Anda di halaman 1dari 8

TBL SISTEM OBSTETRI DAN GINEKOLOGI

BATCH AGUSTUS 2020

1. Seorangperempuan, 29 tahun, G1P0A0 UK 16 minggudatanfkepolikandungandengankeluhanmual


dan muntasebanyak 5x/hariselama masa kehamilannya. Muntaktidakhanyadirasakan pada pagihari.
Pasien juga mengeluhkanpenurunan BB sebanyak 2Kg. Pada pemeriksaantanda vital dalambatas
normal. Pada pemeriksaanfisiktidakditemukanadanyanafasbebaubuah. Pada
pemeriksaanurindidapatkansenyawa 3-beta-hidroksibutirat. Apakahtatalaksana yang paling tepat?
a. Dimenhidrinat
b. Prometzine
c. Doksilamin
d. Vitamin B6
e. Pengaturan diet saja
2. Seorangperempuan, 26 tahun, G1P0A0, UK 39 mimnggudatangdengankeluhankeluar air
derasdarkemaluan 15 menit yang lalu. Pasien juga mengeluhkanperutterasamulas. Pada
pemeriksaantanda vital dalambatas normal. Pada pemeriksaanleopold I tidakterababagianjanin.
Leopold II terababulatkeras di sisikiridenganballotemen. Leopold III terababagiankeciljanin. Pada
pemeriksaan VT ditemukantalipusatteraba di vagina denganpulsasi (+),
selaputketubantelahrobekdenganpembukaan 4cm. apakah diagnosis pasien?
a. G1P0A0 inpartu kala I faseaktifdengan KPD dan letaklintang
b. G1P0A0 inpartu kala I faseaktifdengan prolapse talipusat dan letaklintang
c. G1P0A0 inpartu kala I faseaktifdengan KPD dan prolapse talipusat
d. G1P0A0 inpartu kala I faseaktifdengan KPD
e. G1P0A0 inpartu kala I faseaktifdenganletaklintang
3. Seorangperempuan, 56 tahun, datangkepolidiantarkeluarganyadengankeluhannyeripinggang dan
lututterutamasaatberaktivitas. Pasien juga mengeluhseringmengalami rasa panaspdawajah.
Pasienmnegakuhaidtidakteratur dan jumlahsemakinsedikit. Anggotakeluarganya juga
mengatakanpasienbelakanganmenjadimudahmarahbilaterusiksedikit. Apakahperubahanfisiologi
yang mungkinterjadi pada pasien?
a. Penignkatanrespon ovarium terhadap GnRH
b. Peningkatankadar E2
c. Peningkatan FSH
d. Peningkatankadar progesterone
e. Peningkatankadar testosterone
4. Seorangperempuan, 20 tahun, G1P0A0 UK 31 minggudatangdengansuamike IGD karenakejang 2 jam
yang lalu. Kejangdialamiseluruhtubuhkuranglebihselama 1 menit.
Inimerupakankejangpertamapasien. Pasientidakpernahkontrol ANC selamakehamilan.
Pemeriksaantanda vital didapatkankesadaran compos mentis, TD 180/100mmHg, HR 100x/min, RR
24x/min, suhu 37,3C, Sp)2 99% ambient air. Pada pemeriksaan obstetric dalambatas normal, DJJ
150x/min. pada pemeriksaanurindidapatkan protein urin +3. Apakahtatalaksana yang paling
tepatuntukpasiensaatini?
a. Suplementasioksigen
b. MgSO4
c. Captopril
d. Diazepam
e. Metildopa
5. Seorangperempuan, 24 tahun, post partum per vaginam 1 jam lalu. BBL bayi 4300 gram. Setelah
melahirkandarahtidakkunjungberhentimengalirdarikelamin. Saatdiperiksa, pasienmegalamirobekan
pada jalanlahir. Saatdiperiksaterlihatrobekanjalanlahir yang menembushinggaotot perineum.
