Anda di halaman 1dari 19

KERANGKA ACUAN KERJA/TERM OF REFERENCE

PELAKSANAAN BANTUAN OPERASIONAL KESEHATAN PUSKESMAS


DANA ALOKASI KHUSUS (DAK) NONFISIK BIDANG KESEHATAN
TAHUN ANGGARAN 2022

A. LATARBELAKANG
1. Dasar Hukum
a. Undang-undang Nomor 54 tahun 1999 tentang pembentukan Kabupaten Sarolangun,
Kabupaten Tebo, Kabupaten Muara Jambi dan Kabupaten Tanjung Jabung Timur
(lembaran Negara Republik Indonesia Tahun 1999 Nomor 182.Tambahan lembaran
Negara Republik Indonesia Nomor 3903) sebagaimana telah diubah dengan undang-
undang nomor 14 tahun 2000 tentang perubahan atas Undang-Undang no 54 tahun 1999
tentang pembentukan Kabupaten Sarolangun,Kabupaten Tebo, Kabupaten Muara Jambi,
Kabupaten Tanjung Jabung Timur (Lembaran Negara Republik Indonesia Tahun 2000
Nomor 81, tambahan;
b. Undang-undang Nomor 17 Tahun 2003 Tentang Keuangan Negara (Lembaran Negara
Republik Indonesia Tahun 2003 Nomor 47, Tambahan Lembaran Negara Republik
Indonesia Nomor 3969);
c. Undang-Undang Nomor 1 Tahun 2004 tentang Perbendaharaan Negara (Lembaran Negara
Republik Indonesia Tahun 2004 Nomor 5, Tambahan Lembaran Negara Republik
Indonesia Nomor 4286);
d. Undang-Undang Nomor 25 Tahun 2004 tentang Sistem Perencanaan Pembangunan
Nasional (Lembaran Negara Republik Indonesia Tahun 2004 Nomor 104,Tambahan
Lembaran Negara Republik Indonesia Nomor 4421);
e. Undang-Undang Nomor 33 Tahun 2004 tentang Perimbangan Keuangan Negara antar
Pemerintah Pusat dan Daerah (Lembaran Negara Republik Indonesia Tahun 2004 Nomor
126,Tambahan Lembaran Negara Republik Indonesia Nomor 4438);
f. Undang-Undang Nomor 17 Tahun 2007 tentang Rencana Pembagunan Jangka Panjang
(RPJP) Nasional 2002-2025 . (Lembaran Negara Republik Indonesia Tahun 2007 Nomor
33,Tambahan Lembaran Negara Republik Indonesia Nomor 4700);
g. Undang-undang Nomor 36 Tahun 2009 tentang Kesehatan ;
h. Undang-Undang Nomor 23 Tahun 2014 tentang Pemerintah Daerah . (Lembaran Negara
Republik Indonesia Tahun 2014 Nomor 2440,Tambahan Lembaran Negara Republik
Indonesia Nomor 5578);
i. Peraturan Pemerintah Nomor 58 Tahun 2005 tentang Pengelolaan Keuangan Daerah
( Lembaran Negara Republik Indonesia Tahun 2005 Nomor 140, Tambahan Lembaran
Negara Republik Indonesia Nomor 4578);
j. Peraturan Pemerintah Nomor 65 Tahun 2005 tentang Pedoman Penyusunan Standar
Pelayanan Minimal (SPM) (Lembaran Negara Republik Indonesia Nomor 4585);
k. Peraturan Pemerintah Nomor 6 Tahun 2008 tentang Pedoman Evaluasi Penyelenggaraan
Pemerintah Daerah ( Lembaran Negara Republik Indonesia Tahun 2008 Nomor 19,
Tambahan Lembaran Negara Republik Indonesia Nomor 4815);
l. Peraturan Pemerintah Nomor 8 Tahun 2008 tentang Tahapan ,Tata Cara Penyusunan,
Pengendalian dan Evaluasi Pelaksanaan Rencana Pembangunan Daerah (Lembaran
Negara Republik Indonesia Tahun 2008 Nomor 21.Tambahan Lembaran Negara Republik
Indonesia nomor 4817);
m. Peraturan Presiden Nomor 2 Tahun 2015 tentang Rencana Pembangunan Jangka
Menengah Nasional 2015-2019;
n. Peraturan Pemerintah Nomor 18 Tahun 2016 tentang Perangkat Daerah;
o. Peraturan Menteri dalam Negeri Nomor 13 Tahun 2006 tentang Pedoman Pengelolaan
Keuangan Daerah sebagaimana telah di ubah terakhir dengan Peraturan Menteri Dalam
Negeri No 13 Tahun 2006 tentang Pedoman Pengelolaan Keuangan Daerah;
p. Peraturan Menteri Kesehatan RI Nomor 43 Tahun 2016 tentang Standar Pelayanan
Minimal Bidang Kesehatan;
q. Peraturan Menteri Dalam Negeri Nomor 86 Tahun 2017 tentang Tata Cara Perencanaan,
Pengendalian dan Evaluasi Pembangunan Daerah, Tata Cara Evaluasi Rancangan
Peraturan Daerah tentang Rencana Pembangunan Jangka Menengah Daerah dan
Rencana Kerja Pembangunan Daerah;
r. Peraturan Menteri Kesehatan Nomor 12 Tahun 2021 tentang Petunjuk Teknis Penggunaan
Dana Alokasi Khusus Nonfisik Bidang Kesehatan ;
s. Keputusan Menteri Kesehatan RI Nomir HK.02.02/MENKES/52/2016 tentang Rencana
Strategis Kementerian Kesehatan Tahun 2015-2019;
t. Peraturan Daerah Propinsi Jambi Nomor 07 Tahun 2016 tentang Rencana Pembangunan
Jangka Menengah Daerah (RPJMD) Propisi Jambi Tahun 2016-2021;
u. Peraturan Daerah Kabupaten Tebo Nomor 3 Tahun 2014 tetang Perubahan Atas Peraturan
Daerah Nomor 3 Tahun 2007 tentang rencana Pembangunan Jangka Panjang Kabupaten
Tebo Tahun 2026-2025;
v. Peraturan Daerah Kabupaten Tebo Nomor 06 Tahun 2013 tentang Rencana Tata Ruang
Wilayah Kabupaten Tebo Tahun 2013-2033;
w. Peraturan Daerah Kabupaten Tebo Nomor 08 Tahun 2016 tentang Pembentukan dan
Susunan Perangkat Daerah Kabupaten Tebo (Lembaran Daerah Kabupaten Tebo Tahun
2016 Nomor 8);
x. Peraturan Bupati Nomor 42 Tahun 2016 tentang Kedudukan, Susunan Organisasi, Tugas
dan Fungsi serta Tata Kerja Dinas Kesehatan Kabupaten Tebo;

