan optimal, karena

banyak siswa yang masih malu menyampaikan hasil diskusi

kelompoknya.Sehingga mempengarui terhadap hasil tes evaluasi yang

dilakukan secara individu.

g. Menutup pelajaran

Guru mengakhiri pembelajaran dengan menyimpulkan materi yang

dipelajari bersama-sama dengan siswa dan menutup pelajaran dengan

salam.

2. Siklus II

Pada siklus II tindakan penelitian mempertimbangkan

kekurangan dan kendala yang muncul pada siklus I. Untuk proses

pembelajaran masih sama dengan dengan siklus I yaitu dengan

menggunakan model CIRC. Melalui data yang diperoleh pada

siklus II telah terjadi peningkatan yang signifikasi pada hasil belajar

siswa sebesar 60% dari pra siklus dan 40 % dari siklus I. Hasil tes

evaluasi yang diperoleh pada siklus II yaitu 90% (27 siswa) yang

tuntas sedangkan 10% (3 siswa) belum tuntas. Dengan demikian,

presentase nilai yang diperoleh pada siklus II telah memenuhi target

yang telah ditetapkan peneliti yaitu 85% siswa tuntas atau mencapai

nilai KKM yang ditetapkan SDN Srondol Kulon 01 Kab.Banyumanik

Kota
Semarang. Perolehan presentase nilai tes evaluasi pada siklus II

sebagai berikut:

Gambar 4.2 Persentase Nilai Tes Evaluasi Siklus II

Siklus II

Tuntas
Tidak Tuntas

Berikut ini adalah lembar observasi guru yang peneliti gunakan

pada saat proses pembelajaran langsung:

Tabel 4.6 Lembar Observasi Guru Siklus I

NO. KEGIATAN 4 3 2 1
1. Apersepsi v
2. Penjelasan Materi v
3. Penjelasan model v
pembelajaran CIRC
4. Teknik Pembagian v
Kelompok
5. Penguasaan kelas v
6. Pengelolaan kegiatan v
Diskusi
8. Bimbingan kepada v
Kelompok
9. Pemberian pertanyaan v
atau kuis
10. Kemampuan
melakukan v
Evaluasi
11. Memberikan v
penghargaan
individu dan kelompok
12. Menentukan nilai v
individu dan
kelompok
13. Menyimpulkan materi v
Pembelajaran
14. Menutup pembelajaran v

KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

Hasil observasi aktivitas guru dalam kegiatan pembelajaran pada siklus II

lebih bik dari siklus I sehingga aktivitas guru pada siklus II tergolong baik.

Adapun penjelasan lebih lanjut mengenai aktivitas guru pada siklus II sebagai

berikut :

a. Penilaian guru pada penjelasan materi berada pada skor 4

berpredikat sangat baik.

b. Penilaian guru pada penjelasan model CIRC berada pada skor 4

yang berpredikat sangat baik.

c. Penilaian guru pada teknik pembagian kelompok berada pada skor

4 berpredikat sangat baik.

d. Penilaian penguasaan kelas berada pada skor 4 yang berpredikat

sangat baik.

e. Penilaian terhadap pengelolaan kegiatan diskusi berada pada skor 3

yang berpredikat baik.


f. Penilaian bimbingan terhadap kelompok berada pada skor 4

yang berpredikat sangat baik.

g. Penilaian terhadap pemberian pertanyaan atau kuis berada pada skor

3 yang berpredikat baik.

h. Penilaian terhadap kemampuan melakukan evaluasi berada pada skor

3 yang berpredikat baik.

i. Penilaian terhadap pemberian penghargaan terhadap individu

atau kelompok berada pada skor 3 yang berpredikat sangat baik.

j. Penilaian terhadap menentukan nilai terhadap kelompok dan individu

berada pada skor 3 yang berpredikat baik.

k. Penilaian terhadap kemampuan guru dalam menyimpulkan materi

berada pada skor 4 yang berpredikatsangat baik.

l. Penilaian terhadap kemampuan guru dalam menutup

pembelajaran berada pada skor 4 yang berpredikat sangat baik.

Hasil pengamatan yang dilakukan peneliti pada saat guru menggunakan model

Cooperative Integreted Reading and Compositionadalah sebagai berikut:

a. Membuka pembelajaran

Guru membuka pelajaran dimulai dari memimpin doa, mengabsen

siswa dan memberikan motivasi kepada siswa serta menjelaskan tujuan

pembelajaran. Apersepsi yang dilakukan oleh guru sudah sesuai

dengan RPP.

b. Penguasaan Materi
Guru mampu menerangkan materi menemukan ide pokok

paragraf dengan jelas dan runtut. Sehingga, siswa mampu memahami

materi dengan baik.

c. Menyajikan materi

Dalam penyajian materi guru menjelaskan siswa dengan

memberikan pertanyaan atau kuis terlebih dahulu kepada siswa

sehingga memancing siswa untuk aktif selama proses pembelajaran

berlangsung.

d. Pengelolaan kelas

Pengelolaan kelasa yang dilakukan oleh guru sudah

mendekati dengan yang tercantumkan dalam RPP. Dimana siswa

sudah dibagi menjadi beberapa kelompok sesuai dengan model

CIRC.Pada siklus II ini guru sudah sesuai dengan RPP yang telah

disusun peneliti yang berkolaborasi dengan guru kelas.

e. Ketepatan menggunakan model

Guru sudah menguasai model pembelajaran CIRC sehingga dalam

pelaksanaan model CIRC guru mampu menguasai kelas dengan

baik.Bahkan siswasudah terlibat aktif dalam diskusi hal ini disebabkan

karena siswa sudah terbiasa menggunakan model pembelajaran CIRC.

Selain itu, guru sudah merata dalam membimbing setiap kelompok

sehingga siswa mengikuti proses pembelajaran dengan baik. Hal ini

berpengaruh terhadap peningkatan pemahaman siswa yang diajarkan

oleh guru.
f. Pelaksanaan evaluasi

Pelaksanaan Evaluasi sudah berjalan dengan optimal, karena

banyak siswa yang terlibat aktif dalam menyampaikan hasil diskusi

kelompoknya.Sehingga meningkatnya hasil tes evaluasi yang

dilakukan secara individu.

g. Menutup pelajaran

Guru mengakhiri pembelajaran dengan menyimpulkan materi yang

dipelajari bersama-sama dengan siswa dan menutup pelajaran dengan

salam.

3. Rekapitulasi Pra Siklus, Siklus I dan Siklus II

Tabel 4.7 Rekapitulasi Pra Siklus, Siklus I dan Siklus II

Kategori Pra Siklus Siklus I Siklus II

Siswa % Siswa % Siswa %

Tuntas 11 36,6% 17 56,6% 27 90%

Tidak Tuntas 19 63,4% 13 43,3% 3 10%

Jumlah 30 100% 30 100% 30 100%

Berikut ini adalahpresentase ketuntasan hasil belajar siswa pra

siklus, siklus I dan siklus II:

Gambar 4.3 Presentase Ketuntasan Hasil Belajar Siswa Pra Siklus, Siklus I

dan Siklus II:


Tuntas
Tidak Tuntas

Berdasarkan tabel dan gambar diatas diketahui bahwa

ketuntasan siswa kelas V SDN Srondol Kulon 01 Kecamatan

Banyumanik Kota Semarang meningkat. Dari pra siklus sebelum

menggunakan model pembelajaran Cooperative Integreted Reading

and Composition, siswa yang mencapai ketuntasan hanya 36,6% (11

siswa) dari keseluruhan siswa yang berjumlah 30 siswa. Sedangkan

pada siklus I sebesar 56,6% (17 siswa) dan siklus II 90% (27 siswa)

yang mencapai ketuntasan. Nilai rata- rata pra siklus yaitu 54,6, pada

siklus I nilai rata- rata siswa meningkat menjadi 62,6 dan siklus II

nilai rata-rata siswa juga meningkat menjadi 74,6. Pada pelaksanaan

siklus II ketuntasan klasikal telah mencapai 90% yang mana telah

melebihi dari kriteria ketuntasan klasikal yang ditetapkan yaitu ≥ 85%.

Meningkatnya hasil belajar siswa dari siklus I ke siklus II

disebabkan karena menggunkan model pembelajaran Cooperative


Integrated Reading And Compositiondapat menambah dan

memperjelas pemahaman siswa tentang materi menemukan ide pokok

paragraf yang dipelajari siswa dan merangasang partisipasi siswa

dalam diskusi selama proses pembelajaran berlangsung.

Aktivitas siswa dalam proses pembelajaran sudah mengarah

pada model pembelajaran Cooperative Integrated Reading And

Compositiondengan baik. Siswa mampu membangun kinerja dengan

kelompok untuk memahami tugas yang diberikan kepada guru.Siswa

mulai mampu berpartisipasi hasil kerja dan menyelesaikannya dalam

waktu yang tepat. Meningkatnya aktivitas siswa dalam proses

pembelajaran ini didukung oleh aktivitas guru dalam mempertahankan

dan meningkatkan suasana pembelajaran yang mengarah pada model

pembelajaran Cooperative Integrated Reading And Composition.

Dengan memperhatikan pembahasan hasil penelitian diatas

peneliti menyimpulkan bahwa hipotesis yang diajukan dapat diterima

kebenarannya, dengan kata lain penerapan model pembelajaran

kooperative tipe Cooperative Integrated Reading And Compositiondi

SDN Srondol Kulon 01 Kecamatan Banyumanik Kota Semarang

dapat meningkatkan hasil belajar siswa mata pelajaran Bahasa

Indonesia materi menemukan ide pokok paragraf.

