Anda di halaman 1dari 21

ASUHAN KEPERAWATAN PADA KLIEN DENGAN STROKE NON HEMORAGIK

DI RSUP PROF .Dr.R.D. KANDOU MANADO

Di susun oleh :
Nama : Susma Djabu
NIM : 711490120034

POLITEKNIK KESEHATAN KEMENKES MANADO


PRODI NERS LANJUTAN
2020
LAPORAN PENDAHULUAN

A. Pengertian Stroke Non Hemoragik


Stroke non hemoragik merupakan keadaan sementara atau temporer dari

disfungsi neurologik yang dimanifestasikan oleh kehilangan fungsi motorik,

sesorik atau visual secara tiba-tiba. Stroke iskemik atau stroke non hemoragik

terjadi akibat obstruksi atau bekuan (thrombus) yang terbentuk di dalam suatu

pembuluh otak atau pembuluh organ distal (Price & Wilson, 2006). Tidak

terjadi perdarahan namun terjadi iskemia yang menimbulkan hipoksia dan

selanjutnya dapat timbul edema sekunder (Wijaya & Putri, 2013).

B. Etiologi
Penyebab stroke non hemoragik disebabkan oleh faktor yaitu hipertensi,

merokok, peningkatan kolesterol, dan obesitas (Muttaqin, 2014).

1. Peningkatankolesterol

Peningkatan kolesterol tubuh dapat menyebabkan aterosklerosis dan

terbentuknya thrombus sehingga aliran darah menjadi lambat untuk

menuju ke otak, kemudian hal itu dapat menyebabkan perfusi otak

menurun.

2. Obesitas

Obesitas atau kegemukan merupakan seseorang yang memiliki berat

badan berlebih dengan IMT lebih besar daripada 27,8 kg/m².

3. Merokok

Pada perokok akan timbul plaque pada pembuluh darah oleh nikotin
sehingga memungkinkan penumpukan aterosklerosis dan kemudian

berakibat pada stroke.

C. Patofisiologi dan WOC


Infark serebral adalah berkurangnya suplai darah ke area tertentu di
otak. Luasnya infark bergantung pada faktor-faktor seperti lokasi dan
besarnya pembuluh darah dan adekuatnya sirkulasi kolateral terhadap area
yang disuplai oleh pembuluh darah yang tersumbat. Suplai darah ke otak
dapat berubah (makin lambat atau cepat) pada gangguan lokal (trombus,
emboli, perdarahan, dan spasme vaskuler) atau karena gangguan umum
(hipoksia karena gangguan paru dan jantung).
Arterosklerosis sering sebagai factor penyebab infark pada otak.
Trombus dapat berasal dari plak arterosklerotik, atau darah dapat beku pada
area yang stenosis, tem pat aliran darah mengalami pelambatan atau terjadi
turbulensi. Trombus dapat pecah dari dinding pembuluh darah terbawa
sebagai emboli dalam aliran darah. Trombus mengakibatkan iskemia jaringan
yang disuplai oleh pembuluh darah yang bersangkutan dan edema dan
kongesti di sekitar area. Area edema ini menyebabkan disfungsi yang lebih
besar daripada area infark itu sendiri. Edema dapat berkurang dalam beberapa
jam atau kadang-kadang sesudah beberapa hari. Dengan berkurangnya edema
klien mulai menunjukan perbaikan. Oleh karena itu thrombosis biasanya tidak
fatal, jika tidak terjadi perdarahan masif.
Oklusi pada pembuluh darah serebral oleh embolus menyebabkan
edema dan nekrosis diikuti trombosis. Jika terjadi septik infeksi akan meluas
pada dinding pembuluh darah maka akan terjadi abses atau ensefalitis, atau
jika sisa infeksi berada pada pembuluh darah yang tersumbat menyebabkan
dilatasi aneurisma pembuluh darah. Hal ini akan menyebabkan perdarahan
serebral, jika aneurisma pecah atau rupture Perdarahan pada otak disebabkan
oleh ruptur arteriosklerotik dan hipertensi pembuluh darah.
Perdarahan intraserebral yang sangat luas akan lebih sering
menyebabkan kematian dibandingkan keseluruhan penyakit serebro vaskuler,
karena perdarahan yang luas terjadi destruksi massa otak, peningkatan
tekanan intrakranial dan yang lebih berat dapat menyebabkan herniasi otak
pada falk serebei atau lewat foramen magnum. Kematian dapat disebabkan
oleh kompresi batang otak, hemisfer otak, dan perdarahan batang otak
sekunder atau ekstensi perdarahan ke batang otak. Perembesan darah ke
ventrikel otak terjadi pada sepertiga kasus peradarahan otak di nekleus
kaudatus, talamus, dan pons.
Jika sirkulasi serebral terhambat, dapat berkembang anoksia serebral.
Perubahan yang disebabkan oleh anoksia serebral dapat reversibel untuk
waktu 4-6 menit. Perubahan inversibel jika anoksia lebih dari 10 menit.
Anoksia serebral dapat terjadi oleh karena gangguan yang bervariasi salah
satunya henti jantung. Selain kerusakan perenkim otak, akibat volume
perdarahan yang relatif banyak akan mengakibatkan peningkatan tekanan
intrakranial dan penurunan tekanan perfusi otak serta gangguan drainase otak.
Elemen-elemen vasoaktif darah yang keluar dan kaskade iskemik akibat
menurunya tekanan perfusi, menyebabkan saraf di area yang terkena dan
sekitarnya tertekan lagi. (Arif Mutaqin, 2013).
WOC
Faktor-faktor Resiko Stroke