2. GambaranUmum

DAK Nonfisik Bidang Kesehatan adalah dana yang bersumber dari APBN yang
dialokasikan kepada daerah untuk membantu mendanai kegiatan operasional bidang
kesehatan yang merupakan urusan daerah sesuai dengan prioritas nasional.
Bantuan operasional Puskesmas merupakan bagian dari dana DAK non fisik yang di
manfaatkan puskesmas untuk kegiatan UKM esensial dan Kejadian luar biasa serta
dukungan manajemen Puskesmas
UPTD Puskesmas Bangun Seranten merupakan unit pelaksana Teknis Dinas
Kesehatan kabupaten Tebo yang bertanggung jawab terhadap penyelenggaraan upaya
kesehatan di wilayah UPTD Puskesmas Bangun Seranten di Kecamatan Muara Tabir
Bangun Seranten memiliki 3 Desa binaan dengan estimasi jumlah Penduduk 8.193 jiwa.
Kegiatan- kegiatan Puskesmas mencakupi seluruh daerah binaan Puskesmas tersebut.
No RinciaanMenu/Kompoen Uraian
1 UpayaPenurunanAKI-AKB
A Surveilans Kesehatan Ibu Merupakan pertemuan/kunjungan lapangan ke
dan Bayi desa untuk kegiatan yang berhubungan
pelacakan, dan pendataan / surveilains
kesehatan mulai dari ibu hamil, melahirkan, dan
bayi. Harapannya dapat meningkatkan derajat
kesehatan ibu dan bayi dan menurunkan AKI-
AKB