BAB V

PENUTU

P
A. Kesimpulan

Penerapan model pembelajaran Cooperative Integreted Reading

and Compositiondapat meningkatkan aktivitas proses belajar mengajar

di SDN Srondol Kulon 01 Kecamatan Banyumanik Kota Semarang

tahun pelajaran 2018 pada mata pelajaran Bahasa Indonesia kelas V

materi menemukan ide pokok paragraf. Hal ini dibuktikan dengan

adanya peningkatan hasil belajar siswa. Pada pra siklus terdapat 11

siswa (56,6%) yang mencapai ketuntasan yang belum tuntas 19 siswa

(43,3) dengan nilai rata- rata 54,6. Pada siklus I mengalami

peningkatan menjadi 17 siswa (90%) yang tuntas dan 13 siswa (10%)

belum tuntas dengan nilai rata- rata 62,6. Siklus II lebih meningkat

menjadi 27(90%) siswa yang tuntas dan yang belum tuntas 3 (10%)

siswa dengan perolehan nilai rata- rata 74,6. Pencapaian hasil belajar

pada siklus terakhir menyatakan bahwa target pencapaian indikator

keberasilan sudah memenuhi yaitu 90 % dari keseluruhan siswa yang

tuntas belajar dari indikator keberhasilan yang ditetapkan yaitu ≥ 85%

dari total keseluruhan siswa. Penelitian tindakan kelas yang dilakukan

di SDN Srondol Kulon 01 Kecamatan Banyumanik Kota Semarang

dinyatakan berhasi.

B. Saran
Berdasarkan hasil penelitian yang telah dilaksanakan dan telah

mencapai keberhasilan maka peneliti memberikan saran sebagai berikut :

1. Bagi Guru

a. Pembelajaran dengan menggunakan model Cooperative Integreted

Reading and Compositionhendaknya diterapkan kembali dalam proses

pembelajaran Bahasa Indonesia karena terbukti dapat meningkatkan

hasil belajar siswa pada pelajaran Bahasa Indonesia.

b. Sebelum melaksanakan kegiatan pembelajaran hendaknya guru

melakukan persiapan yang matang dengan telebih dahulu memahami

langkah-langkah yang akan diterapkan dalam proses pembelajaran

yang berpedoman pada RPP yang telah disusun sebelumnya.

c. Guru hendaknya memberikan penjelasan mengenai langkah- langkah

model pembelajaran Cooperative Integreted Reading and Composition

agar siswa tidak merasa bingung dan tidak menyamakan dengan

model diskusi lain.

d. Guru sebaiknya lebih kreatif dan variatif dalam menggunakan strategi

pembelajaran sehingga dapat meningkatkan minat siswa untuk

mengikuti proses pembelajaran dengan baik sehingga tujuan

pembelajaran dapat tercapai, serta melibatkan siswa secara aktif dalam

proses pembelajaran sehingga akan menghilangkan kejenuhan siswa.

2. Orang tua siswa


Kepada orang tua siswa yang belum mencapai ketuntasan

diharapkan mampu memberikan pengarahan atau penambahan belajar

seperti mengikuti bimbingan belajar. Masih ada 3 siswa yang belum

mencapai ketuntasan yaitu : Dewi Anggi, Satriya dan Safira. Ketiga siswa

ini perlu bimbingan secara lebih intensif lagi agar mampu mengejar

ketertingalan.
DAFTAR PUSTAKA

Arikunto, SuhardjonodanSupardi. 2014. PenelitianTindakanKelas. Jakarta: PT


BumiAksara.
Basrowi&Suwandi. 2008. ProsedurPenelitianTindakanKelas. Bogor: Ghalia
Indonesia.

Daryanto. 2011. PenelitianTindakanKelas. Yogyakarta: Gava Media.

Dimyati dan Mujiono. 2006. BelajardanPembelajaran. Jakarta: RienikaCipta.


Fathurrohman Muhammad. 2015. Model- Model Pembelajaran Inovatif
Alternatif Desain Pembelajaran yang Menyenangkan. Jogjakarta:
Ar- Ruzz Media.
Huda Miftahul. 2013. Model- Model PengajarandanPembelajaranIsu-
IsuMetodisdanParadigmatis. Yogyakarta: PustakaPelajar.
IskandarwasiddanDadangSunendar. 2008. StrategiPembelajaranBahasa.
Bandung: PT RemajaRosdakarya.

Kunandar.2009.
LangkahMudahPenelitianTindakanKelasSebagaiPengembangPro
f esi Guru. Jakarta: PT Rajagrafindo.

Mulyasa. 2011. PraktikPenelitianTindakanKelas. Bandung: PT


RemajaRosdakarya.

Rahyubi, Heri. 2014.


Teori-
TeoriBelajardanAplikasiPembelajaranMotorikDeskripsidanTinjau
anKritis. Bandung : Nusa Media.

Ramlan, dkk. 1994. Bahasa Indonesia Yang Salah danBenar. Yogyakarta:


Andi Offset.

Sardiman. 1994. InteraksidanMotivasiBelajarMengajar. Jakarta: PT Raja


GrafindoPersada.

Slameto. 1991. BelajardanFaktor- Faktor Yang Mempengaruhinya. Jakarta:


Rineka Cipta.
Susanto, Ahmad. 2013. TeoriBelajardanPembelajaran di SekolahDasar.
Jakarta: PT Kharisma Putra Utama.

Tarigan Guntur. 2008. MembacaSebagaiSuatuKetrampilanBerbahasa.


Bandung

Tambubolon, DP.
TT.KemampuanMembacaTeknikMembacaEfektifdanEfisien
. Bandung: Offset Angkasa.

Wibowo, Basuki. 2003. PenelitianTindakanKelas. Direktorat Kependidikan

Yamin, Martinis. 2008. ParadigmaPendidikanKontruktivistik. Jakarta: Gaung


Persada Press.

Zulela. 2012. PembelajaranBahasa Indonesia. Bandung: PT Remaja


Rosdakarya.

http://www.kajianpustaka.com2017/10ModelPembelajaranCIRCdiaksespada

25 Juli 2018 15:30


LAMPIRAN- LAMPIRAN

1
RENCANA PELAKSANAAN PEMBELAJARAN

(RPP)

Satuan Pendidikan : SD Negeri Srondol Kulon 01


Tema : Organ Gerak Hewan dan
Manusia
Subtema : 2 (Manusia dan Lingkungan)
Kelas / Semester : 5/1
Pembelajaran : ke-3
Alokasi waktu : 2 x 35 menit (70)

A. Kompetensi Inti
KI 1: Menerima dan menjalankan ajaran agama yang dianutnya
KI 2: Memiliki perilaku jujur disiplin tanggung jawab santun peduli dan
percaya diri dalam berinteraksi dengan keluarga, teman dan guru.
KI 3: Memahami pengetahuan factual dengan cara mengamati (mendengar
melihat membaca) dan menanya berdasarkan rasa ingin tau tentang
dirinya, makhluk ciptaan Tuhan dan kegiatannya dan benda-benda
yang dijumpainya dirumah, sekolah.
KI 4: Menyajikan pengetahuan factual dalam bahasa yang jelas, logis dan
sistematis dalam karya yang estetis dalam gerakan yang
mencerminkan anak sehat, dan dalam tindakan yang
mencerminkan perilaku anak beriman dan berakhlak mulia.
B. Kompetensi Dasar dan
Indikator Bahasa Indonesia
3.4 Menentukan pokok pikiran dalam teks lisan dan tulisan.
4.1 Menyajikan hasil identifikasi pokok pikiran dalam teks tulis dan
lisan secara lisan tulis dan visual.

Indikator:
 Siswa menjelaskan pokok pikiran dalam sebuah teks lisan dan
tulisan.
 Siswa menyelesaikan hasil identifikasi pokok pikiran dalam teks
tulisa dan lisan secara lisan, tulis dan visual.

IPS
3.1 Mengidentifikasi karakteristik geografis Indonesia sebagai negara
kepulauan/ maritim dan agraris serta pengaruhnya terhadap kehidupan
ekonomi, sosial, budaya, komunikasi serta transportasi.
4.1 Membuat model sederhana alat gerak manusia dan hewan.

Indikator:
 Siswa menjelaskan karakteristik geografis Indonesia sebagai
Negara kepulauan.
 Siswa membuat model sederhana alat gerak manusia dan hewan.

PPKn
1.1 Bersyukur kepada Tuhan Yang Maha Esa atas nilai-nilai Pancasila
dalam
kehidupan sehari-hari.
2.1 Bersikap tanggung jawab, cinta tanah air, dan rela berkorban sesuai
nilai-
nilai sila Pancasila.
3.1 Mengidentifikasi nilai-nilai Pancasila dalam kehidupan sehari-hari.
4.1 Menyajikan hasil identifikasi nilai-nilai Pancasila dalam kehidupan
sehari-hari.

Indikator:
 Siswa bersyukur kepada Tuhan Yang Maha Esa atas nilai Pancasila
dalam kehidupan sehari- hari
 Siswa bersikap tanggung jawab cinta tanah air dan rela berkorban
sesuai nilai- nilai Pancasila
 Siswa mengidentifikasi nilai Pancasila dalam kehidupan sehari- hari
 Siswa menyajikan hasil identifikasi nilai Pancasila
dalamkehidupan sehari- hari.