Kebiasaan: merokok, alcohol, Usia tua, obesitas


penggunaan obat terlarang Penyakit kardiovaskuler: fibrasi jantung, jantung koroner, gagal jantung,RHD, Hipertensi,
(kokain) Endokarditis, miokard infark, katup jantung rusak, aterosklerosis, hiperkoagulasi

Penyumbatan pembuluh darah otak oleh bekuan darah, lemak, dan udara

Emboli serebral, suplai darah dan oksigen ke otak

Okulasi yang menybabkan sumbatan aliran darah otak

Hipoksia Sel otak

Iskemik Lobus otak

Defisit Neurologi

Kehilangan kontrol volunter Disfungsi kandung kemih dan saluran pencernaan Infark serebral

Hemiplegi dan hemiparesis 1. Gangguan Eliminasi Urine Resiko Perfusi serebral tidak efektif
2. Inkontinensia Fekal
Gangguan Mobilitas Fisik
D. Pemeriksaan Penunjang
Menurut Muttaqin, (2008), pemeriksaan penunjang yang dapat dilakukan ialah
sebagai berikut :
1. Angiografi serebral
Membantu menentukan penyebab dari stroke secara spesifik seperti
perdarahan arteriovena atau adanya ruptur dan untuk mencari sumber
perdarahan seperti aneurisma atau malformasi vaskular.
2. Lumbal pungsi
Tekanan yang meningkat dan disertai bercak darah pada carran
lumbal menunjukkan adanya hernoragi pada subaraknoid atau
perdarahan pada intrakranial. Peningkatan jumlah protein
menunjukkan adanya proses inflamasi. Hasil pemeriksaan likuor
merah biasanya dijumpai pada perdarahan yang masif, sedangkan
perdarahan yang kecil biasanya warna likuor masih normal
(xantokrom) sewaktu hari-hari pertama.
3. CT scan.
Pemindaian ini memperlihatkan secara spesifik letak edema, posisi
henatoma, adanya jaringan otak yang infark atau iskemia, dan
posisinya secara pasti.Hasil pemeriksaan biasanya didapatkan
hiperdens fokal, kadang pemadatan terlihat di ventrikel, atau
menyebar ke permukaan otak.
4. MRI
MRI (Magnetic Imaging Resonance) menggunakan gelombang
magnetik untuk menentukan posisi dan besar/luas terjadinya
perdarahan otak.Hasil pemeriksaan biasanya didapatkan area yang
mengalami lesi dan infark akibat dari hemoragik.
5. USG Doppler
Untuk mengidentifikasi adanya penyakit arteriovena (masalah sistem
karotis).
6. EEG
Pemeriksaan ini bertujuan untuk melihat masalah yang timbul dan
dampak dari jaringan yang infark sehingga menurunnya impuls listrik
dalam jaringan otak.
E. Konsep Asuhan Keperawatan Teoritis Stroke Non Hemoragik
1. Pengkajian

