Anda di halaman 1dari 5

1.

Peserta didik dapat mengidentifikasi pernyataan yang benar mengenai kesetimbangan


tekanan uap dari zat yang berupa cairan dalam sistem tertutup.
2. Peserta didik dapat memprediksi kondisi eksperimental yang paling mungkin untuk
meningkatkan laju produk reaksi yang terbentuk berdasarkan wacana yang diberikan.
3. Peserta didik dapat memprediksi faktor yang memengaruhi kesetimbangan (suhu, luas
permukaan, konsentrasi, tekanan) berdasarkan wacana / teks yang diberikan.
4. Peserta didik dapat menganalisa variabel-variabel yang terlibat dalam melakukan suatu
eksperimen (variabel bebas, variabel terikat, dan atau variabel kontrol) yang berkaitan
dengan sistem kesetimbangan kimia berdasarkan gambar atau pernyataan.
5. Peserta didik dapat menganalisa pernyataan yang benar atau tidak benar berdasarkan
wacana mengenai suatu reaksi kesetimbangan yang diketahui entalpinya (pembentukan,
penguraian atau pembakaran).
6. Peserta didik dapat memberikan alasan yang tepat mengenai perubahan warna secara
tiba-tiba yang terjadi pada titik akhir titrasi asam kuat / lemah – basa kuat /lemah dengan
indikator tertentu (misalnya, BTB, MO, PP, dll).
7. Peserta didik dapat menganalisa pernyataan yang  benar apabila diberikan 2 atau lebih
gambar larutan asam / basa yang berbeda tetapi mempunyai pH sama yang ditempatkan
dalam suatu wadah (misal: asam kuat, asam lemah serta parameter pendukung lainnya).
8. Peserta didik dapat memilih teknik laboratorium kimia yang benar berkaitan dengan
penggunaan peralatan laboratorium tersebut (misalnya, buret, dll.)
9. Peserta didik dapat mengidentifikasi pasangan / kelompok data larutan garam yang
terhidrolisis (sebagian) apabila diberikan tabel 5 data berupa nama garam, persamaan
reaksi hidrolisis dari masing-masing larutan garam tersebut beserta perkiraan pHnya.
10. Peserta didik dapat mengidentifikasi tahapan umum yang menyimpang dalam pembuatan
larutan buffer dengan pH tertentu.
11. Peserta didik dapat menghitung pH larutan campuran senyawa asam lemah dengan
garamnya (buffer) jika parameter pendukung lainnya diketahui.
12. Peserta didik dapat menganalisis fenomena dalam wacana berdasarkan penggunaan
konsep sifat koligatif larutan dalam kehidupan sehari-sehari (misal: pembuatan es krim,
radiator coolant, penambahan NaCl pada salju atau lintah, dll).
13. Peserta didik dapat memprediksi larutan garam yang mempunyai titik beku paling rendah
atau tinggi apabila konsentrasi masing-masing garamnya sama.
14. Peserta didik dapat menghitung massa zat terlarut - berdasarkan wacana sifat koligatif
larutan yang diberikan - jika parameter pendukung lainnya diketahui.
15. Peserta didik dapat menghitung nilai tetapan kenaikkan titik didih molal / tetapan penurunan
titik beku molal apabila disajikan 2 gambar percobaan sifat koligatif larutan elektrolit dan
non elektrolit (titik didik / titikbeku) dengan massa zat yang sama serta diketahui parameter
pendukung lainnya.
16. Peserta didik dapat menghitung massa zat yang diendapkan pada logam yang disepuh
apabila parameter pendukung lainnya diketahui (arus listrik, waktu, dan Ar / Mr).
17. Peserta didik dapat menganalisis pernyataan yang benar mengenai pembuatan senyawa
alkali, alkali tanah, aluminium, nitrogen, oksigen, belerang, silikon, besi, kromium, atau
tembaga yang penting dalam industri (misalnya: NaOH, Na2CO3, NH3, Al2O3, SO3, dll.)
18. Peserta didik dapat mengidentifikasi pernyataan yang benar mengenai manfaat / dampak
(terhadap lingkungan ataupun kesehatan tubuh) atau proses pembuatan senyawa kimia
yang penting dalam industri (misalnya: HNO3, H2SO4, HCl, dll.).
19. Peserta didik dapat menentukan anhidrida dari Ba(OH)2.
20. Peserta didik dapat mengartikan sistem reaksi kimia yang mencapai energi bebas
minimumnya.
21. Peserta didik dapat mengidentifikasi peralatan laboratorium, dengan tingkat akurasi tinggi,
yang harus digunakan untuk membuat larutan garam dengan konsentrasi tertentu.
22. Peserta didik dapat menentukan teknik pemurnian senyawa yang benar - yang banyak
digunakan dalam industry berdasarkan wacana yang diberikan.