Apkaahderajat rupture yang tepat pada pasien?
a. Derajat 1
b. Derajat 2
c. Derajat 3a
d. Derajat 3b
e. Derajat 3c
6. Seorangperempuan, 83 tahun, datangdengankeluhandaerahkemaluanterasapenuhsejak 1 bulanlalu
dan memberat. Pasien juga merasaterkadang BAB sulitkeluar.
Pasienmemilikiriwayatmelahirkanpervaginamsebanyak 4 kali. Pada
pemeriksanfisikditemukanbenjolan yang keluardari vagina 3cm di bawahhimen. Apakah diagnosis
yang paling tepat?
a. Prolapse uteri grade I
b. Prolapse uteri grade II
c. Prolapse uteri grade III
d. Prolapse uteri grade IV
e. Prolapse uteri grade V
7. Seorangperempuan, 25 tahun, dating kepoli kandunga
ndengankeluhannyeriperutsisikananbawahsejak 3 harilalu. Pasienmengakubarusajamenikah dan
setelahberhubunganintimterkadangkeluardarahdarikemaluan. Pada pemeriksaantanda vital
tidakdidapatkankelainan. Pada pemeriksaanfisikdidapatkannyeritekan pada daerahiliacadextra,
tidakterabamassa. Pada inspikuloterdapatfluoralbusdenganportiohiperemis. Swab
fluoralbusmenunjukkantrofozoitberflagella. Apakah diagnosis paling tepat?
a. Salpingitis
b. Servisitis
c. Vaginitis
d. Vulvovaginitis
e. Kankerserviks
8. Seorangperempuan, 25 tahun, datangke IGD dengankeluhannyeri pada perutkiribawah yang
dirasakansejak 30 menitlalu. Nyeri dirasakanmendadakdenganintensitas yang tinggi.
Keluhandisertaimuntah 2 kali. Pasienmemilikiriwayatseringdipijat. Pada pemeriksaantanda vital
ditemukan TD 130/90mmHg, HR 125x/min, RR 26x/min, suhu 37,2C. pada
pemeriksaanfisikditemukannyeri pada adneksakiri. Pada USG ditemukanukuran ovarium
kiri>kanandisertaipenurunanalirandarah pada doppler pada ovarium kiri. Apakahpernyataan yang
kurangtepatuntukpasienini?
a. Pembedahandilakukanuntuk diagnosis pasti
b. Detorsion sebaiknyadalamkurunwaktu<72 jam
c. Kistektomidilakukanbilatidakadatandakeganasan
d. Salpingo-oophorectomy dilakukanbila ovarium nekrotik
e. Factor resikopenyakitiniadalahkista ovarium
9. Seorangperempuan, 30 tahun, G2P1A0 UK 38
minggudatangkepolikandungandengankeluhanbelakangansangatseringhaus.
Pasientidakpernahmemeriksakankehamilannya di doktersebelumnya. Riwayat DM di
keluargadisangkal. Riwayat kehamilananakpertamatidakadakelainan. Pada pemeriksaantanda vital
dalambatas normal. Doktermelakukanpemeriksaangula dan didapatkanhasil GDP 140g/dL dan TTGO
2 jam sebesar 200 g/dL. Apakah diagnosis paling tepat?
a. Diabetes gestasional
b. DM tipe I
c. DM tipe II
d. Diabetes insipidus gestagen
e. Diabetes insipidus dipsogen
10. Seorangperempuan, 30 tahun, post partumanakpertam 15 menit yang lalu per vaginam.
Plasentalahirlengkap. Saatinikeluardarah yang tidakkunjungberhentidarijalanlahir. Pada
peemeriksaantanda vital tidakditemukanadanyakelainan. Pada pemeriksaanfisikditemukan uterus
lembek. Dokterlangsungmelakukanmasase uterus. Apakahtindakan yang
sebaiknyadilakukanberikutnya?
a. Infusoksitosin 20-40 IU
b. Lakukanperegangantalipusat
c. Histerektomi
d. Lakukanreposisi manual
e. Histeroraphy
11. Seorangperempuan, 45 tahun,
datangkepuskesmasbersamadengansuaminyauntukmembicarakanstrategi KB.