C. Tujuan Pembelajaran
1. Dengan mengamati peta, siswa mampu mengidentifikasi potensi
kekayaan alam bangsa Indonesiasecara kritis.
2. Dengan mengamati peta, siswa mampu mengidentifikasi kepadatan
penduduk tiap-tiap provinsi secara kritis.
3. Dengan mengamati peta, siswa mampu menunjukkan asal suku-
suku bangsa yang ada di Indonesia secara tepat.
4. Dengan diskusi, siswa mampu menunjukkan daerah-daerah persebaran
agama di Indonesia pada peta secara benar.
5. Dengan wawancara, siswa mengidentifikasi keberagaman penduduk
di daerah tempat tinggalnya secara bertanggung jawab.
6. Dengan membaca dan menulis, siswa menentukan ide pokok dari
bacaan
secara tepat.

D. Materi Pembelajaran
Ide pokok adalah inti dari sebuah bacaan, baik dalam bentuk

paragraph ataupun wacana.Menemukan ide pokok merupakan cara yang

baik bagi pembaca ketika mencoba menambah wawasan pengetahuan

melalui bacaan. Jika siswa mampu menemukan ide pokok dengan baik,

maka pemahamannya melalui bacaan tersebut akan baik pula. Hal ini akan

menambah dampak positif bagi pembaca dari informasi yang didapat dari

bacaan tersebut.
Dalam membaca paragraf, yang terutama harusa ditemukan adalah

pokok pikiran atau ide pokok dalam suatu paragraf.Pokok pikiran yang

terkandung dalam paragraf biasanya terkandung dalam kalimat pertama

atau kalimat terakhir. Jika kalimat pokok terdapat pada kalimat pertama,

maka dapat dipahami bahwa pengarang mrnggunakan cara berfikir

deduktif. Sedangkan jika pikiran pokok terdapat pada akhir paragraf,

penulis menggunakan cara berfikir induktif (Tampubolon, TT: 85).

Menemukan informasi yang terkandung didalam suatu bacaan,

pembaca harus menemukan ide pokok yang terdapat disetiap

paragraf.Selain menentukan ide pokok siswa dituntut untuk menemukan

permasalahan yang terdapat suatu wacana untuk lebih memahami suatu

bacaan.

E. Metode Pembelajaran
1. CIRC (Cooperative Integrated Reading And Composition)
2. Tanya jawab
3. Demonstrasi

F. Media Pembelajaran
Teks bacaan bergambar

G. Sumber Pembelajaran
Buku Tema siswa kelas 5 : Oegan Gerak Hewan dan Manusia kelas V
(Buku Tematik Terpadu Kurikulum 2013, Jakarta: Kementrian
Pendidikan dan Kebudayaan, 2017).

H. Langkah-Langkah Pembelajaran
Deskripsi Kegiatan Alokasi
Waktu
Pendahuluan a. Menyiapkan peserta didik secara fisik 10 menit
dan psikis
1) Guru memberikan salam pembuka
di awal pelajaran
“ Assalamu’alaikum wr.wb “.
2) Guru mengajak siswa berdoa
bersama dengan khidmat.
3) Guru memberi apersepsi kepada
siswa.
b. Memperlihatkan kesiapan diri dengan
mengisi lembar kehadiran.
c. Guru menginformasikan tujuan
pembelajaran yang akan dicapai
setelah kegiatan pembelajaran
dilaksanakan.
d. Guru melakukan apersepsi dengan
melakukan salah satu kegiatan berikut
yaitu tanya jawab, mengulas kembali
beberapa hal tentang kegiatan
sebelumnya, menceritakan
pengalaman, atau kegiatan lainnya
e. Guru menyiapkan media
pembelajaran.
Inti 1. Mengamati 50 menit
a. Siswa mengamati teks bacaan di
buku Tema.
b. Guru cara menentukan ide pokok
pikiran.
c. Siswa menyimak teks bacaan yang
disampaikan oleh guru.

2. Menannya
a. Siswa diarahkan oleh guru
mengajukan pertanyaan
menggunakan kata tanya siapa,
mengapa, di mana, bagaimana,
dan kapan berdasarkan gambar
yang diamati .
b. Siswa lain diberi kesempatan
untuk menjawabnya .
c. Siswa menyebutkan ide pokok
pikiran yang terdapat dalam
paragraf.
d. Siswa dengan bimbingan guru
menentukan jawaban yang benar .
3. Mencoba
a. Siswa dibagi menjadi beberapa
kelompok yang masing masing
kelompok terdiri dari 4 siswa.
b. Siswa berdiskusi menentukan ide
pokok pikiran yang terdapat
dalam paragraf.
c. Siswa menuliskan ide pokok
masing- masing paragraf
4. Mengasosiasi
a. Siswa menjelaskan secara
berkelompok ide pokok paragraf.
b. Siswa melakukan perngamatan
mengenai ide pokok yang terdapat
dalam bacaan.
5. Mengkomunikasikan
a. Siswa menemukan ide pokok
dengan pemahaman dan bahasa
sendiri .
b. Siswa bertanya jawab tentang cara
menemukan ide pokok pada suatu
paragraf .
c. Siswa bekerja sama dengan
kelompoknya mendiskusikan
tentang cara menentukan bahasa
sendiri
d. Siswa bertanya jawab tentang hal
yang belum dimengerti.
6. Penutup
a. Siswa diminta mengerjakan soal
yang diberikan oleh guru.
Penutup 1. Kegiatan ditutup dengan membuat 10 menit
kesimpulan bersama-sama mengenai
pembelajaran yang telah dilakukan.
2. Guru memberi motivasi dan apresiasi
kepada siswa
3. Guru menutup pelajaran dengan doa
penutup dan memberi salam
“wassalamualaikum wr.wb”

I. Penilaian Pembelajaran
Penilaian
A. Teknik Penilaian
1. Penilaian Sikap: Percaya diri, peduli, tanggung jawab, disiplin
2. Penilaian Pengetahuan: Tes tertulis
3. Penilaian Keterampilan: Unjuk Kerja
B. Bentuk Instrumen Penilaian
1. Sikap
a. Disiplin
b. Tanggung Jawab
c. Peduli
d. Percaya Diri
2. Pengetahuan
Siswa mengerjakan soal- soal latihan tertulis, remidial, dan
pengayaan pada buku siswa.
Format penilaian

Hasil Penilaian Pengetahuan


Aspek 1 Aspek 2
Nama Siswa Tercapai Belum Tercapai Belu
Tercapai Terca

Keterangan :
1. Aspek 2: Mengidentifikasi persebaran penduduk dan suku-suke serta agama di Indonesia
2. Aspek 3: Menyebutkan sikap-sikap yang sesuai dan tidak sesuai dengan nilainilai sila Pa

3. Ketrampilan
Penilaian unjuk kerja
a. Mencari ide pokok bacaan
Baik Sekali Baik Cukup Perlu
Aspek Bimbingan
4 3 2 1
Ketepatan Menemukan Hampir Ada Sebagian ide
keseluruhan semua ide beberapa ide pokok yang
ide pokok pokok pokok yang ditemukan
dengan ditemukan tidak tepat. tidak tepat.
tepat. dengan
tepat.
Menunjukka Mampu Mampu Ada Sebagian
n pendukung meunjukkan menunjukka beberapa besar bukti
bukti bukti n hampirbukti pendukung
pendukung pendukung. semua bukti pendukung yang
pendukung. yang tidak ditunjukkan
tepat. tidak tepat.
Waktu Keseluruhan Keseluruhan Keseluruhan Keseluruhan
ide ide ide ide
pokok pokok pokok pokok
ditemukan ditemukan ditemukan ditemukan
dengan dengan dengan dengan
sangat cepat. cukup sangat
cepat. cepat. lambat.
Ketrampilan Keseluruhan Keseluruhan Sebagian Hanya
penulisan: hasil hasil besar sebagian
Ringkasan penulisan penulisan hasil kecil hasil
dibuat dengan ringkasan ringkasan penulisan penulisan
benar, yang yang ringkasan ringkasan
sistematis sistematis sistematis yang yang
dan jelas, dan benar dan benar sistematis sistematis
yang menunjukka menunjukka dan benar dan benar
menunjukkan n n menunjukka menunjukka
keterampilan keterampila keterampila n n
penulisan n n keterampila keterampila
yang penulisan penulisan n n
baik yang yang penulisan penulisan
sangat baik, baik yang terus yang
di berkembang masih perlu
atas rata-rata . terus
kelas. ditingkatkan

b. Menuliskan ide pokok dari bacaan


Baik Sekali Baik Cukup Perlu
Aspek Bimbinga
n
4 3 2 1
Rumusan ide Keseluruha Hampir semua Sebagian Hanya
pokok: Ide n ide ide pokok ditulis besar sebagian
pokok ditulis pokok dalam bentuk ide pokok kecil ide
dalam ditulis kalimat. ditulis pokok
bentuk dalam dalam ditulis
kalimat bentuk bentuk dalam
(Subjek + kalimat. kalimat. bentuk
Predikat). kalimat.
Penggunaan Bahasa Bahasa Indonesia Bahasa Bahasa
Bahasa Indonesia yang baik dan Indonesia Indonesia
Indonesia yang baik benar digunakan yang baik yang baik
yang baik dan dengan dan dan
dan benar efisien dalam benar benar
benar:Bahas digunakan keseluruhan digunaka digunakan
a dengan penulisan. n dengan
Indonesia efisien dan dengan sangat
yang menarik sangat efisien
baik dan dalam efisien dalam
benar keseluruhan dalam sebagian
digunakan penulisan. sebagian kecil
dalam besar penulisan.
penulisan penulisan.
ringkasan.
Ketepatan: Keseluruha Hampirkeseluruha Sebagian Sebagian
Ide n n besar kecil
Pokok yang ide pokok ide pokok yang ide pokok ide pokok
ditulis benar yang ditulis benar dan yang yang
dan sesuai ditulis benar sesuai dengan ditulis ditulis
dengan dan bacaan. benar dan benar dan
bacaan. sesuai sesuai sesuai
dengan dengan dengan
bacaan. bacaan bacaan.