Pengkajian merupakan kegiatan menganalisis informasi, yang dihasilkan

dari

pengkajianskrininguntukmenilaisuatukeadaannormalatauabnormal,kemudian

nantinya akan digunakan sebagai pertimbangan dengan diagnosa keperawatan

yang berfokus pada masalah atau resiko. Pengkajian harus dilakukan dengan

dua tahap yaitu pengumpulan data (informasi subjektif maupun objektif) dan

peninjauaninformasiriwayatpasienpadarekammedic(Nanda,2018).Pengkajian

melibatkan beberapa langkah-langkah di antaranya yaitu pengkajianskrining.

Dalampengkajianskrininghalyangpertamadilakukanadalahpengumpulandata.

Pengumpulan data merupakan pengumpulan informasi tentang klien yang di

lakukansecarasistemastis.Metodeyangdigunakandalampengumpulandatayaitu

wawancara(anamnesa),pengamatan(observasi),danpemeriksaanfisik(pshysical

assessment).Langkahselanjutnyasetelahpengumpulandatayaitulakukananalisis

data dan pengelompokaninformasi.

Selain itu, terdapat 14 jenis subkategori data yang harus dikaji yakni

respirasi, sirkulasi, nutrisi atau cairan, eliminasi, aktivitas atau latihan,


neurosensori, reproduksi atau seksualitas, nyeri atau kenyamanan, integritas

ego, pertumbuhan atau perkembangan, kebersihan diri, penyuluhan atau

pembelajaran, interaksi sosial, dan keamanan atau proyeksi (Tim Pokja SDKI

PPNI,2017).

Dalamhalini,masalahyangdiambiltermasukkedalamkategorifisiologisdan

subkategori aktivitas atau istirahat. Pengkajian pada masalah gangguan

mobilitas fisik meliputi:

a. Identitas

Identitas pasien yang harus dikaji meliputi nama, jenis kelamin, umur,

alamat, agama, suku, status perkawinan, pendidikan, pekerjaan, golongan

darah, nomor rekam medis, tanggal MRS, diagnosa medis.

b. Datakeluhanutama:keluhanutamamerupakanfaktoryangsangatmendorong

pasienuntukmencaripertolongan.Keluhanyangutamapadapasienstrokenon

hemoragik yaitu mengeluh sulit menggerakkanekstremitas.

c. Data riwayat penyakit sekarang : pasien stroke non hemoragik diawali

gangguan neuromuskular. Gangguan neuromuscular merupakan kondisi

progresifyangdikarakteristikandengandegenerasisarafmotorikdibagian

korteks,intibatangotakdanselkornuanteriorpadamedullaspinalissehingga

menimbulkan ketidakmampuan sistem saraf dan otot untuk bekerja

sebagaimana mestinya (Rianawati & Rahayu,2015)

d. Data riwayat penyakit keluarga : riwayat kelauarga dihubungkan dengan


adanya penyakit keturunan yang di derita seperti misalnya hiperkolesterol,

hipertensi dan storke ringan yang dapat menyebabkan gangguan mobilitas

fisik

e. Data fisiologis

Pada pasien dengan gangguan mobilitas fisik termasuk kedalam kategori

fisiologis dan subkategori aktivitas atau istirahat.