23. Peserta didik dapat menganalisis hubungan konfigurasi elektrondan diagram orbital dari
suatu notasi unsur - yang partikel-partikel penyusun atomnya diketahui – dalam kaitannya
dengan letak unsure dalam table periodik.
24. Peserta didik dapat menganalisis konfigurasi elektrondan diagram orbital dalam kaitannya
dengan sifat-sifat periodik unsur (jari-jari atom, elektronegativitas, afinitas elektron atau
yang lainnya).
25. Peserta didik dapat menuliskan konfigurasi elektron untuk salah satu unsure transisi
(nomor atomnya diketahui) tanpa menggunakan notasi gas mulia.
26. Perserta didik dapat menentukan letak golongan-periode dari notasi unsur-unsur (yang
masing-masing jumlah netronnya diketahui) apabila diberikan 2 gambar orbital elektron dari
ion tak sebenarnya.
27. Peserta didik dapat menganalisis salah satu model atom (Thomson, Rutherford, atau Niels
Bohr) berdasarkan gambar model atomnya.
28. Peserta didik dapat menggambarkan struktur Lewis dari 2 buah notasi unsur yang
berikatan – yang masing-masing nomor atomnya diketahui atau yang masing-masing
partikel penyusun atomnya (proton, elektron dan atau netronnya) diketahui.
29. Peserta didik dapat menggunakan teori domain elektron atau teori  hibridisasi dalam
kaitannya dengan prediksi bentuk molekul atau kepolaran senyawa atau sebaliknya.
30. Peserta didik dapat menghitung bilangan oksidasi molekul senyawa atau ion (anion).
31. Peserta didik dapat mengidentifikasi spesi yang berfungsi sebagai oksidator atau reduktor
apabila diberikan persamaan reaksi kimianya.
32. Peserta didik dapat menganalisis tata-nama senyawa atau kelompok senyawa anorganik /
organic berdasarkan struktur senyawa / kelompok senyawa tersebut.
33. Peserta didik dapat menganalisis salah satu hokum dasar kimia (yang diaplikasikan dalam
industri) berdasarkan wacana yang diberikan.
34. Peserta didik dapat menghitung prosentase kadar senyawa pekat (misal, H 2SO4 pekat,
HNO3 pekat, H3PO4 pekat atau yang lainnya) apabila parameter pendukung lainnya
diketahui (massa jenis, konsentrasi, Mr ).
35. Peserta didik dapat menghitung konversi satuan kadar zat (% massa, % volume, ppm,
molaritas atau molalitas berdasarkan wacana (mengenai aplikasinya dalam industri) yang
diberikan.
36. Peserta didik dapat menghitung massa atau volum zat yang dihasilkan pada keadaan
tertentu (reaksi pembatas) – berdasarkan wacana reaksi kimia dalam kehidupan sehari-hari
- jika parameter pendukung lainnya (misalnya, massa dan persamaan reaksi) diketahui.
37. Peserta didik dapat memprediksi rumus struktur dari senyawa turunan benzena
berdasarkan wacana tentang senyawa turunan benzena dalam kehidupan sehari-hari
38. Peserta didik dapat mengidentifikasi salah satu kekhasan atom karbon dalam sintesa
senyawa-senyawa organik.
39. Peserta didik dapat mengidentifikasi pengaruh penambahan air (pengenceran) terhadap pH
larutan buffer.
40. Peserta didik dapat mengidentifikasi factor penentu sifat paramagnetic dan feromagnetik
dari suatu logam transisi.

1. 1. Diberikan suatu struktur hidrokarbon yang memiliki ikatan rangkap, peserta didik
dapat menentukan jenis atom karbon (primer, sekunder, atau tersier) berikut jenis
hibridisasinya secara tepat. (3 jumlah soal)
2. Detail
3. 2. Diberikan tabel berisi beberapa struktur hidrokarbon (alkana, alkena, dan alkuna),
jenis hidrokarbon (jenuh, tak jenuh), dan jenis reaksi yang dapat terjadi (substitusi, adisi,
dll), peserta didik dapat mengidentifikasi pasangan data yang tepat. (3 jumlah soal)
4. Detail
5. 3. Diberikan tabel berisi beberapa fraksi minyak bumi jumlah atom karbon dan
kegunaannya, peserta didik dapat mengidentifikasi pasangan data yang tepat. (3 jumlah
soal)
6. Detail
7. 4. Diberikan beberapa (5 proses) dalam kehidupan sehari-hari (misal: kondensasi,
elektrolisis air, air membeku, dll) peserta didik dapat mengidentifikasi proses yang
tergolong endoterm atau eksoterm secara tepat. (3 jumlah soal)
8. Detail
9. 5. Diberikan persamaan termokimia reaksi netralisasi lengkap, misal: H⁺ (aq) + OH¯ (aq)
→ H2O (l) ∆H = -52 kj mol¯1 , peserta didik dapat menghitung ∆H reaksi netralisasi
suatu asam dan basa tertentu dengan konsentrasi molar tertentu secara tepat.