B Gerakan Perempuan Merupakan pertemuan/kunjungan lapangan ke


Pekerja Sehat Produktif desa dalam rangka kegiatan gerakan perempuan
(GP2SP) pekerja sehat produktif (GP2SP). Harapannya
dapat terbentuk kelompok perempuan pekerja
masa usia produktif yang sehat di masyarakat
C Merupakan pertemuan/kunjungan lapangan ke
Peningkatan Mutu Layanan desa dalam rangka kegiatan peningkatan mutu
Ibu dan Bayi Baru Lahir di layanan ibu dan bayi baru lahir di puskesmas.
Puskesmas dan Rumah Harapannya pelayanan terhadap kesehatan ibu
Sakit dan bayi dapat menjadi baik, dan meningkatkan
derajat kesehatan ibu dan bayi baru lahir
D Merupakan pertemuan/kunjungan lapangan ke
Peningkatan Pemberdayaan
desa dalam rangka kegiatan peningkatan
masyarakat melalui UKBM
pemberdayaan masyarakat melalui UKBM
dalam Upaya penurunan AKI
seperti posyandu, posbindu, SMD dan MMD,
AKB terintegrasi dengan
posyandu lansia dan lain-lain. Harapannya untuk
upaya perbaikan gizi
meningkatkan derajat kesehatan masyarakat,
masyarakat
mulai dari ibu hamil, bayi, balita, sampai lansia
E Merupakan pertemuan/kunjungan lapangan ke
Pemeriksaan Kesehatan, desa dalam rangka kegiatan Pemeriksaan
Pemberian Tablet Tambah Kesehatan, Pemberian Tablet Tambah
Darah,Edukasi Gizi Darah,Edukasi Gizi Seimbang dan Pendidikan
Seimbang dan Pendidikan Kespro Pada Anak Usia Sekolah dan Remaja.
Kespro Pada Anak Usia Harapannya untuk meningkatkan derajat
Sekolah dan Remaja kesehatan melalui gizi yang baik, dan kespro
pada remaja
F Merupakan pertemuan/kunjungan lapangan ke
Pelayanan Kesehatan desa dalam rangka kegiatan Pelayanan
Reproduksi Bagi calon Kesehatan Reproduksi Bagi calon Pengantin,
Pengantin, Pasangan Usia Pasangan Usia Subur (PUS). Harapannya untuk
Subur (PUS) meningkatkan kesehatan reproduksi usia remaja
dan PUS bagi calon pengantin
G Merupakan pertemuan/kunjungan lapangan ke
desa dalam rangka kegiatan Program
Program Perencanaan dan Perencanaan dan Pencegahan Komplikasi
Pencegahan Komplikasi Terintegrasi Desa Siaga. Harapannya dapat
Terintegrasi Desa Siaga meningkatkan kesadaram masyarakat dalam
upaya pencegahan komplikasi untuk penurunan
AKI-AKB
H Merupakan pertemuan/kunjungan lapangan ke
desa dalam rangka kegiatan Pelaksanaan Kelas
Pelaksanaan Kelas Ibu
Ibu ( Kelas Ibu Hamil, Kelas Ibu Balita).
( Kelas Ibu Hamil, Kelas Ibu
Harapannya untuk meningkatkan kesadaran dan
Balita)
pengetahuan ibu hamil dan balita serta
meningkatkan derajat kesehatannya
I Pendampingan ibu hamil, ibu Merupakan pertemuan/kunjungan lapangan ke
nifas, dan bayi (termasuk desa dalam rangka kegiatan Pendampingan ibu
pemantauan faktor resiko/ hamil, ibu nifas, dan bayi (termasuk pemantauan
komplikasi) oleh faktor resiko/ komplikasi). Harapannya untuk
menurunkan AKI- AKB pada masyarakat dengan
kader/mahasiswa/fasilitator/t
cara pendampingan/ turun lapangan secara
enaga lainnya
langsung
2 UpayaPerbaikanGiziMasyarakat
a Merupakan pertemuan /
kunjunganlapangankedesa/ kelurahan untuk
Pendampingan pemantauan pertumbuhan gizi
bayi dan masyarakat. Harapannya agar muali dari
Surveilans Gizi
bayi, balita dan masyarakat dapat terpantau
kesehatan terutama gizinya sebagai upaya
penurunan AKI-AKB

b Merupakan pertemuan / kunjungan lapangan ke


desa dalam rangka kegiatan mepberian
Pendidikan Gizi Melalui pendidikan gizi pada ibu hamil dan balita.
peningkatan konsumsi gizi Harapannya agar bayi dan balita dapat terpantau
pada ibu hamil dan balita kesehatannya sebagai upaya penurunan AKI-
AKB

Merupakan pertemuan /
kunjunganlapangankedesa/ kelurahan untuk
Pertemuan advokasi LP/LS terkait kegiatan
Konvergensi LP/LS dalam
pemantauan pertumbuhan. Harapannya agar bayi
upaya percepatan perbaikan
dan balita dapat terpantau kesehatannya
gizi masyarakat
sebagai upaya penurunan AKI-AKB

Merupakan pertemuan / kunjungan lapangan


kedesa untuk Peningkatan cakupan pelayanan
melalui Kunjungan rumah dalam rangka
konfirmasi balita risiko gangguan pertumbuhan
Pemantauan Tumbuh maupun status gizi (termasuk balita yang tidak
Kembang Balita datang timbang. Harapannya agar mendapatkan
informasi dan data balita yang memiliki gangguan
pertumbuhan sebagai upaya penurunan AKI-AKB

Merupakan pertemuan / kunjungan lapangan ke


desa untuk pelaksanaan pemeriksaan dan
Pemeriksaan dan
pengawasan kualitas air dan sanitasi dasar.
Pengawasan Kualitas Air
Harapannya dapat meningkatkan sanitasi
dan Sanitasi Dasar
lingkungan pada masyarakat.