Tabel 2 Kemampuan Mobilitas

Tingkat Kateg
Aktivitas/Mobilit ori
as
Tingkat0 Mampu merawat diri sendiri secara penuh
Tingkat1 Memerlukan penggunaan alat
Tingkat2
Memerlukan bantuan, pengawasan orang lain,
Tingkat3
Memerlukan bantuan, pengawasan orang lain,
dan peralatan
Sangat tergantung dan tidak dapat melakukan atau
Tingkat4
berpartisipasi dalam perawatan
(Sumber: Hidayat, Aziz Alimul. Pengantar Kebutuhan Dasar Manusia
Aplikasi Konsep dan Proses Keperawatan. 2012).

a. Kekuatan otot dan gangguankoordinasi

Derajat kekuatan otot dapat ditentukan dengan skala, presentase kekuatan

otot dan karakteristik.


Tabel 3
Kekuatan Otot dan Gangguan Koordinasi

Presentasi Karakterist
ik
Sk kekuatan
ala otot
1 2 3
0 0 Paralissi sempurna
1 10 Tidak ada gerakan, kontraksi otot dapat di
palpasi atau dilihat
2 25 Gerakan otot penuh melawan gravitasi dengan
topangan
3 50 Gerakan yang normal melawan gravitasi

4 75 Gerakan penuh yang normal melawan


gravitas dan melawan tahanan minimal
Kekuatan normal, gerakan penuh yang normal
5 100
melawan gravitasi dan tahanan penuh
(Sumber: Hidayat, Aziz Alimul. Pengantar Kebutuhan Dasar Manusia
Aplikasi Konsep danProses Keperawatan. 2012).
b. Perubahanpsikologis
Pengkajian perubahan psikologis yang disebabkan oleh adanya gangguan
mobilitas fisik antara lain: perubahan perilaku, peningkatan emosi,perubahan dan
mekanisme koping.
2. Diagnosakeperawatan

Diagnosa keperawatan merupakan suatu penilaian klinis mengenai

respons klien terhadap suatu masalah kesehatan atau proses kehidupan yang

dialaminya baik yang berlangsung aktual maupun potensial. Diagnosa

keperawatan bertujuan untuk mengidentifikasi respon klien individu, keluarga

dan komunitas terhadap

yangberkaitandengankesehatan.Prosespenegakandiagnosa(diagnosticprocess)

merupakan suatu proses yang sistemasis yang terdiri atas tiga tahap yaitu

analisa data, identifikasi masalah dan perumusan diagnosa. Diagnosis

keperawatan memiliki dua komponen utama yaitu masalah (problem) yang

merupakan label diagnosis keperawatan yang menggambarkan inti dari

respons klien terhadap kondisi kesehatan, dan indikator diagnostik. Indikator

diagnostik terdiri atas penyebab, tanda/gejala dan faktor risiko. Pada diagnosis

aktual, indikator diagnostik hanya terdiri atas penyebab dantanda/gejala.

Diagnosa keperawatan yang diambil dalam masalah ini adalah gangguan

mobilitas fisik. Gangguan mobilitas fisik merupakan keterbatasan dalam

gerakan fisik dari satu atau lebih ekstremitas secara mandiri. Gangguan

mobilitas fisik termasuk jenis kategori diagnosis keperawatan negatif.

Diagnosis negatif

menunjukkanbahwakliendalamkondisisakitsehinggapenegakkandiagnosisini

akan mengarah ke pemberian intervensi keperawatan yang bersifat

penyembuhan (Tim Pokja SDKI PPNI,2017).