SOAL TES I

1. Isilah soal dibawah ini dengan benar !


Taman Nasional Baluran merupakan perwakilan
ekosistem hutan yang spesifik kering diluar Jawa.
Taman Nasional Baluran terdiri atas tipe vegetasi
savanna, hutan mangrove, hutan musim hutan pantai,
hutan pegununggan bawah, hutan rawa, dan hutan
yang selalu hijau sepanjang tahun.

Ide pokok paragraf tersebut adalah….


a. Taman Nasional Baluran terdiri atas beberapa tipe
b. Taman Nasional Baluran terletak di Pulau Jawa
c. Taman Nasional Baluran merupakan perwakilan ekosistem di Pulau
Jawa
d. Taman Nasional Baluran merupakan jenis hutan mangrove
yang beradadi Pulau Jawa

2. Saya sungguh gembira hari ini, karena dapat merayakan tahun baru
bersama keluarga dan teman-teman, kata paman. Biasanya pada tahun-
tahun yang lalu saya merayakan tahun baru di atas kapal. Semua
penumpang berkumpul di ruang besar, mereka saling bercanda ria.
Ide pokok paragraf diatas adalah ...
a. Paman gembira merayakan tahun baru bersama.
b. Paman menyesal tidak merayakan tahun baru di rumah.
c. Merayakan tahun baru di atas kapal
d. Semua penumpang bercanda ria.

3. Untuk menambah kompetensi di dunia kerja, bahasa Inggris perlu


dikuasai. Penguasaan bahasa Inggris memiliki nilai penting untuk
mendongkrakkemajuan karier. Pada era persaingan dunia kerja yang
semakin kompetitif, seseorang yang menguasai bahasa Inggris otomatis
memiliki peluang kerja. Seseorang yang tidak menguasai bahasa
Inggris peluangnya lebih kecil untuk diterima sebagai karyawan.
Gagasan utama paragraf tersebut adalah....
a. bahasa Inggris untuk mendongkrak kemajuan
b. penguasaan bahasa Inggris bagi pencari kerja
c. dunia kerja semakin kompetitif dengan bahasa Inggris
d. peluang kerja bagi yang tidak bisa berbahasa Inggris

4. Salah satu energi alternatif yang dikembangkan adalah energi biogas


dari kotoran ternak sapi atau kerbau. Keuntungannya bahkan mudah
didapat, ramah lingkungan, aman, ekonomis, dan dapat mengurangi
ketergantungan terhadap bahan bakar minyak.
Ide pokok paragraf di atas adalah ...
a. Ketergantungan terhadap BBM banyak mendatangkan masalah.
b. Keuntungan energi alternatif dapat mengurangi ketergantungan BBM.
c. Salah satu energi alternatif yang dikembangkan adalah energi biogas.
d. Bahan baku energi biogas berupa kotoran ternak sapi dan kerbau.

5. Sampah memiliki bermacam-macam jenis. Ada sampah organik dan


sampah anorganik. Sampah organik adalah sampah sisa-sisa makanan.
Sampah anorganik adalah sampah seperti botol, plastik, kaleng, dan
dari bahan-bahan lain yang tidak dapat membusuk.
Ide pokok paragraf adalah ….
a. Pengelolaan sampah
b. Perkembangan ilmu pengetahuan dan teknologi
c. Jenis-jenis sampah
d. Pengolahan sampah organik dan anorganik

6. (1) Buah mengkudu adalah buah yang berasal dari Asia Tenggara. (2)
Buah ini memiliki bintik-bintik di permukaannya. (3) Sebagian orang
kurang suka buah ini karena aromanya yang tidak enak. (4) Namun ada
juga yang mengonsumsi buah ini dalam bentuk sayur, jus, atau rujak.
Ide pokok paragraph diatas ditunjukkan pada nomer….
a. 1
b. 2
c. 3
d. 5

7. Kini ada ratusan jenis teh yang bisa dinikmati. Bahan bakunya juga tidak
hanya dari daun teh, tetapi juga berbagai jenis buah, seperti apel,
strawberry, atau campuran bermacam buah; atau dari berbagai bunga,
seperti melati dan rosela. Bahkan, ada yang berbahan baku dari dedaunan
lain, seperti pepermint. Akan tetapi, secara umum ada tiga jenis teh yang
dikenal, yaitu teh hitam, teh oolong, dan teh hijau.
Gagasan utama paragraf tersebut adalah....
a. bahan baku teh
b. bahan campuran teh
c. kenikmatan jenis teh
d. jenis-jenis the

8. Upaya Pemkot Semarang dalam memperoleh penghargaan Adipura


tampaknya tidak setengah-setengah. Selain menggerakkan masyarakat,
berbagai aparat terkait juga diminta turun tangan. Salah satu aspek yang
menjadi perhatian serius adalah pembersihan sampah-sampah yang ada di
sungai-sungai. Di samping itu, pembersihan sampah di jalan juga makin
ditingkatkan.
Gagasan utama paragraf tersebut adalah....
a. upaya Pemkot Semarang dalam mendapatkan Adipura.
b. pemkot Semarang menggerakkan masyarakat kota.
c. perhatian Pemkot Semarang pada sampah di kali.
d. pembersihan sampah di jalan makin ditingkatkan.
9. Batik merupakan salah satu warisan kebudayaan Indonesia yang telah
menjadi kebanggaan bangsa. Batik sudah mempunyai tempat tersendiri di
hati masyarakat Indonesia. Batik seakan mampu menyampaikan rasa
kebudayaan bangsa. Keberadaan batik selama ini telah menjadi primadona
di kalangan pecinta mode.
Gagasan utama paragraf tersebut adalah....
a. batik warisan kebudayaan Indonesia.
b. batik kebanggaan bangsa Indonesia.
c. batik lambang kebudayaan Indonesia.
d. batik adalah primadona bangsa Indonesia.

10. Bencana banjir lumpur akibat jebolnya tanggul Situ Gintung di Tangerang
Selatan dapat menimbulkan berbagai macam penyakit. Beberapa penyakit
yang akan timbul sesudah bencana adalah diare, tifus, leptospirosis, dan
demam berdarah. Masalah kesehatan korban dan masyarakat di sekitar
lokasi bencana harus diantisipasi. Beberapa penyakit itu muncul karena
lingkungan kotor dan sumber air bersih tercemarlumpur.
Gagasan utama paragraf tersebut adalah....
a. masalah kesehatan korban bencana harus diperhatikan.
b. bencana banjir lumpur akibat jebolnya tanggul.
c. bencana banjir lumpur menimbulkan berbagai penyakit.
d. beberapa penyakit muncul karena lingkungan kotor.
RENCANA PELAKSANAAN PEMBELAJARAN
(RPP)

Satuan Pendidikan : SD NegeriSrondolKulon 01


Tema : Organ
GerakHewandanManusia
Subtema : 2 (Manusia dan Lingkungan)
Kelas / Semester : 5/1
Pembelajaran : ke-4
Alokasiwaktu : 2 x 35 menit (70)

J. KompetensiInti
KI 1: Menerima dan menjalankan ajaran agama yang dianutnya
KI 2: Memiliki perilaku jujur disiplin tanggung jawab santun peduli dan
percaya diri dalam berinteraksi dengan keluarga, teman dan guru.
KI 3: Memahami pengetahuan factual dengan cara mengamati (mendengar
melihat membaca) dan menanya berdasarkan rasa ingin tau tentang
dirinya, makhluk ciptaan Tuhan dan kegiatannya dan benda-benda
yang dijumpainya dirumah, sekolah.
KI 4: Menyajikan pengetahuan factual dalam bahasa yang jelas, logis dan
sistematis dalam karya yang estetis dalam gerakan yang
mencerminkan anaksehat, dan dalam tindakan yang mencerminkan
perilaku anak beriman dan berakhlak mulia.

K. KompetensiDasardanIndikator
Bahasa Indonesia

3.1 Menentukanpokokpikirandalamtekslisandantulis.

4.1 Menyajikanhasilidentifikasipokokpikirandalamtekstulisdanlisan

secara lisan, tulis, dan visual.

Indikator

 Siswa menjelaskanpokokpikirandalamsebuahtekslisandantulisan.
 Siswamenyelesaikanhasilidentifikasipokokpikirandalamtekstulisan
danlisansecaralisan, tulisdan visual.
PPKn

1.1 BersyukurkepadaTuhan Yang MahaEsaatas nilai


nilaiPancasiladalamkehidupansehari-hari.

2.1 Bersikap tanggung jawab, cintatanah air, danrelaberkorbansesuainilai-

nilaisilaPancasila.

3.1 Mengidentifikasinilai-nilaiPancasiladalamkehidupansehari-hari.

4.1 Menyajikanhasilidentifikasinilai-nilaiPancasiladalamkehidupan

sehari-hari.