3 UpayaGerakanMasyarakatHidupSehat(GERMAS)
a Merupakan pertemuan /
kunjunganlapangankedesa/ kelurahan untuk
Kegiatan penggerakkan tokoh masyarakat, tokoh
agama, kader, fasilitator desa, kelompok
masyarakat lainnya untuk melakukan kegiatan
Penggerakan Gerakan
Germas. Harapannya agar masyarakat, tokoh
Masyarakat Hidup Sehat
agama, kader, fasilitator desa, kelompok
masyarakat dapat ikut dapat mealkukan kegiatan
germas sebagai upaya gerakan masyarakat hidup
sehat (GERMAS)

b Pelaksanaan Germas, Merupakan pertemuan / kunjunganlapangan


Aktifitas Fizik, Pemeriksaan kedesa/ kelurahan untuk Aktifikas fisik (senam
Kesehatan Berkala dan rutin, senam hamil, senam lansia, kelompok
Edukasi Gizi Seimbang di komorbid, dll),Harapannya agar lansia,bumi dapat
Tingkat kecamatan/ Wilayah melakukan aktifitas fisik secara rutin germas
sebagai upaya gerakan masyarakat hidup sehat
puskesmas (GERMAS)

Merupakan pertemuan / kunjungan lapangan


Kampanye Lokal dalam kedesa untuk kegiatan Kampanye Lokal dalam
mendukung pelaksanaan mendukung pelaksanaan Germas. Harapannya
Germas agar tersampaikan misi gerakan masyarakat hidup
sehat ke masyarakat
Merupakan pertemuan / kunjungan lapangan
kedesa untuk kegiatan kesehatan olahraga.
Upaya Kesehatan Olahraga Harapannya dapat meningkatkan derajat
kesehatan masyarakat melalui peningkatan
kesehatan olahraga
4 Upayadeteksidini,preventifdanresponspenyakit
a Surveilans Kejadian Ikutan Merupakan pertemuan /
Paska Imunisasi (KIPI) kunjunganlapangankedesa/ kelurahan
pelaksanaan imunisasi untukSurveilans Kejadian Ikutan Paska Imunisasi
(KIPI) pelaksanaan imunisasi. Harapannya agar
kejadian ikutan pasca imunisasi dapat dideteksi
sebagai upaya deteksi dini, preventif dan respons
penyakit

b Validasi sasaran, hasil Merupakan pertemuan /


cakupan imunisasi dan kunjunganlapangankedesa/ kelurahan
Rapid Convinience untukValidasi sasaran, hasil cakupan imunisasi
Assessment (RCA) dan Rapid Convinience Assessment (RCA)
Harapannya agar sasaran dan cakupan dapat
valid Validasi sasaran, hasil cakupan imunisasi
dan Rapid Convinience Assessment (RCA)
sebagai upaya deteksi dini, preventif dan respons
penyakit

6 Pelacakan kasus Kronis atau Merupakan pertemuan /


kasus ikutan atau hasil kunjunganlapangankedesa/ kelurahan untuk
reaksi minum obat pada Pelacakan kasus Kronis atau kasus ikutan atau
Pemberian Obat Pencegah hasil reaksi minum obat pada Pemberian Obat
Masal (POPM). Pencegah Masal (POPM. Harapannya agar reaksi
ikutan POPM dapat di lacak sebagai upaya
deteksi dini, preventif dan respons penyakit
7 Penyelidikan Epidemiologi Merupakan kegiatan pelacakan terhadap kasus
(PE) penyakit potensi KLB penyakit yang berpotensi menjadi kejadian luar
dan penanggulangan KLB. biasa dan penanggulangannya di wilayah
puskesmas. Harapannya penyakit potensial KLB
dapat tertangani

8 Analisa hasil Penyelidikan Merupakan kegiatan menganalisa hasil kegiatan


Epidemiologi (PE) dan PE dan perencanaan nya di wilayah puskesmas.
diseminasi informasi di Harapannya puskesmas dapat membuat
wilayah kerja puskesmas. perencanaan yang efektif dalam penanganan
penyakit
9 Pelacakan kontak kasus Merupakan kegiatan pelacakan terhadap kontak
KLB penyakit yang menjadi KLB. Harapannya
penyebaran penyakit KLB dapat di tekan di
wilayah puskesmas

10 Pelaksanaan surveilans Merupakan kegiatan pelaksanaan surveilans


migrasi malaria. terhadap penyebaran penyakit malaria.
Harapannya penyebaran terhadap nyamuk
Anopheles dapat di tekan
11 Surveilans Penyakit Tidak Merupakan kegiatan kunjungan surveilans
Menular (PTM) dan penyakit terhadap penyakit tidak menular di desa.
berpotensi KLB termasuk Harapannya faktor risiko PTM dapat di deteksi
Penyakit Infeksi Emerging dengan cepat
(PIE) di masyarakat
Survei anak sekolah dalamMerupakan kegiatan kunjungan sekolah untuk
rangka pencegahan dan survei terhadap anak sekolah demi mencegah dan
pengendalian penyakit pegnedalian penyakit. Harapannya dapat
mencegah terhdap penyakit menular pada anak
sekolah
Validasi sasaran, hasil Merupakan pertemuan /
cakupan GME, Depresi, kunjunganlapangankedesa/ kelurahan
ODGJ Berat, untukValidasi sasaran, hasil cakupan GME,
Penyalahgunaan Napza dan Depresi, ODGJ Berat, Penyalahgunaan Napza
Bunuh Diri dan Bunuh Diri.Harapannya data sasaran dapat
valid. sebagai upaya deteksi dini, preventif dan
respons penyakit