10.  (3 jumlah soal)
11. Detail
12. 6. Diberikan beberapa persamaan reaksi termokimia lengkap (minimal 2 persamaan)
peserta didik dapat menghitung ∆H suatu persamaan reaksi yang berhubungan melalui
Hukum Hess secara tepat.
13.  (3 jumlah soal)
14. Detail
15. 7. Diberikan data nilai/besarnya laju penguraian suatu zat, peserta didik dapat
menghitung laju pembentukan zat lain dalam suatu persamaan reaksi.
16.  (3 jumlah soal)
17. Detail
18. 8. Diberikan grafik perubahan konsentrasi [X] terhadap waktu, t, suatu persamaan reaksi
X → produk, peserta didik dapat menghitung laju awal reaksi penguraian X berdasarkan
grafik secara tepat.
19.  (3 jumlah soal)
20. Detail
21. 9. Diberikan wacana tentang upaya mengkaji salah satu faktor yang mempengaruhi laju
reaksi (misal: mengkaji pengaruh suhu terhadap laju reaksi Na₂S₂O₃ + HCl), peserta
didik dapat mengidentifikasi secara berturut-turut (suhu, konsentrasi, dan waktu) sesuai
variabelnya (bebas, terikat, atau tetap) secara tepat.
22.  (3 jumlah soal)
23. Detail
24. 10. Diberikan persamaan reaksi kesetimbangan heterogen, peserta didik dapat
menuliskan ungkapan/hukum kesetimbangan (rumus Kc) secara tepat. (3 jumlah soal)
25. Detail
26. 11. Diberikan persamaan kesetimbangan lengkap dengan warna pereaksi dan
produknya, peserta didik dapat memprediksi arah pergeseran perubahan warna yang
terjadi dan nilai K (berkurang/bertambah/tetap) jika diberikan perlakuan tertentu. (3
jumlah soal)
27. Detail
28. 12. Diberikan data percobaan konsentrasi terhadap laju (3 data), peserta didik dapat
menghitung laju reaksi jika konsentrasi masing-masing peraksi diubah.
29.  (3 jumlah soal)
30. Detail
31. 13. Diberikan persamaan kesetimbangan gas lengkap dengan parameter yang
diperlukan, peserta didik dapat menghitung harga Kc sistem kesetimbangan secara
tepat.
32.  (3 jumlah soal)
33. Detail
34. 14. Diberikan persamaan reaksi kesetimbangan gas dan ilustrasi/ diagram susunan
molekul gas pada keadaan kesetimbangan, peserta didik dapat menyimpulkan
hubungan Kc dan Qc berikut arah pergeserannya jika diberikan susunan molekul gas-
gas yang baru secara tepat.
35.  (3 jumlah soal)
36. Detail
37. 15. Diberikan persamaan kesetimbangan setara pada dua suhu berbeda, T₁ dan T₂
berikut nilai Kc masing-masing, peserta didik dapat menjelaskan dan mengidentifikasi
pernyataan yang tepat tentang faktor-faktor yang dapat menggeser kesetimbangan ke
arah kiri atau kanan.
38.  (3 jumlah soal)
39. Detail
40. 16. Diberikan larutan basa kuat dengan pH tertentu sebanyak 1 liter dan parameter
lainnya, peserta didik dapat menghitung massa (gram) padatan yang diperlukan secara
tepat. (3 jumlah soal)
41. Detail
42. 17. Disajikan tabel berisi 4 data larutan asam - basa, (kuat/lemah), nilai Ka/Kb, pH, dan
pOH pada T = 25⁰ C, peserta didik dapat mengidentifikasi pasangan data yang tepat. (3
jumlah soal)
43. Detail
44. 18. Diberikan 4 diagram larutan (2 asam, 2 basa) dengan konsentrasi dan volume
tertentu, peserta didik dapat mengidentifikasi pasangan larutan yang jika dicampurkan
menghasilkan pH netral.
45.  (3 jumlah soal)
46. Detail
47. 19. Disajikan 2 pola kurva (dalam satu grafik yang sama) yang diperoleh dari dua
percobaan (misal: pualam + HCl), peserta didik dapat menjelaskan alasan terjadinya
perbedaan pola grafik secara tepat (misal: jumlah mol sama, luas permukaan CaCO₃
berbeda).
