Anda di halaman 1dari 1

KLINIK PRATAMA LKC DOMPET DHUAFA

Jl. Sultan HasanudinRuko Blok A RT.01/02, Tambun, Kec. Tambun Sel., Bekasi, Jawa Barat-17510
Telp. (021) 22162169

SURAT KETERANGAN PEMERIKSAAN COVID-19


No.321/KlinikLKCDD/GP/V/2021

Nama Pasien : Rosa Amelia TanggalLahir : Bogor, 14-06-1997


Patient’s Name Date of Birth

JenisKelamin : Perempuan Jam / : 10.00 / 20 Mei 2021


Sex TanggalPengambilanSampel
Times

AlamatPasien : Kp. Ragamukti Rt 002 Rw 001 AlamatPemeriksaan : Philanthropy Building,


Patient’s Address Kel. Citayam Kec. Cijantung Examination Address Jakarta

JenisPemeriksaan Hasil

Rapid Tes Antigen SARS-CoV-2


Negatif
ANTI SARS CoV-2 Antigen

Catatan :
HasilPositifbelumdapatmemastikaninfeksi SARS-CoV-2, hasilPositifdapatterjadipadakondisi :
- Paparan / Infeksi SARS-CoV-2.
- Reaksisilangdengan antibody coronavirus lain / virus lain yang menyerupai.

HasilNegatiftidakmenyingkirkankemungkinanterinfeksi SARS-CoV-2, sehinggamasihberesikomenularkanke orang lain


makatetappatuhiprotokolkesehatan yang berlakusertamenerapkanperilakuhidupsehat.

Saran :
- Lanjutkandenganpemeriksaankonfirmasi PCR.

Demikiansuratketeranganinidibuatdengansebenarnyadanmohon di pergunakansebagai mana mestinya.


This statement is actually made of and use as should be.

Untukkonsultasilebihlanjutdapatmenghubungi CALL CENTER ( 0877 9409 9531 ).


For further consultation, you can contact CALL CENTER (0877 9409 9531 ).

Note. Jakarta, 20 Mei 2021


Akses barcode sebagai link DokterPeriksa,
verifikasikeaslianhasilpemeriksaan.
Access the barcode as a link to verify the
authenticity of the examination results.

dr. Maria Ulfa


SIP : 503/531/dinkes/DU/2018