Pasientelahmelahirkan 3 anaksebelumnya, anakterakhirberusia 11 tahun.
Pasienmengeluhkantakutmengalamikehamilan yang tidakdiharapkan. Apakahtujuankontrasepsi
pada kasusini?
a. Menurunkankesuburan
b. Menjarangkankehamilan
c. Menundakehamilan
d. Mengakhirikesuburan
e. Meningkatkankesuburan
12. Seorangperempuan, 28 tahun, datangkepolikandunganuntukmelakukan ANC berkala.
padaANCsebelumnya, TFU pasien 21cm dengan UK 35 minggu. Pada pemeriksaantanda vital
saatinitidakditemukankelainan. Pada pemeriksaan obstetric ditemukan TFU 21 cm, DJJ 110x/min.
doktermenyarankandilakukanpemeriksaan USG denganhasil AFI 3,2cm.
tidakterlihatadanyapertumbuhan femur leghtsejak ANC sebelumnya. Apakah diagnosis janin yang
paling mungkin pada kasusini?
a. IUGR
b. Small for gestational age
c. Oligohidramninon
d. Insufisiensiplasenta
e. Prematuritas
13. Seorangperempuan, 17 tahun, datangdengankeluhankeluarfesesdarijalanlahirterutamasaat BAB.
Pasienseringtidakdapatmenahan BAB. Keluhankeluar air senidari vagina disangkal.
Pasienmemilikiriwayatmelahirkanpervaginam 2 kali fitolonh oleh dukun beranak. Pada
pemeriksaanfisikditemukanadanyahubunganantarasalurancerna 4 cm darijalanlahir.
Apakahpernyataan yang tepat pada kasusini?
a. Defekterletak pada dinding posterior vagina
b. Tidakdiperlukanpembedahan pada kasusini
c. Fistula jenisinidisebut fistula anovaginal
d. Fistula jenisiniterjadi di bawahlinea dentata
e. Prolapse jenisinidisebur prolapse rektovagina
14. Seorangperempuan, 26 tahun, datangkepolikandungandengankeluhankeputihansejak 3 harilalu.
Keputihandirasakankental dan menggumpaldisertaidengan rasa gatalhebat pada daerahkemaluan.
Pada inspikuloditemukangambarancoxtage-cheese.
Doktermenyarankanuntukdilakukanpemeriksaanpenunjang. Apakahpemeriksaanpenunjang yang
paling tepatuntukkasusini?
a. NAAT test
b. Wet mount
c. Kultur agar subaraud
d. Ferning test
e. Potassium hydroxide test
15. Seorangperempuan, 32 tahun, datangdengankeluhannyeri pada area kemaluan yang dirasakansejak
5 harilalu. Nyeri dirasakanterutamasaatbergantiposisi dan berjalan.
Pasienmenyangkalberhubunganseksualbeberapaini. Pada pemeriksaantanda vital
ditemukandemamsubfebris. Pada inspeksi vulvovaginal ditemukanbenjolankemerahan pada vagina
sisikiri di balik labia mayora. Massa fluktuasi (+) dan nyeribiladitekan. Apakah diagnosis yang tepat?
a. Bartolinitis
b. Kistabartolin
c. Absesbartolin
d. Kistagartner
e. Vulvitis
16. Seoarangperempuan, 32 tahun, G2P1A0 UK 35 mingguberdasarkan HPHT,
dibawakarenamengalamikejangkuranglebih 1 menit. Pada pemeriksaantanda vital didapatkan TD
170/90mmHg, HR 120x/min, RR 29x/min, suhuh 37,3C. pada pemeriksaanobsteridiemukan TFU 1 jari
di bawah proc. Xyphoideus, DJJ 135x/min, tidakadapembukaan. Pada
pemeriksaanpenunjangditemukan protein urin dipstick +3. Dokterkemudianmemberikanterapi
MgSO4. Terapikemudiandihentikankarenaterjaditandatoksisitas. Apakahtanda paling
awaldarimunculnyatoksisitas pada pasienini?