Penyebab terjadinya gangguan mobilitas fisik antara lain kerusakan

integritas struktur tulang, perubahan metabolism, ketidakbugaran fisik,

penurunan kendali otot, penurunan massa otot, penurunan kekuatan otot,

keterlambatan perkembangan, kekakuan sendi, kontraktur, malnutrisi,

gangguan

muskuluskeletal,gangguanneuromuscular,indeksmasatubuhdiataspersentilke-

75 sesuai usia, efek agen farmakologis, program pembatasan gerak, nyeri,

kurang terpapar informasi tentang aktivitas fisik, kecemasan, gangguan

kognitif, keengganan melakukan pergerakan, gangguan sensori persepsi.

Tanda dan gejala mayor gangguan mobilitas fisik secara subjektif yaitu

mengeluh sulit menggerakkan ekstremitas, dan secara objektif yaitu kekuatan

otot menurun dan rentang gerak (ROM) menurun (Tim Pokja SDKI

PPNI,2017).

Tanda dan gejala mayor minor dari gangguan mobilitas fisik secara

subjektif yaitu nyeri saat bergerak, enggan melakukan pergerakan, merasa

cemas saat bergerak, secara objektif yaitu sendi kaku, gerakan tidak

terkoordinasi, gerakan terbatas, fisik lemah. Kondisi klinis yang terkait

dengan gangguan mobilitas fisik yaitu stroke, cedera medulla spinalis, trauma,

fraktur, osteoarthritis, osteomalasia, ostemalasia dan keganasan (Tim Pokja

SDKI PPNI, 2017).


3. Perencanaankeperawatan
Setelah merumuskan diagnosa dilanjutkan dengan perencanaan dan
aktivitas keperawatan untuk mengurangi, menghilangkan serta mencegah
masalah keperawatan klien. Intervensi keperawatan merupakan segala
treatment yang dikerjakan oleh perawat yang didasarkan pada pengetahuan
dan penilaian klinis untuk mencapai luaran (outcome) yang di harapkan
(Tim Pokja SIKI PPNI, 2018).
Luaran (Outcome) Keperawatan merupakan aspek-aspek yang dapat
diobservasi dan diukur meliputi kondisi, perilaku, atau persepsi pasien,
keluarga atau komunitas sebagai respon terhadap intervensi keperawatan.
Luaran keperawatan menunjukkan status diagnosis keperawatan setelah
dilakukan intervensi keperawatan. Hasil akhir intervensi keperawatan yang
terdiri dari indikator-indikator atau kriteria-kriteria hasil pemulihan
masalah. Terdapat dua
jenisluarankeperawatanyaituluaranpositif(perluditingkatkan)danluarannegat
if (perlu diturunkan) (Tim Pokja SLKI PPNI,2018).
Adapun komponen luaran keperawatan diantaranya label (nama luaran
keperawatan berupa kata-kata kunci informasi luaran), ekspetasi (penilaian
terhadaphasilyangdiharapkan,meningkat,menurun,ataumembaik),kriteriahas
il (karakteristik pasien yang dapat diamati atau diukur, dijadikan sebagai
dasaruntuk menilai pencapaian hasil intervensi, menggunakan skor 1-3
pada pendokumentasian computer-based).
Ekspetasi luaran keperawatan terdiri dari ekspetasi meningkat yang
artinya bertambah baik dalam ukuran, jumlah, maupun derajat atau
tingkatan, menurun artinya berkurang baik dalam ukuran, jumlah maupun
derajat atau tingkatan, membaik artinya menimbulkan efek yang lebih baik,
adekuat, atau efektif. Pemilihan luaran keperawatan tetap harus didasarkan
pada penilaian klinis dengan mempertimbangkan kondisi pasien, keluarga,
kelompok, atau komunitas (Tim Pokja SLKI DPP PPNI,2018).
Intervensi keperawatan memiliki tiga komponen yaitu label, definisi
dan tindakan (Tim Pokja SIKI PPNI, 2018). Label merupakan kata kunci
untuk memperoleh informasi mengenai intervensi keperawatan. Label
terdiri atas satu atau beberapa kata yang diawali dengan kata benda
(nomina) yang berfungsi sebagai deskriptor atau penjelas dari intervensi
keperawatan. Terdapat 18 deskriptor pada label intervensi keperawatan
yaitu dukungan, edukasi, kolaborasi, konseling, konsultasi, latihan,
manajemen, pemantauan, pemberian, pemeriksaan, pencegahan,
pengontrolan, perawatan, promosi, rujukan, resusitasi, skrining dan terapi.
Definisi merupakan komponen yang menjelaskan tentang makna dari
tabel intervensi keperawatan. Tindakan adalah rangkaian perilaku atau
aktivitas yang dikerjakan oleh perawat untuk mengimplementasikan
intervensi keperawatan. Tindakan-tindakan pada intervensi keperawatan
terdiri atas tindakan observasi, tindakan terapeutik, tindakan edukasi dan
tindakan kolaborasi (Tim Pokja SIKI PPNI, 2018).
Tabel 4. Perencanaan Keperawatan pada Stroke Non Hemoragik