Indikator

 Siswa bersyukur kepada Tuhan Yang Maha Esa atas nilai- nilai
Pancasila dalam kehidupan sehari- hari.
 Siswa bertanggung jawab, cinta tanah air dan rela berkorban sesuai
nilai Pancasila.
 Siswa mengidentifikasi nilai- nilai Pancasila dalam kehidupan
sehari- hari
 Siswa menyajikan hasil identifikasi nilai- nilai Pancasila dalam
kehidupan sehari- hari.
IPS

3.1 Mengidentifikasi karakteristik geografis Indonesia sebagai Negara

kepulauan/maritime danagrarissertapengaruhnya terhadap


kehidupan

ekonomi, sosial, budaya, komunikasisertatransportasi.

4.1 Menyajikanhasilidentifikasikarakteristikgeografis Indonesia

sebagai Negara kepulauan/ maritime

danagrarissertapengaruhnyaterhadap

kehidupanekonomi, sosial, budaya, komunikasi serta transportasi.


Indikator

 Siswa mengidentifikasi karakteristik geografis Indonesia sebagai


Negara kepulauan.
 Siswa menyajikan hasi lidentifikasi karakteristik geografis
Indonesia sebagai Negara kepulauan.

L. TujuanPembelajaran
1. Denganmengamatigambar,
siswadapatmengidentifikasikenampakanalambuatan dan kenampakan
alam dengan percayadiri.
2. Denganmengamatigambarpadapeta,
siswadapatmenyebutkankondisigeografismasing-masingpulaubesar di
Indonesia denganpercayadiri.
3. Denganmengamatipeta, siswadapatmemahamikondisiiklim di
Indonesia dengan peduli.
4. Denganmembaca, siswamengidentifikasikeragaman flora dan fauna di
Indonesia dengantanggungjawab.
5. Denganmengamatigambar, siswadapatmengidentifikasiperilaku
yang sesuaidantidaksesuaidengannilai-nilaiPancasiladenganpeduli.
6. Dengan membaca, siswa dapat menemukan ide pokok bacaan
dengan tanggung jawab.
7. Denganberlatih, siswamelakukanoperasipangkatduabilangancacah
dengandisiplin.

M. MateriPembelajaran
Ide pokok adalah inti dari sebuah bacaan, baik dalam bentuk

paragraph ataupun wacana.Menemukan ide pokok merupakan cara yang

baik bagi pembaca ketika mencoba menambah wawasan pengetahuan


melalui bacaan. Jika siswa mampu menemukan ide pokok dengan baik,

maka pemahamannya melalui bacaan tersebut akan baik pula. Hal ini akan

menambah dampak positif bagi pembaca dari informasi yang didapat dari

bacaan tersebut.

Dalam membaca paragraf, yang terutama harusa ditemukan adalah

pokok pikiran atau ide pokok dalam suatu paragraf.Pokok pikiran yang

terkandung dalam paragraf biasanya terkandung dalam kalimat pertama

atau kalimat terakhir. Jika kalimat pokok terdapat pada kalimat pertama,

maka dapat dipahami bahwa pengarang mrnggunakan cara berfikir

deduktif. Sedangkan jika pikiran pokok terdapat pada akhir paragraf,

penulis menggunakan cara berfikir induktif (Tampubolon, TT: 85).

Menemukan informasi yang terkandung didalam suatu bacaan,

pembaca harus menemukan ide pokok yang terdapat disetiap

paragraf.Selain menentukan ide pokok siswa dituntut untuk menemukan

permasalahan yang terdapat suatu wacana untuk lebih memahami suatu

bacaan.

N. Metode Pembelajaran
1. CIRC (Cooperative Integrated Reading And Composition)
2. Tanya jawab
3. Demonstrasi

O. Media Pembelajaran
Teks bacaan bergambar

P. SumberBelajar
Buku Tema siswa kelas 5 : Oegan Gerak Hewan dan Manusia kelas V
(Buku Tematik Terpadu Kurikulum 2013, Jakarta: Kementrian Pendidikan
dan Kebudayaan, 2017).

Q. Langkah – LangkahPembelajaran
Deskripsi Kegiatan Alokasi
Waktu
Pendahuluan f. Menyiapkan peserta didik secara fisik dan 10
psikis menit
4) Guru memberikan salam pembuka di
awal pelajaran
“ Assalamu’alaikum wr.wb “.
5) Guru mengajak siswa berdoa bersama
dengan khidmat.
6) Guru memberi apersepsi kepada siswa.
g. Memperlihatkan kesiapan diri dengan
mengisi lembar kehadiran.
h. Guru menginformasikan tujuan
pembelajaran yang akan dicapai setelah
kegiatan pembelajaran dilaksanakan.
i. Guru melakukan apersepsi dengan
melakukan salah satu kegiatan berikut
yaitu tanya jawab, mengulas kembali
beberapa hal tentang kegiatan
sebelumnya, menceritakan pengalaman,
atau kegiatan lainnya
j. Guru menyiapkan media pembelajaran.
Inti 7. Mengamati 50
d. Siswa mengamati teks bacaan di buku menit
Tema.
e. Guru cara menentukan ide pokok
pikiran.
f. Siswa menyimak teks bacaan yang
disampaikan oleh guru.

8. Menannya
e. Siswa diarahkan oleh guru
mengajukan pertanyaan menggunakan
kata tanya siapa, mengapa, di mana,
bagaimana, dan kapan berdasarkan
gambar yang diamati .
f. Siswa lain diberi kesempatan untuk
menjawabnya .
g. Siswa menyebutkan ide pokok pikiran
yang terdapat dalam paragraf.
h. Siswa dengan bimbingan guru
menentukan jawaban yang benar .
9. Mencoba
d. Siswa dibagi menjadi beberapa
kelompok yang masing masing
kelompok terdiri dari 4 siswa.
e. Siswa berdiskusi menentukan ide
pokok pikiran yang terdapat dalam
paragraf.
f. Siswa menuliskan ide pokok masing-
masing paragraf
10. Mengasosiasi
c. Siswa menjelaskan secara
berkelompok ide pokok paragraf.
d. Siswa melakukan perngamatan
mengenai ide pokok yang terdapat
dalam bacaan.
11. Mengkomunikasikan
e. Siswa menemukan ide pokok dengan
pemahaman dan bahasa sendiri .
f. Siswa bertanya jawab tentang cara
menemukan ide pokok pada suatu
paragraf .
g. Siswa bekerja sama dengan
kelompoknya mendiskusikan tentang
cara menentukan bahasa sendiri
h. Siswa bertanya jawab tentang hal
yang belum dimengerti.
12. Penutup
b. Siswa diminta mengerjakan soal yang
diberikan oleh guru.
Penutup 4. Kegiatan ditutup dengan membuat 10
kesimpulan bersama-sama mengenai menit
pembelajaran yang telah dilakukan.
5. Guru memberi motivasi dan apresiasi
kepada siswa
6. Guru menutup pelajaran dengan doa
penutup dan memberi salam
“wassalamualaikum wr.wb”

R. PenilaianPembelajaran
A. Teknik Penilaian
1. Penilaian Sikap: Percaya diri, peduli, tanggung jawab, disiplin
2. Penilaian Pengetahuan: Tes tertulis
3. Penilaian Keterampilan: Unjuk Kerja
B. Bentuk Instrumen Penilaian
4. Sikap
a. Disiplin
b. Tanggung Jawab
c. Peduli
d. Percaya Diri
5. Pengetahuan
Siswa mengerjakan soal- soal latihan tertulis, remidial, dan
pengayaan pada buku siswa.
Format penilaian
Hasil Penilaian Pengetahuan
Aspek 1 Aspek 2
Nama Siswa Tercapai Belum Tercapai Belum
Tercapai Tercapai

Keterangan :
1. Aspek 1: Mengenal perilaku yang sesuai dengan nilai-nilai luhur dalam
sila-silaPancasila.
2. Aspek 2: Mengidentifikasi kondisi geografis wilayah Indonesia.
6. Ketrampilan
Penilaian unjuk kerja
c. Mencari ide pokok bacaan
Baik Sekali Baik Cukup Perlu
Aspek Bimbingan
4 3 2 1
Ketepatan Menemukan Hampir Ada Sebagian ide
keseluruhan semua ide beberapa ide pokok yang
ide pokok pokok pokok yang ditemukan
dengan ditemukan tidak tepat. tidak tepat.
tepat. dengan
tepat.
Menunjukka Mampu Mampu Ada Sebagian
n pendukung meunjukkan menunjukka beberapa besar bukti
bukti bukti n hampir bukti pendukung
pendukung pendukung. semua bukti pendukung yang
pendukung. yang tidak ditunjukkan
tepat. tidak tepat.
Waktu Keseluruhan Keseluruhan Keseluruhan Keseluruhan
ide ide ide ide
pokok pokok pokok pokok
ditemukan ditemukan ditemukan ditemukan
dengan dengan dengan dengan
sangat cepat. cukup sangat
cepat. cepat. lambat.
Ketrampilan Keseluruhan Keseluruhan Sebagian Hanya
penulisan: hasil hasil besar sebagian
Ringkasan penulisan penulisan hasil kecil hasil
dibuat dengan ringkasan ringkasan penulisan penulisan
benar, yang yang ringkasan ringkasan
sistematis sistematis sistematis yang yang
dan jelas, dan benar dan benar sistematis sistematis
yang menunjukka menunjukka dan benar dan benar
menunjukkan n n menunjukka menunjukka
keterampilan keterampila keterampila n n
penulisan n n keterampila keterampila
yang penulisan penulisan n n
baik yang yang penulisan penulisan
sangat baik, baik yang terus yang
di berkembang masih perlu
atas rata-rata . terus
kelas. ditingkatkan
d. Menuliskan ide pokok dari bacaan
Baik Sekali Baik Cukup Perlu
Aspek Bimbingan
4 3 2 1
Rumusan ide Keseluruhan Hampir Sebagian Hanya
pokok: Ide ide semua besar sebagian
pokok ditulis pokok ditulis ide pokok ide pokok kecil ide
dalam bentuk dalam bentuk ditulis ditulis pokok
kalimat kalimat. dalam bentuk dalam bentuk ditulis dalam
(Subjek + kalimat. kalimat. bentuk
Predikat). kalimat.
Penggunaan Bahasa Bahasa Bahasa Bahasa
Bahasa Indonesia Indonesia Indonesia Indonesia
Indonesia yang baik dan yang baik dan yang baik yang baik dan
yang baik dan benar benar dan benar
benar:Bahasa digunakan digunakan benar digunakan
Indonesia yang dengan dengan digunakan dengan sangat
baik dan benar efisien dan efisien dalam dengan efisien dalam
digunakan menarik keseluruhan sangat sebagian kecil
dalam dalam penulisan. efisien dalam penulisan.
penulisan keseluruhan sebagian
ringkasan. penulisan. besar
penulisan.
Ketepatan: Ide Keseluruhan Hampir Sebagian Sebagian
Pokok yang ide pokok keseluruhan besar kecil
ditulis benar yang ide pokok ide pokok ide pokok
dan sesuai ditulis benar yang yang yang
dengan dan ditulis benar ditulis benar ditulis benar
bacaan. sesuai dengan dan dan dan
bacaan. sesuai dengan sesuai sesuai dengan
bacaan. dengan bacaan.
bacaan