a. Reflex patella menghilang, nafas < 16x, muka panas, bicara sulit, penurunan kesadaran
b. Hentinafas
c. Hentijantung
d. Anuria
e. Hiperventilasi
17. Seorangperempuan, 27 tahun G1P0A0 UK 9 minggudatanguntukmelakukan ANC rutin. Pada
pemeriksaantanda vital tidakditemukankelainan. Pada pemeriksaan obstetric
tidakditemukankelainan. Pada pemeriksaanpenunjangdarahdidapatkan Hb 10g/dL, Ht 28%,
denganleukosit 7500sel/mm3. Serum ferritin 9mg/L. pasienmenyangkalriwayatanemiasebelumnya
dan tidakmenderitapenyakitapapun.
Pasienmengakusaathamilmakanberkurangkarenamuntahterutamapagihari. Apakahtatalaksana yang
tepat?
a. Sulfasferosus 1x300 mg hinggaakhir masa kehamilam
b. Sulfasferosus 1x300 mg hingga Hb 11g/dL
c. Besi elemental 60mg/harihinggaakhir masa kehamilan
d. Besi elemental 180mg/harihingga HB 11g/dL
e. Besi elemental 60mg/harisebanyak 90 tablet sejak ANC pertama
18. Seorangperempuan, 25 tahun, G1P0A0 UK 13
minggudatangdenganperutmulassertakeluardarahdarikemaluansejak 1 jam lalu.
Selaindarahtampakkeluardagingsepertihatiayamdariajlanlahir. Pada pemeriksaantanda vital
ditemukan TD 120/70mmH, HR 97x/min, RR 25x/min, suhu 37C. pada
pemeriksaanfisikdiemukankontraksi uterus kuat. Pada pemeriksaan obstetric ditemukan TFU
sesuaiusiakehamilandengan ostium servikstermuka, DJJ tidakdotemukan. Apakah diagnosis yang
tepat?
a. Abortus insipient
b. Abortus iminens
c. Abortus komplit
d. Abortus inkomplit
e. Missed abortion
19. Seorangperempuan, 30 tahundibawake IGD oleh suaminyakrenalemas yang semakinmemberat.
Beberapa jam sebelumnyapasiensempatmengeluhnyeriperutbawahberat. Pada pemeriksaantanda
vital didapatkan TD 80/60mmHg, HR 120x/min, RR 28x/min, suhu 37,3C. pada
pemeriksaanfisikdidapatkan chandelier sign dan terdapatpenumpukancairan di cavum douglas. Hasil
tesplano (+) denganserumhCG 3000 mIU/mL.apakahtatalaksana definitive yang paling tepat?
a. Resusitasicairan
b. Rawat inap dan observasi
c. Terapimetotreksat
d. Pembedahanlaparoskopi
e. Pembedahanlaparotomi
20. Seorangperempuan, 24 tahun, G2P1A0 UK 23
minggudatangkepolikandungandengankeluhanseringdemam naik turundisertaimenggigil.