Deteksi dini kasus HIV/AIDS, Merupakan pertemuan /


TBC, Hepatitis, Malaria dan kunjunganlapangankedesa/ kelurahan
penyakit menular lainnya untukDeteksi dini kasus HIV/AIDS, TBC, Hepatitis,
pada Ibu hamil dan Malaria dan penyakit menular lainnya pada Ibu
kelompok berisiko. hamil dan kelompok berisiko. Harapannya agar
kasus HIV/AIDS, TBC, Hepatitis, Malaria dan
penyakit menular lainnya pada Ibu hamil dan
kelompok berisiko dapat terdeteksi sebagai upaya
deteksi dini, preventif dan respons penyakit

Deteksi dini faktor risiko Merupakan pertemuan /


PTM di posbindu PTM dan kunjunganlapangankedesa/ kelurahan
Posyandu lansia. untukDeteksi dini faktor risiko PTM di posbindu
PTM dan Posyandu lansia. Harapannya faktor
risiko PTM di posbindu PTM dan Posyandu lansia
dapat terdeteksi. sebagai upaya deteksi dini,
preventif dan respons penyakit

Penemuan kasus PD3I, Merupakan pertemuan /


kasus kontak TB dan kasus kunjunganlapangankedesa/ kelurahan
mangkir, kasus kontak kusta untukPenemuan kasus PD3I, kasus kontak TB
serta orang dengan dan kasus mangkir, kasus kontak kusta serta
gangguan jiwa serta orang dengan gangguan jiwa serta penyakit
penyakit lainnya. lainnya. Harapannya agar kasus PD3I, kasus
kontak TB dan kasus mangkir, kasus kontak kusta
serta orang dengan gangguan jiwa serta penyakit
lainnya dapat ditemukan
sebagai upaya deteksi dini, preventif dan respons
penyakit

Kunjungan ulang kasus Merupakan kegiatan kunjungan terhadap


Acute Flaccyd Paralysis penderita AFP di desa. Harapannya pasien
(AFP). mendapatkan pelayanan dan konseling sehingga
meningkatkan derajat kesehatan pasien tersebut
Konseling dan deteksi dini Merupakan pertemuan /
masalah kesehatan jiwa dan kunjunganlapangankedesa/ kelurahan
napza. untukKonseling dan deteksi dini masalah
kesehatan jiwa dan napza. Harapannya agar
masalah kesehatan jiwa dan napza dapat
terdeteksi secara dini
sebagai upaya deteksi dini, preventif dan respons
penyakit

Pelaksanaan pelayanan Merupakan pertemuan /


imunisasi baik imunisasi kunjunganlapangankedesa/ kelurahan
rutin, pengenalan antigen untukPelaksanaan pelayanan imunisasi baik
baru, imunisasi tambahan, imunisasi rutin, pengenalan antigen baru,
maupun kegiatan defaulter imunisasi tambahan, maupun kegiatan defaulter
tracking. tracking. Harapannya agar pelayanan imunisasi
baik imunisasi rutin, pengenalan antigen baru,
imunisasi tambahan, maupun kegiatan defaulter
tracking dapat terlaksana. sebagai upaya deteksi
dini, preventif dan respons penyakit

Sosialisasi pelaksanaan Merupakan pertemuan / kunjungan lapangan


imunisasi rutin kepada dalam rangka mensosialisasikan kegiatan BIAS di
orangtua dan Bulan sekolah. Harapannya dapat meningkatkan
Imunisasi Anak Sekolah kesadaran dan minat pada guru, dan wali murid
(BIAS) kepada guru dan wali
murid.

Pemberian Obat Pencegah Merupakan pertemuan /


Masal (POPM) untuk kunjunganlapangankedesa/ kelurahan
pencegahan penyakit. untukPemberian Obat Pencegah Masal (POPM)
untuk pencegahan penyakit. Harapannya agar
obat cacing dapat di berikan kepada sasaran
sebagai upaya deteksi dini, preventif dan respons
penyakit
Advokasi/sosialisasi/lokakary Merupakan pertemuan /
a/rapat koordinasi Lintas kunjunganlapangankedesa/ kelurahan
Sektor (LS)/ Lintas Program untukAdvokasi/sosialisasi/lokakarya/rapat
(LP) terkait pencegahan dan koordinasi Lintas Sektor (LS)/ Lintas Program (LP)
pengendalian penyakit. terkait pencegahan dan pengendalian penyakit.
Harapannya agar koordinasi linsek berjalain baik
terkait pencegahan dan pengendalian penyakit.
sebagai upaya deteksi dini, preventif dan respons
penyakit