NO DIAGNOSA (SDKI) LUARAN (SLKI) INTERVENSI (SIKI)


1. (D.0017) Risiko Perfusi Serebral Tidak (L.02014) Perfusi Serebral Meningkat (I.06198) Pemantauan Tekanan Intrakranial
Efektif Kriteria hasil: Observasi :
1. Tingkat kesadaran meningkat - Identifikasi penyebab peningkatan TIK (mi. Lesi
2. Tekanan Intrakranial menurun menempati ruang, gangguan metabolisme,
3. Sakit kepala menurun edema serebral, peningkatan tekanan vena,
4. Gelisah menurun obstruksi aliran cairan serebrospinal, hipertensi,
5. Kecemasan menurun intrakranial idiopatik)
6. Tekanan darah sistolik membaik - Monitor TD
7. Tekanan darah diastolik - Monitor pelebaran tekanan nadi (selisih TDS dan
membaik TDD)
8. Refleks saraf membaik - Monitor penurunan frekuensi jantung
- Monitor ireguleritas irama napas
- Monitor penurunan tingkat kesadaran
- Monitor perlambatan atau ketidaksimetrisan
respon pupil
- Monitor kadar CO₂ dan pertahankan dalam
rentang yang diindikasikan
- Monitor tekanan perfusi serebral
- Monitor keberhasilan terapi komplementar yang
sudah diberikan
- Monitor efek samping penggunaan analgetik
Teraupetik :
- Pertahankan posisi kepala dan leher netral
Edukasi
- Jelaskan tujuan dan prosedur pemantauan
2. (D.0054) Gangguan Mobilitas Fisik (L.05042) Mobilitas Fisik Meningkat (I.05173) Dukungan Mobilisasi
Mayor Kriteria hasil: Observasi :
S : Mengeluh sulit menggerakan ekstremitas 1. Pergerakan ekstremitas
1. Identifikasi adanya nyeri atau keluhan fisik
O : - Kekuatan otot menurun meningkat
lainnya
- Rentang gerak (ROM) menurun 2. Kekuatan otot meningkat
2. Identifikasi toleransi fisik melakukan pergerakan
3. Rentang gerak (ROM)
Minor 3. Monitor frekuensi jantung dan tekanan darah
meningkat
S : - Nyeri saat bergerak sebelum memulai mobilisasi
- Enggan melakukan pergerakan 4. Monitor kondisi umum selama melakukan
- Merasa cemas saat bergerak mobilisasi
Teraupetik :
O:- Sendi kaku
- Gerakkan tidak terkoordinasi 1. Fasilitasi aktivitas mobilisasi dengan alat bantu
- Gerakkan terbatas (mis. Pagar tempat tidur)
- Fisik lemah 2. Fasilitasi melakukan pergerakan, jika perlu
3. Libatkan keluarga untuk membantu pasien
dalam meningkatkan pergerakan
Edukasi :
1. Jelaskan tujuan dan prosedur mobilisasi
2. Anjurkan melakukan mobilisasi dini
3. Anjurkan mobilisasi sederhana yang harus
dilakukan (mis. Duduk di tempat tidur, duduk di
sisi tempat tidur, pindah dari tempat tidur ke
kursi)