48.  (3 jumlah soal)
49. Detail
50. 20. Diberikan suatu persamaan kesetimbangan asosiasi (pembentukan) dilengkapi
dengan identitas ∆H (∆H < 0; atau ∆H > 0), peserta didik dapat memprediksikan 2 pola
kurva dalam satu grafik % pembentukan produk pada 2 kondisi suhu yang berbeda (T₁
dan T₂).
51.  (3 jumlah soal)
52. Detail
53. Pesertadidikdapatmenentukandampakdaripembakarantidaksempurnasenyawahidrokarb
onterhadapkesehatan.
54. Pesertadidikdapatmenghitungjumlah atom C-primer/C-sekunder/C-
tersierpadarantaisiklik /
alifatikbergugusfungsiataupuntidakapabiladiberikanrumusmolekulsenyawahidrokarbonte
rsebut
55. Pesertadidikdapatmengidentifikasi isomer (rangka, gugusfungsi, atauoptis) yang
mungkinterbentukapabiladiberikantata-nama IUPAC nya.
56. Pesertadidikdapatmenganalisisrumusstruktur, tatanama,
sifatdankegunaansenyawakarbon (halo alkana, alkanol, alkoksialkana, alkanal, alkanon,
asamalkanoat, danalkillalkanoat) berdasarkantabel.
57. Pesertadidikdapatmembedakangolongankarbohidrat (monosakarida, disakarida,
polisakarida) berdasarkanujikarbohidrat (ujiIodium, Biuret, Molish, dll.).
58. Pesertadidikdapatmenjelaskanataumendeskripsikanperbedaanantarmolekulsenyawapoli
mersintetik (misal: nilon-66 dannilon 610, etilendanpolietilen, atau LDPE dan HDPE).
59. Pesertadidikdapatmenjelaskanperbedaaanantaragolongankarbohidrat (mono-, di-,
danatau  polisakarida) berdasarkansatuan unit
pembentuknyaataumenjelaskanperbedaaanantara starches (amilosa, amilopektin,
atauglikogen) denganselulosa.
60. Pesertadidikdapatmembedakansifatkimiadarisenyawakarbon (alkohol/alkanol
denganeter/alkoksialkana, aldehid/alkanaldenganketon/alkanon,
asamalkanoatdanalkilalkanoat) berdasarkan 2 rumusstruktursenyawakarbon yang
diketahui.
61. Diberikanwacanasingkatmengenaibahanbakaretanol,
pesertadidikdapatmengidentifikasimanfaatnyabagikehidupanditinjaudariberbagaiaspek.
62. Diberikanwacanasingkatmengenaikualitasbahanbakar yang
banyakdigunakandalamkehidupan (misalnya, bensin, dll),
pesertadidikdapatmemprediksimutunya.
63. Diberikanwacanasingkatmengenaibensin yang teroksigenasiatauterformulasiulang,
pesertadidikdapatmengidentifikasipengaruhnyaterhadapkesehatanmanusia.
64. Pesertadidikdapatmemprediksipernyataan yang
benarmengenaiterjadinyareaksiendotermikataueksotermikdisertaidenganalasannyaberd
asarkanwacana / teks (yang berisipersamaanreaksikimiadanetalpinya).
65. Pesertadidikdapatmenentukan / memprediksiterjadinyareaksiendotermikataueksotermik
yang paling menguntungkansecaratermodinamikaberdasarkankondisinya
(Δ G, Δ H,danatau TΔ S).
66. Pesertadidikdapatmenginterpretasikan diagram energipotensial (energipotensial vs
koordinatreaksi) darisuatureaksikimia yang menggunakankatalis.
67. Pesertadidikdapatmenghitungentalpipembakaran / pembentukan /
penguraianstandardarisuatusenyawadalampersamaanreaksi yang diberikan, 
apabiladiketahui 3 data mengenaientalpipembentukan / penguraianstandar.
68. Pesertadidikdapatmenghitungbesarnyaenergi yang
diperlukanuntukmenguraikansuatusenyawadenganmassatertentuapabiladiberikan data
nilaienergiikat rata-rata serta parameter pendukunglainnya.
69. Pesertadidikdapatmemprediksikecepatan / laju rata-rata molekul gas yang paling besar
– berdasarkan 5 ilustrasi/gambar yang berasaldari 2 molekul gas yang masing-masing
parameter P dan T nyadiketahui.
70. Berdasarkan data percobaanlajureaksi (konsentrasireaktandanlajunya)
besertapersamaanreaksinya,  pesertadidikdapatmenghitungordereaksinya.
71. Pesertadidikdapatmengidentifikasisifatkoligatif yang paling
praktisdigunakanuntukmenentukantingkat/derajatagregasi protein.
Pesertadidikdapatmenentukanlarutanstandar primer yang
digunakanuntukmenstandarisasilarutanbasadalamsuatutitrasi.