Penyediaan bahan media Merupakan pertemuan /


Komunikasi, Informasi dan kunjunganlapangankedesa/ kelurahan
Edukasi (KIE). untukPenyediaan bahan media Komunikasi,
Informasi dan Edukasi (KIE). Harapannya agar
bahan bahan media Komunikasi, Informasi dan
Edukasi (KIE) tersedia. sebagai upaya deteksi
dini, preventif dan respons penyakit
Pendataan sasaran POPM. Merupakan pertemuan /
kunjunganlapangankedesa/ kelurahan
untukPendataan sasaran POPM. Harapannyaagar
sasasran POM terdata. sebagai upaya deteksi
dini, preventif dan respons penyakit
Pengambilan obat POPM ke Merupakan pertemuan /
dinas kesehatan kunjunganlapangankedesa/ kelurahan
kabupaten/kota. untukPengambilan obat POPM ke dinas
kesehatan kabupaten/kota. Harapannya agar
logistik POM tersedia sebagai upaya deteksi dini,
preventif dan respons penyakit
Sweeping untuk Merupakan pertemuan /
meningkatkan cakupan kunjunganlapangankedesa/ kelurahan
POPM, imunisasi dan untukSweeping untuk meningkatkan cakupan
penyakit menular lainnya. POPM, imunisasi dan penyakit menular lainnya.
Harapannya agar cakupan POPM dapat tercapai
sebagai upaya deteksi dini, preventif dan respons
penyakit
Pengendalian vektor nyamuk Merupakan pertemuan /
(Pemberantasan Sarang kunjunganlapangankedesa/ kelurahan
Nyamuk, larvasidasi, untukPengendalian vektor nyamuk
fogging, Indoor Residual (Pemberantasan Sarang Nyamuk, larvasidasi,
Spraying (IRS), modifikasi fogging, Indoor Residual Spraying (IRS),
lingkungan). modifikasi lingkungan). Harapannya agar vektor
nyamuk dapat di kendalikan sebagai upaya
deteksi dini, preventif dan respons penyakit
Pemantauan jentik secara Merupakan pertemuan /
berkala. kunjunganlapangankedesa/ kelurahan
untukPemantauan jentik secara berkala.
Harapannya agar jentik nyamuk dapat terpantau
sebagai upaya deteksi dini, preventif dan respons
penyakit

Survei habitat jentik dan Merupakan kegiatan pertemuan/ kunjungan


nyamuk dewasa. lapangan dalam rangka survei tehadapa habitat
jenitk nyamuk faktor pembawa penyakit.
Harapannya terdapat pengendalian habitat
nyamuk dewasa sehingga lingkungan bebas
faktor pembawa penyakit

Distribusi kelambu ke Merupakan pertemuan /


kelompok sasaran di desa. kunjunganlapangankedesa/ kelurahan untuk
pendistribusian kelambu ke sasaran. Harapannya
untuk pencegahan terhadap gigitan nyamuk
pembawa penyakit
Monitoring penggunaan Merupakan pertemuan /
kelambu malaria. kunjunganlapangankedesa/ kelurahan untuk
mengawasi penggunan kelambu di kelompok
sasaran. Harapannya penggunan kelambu dalam
pencegahan dapat terlaksana dengan baik
Penerapan Kawasan Tanpa Merupakan pertemuan /
Rokok (KTR) untuk Desa kunjunganlapangankedesa/ kelurahan
Tanpa Asap Rokok untukPenerapan Kawasan Tanpa Rokok (KTR)
untuk Desa Tanpa Asap Rokok. Harapannya agar
desa dapat memiliki kawasan tanpa asap rokok
sebagai upaya deteksi dini, preventif dan respons
penyakit
Pelatihan petugas konseling Merupakan pertemuan /
Upaya Berhenti Merokok kunjunganlapangankedesa/ kelurahan
(UBM) di Puskesmas bagi untukPelatihan petugas konseling Upaya Berhenti
kader kesehatan Merokok (UBM) di Puskesmas bagi kader
masyarakat. kesehatan masyarakat. Harapannya agar kader
kesehatan dapat mengetahui tentang UBM.
sebagai upaya deteksi dini, preventif dan respons
penyakit