Sumber : Tim Pokja SIKI DPP PPNI. Standar Intervensi Keperawatan Indonesia Definisi dan Tindakan Keperawatan 2018
4. Implementasikeperawatan

Implementasi keperawatan merupakan sebuah fase dimana perawat

melaksanakan rencana atau intervensi yang sudah dilaksanakan

sebelumnya. Berdasarkan terminologi SIKI, implementasi terdiri atas

melakukan dan mendokumentasikan yang merupakan tindakan khusus yang

digunakan untuk

melaksanakanintervensi(TimPokjaSIKIPPNI,2018).Implementasikeperawat

an membutuhkan fleksibilitas dan kreativitas perawat. Sebelum melakukan

tindakan, perawat harus mengetahui alasan mengapa tindakan tersebut

dilakukan. Implementasikeperawatanberlangsungdalamtigatahap.

Fasepertamamerupakan

fasepersiapanyangmencakuppengetahuantentangvalidasirencana,implement

asi rencana,persiapanpasiendankeluarga.Fasekeduamerupakanpuncak

implementasi keperawatan yang berorientasi pada tujuan. Fase ketiga

merupakan transmisi perawat dan pasien setelah implementasi keperawatan

selesai dilakukan (Asmadi, 2008).

5. Evaluasikeperawatan

Evaluasi keperawatan merupakan tindakan akhir dalam proses

keperawatan (Tarwoto & Wartonah, 2015). Evaluasi dapat berupa evaluasi

struktur, proses dan

hasil.Evaluasiterdiridarievaluasiformatifyaitumenghasilkanumpanbaliksela

ma program berlangsung. Sedangkan evaluasi sumatif dilakukan setelah

program selesai dan mendapatkan informasi efektivitas pengambilan


keputusan (Deswani, 2011). Evaluasi asuhan keperawatan

didokumentasikan dalam bentukSOAP.

Data Subjektif (S) dimana perawat menemui keluhan pasien yang masih

dirasakan setelah diakukan tindakan keperawatan, O (Objektif) adalah data

yang berdasarkan hasilpengukuran atau observasi perawat secara langsung

pada pasien dan yangdirasakan pasien setelah tindakan keperawatan, A

(Assesment) yaitu interpretasi makna data subjektif dan objektif untuk

menilai sejauh mana tujuan yang telah ditetapkan dalam rencana

keperawatan tercapai. Dapat dikatakan tujuan tercapai apabila pasien

mampu menunjukkan perilaku sesuai kondisi yang ditetapkan pada tujuan,

sebagian tercapai apabila perilaku pasien tidak seluruhnya

tercapaisesuaidengantujuan,sedangkantidaktercapaiapabilapasientidakmam

pu menunjukkan perilaku yang diharapkan sesuai dengan tujuan, dan yang

terakhir adalah planning (P) merupakan rencana tindakan berdasarkan

analisis. Jika tujuan telah dicapai, maka perawat akan menghentikan

rencana dan apabila belum tercapai, perawat akan melakukan modifikasi

rencana untuk melanjutkan rencana keperawatan pasien. Evaluasi ini

disebut juga evaluasi proses(Dinarti,2013). Evaluasi yang diharapkan

sesuai dengan masalah yang pasien hadapi yang telah dibuat pada

perencanaan tujuan dan kriteria hasil.

Evaluasi penting dilakukan untuk menilai status kesehatan pasien

setelah

tindakankeperawatan.Selainitujugauntukmenilaipencapaiantujuan,baiktujua
n

jangkapanjangmaupunjangkapendek,danmendapatkaninformasiyangtepatda

n jelas untuk meneruskan, memodifikasi, atau menghentikan asuhan

keperawatan yang diberikan (Deswani,2011).

Anda mungkin juga menyukai