Demamtidakdisertaipola yang menentu. Pasienbarupulangdari Papua sebelumnya. Pada
pemeriksaantanda vital didapatkandalambatas normal. Pada
pemeriksaanpenunjangapusandarahtepiditemukangambaran Maurer spots. Apakahtatalaksana yang
tepat?
a. Primakuin
b. Amodiakuin
c. Doksisiklin
d. Tetrasiklin
e. Proguanil
21. Seorangperempuan, 20 tahun, G1P0A0 UK 20 minggudatangdengankeluhanmual dan
muntahhebatdisertaidengannyeriperut. Pasienmengaku 1 harilalukeluardarahdarikemaluan. Pada
pemeriksaantanda vital didapatkan TD 110/80mmHg, HR 80x/min, RR 20x/min, suhu 36,8C. pada
pemeriksaanfisikditemukan TFU setinggi 3 jaridiatas umbilicus. Pada USG
ditemukangambaransnowstprm. Dilakukankuretase dan pada pemeriksaankariotipedidapatkan
46XY. Apakah diagnosis yang paling tepat?
a. Molakomplitmonosperma
b. Molakomplitdisperma
c. Molaparsial
d. Plasenta previa
e. Abortus insipens
22. Seorangperempuan, 28 tahun, G1P1A0 UK 24 minggudatangkepolikandunganuntuk ANC rutin.
Pasienmengeluh 2 harilalusempatkeluardarahdarikemaluan yang berhentisendiri.
Keluhannyeriperutdisangkal. Janinmasihberd=gerakaktif. Anak pertamaapsiendilakurkansecara SC.
Pada pemeriksaantanda vital didapatkan TD 110/70mmHg, HR 88x/min, RR 24x/min, suhu 36,8C.
pada inspikulotidakditemukandarah yang keluardriserviks. TFU 2 jaridiatas umbilicus, DJJ 130x/min.
Manakah yang bukanmerupakan factor resikopemicukondisipasientersebut?
a. Riwayat SC
b. Merokok
c. Primigravida
d. Usia maternal >35 tahun
e. Serum alfa-fetoprotein maternal tinggi
23. Seorangperempuan, 29 tahun, post partumanak ke-2 3 harilaludatangdengankeluhandemam yang
tidakkunjungturun. Pasien juga mengeluhkankeluar lochia kekuningan yang berbau. Pada
pemeriksaantanda vital didaptkan TD 100/70mmHg, HR 85x/min, RR 20x/min, suhu 38,3C. pada
pemeriksaanfisikditemukan TFU tepat di umbilicus dengannyeritekan fundus (+). Pakaahtatalaksana
yang tepatuntukpasien?
a. Dilatasikuretase
b. Eksplorasikavum uteri
c. Perbaikankeadaanumum dan rencanakankuretase
d. Perbaikankeadaanumum dan antibiotic
e. Perbaikankeadaanumum dan tampon uterus
24. Seorangperempuan, 37 tahun,
datangkepolikandungandengankeluhankeluarperdarahandarijalanlahirsejak 1 minggulalu. Darah
terutamakeluarsetelahbersenggama. Pasien juga mengakubeberapabulaninimengalamihaid yang
tidakteratur. Pasienmemilikiriwayatbekerjasebagai PSK 15
tahunlalunamunsudahberhentisejakmenikah. Pada pemeriksaantanda vital dalambatas normal. Pada
pemeriksaanfisikditemukan duh vagina berwarnakecoklatandenganbautidaksedap. Pada
pemriksaaninspikuloditemukanserviks yang mudahberdarahdengansentukan.
Pemeriksaanpenunajng biopsy serviksmenunjukkanakrsinomaselskuamosa.
Manakahlokasiterseringawalpenyakitini?
a. Squamocolumnar junction
b. Isthmus
c. Endoserviks
d. Osinterna
e. Ektoserviks
25. Seorangperempuan, 29 tahun, datangkepolidengankeluhannyeriberatsaathaidsejak 3 bulanlalu.
Terkadangnyeridirasakanhinggapasientidakbisabangundaritempattidur. Pasien juga
mengeluhkannyeriperutbawah. Pasienbelummemilikianakwalaupunsudahmencoba 3 tahun. Pada
pemeriksaantanda vital tidakdidapatkankelainan. Pada
pemeriksaanfisikhanyaditemukannyeritekanperut di bawahumbiikus. Pada pemeriksaan USG
ditemukan uterus ukuran 14 minggudenganmassa intrauterine. Apakahtatalaksana yang tepat?