Monitoring, bimbingan teknis Merupakan pertemuan /


pelaksanaan kegiatan pos kunjunganlapangankedesa/ kelurahan
pembinaan terpadu untukMonitoring, bimbingan teknis pelaksanaan
(posbindu) penyakit tidak kegiatan pos pembinaan terpadu (posbindu)
menular oleh petugas penyakit tidak menular oleh petugas puskesmas.
puskesmas. Harapannya agar posbindu dapat termonitor
dengan baik. sebagai upaya deteksi dini, preventif
dan respons penyakit
Pelaksanaan Dukungan Merupakan pertemuan /
Kesehatan Jiwa dan kunjunganlapangankedesa/ kelurahan untuk
Psikososial pada Bencana pemberian dukungan kesehatan jiwa pada
sasaran terdampak bencana. Harapannya
sasaran mendapatkan konseling dan
meningkatkan derajat kesehatan jiwa yang baik
Pendampingan penderita Merupakan pertemuan /
penyakit menular menahun kunjunganlapangankedesa/ kelurahan
dan penyakit tidak menular untukPendampingan penderita penyakit menular
menahun dan penyakit tidak menular. Harapannya
agar penderita peyakit menahun dapat di di
pantau dan di rawat secara berkala. sebagai
upaya deteksi dini, preventif dan respons penyakit

Validasi data laporan hasil Merupakan pertemuan / kunjungan lapangan ke


POPM dan manajemen desa untuk memvalidasi data hasil penggunaan
kasus filariasis. obat POPM. Harapannya target penggunaan obat
POPM dapat tercapai.
Kunjungan rumah untuk Merupakan pertemuan / kunjungan lapangan ke
tatalaksana/manajemen desa untuk tata laksana terhadappasien filariasis.
kasus filariasis. Harapannya pasien filariasis mendapatkan derajat
kesehatan yang baik.
Follow up tatalaksana dan Merupakan pertemuan /
pencegahan cacat kasus kunjunganlapangankedesa/ kelurahan
kusta dan penyakit menular untukFollow up tatalaksana dan pencegahan
lainnya serta gangguan jiwa. cacat kasus kusta dan penyakit menular lainnya
serta gangguan jiwa. Harapannya agar
mengurangi resiko cacat pada kasus kusta dan
penyakit menular lainnya serta gangguan jiwa.
sebagai upaya deteksi dini, preventif dan respons
penyakit

Pendampingan rujukan Merupakan pertemuan /


kasus gangguan jiwa dan kunjunganlapangankedesa untuk pendampingan
napza pasien gangguan jiwa hasil rujukan dan pasien
NAPZA. Harapannya pasien mendapatkan
konseling dan dapat meningkatkan derajat
kesembuhan.
Pembentukan dan Merupakan pertemuan dalam rangka
pengaktifan, serta pembentukan kader P2P. harapannya dapat
pembinaan kader kesehatan terbentuk kader P2P di masyarakat guna
program P2P serta masalah mengawasi, pendampingan di masyarakat secara
kesehatan jiwa dan Napza. langsung

Orientasi/pembekalan/penin Merupakan pertemuan /


gkatan kapasitas SDM bagi kunjunganlapangankedesa/ kelurahan
kader kesehatan untuk untukOrientasi/pembekalan/peningkatan kapasitas
peningkatan P2P. SDM bagi kader kesehatan untuk peningkatan
P2P. Harapannya agar pengetahuan kader dapat
meningkat. sebagai upaya deteksi dini, preventif
dan respons penyakit

Pertemuan berkala kader Merupakan pertemuan /


kesehatan untuk P2P. kunjunganlapangankedesa/ kelurahan
untukPertemuan berkala kader kesehatan untuk
P2P. Harapannya agar pengetahuan kader dapat
meningkat. sebagai upaya deteksi dini, preventif
dan respons penyakit

Monitoring dan bimbingan Merupakan pertemuan /


teknis kader kesehatan oleh kunjunganlapangankedesa/ kelurahan
petugas puskesmas. untukMonitoring dan bimbingan teknis kader
kesehatan oleh petugas puskesmas. Harapannya
agar kegiatan kader kesehatan dapat terpantau.
sebagai upaya deteksi dini, preventif dan respons
penyakit

Koordinasi terpadu lintas Merupakan pertemuan / kunjungan


program/lintas sektor lapangankedesa/ kelurahan untukKoordinasi
tentang pencegahan dan terpadu lintas program/lintas sektor tentang
pengendalian penyakit pencegahan dan pengendalian penyakit tingkat
tingkat puskesmas puskesmas. Harapannya agar koordinasi dengan
linsek dapat terjalin dengan baik. sebagai upaya
deteksi dini, preventif dan respons penyakit

STBM Desa/ Kelurahan Prioritas


5
Pemicuan 5 Pilar STBM Merupakan pertemuan / kunjungan lapangan
kedesa utntuk pemicuan 5 pilar STBM.
Harapannya desa prioritas dapat menerapkan
sanitasi total berbasis masyarakat