Soal Tes 2
1. Kelestarian hutan Suaka Margasatwa Nantu di Gorontalo semakin
terancam. Pasalnya, di sana kini mulai hadir penambang liar. Mereka
mencari emas. Penambang liar tersebut jumlahnya mencapai ratusan
orang. Ide pokok bacaan di atas adalah ... .
a. Penyebab penambangan liar di hutan Suaka Margasatwa Nantu
b. Penambangan liar di hutan Suaka Margasatwa Nantu
c. Terancamnya kelestarian hutan Suaka Margasatwa Nantu
d. Mencegah penambangan liar di hutan Suaka Margasatwa Nantu

2. Memainkan alat musik sasando tidaklah mudah. Dibutuhkan harmonisasi


perasaan dan teknik sehingga tercipta alunan nada merdu. Selain itu,
diperlukan keterampilan jari-jemari untuk memetik dawai seperti pada
harpa.
Ide pokok bacaan di atas adalah ... .
a. Teknik memainkan sasando
b. Memainkan sasando itu sulit
c. Memainkan sasando tidak sulit
d. Ciri-ciri alat musik sasando

3. Penyakit influenza termasuk ke dalam penyakit yang penularannya sangat


mudah. Penyakit ini menyebar dari satu orang ke orang lain melalui
kontak langsung. Menurut penelitian terbaru, penyebaran virus flu sangat
terkait dengan level kelembapan udara. Di negara beriklim sedang seperti
Amerika Utara dan Eropa, wabah flu biasanya terjadi di musim dingin.
Sementara di negara tropis influenza menyebar di musim penghujan.
Ide pokok bacaan di atas adalah ... .
a. Jenis penyakit yang penularannya mudah
b. Mudahnya menular
c. Penyebaran penyakit influenza
d. Penyebab penyakit influenza

4. Insomnia bisa disebabkan oleh banyak faktor. Gangguan tidur ini


umumnya disebabkan kecemasan atau beban pikiran, bekerja sampai larut
malam, kondisi tempat tidur yang kurang nyaman, hingga kebiasaan
memakai peralatan elektronik sebelum tidur. Selain itu, hal-hal yang sering
kali sepele tetapi banyak dilakukan juga dapat memicu insomnia.
Contohnya adalah kebiasaan berolahraga di malam hari beberapa saat
sebelum tidur. Dengan alasan kesibukan, banyak orang di perkotaan yang
baru sempat berolahraga pada malam hari. Dengan mengenali
penyebabnya, insomnia akan lebih mudah diatasi.
Ide pokok bacaan di atas adalah ... .
a. Faktor penyebab insomnia
b. Akibat dari insomnia
c. Pengertian insomnia
d. Jenis penyakit gangguan tidur
5. Prestasi olahraga sekolah kita menurun dibandingkan dengan tahun lalu.
Salah satu penyebabnya adalah pembinaan yang tidak berkesinambungan.
Pembinaan olahraga harus dilakukan sejak dini. Salah satu cara yang kita
tempuh adalah menyelenggarakan beberapa kegiatan ekstrakurikuler
olahraga. Siswa dapat memilih sesuai dengan bakat dan minatnya.
Ide pokok bacaan di atas adalah ... .
a. Penyebab prestasi sekolah
b. Pembinaan olahraga yang tidak berkesinambungan
c. Penyebab prestasi anak menurun
d. Penyebab prestasi sekolah menurun

6. Persahabatan Annisa dan Fatimah begitu dekat. Pemikiran dan hobi


mereka sangat cocok. Mereka sudah bersahabat sedari kecil. Hubungan
keduanya sangat erat seperti tidak dapat dipisahkan.
Ide pokok bacaan di atas adalah ... .
a.Persahabatan dua anak yang dekat
b.Bentuk persahabatan
c.Jenis persahabatan
d.Annisa dan Fatimah tidak dapat dipisahkan

7. Festival rakyat di daerahku sangat meriah. Acara tersebut diadakan di


alun- alun dekat keraton. Di sana banyak pedagang yang menjual berbagai
macam barang kebutuhan masyarakat, misal baju, sepatu, dan tas. Tidak
hanya barang-barang, mereka juga menjual makanan tradisional. Wah,
festival ini sangat meriah.
Ide pokok bacaan di atas adalah ... .
a. Acara di alun-alun dekat keraton
b. Festival rakyat
c. Festival rakyat di daerahku
d. Kemeriahan festival rakyat
8. Perayaan tahun baru yang berlangsung meriah di
Jakarta meninggalkan sejumlah persoalan. Satu di antara persoalan
tersebut adalah rusaknya sejumlah taman kota di Jakarta. Kerusakan taman
ini seperti terlihat di Monas Jakarta. Hampir semua tanaman hias yang
berada di area tersebut rusak akibat terinjak-injak ribuan pengunjung.
Ide pokok bacaan di atas adalah ... .
a. Perayaan tahun baru berlangsung meriah
b. Masalah yang muncul setelah perayaan tahun baru
c. Taman kota di Jakarta rusak
d. Tanaman hias rusak diinjak-injak

9. Udara di Bogor terasa dingin. Kali ini dinginnya melebihi hari-hari


sebelumnya. Dinginnya suhu udara di Bogor mencapai 24ºC. Data tingkat
suhu udara ini, terdapat di papan informasi pengukur suhu di jalan-jalan
besar di kota Bogor.
Ide pokok bacaan di atas adalah ... .
a. Suhu di Bogor mencapai 24ºC
b. Keadaan di Bogor
c. Keadaan cuaca di Bogor yang dingin
d. Informasi suhu di jalan-jalan Kota Bogor

10. Pohon memberikan banyak manfaat bagi manusia dan makhluk hidup
lain. Pohon berperan sebagai sumber makanan, obat, dan bahan industri.
Salah satu peran pohon yang tidak kalah penting adalah penghasil udara
segar.
Ide pokok bacaan di atas adalah ... .
a. manfaat pohon bagi kehidupan
b. pohon sebagai penghasil udara segar
c. pohon sebagai sumber makanan
d. Salah satu peran pohon
Kunci Jawaban :
1. C
2. B
3. C
4. A
5. D
6. A
7. D
8. B
9. C
10. A

Mengetahui, Semarang, Agustus 2018


Guru Kelas 5 Peneliti

NurIrianah, S. Pd. Tri Indah Telogowati


................................................ ...............................................
NIP.19621105 198201 2003 NIM. 115-14- 045

KepalaSekolah

SD NegeriSrondolKulon 01

Kurniawati ,S.Pd
...............................................
NIP.19700525 200221 2 004
Daftar Nilai Ulangan Harian (Pra Siklus)

No. Nama Siswa L/P Nilai KKM Ketuntasan


1 Satriyo Bagus P. L 60 70 Tidak Tuntas
2 Widya Atania Z. P 55 70 Tidak Tuntas
3 Permata Sari P 70 70 Tuntas
4 Ahnaf Fairus R. L 65 70 Tidak Tuntas
5 Al Azhar Kirana P 40 70 Tidak Tuntas
6 Diandra A.R. P 60 70 Tidak Tuntas
7 Farel Army W. L 40 70 Tidak Tuntas
8 Joyata Mazaya P 75 70 Tuntas
9 M. Ricky M. L 40 70 Tidak Tuntas
10 R. Dwi Kresna L 75 70 Tuntas
11 Risky Putra A. L 55 70 Tidak Tuntas
12 Tiandika N. P. L 65 70 Tidak Tuntas
13 Aditya Putra P. L 40 70 Tidak Tuntas
14 Almira R. P 80 70 Tuntas
15 Arkan Shalif S. L 45 70 Tidak Tuntas
16 Dewi Anggi A. P 35 70 Tidak Tuntas
17 Diva Septian H. L 70 70 Tuntas
18 Hilmiya H. P 75 70 Tuntas
19 Laella O. S. P 55 70 Tidak Tuntas
20 M. Hafiz S. L 50 70 Tidak Tuntas
21 M. Khadaffi L 30 70 Tidak Tuntas
22 Raka Fernando L 60 70 Tuntas
23 Satriya M. L 55 70 Tidak Tuntas
24 Teguh Saputro L 75 70 Tuntas
25 Vannya Dwi H. P 75 70 Tuntas
26 Zahnuba Aulia R. P 80 70 Tuntas
27 Tegar Alief N. L 70 70 Tuntas
28 M. Farhan L 45 70 Tidak Tuntas
29 Shafira N. S. P 40 70 Tidak Tuntas
30 Yoga Whisnu P. L 60 70 Tidak Tuntas
Rata- rata 54,6
LEMBAR PENGAMATAN
PROSES BELAJAR
MENGAJAR RESPONDEN
GURU