a. Analog GnRH
b. Observasi
c. Ablasiradiofrekuensi
d. Myomektomi
e. Histerektomi
26. Seorangperempuan, 22 tahun, datangkeklinikdengankeluhanmudahtumbuhbrewok dan kumis sejak
1 bulanlalu. Pasien juga mengeluhmudahsekalitumbuhjerawat. Pada oemeriksaantanda vital
tidakditemukankelainan. Pada pemeriksaanfisikditemukan BB 110kg dengantinggi 170cm. pada USG
ditemukan ovarium polikistik. Doktermemberikanterapikontrasepsi hormonal oral kombinasi.
Manakahberikutini yang bukanmerupakankriteriauntuk diagnosis kondisipasientersebut?
a. Poli-ovulasi
b. Oligo-ovulasi
c. Anovulasi
d. Testosterone >70ng/dL
e. Volume ovarium >10cc
27. Seorangperempuan, 38 tahun, datangkedokteruntukmelakukancheckuprutin.
Pasienbelumemmilikianak. Pasienmerupakanperokokberatselama 10 tahunterakhir. Ibu
pasiensudahmenjalanimastektomi pada usia 40 tahundenganpenyebab yang tidakdiketahui. Pada
pemeriksaanfisikditemukan patch berskuama pada papilla mammae dextradisertaiulserasi. Pada
palpasiregiotersebutterdapatmassakeras dan keluardarahdari putting.
Manakahpemeriksaanpenunjangterbaikuntukkasusini?
a. Mammografi
b. USG
c. Biopsy
d. Rontgent dada
e. Simple mastectomy
28. Seorangperempuan, 23 tahun, datangdengankeluhankeluarcairandarikemaluansejak 3 harillau.
Keluhandisertaidengandemam dan nyeriperutbawah. Pasien juga
mengakumengalaminyerisaatberhubunganseksualsejak 1 bulanlalu. Pada
pemeriksaanfisikditemukannyerigoyangporsio dan nyeri pada adneksa. Pada VT ditemukan duh tbuh
vagina purulent. Doktermenyarankanuntukmelakukanpemeriksaanmikroskopis. Apakah etiologic
yang paling seringmenyebabkanpenyakitini?
a. Pseudohifadenganblasospora
b. Kokobasildengan clue cells
c. Kokus gram (+), catalase (-), resistenbacitrasin
d. Bakteriintraselulerobligat
e. Trofozoit
29. Seorangperempuan, 23 tahun, datangkepolidengankeluhannyeri pada saathaid yang
dirasakanselama 3 bulanterakhir. Keluhandisertainyeri pada saatberhubungan. Pada
pemeriksaantanda vital ditemukan TD 110/70mmHg, HR 90x/min, RR 21x/min, suhu 36,7C. pada
pemeriksaanfisiktidakditemukankelainan. Pada USG transvaginal
ditemukankistacoklatdengangambaran ground glass. Apakahmanifestasi yang
seingmenyertaipenyakitini?
a. Hyperplasia endometrium
b. Infertilitas
c. Maskulinitas
d. Obesitas
e. Amenorea
30. Seorangperempuan, 24 tahun, datangke IGD setelahmenjadi korban pemerkosaan.
Pasienmengakutelahdisetuuhisekitar 6 jam lalu. Apsienmengakuhaidterakhir 3,5 minggu yang lalu
dan memintadokteruntukmencegahkehamilannya. Pada pemriksaanfisikditemukan hematoma
sekitar labia denganlaserasisebesar 0,5cm. tidakada duh tubuhmaupunnyerigoyangportio.
Doktermemberikan 1 tablet mifepristone 600mg. Bagaimanakahobattersebutbekerja?
a. Antagonisesterogen dan progestin
b. Antagonisesterogen
c. Modulator progestin
d. Antagonis progesterone
e. Antagonis prostaglandin