Nama Sekolah : SDN Srondol Kulon 01 Semarang


Tahun Pelajaran : 2018/2019
Kelas/ Semester : V/ I
Pokok Bahasan : Menemukan Ide Pokok

Siklus I

NO. KEGIATAN 4 3 2 1
1. Apersepsi v
2. Penjelasan Materi v
3. Penjelasan model v
pembelajaran CIRC
4. Teknik Pembagian v
Kelompok
5. Penguasaan kelas v
6. Pengelolaan kegiatan v
Diskusi
8. Bimbingan kepada v
Kelompok
9. Pemberian pertanyaan v
atau kuis
10. Kemampuan
melakukan v
Evaluasi
11. Memberikan
penghargaan v
individu dan kelompok
12. Menentukan nilai v
individu dan kelompok
13. Menyimpulkan materi v
Pembelajaran
14. Menutup pembelajaran v
KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

Semarang, 8 Agustus 2018


Lembar Observasi Siswa Yang Tidak Aktif

Kegiatan
No. Nama Siswa 1 2 3 4 5 6 7 8 9 10
1 Satriyo Bagus P. v v
2 Widya Atania Z. v
3 Permata Sari
4 Ahnaf Fairus R. v
5 Al Azhar Kirana
6 Diandra A.R.
7 Farel Army W. v
8 Joyata Mazaya
9 M. Ricky M. v v
10 R. Dwi Kresna
11 Risky Putra A. v v
12 Tiandika N. P.
13 Aditya Putra P. v v
14 Almira R.
15 Arkan Shalif S. v
16 Dewi Anggi A.
17 Diva Septian H. v
18 Hilmiya H.
19 Laella O. S.
20 M. Hafiz S.
21 M. Khadaffi
22 Raka Fernando
23 Satriya M. v v
24 Teguh Saputro v
25 Vannya Dwi H.
26 Zahnuba Aulia R.
27 Tegar Alief N. v
28 M. Farhan
29 Shafira N. S.
30 Yoga Whisnu P. v
Keterangan :
17. Mengantuk 9. “Nyletuk”
18. Mengerjakan tugas lain 10. Pindah- pindah tempat
duduk
19. Berisik
20. Keluar masuk kelas
21. Mengganggu siswa lain
22. Melamun
23. Usil
24. Corat- coret di kertas

Semarang, 8 Agustus

2018
Lembar Pengamatan kegiatan Pembelajaran dengan model CIRC Siklus I

No Nama siswa Minat Partisipasi Presentasi


.
4 3 2 1 4 3 2 1 4 3 2 1
1. Satriyo Bagus P. v v v
Widya Atania Z. v v v
Permata Sari v v v
Ahnaf Fairus R. v v v
2. Al Azhar Kirana v v v
Diandra A.R. v v v
Farel Army W. v v v
Joyata Mazaya v v v
3. M. Ricky M. v v v
R. Dwi Kresna v v v
Risky Putra A. v v v
Tiandika N. P. v v v
4. Aditya Putra P. v v v
Almira R. v v v
Arkan Shalif S. v v v
Dewi Anggi A. v v v
5. Diva Septian H. v v v
Hilmiya H. v v v
Laella O. S. v v v
M. Hafiz S. v v v
6. M. Khadaffi v v v
Raka Fernando v v v
Satriya M. v v v
Teguh Saputro v v v
Vannya Dwi H. v
7. Zahnuba Aulia R. v v v
Tegar Alief N. v v v
M. Farhan v v
Shafira N. S. v v v
Yoga Whisnu P. v v v
KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

Semarang, 8 Agustus 2018


Lembar Observasi GuruSiklus II

NO. KEGIATAN 4 3 2 1
1. Apersepsi v
2. Penjelasan Materi v
3. Penjelasan model v
pembelajaran CIRC
4. Teknik Pembagian v
Kelompok
5. Penguasaan kelas v
6. Pengelolaan kegiatan v
Diskusi
8. Bimbingan kepada v
Kelompok
9. Pemberian pertanyaan v
atau kuis
10. Kemampuan
melakukan v
Evaluasi
11. Memberikan
penghargaan v
individu dan kelompok
12. Menentukan nilai v
individu dan
kelompok
13. Menyimpulkan materi v
Pembelajaran
14. Menutup pembelajaran v
KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)

Semarang, 15 Agustus
2018
Lembar Observasi Siswa Yang Tidak Aktif Siklus II

No. Nama Siswa Kegiatan


1 2 3 4 5 6 7 8 9 10
1 Satriyo Bagus P. v
2 Widya Atania Z.
3 Permata Sari
4 Ahnaf Fairus R.
5 Al Azhar Kirana
6 Diandra A.R.
7 Farel Army W.
8 Joyata Mazaya
9 M. Ricky M. v v
10 R. Dwi Kresna
11 Risky Putra A.
12 Tiandika N. P.
13 Aditya Putra P. v
14 Almira R.
15 Arkan Shalif S.
16 Dewi Anggi A.
17 Diva Septian H.
18 Hilmiya H.
19 Laella O. S.
20 M. Hafiz S.
21 M. Khadaffi
22 Raka Fernando
23 Satriya M.
24 Teguh Saputro v
25 Vannya Dwi H.
26 Zahnuba Aulia R.
27 Tegar Alief N. v
28 M. Farhan
29 Shafira N. S.
30 Yoga Whisnu P.
Keterangan :
1. Mengantuk 9. “Nyletuk”
2. Mengerjakan tugas lain 10. Pindah- pindah tempat
duduk
3. Berisik
4. Keluar masuk kelas
5. Mengganggu siswa lain
6. Melamun
7. Usil
8. Corat- coret di kertas
Semarang, 15 Agustus
2018
Lembar Pengamatan kegiatan Pembelajaran dengan model
CIRC Siklus II

No. Nama siswa Minat Partisipasi Presentasi


4 3 2 1 4 3 2 1 4 3 2 1
1. Satriyo Bagus P. v v v
Widya Atania Z. v v v
Permata Sari v v v
Ahnaf Fairus R. v v v
2. Al Azhar Kirana v v v
Diandra A.R. v v v
Farel Army W. v v v
Joyata Mazaya v v v
3. M. Ricky M. v v v
R. Dwi Kresna v v v
Risky Putra A. v v v
Tiandika N. P. v v v
4. Aditya Putra P. v v v
Almira R. v v v
Arkan Shalif S. v v v
Dewi Anggi A. v v v
5. Diva Septian H. v v v
Hilmiya H. v v v
Laella O. S. v v v
M. Hafiz S. v v v
6. M. Khadaffi v v v
Raka Fernando v v v
Satriya M. v v v
Teguh Saputro v v v
Vannya Dwi H. v v v
7. Zahnuba Aulia R. v v v
Tegar Alief N. v v v
M. Farhan v v v
Shafira N. S. v v v
Yoga Whisnu P. v v v

KETERANGAN :
SB = SANGAT BAIK (4)
B = BAIK (3)
C = CUKUP (2)
K = KURANG (1)
Semarang, 15 Agustus
2018
PROFIL SDN SRONDOL KULON O1

1. Gambaran Umum SDN Srondol Kulon 01

1. Lokasi Penelitian

a. Tempat penelitian : SDN Srondol Kulon 01

b. Alamat Penelitian : Jl. Dr Setiabudi 193 B

c. Kelurahan : Srondol Kulon

d. Kecamatan : Banyumanik

e. Kabupaten/ Kota : Semarang

f. Provinsi : Jawa Tengah

2. Data Guru MI Sruwen 04

No. Nama Guru Jabatan

1. Kurniawati, S.Pd. Kepala Sekolah

2. Mujiani, S.Pd. Guru Kelas 1A

3. Nur Irianah, S.Pd. Guru Kelas 5A

4. Sugimin, S.Pd. Guru Kelas 4A

5. Sri Narti, A. Ma. Pd. Guru Penjas


6. Eli Marlina, S. Pd. Guru PAI

7. Widiastuti Kumala Dewi, S.Pd. Guru Kelas 2

8. Amoempoeni, S.Pd. Guru Kelas 6

9. Nur Ida Prastiwi, S.Pd. Guru Kelas4B

10. Yustina Ana Mayasari Guru Kelas5B

11. Rita Ety Nurcahyati, S.Pd.SD Guru Kelas 3

12. Fitrianawati, S.Pd Guru Kelas 1B

13. Agus Heri Penjaga Sekolah

14. Muji Agus Setiyani TU

2. Keadaan Umum SD ini:

1. Gedung sekolah : 1 ruang

2. Ruang Kantor UKS : 1 Ruang

3. Kantor Guru : 1 Ruang

4. Ruang TU/ Penjaga : - Ruang

5. Ruang Gugus/ KKG : - Ruang

6. Ruang Perpus : 1 Ruang

7. Ruang Ukas : 1 Ruang

8. Laboratorium : - Ruang

9. Ruang Kesenian : 1 Ruang

10. Ruang Olah Raga : - Ruang

11. Ruang Serba Guna : 1 Ruang

12. Ruang Tamu : ada


13. Tempat Upacara : ada

14. Meja/ Kursi Murid : 154/303 Buah

15. Meja/ Kursi Guru : 18/17 Buah

16. Meja/ Kursi TU :- Buah

17. Meja/ Kursi KS : 2/1 Buah

18. Almari Murid/ Guru : 12 Buah

19. Almari KS : 2 Buah

20. Almari TU/ Penjaga : - Buah

21. Papan Tulis : 12 Buah

22. Papan Pajangan Kelas : 12 Buah

23. Rak Kelas/Guru : 1 Buah

24. Rak KS/R. TU : - Buah

25. Tiang Bendera : 1 Buah

26. KM Murid/ Guru : 2/1 Buah

27. WC Murid/ Guru : 3 Buah

28. Mesin Ketik/ Komputer : 2/9 Buah

29. Kipas Angin :- Buah

30. TV/ Radio/Tape : 3 Buah

31. Kebun Sekolah : Ada

32. Sumur/ PDAM : Ada

33. Listrik : 3500 KWH

34. Dapur Sekolah : Ada

35. Rmh Dinas Penjaga : 1 Unit


DOKUMENTASI

Proses Pembelajaran Menggunakan Model CIRC Siklus I

Gambar 1. Guru Mempersiapkan Peserta Didik

Gambar 2. Guru Membentuk Kelompok Diskusi


Gambar 3. Guru Memberikan Bimbingan Kelompok

Gambar 4. Siswa melakukan diskusi Kelompok


Gambar 5. Masing- masing kelompok mempresentasikan hasil diskusi

Gambar 6. Siswa mengerjakan soal siklus I

Proses Pembelajaran Menggunakan Model CIRC Siklus II


Gambar 7. Guru mempersiapkan peserta didik

Gambar 8. Guru membentuk kelompok diskusi


Gambar 10. Siswa melakukan diskusi kelompok

Gambar 11. Guru memberikan bimbingan kelompok


Gambar 12. Siswa mempresentasikan hasil diskusi

Gambar 13. Siswa mengerjakan soal siklus II


Gambar 14. Guru menutup pembelajaran dan memberikan kesimpulan

Gambar 15. Semua siswa dan guru bersama peneliti


SATUAN KETERANGAN KEGIATAN

Nama : Tri Indah Telogowati

NIM : 115-14-045

Jurusan : PGMI

DosenPembimbing Akademik : Dr. Siti Zumrotun, M. Ag.

No. Nama Kegiatan Pelaksanaan Sebagai Nilai


1. “Training pembuatan
makalah” 17 September Peserta 2
yang diselelnggarakan oleh 2014
lembaga dakwah kampus
(LDK)
2. Kajian Ekonomi Islam November- Peserta 2
selama Desember 2014
Bulan November- Desember
2014
3. Pentas seni dan diskusi 2
“Potret Kebudayaan Bagian 11 Desember Peserta
dari Kekayaan Indonesia ”. 2014
4. Talk show “Ciptakan 2
Karakter 19 September Peserta
Mahasiswa Religius dan 2014
Berakhlak Mulia”.
5. Peran UU Sisdiknas dan 2
Permendikbud dalam 2 Mei 2016 Peserta
penerapan kurikulum 2013
6 . Achiement Motivation 2
Training (AMT) “Dengan 23 Agustus 2014 Peserta
AMT Semangat
Menyongsong Prestasi”
7. Seminar Internasional 24 September Peserta 8
“Petani Untuk Negri”. 2015
Festival solidaritas untuk
petani Indonesia.
8. Sekolah Pasar Modal “Level 13 Oktober 2014 Peserta
Basic 1 Atau Pendidikan 2
Tingkat 1”
9. Pengakraban Mahasiswa
Baru 27 Agustus 2014 Peserta 2
PGMI STAIN Salatiga.
”Harmoni Keluarga PGMI
yang Humanis dan
Berkarakter”
10. Diklat Ekonomi Islam.
“Menciptakan Generasi
yang Berpegang Teguh 22-23 November Peserta 3
Prinsip Ekonomi Syariah 2014
Untuk Kemajuan
Perekonomian Indonesia ”
11. Workshop Enterpreneurship.
(Optimalisasi peran 2
mahasiswa 10 September Peserta
Dalam Berwirausaha untuk 2014
Kemajuan Perekonomian
Indonesia)
12. OPAK STAIN Salatiga.
d“Aktualisasi Gerakan 18-19 Agustus Peserta 3
Mahasiswa Yang Beretika, 2014
Disiplin dan Berpikir
Terbuka”
13. PLCPP XXV. “Racana 25-27 September Peserta 3
Sebagai Gada Terdepan 2015
Pelaku Perubahan”
14. Seminar Nasional Meretas
Bullying. “Mengembangkan 17 Desember Peserta 8
Layanan Kemanusiaan 2016
Berbasis Kearifan Lokal
Komunitas”
15. Tabligh Akbar “Membangun
Karakter Mahasiswa Islamic 14 oktober 2014 Peserta 2
Entrepreneurship ”
16. Workshop Enterpreneurship
“Menanamkan Nilai- Nilai 22 Agustus 2014 Peserta 2
Jiwa Kewirausahaan
Mahasiswa yang Kreatif dan
Inovatif”
17. Festival Budaya PGMI.
Jalan sehat semarak hari jadi 15 November Peserta 2
PGMI ke-10. 2017
“Bersama kita bisa”.
18. Orientasi Dasar Keislaman
(ODK). “Pemahaman islam 21 Agustus 2014 Peserta 2
rahmatan lil’alamin sebgai
langkah awal menjadi
mahasiswa berkarakter”
19. Pendidikan dasar
pengkoperasian . 28 November Peserta 2
“Membangun Jiwa 2014
Enterpreneur dengan
berkoperasi ”
20. Seminar Nasional
“Optimalisasi sumber daya 14 oktober 2014 Peserta 8
insane terhadap lembaga
keuangan syariah”
21. Seminar Nasional “
Kesehatan Islami”. Wisata 10 Agustus 2015 Peserta 8
hati kota Salatiga

22. Seminar Nasional


“Indonesia Budayaku
Indonesia Warisanku 2 Juni 2016 Peserta 8
(Salatiga Kota Pustaka)”.

23. Festival Tari dan


Musyawarah Wilayah
(MUSWIL). Ikatan 10 November Panitia 4
Mahasiswa Pendidikan Guru 2016
Madrasah Ibtidaiyah (HMJ
PGMI)

24. Surat Keputusan Panitia


kegiatan Festival Tari dan
Musyawarah Wilayah 9 November Panitia 4
(MUSWIL). Ikatan 2016
Mahasiswa Pendidikan Guru
Madrasah Ibtidaiyah (HMJ
PGMI)
25. Edukasi Literasi Keuangan
Bersama OJK .” Literasi
Keuangan Syariah dan 12 Oktober 2015 Panitia 4
Kebijakan
Mikroprudensia dalam
Stabilitas Ekonomi”.
26. Seminar Nasional
Enterpreneurship 16 November Peserta
diselenggarakan oleh 2014 8
gerakan
Pramuka racana kusuma
dilaga- woro srikandi.
27. PAB JQH AL- Furqon
STAIN Salatiga. 13-14 Desember Peserta 3
“Menumbuhkan Karakter 2014
Islami dan Qur’ani”.

28. Library User Education 23 Agustus 2014 Peserta 2


(Pendidikan Pemustaka)
Jumlah 100
DAFTAR RIWAYAT HIDUP

Dengan ini penulis mencantumkan riwayat hidup sebagai berikut

: Nama : Tri Indah Telogowati

NIM : 115-14-045

Tempat/ Tanggal Lahir : Kab. Semarang, 12 Juli 1994

Jenis Kelamin : Perempuan

Alamat : Jl. Tamtama Timur IV no. 160 A. Rt 01/ Rw 01

Kelurahan Jangli, Kecamatan Tembalang, Kota

Semarang.

Agama : Islam

Riwayat Pendidikan :

1. SDN Bandarjo 01 Ungaran lulus tahun 2006

2. SMP Islam Ungaran lulus tahun 2009

3. SPMA H. Moenadi Ungaran lulus tahun 2012

Demikian riwayat hidup penulis, penulis buat dengan sebenar-benarnya.

Salatiga, 4 September 2018

Penulis,

Tri Indah Telogowati


NIM. 11514045
PERNYATAAN PUBLIKASI SKRIPSI

Assalamu’alaikum Wr. Wb.

Saya yang bertanda tangan dibawah ini :

Nama : Tri Indah Telogowati

NIM 11514045

Fakultas : Tarbiyah dan Ilmu Keguruan

Jurusan : Pendidikan Guru Madrasah Ibtidaiyah (PGMI)

Menyatakan bahwa skripsi ini benar- benar karya saya sendiri dan tidak

berkeberatan untuk dipublikasikan oleh perpustakaan IAIN Salatiga tanpa

menuntut konsekuensi apapun.

Dengan surat pernyataan ini saya buat dan jika dikemudian hari terbukti

bahwa skripsi saya ini bukan karya saya sendiri, maka saya sanggup untuk

menanggung konsekuensinya. Atas perhatiannya saya ucapkan terima kasih.

Wassalamu’alaikum Wr. Wb.