Identifikasi Masalah dan Analisis Merupakan pertemuan dalam rangka


Situasi Perilaku Kesehatan mengidentifikasi masalah dan analisis prilaku
kesehatan pada masyarakat. Harapannya
puskesmas dapat meneumakan masalah dan
pemecahan dalam pemicuan STBM
 Monitoring Paska Pemicuan Merupakan pertemuan dalam rangka
Pembuatan dan Update Peta monitoring dan evaluasi hasil pemicuan dan
Sanitasi dan Buku Kader update peta sanitasi. Harapannya
puskesmas dapat mengevaluasi hasil
pemicuan dan memetakan sanitasi di desa
prioritas
Kampanye 5 Pilar STBM Merupakan pertemuan / kunjungan lapangan
untuk mensosialisasikan 5 pilar STBM.
Harapannya dapat meningkatkan kesadaran
masyarakat dalam menerapkan sanitasi yang
baik di lingkungannya.
 Kampanye Higiene Sanitasi Merupakan pertemuan / kunjungan
Sekolah lapangandi sekolah dalam rangka sosialisasi
hygiene sanitasi di sekolah. Harapannya
sekolah dapat menerakan hygiene yang baik
Surveilans Kualitas Air Minum Merupakan pertemuan / kunjungan lapangan
di desa dalam rangka survei kualitas air
minum. Harapannya dapat meningkatkan
kualitas air minum di masyarakat menjadi
layak pakai.
Verifikasi Desa Stop Buang Air Merupakan pertemuan / kunjungan lapangan
Besar Sembarangan di desa untuk verifikasi stop BABS di desa.
Harapannya agar tidak ada lagi masyarakat
yang Buang Air Sembarangan.
6 Dukungan operasional UKM Tim Nusantara

Penyediaan Tenaga dengan Perjanjian Kerja


7 (tenaga sanitarian lingkungan)
Honorarium Merupakan perekrutan tenaga kontrak
sanitasi lingkungan. Honorarium BOK untuk
membantu kegiatan puskesmas sebagi upaya
penyediaan tenaga dengan perjanjian kerja
Asuransi Merupakan jaminan kesehatan dan kematian
bagi tenaga kontrak honorarium BOK
khususnya sanitasi lingkungan sebagai upaya
penyediaan tenaga dengan perjanjian kerja
Akselerasi Program Indonesia Sehat dengan Pendekatan Keluarga (PIS-
8 PK)

A Pelaksanaan kunjungan Merupakan pertemuan / kunjunganlapangankedesa/


keluarga dan intervensi kelurahan untuk Pelaksanaan kunjungan keluarga
awal dalam rangka deteksi dan intervensi awal dalam rangka deteksi dini dan
dini dan pengelolaan pengelolaan masalah kesehatan terintegrasi melalui
masalah kesehatan pendekatan keluarga. Harapannya agar masalah
terintegrasi melalui kesehatan keluarga dapat di intervensi sebagai
pendekatan keluarga upaya Akselerasi Program Indonesia Sehat dengan
Pendekatan Keluarga (PIS-PK)

B Pelaksanaan intervensi Merupakan pertemuan / kunjunganlapangankedesa/


lanjut termasuk kelurahan untuk Pelaksanaan intervensi lanjut
Perkesmas dalam rangka termasuk Perkesmas dalam rangka intervensi hasil
intervensi hasil PIS-PK PIS-PK. Harapannya agar masalah kesehatan
keluarga dapat di intervensi lanjut sebagai upaya
Akselerasi Program Indonesia Sehat dengan
Pendekatan Keluarga (PIS-PK)

 
Fungsi Manajemen
Puskesmas (P1, P2, P3)

Lokakarya mini dalam Merupakan pertemuan / kunjunganlapangankedesa/


rangka penguatan kelurahan untukLokakarya mini dalam rangka
perencanaan (P1), penguatan perencanaan (P1), penggerakan
penggerakan pelaksanaan pelaksanaan (P2), pengawasan pengendalian dan
(P2), pengawasan penilaian (P3) kinerja Puskesmas serta kegiatan
pengendalian dan koordinasi lintas sektor lainnya.
penilaian (P3) kinerja Lokakarya mini dalam rangka penguatan
Puskesmas serta kegiatan perencanaan (P1), penggerakan pelaksanaan (P2),
koordinasi lintas sektor pengawasan pengendalian dan penilaian (P3) kinerja
lainnya. Puskesmas serta kegiatan koordinasi lintas sektor
lainnya. Harapannya agar perencanaan (P1),
penggerakan pelaksanaan (P2), pengawasan
pengendalian dan penilaian (P3) kinerja Puskesmas
dapat berjalan dan koordinasi dengan linsek lebih
terjalin dengan baik sebagai Upaya penguatan
Fungsi Manajemen Puskesmas (P1, P2, P3)

Upaya Kesehatan Lanjut Usia

Pelatihan Caregiver Merupakan pertemuan dalam rangka kegiatan


Informal di Wilayah pelatihan dan pembentukan caregiver informal di
Puskemas wilayah puskesmas bangun seranten. harapannya
adalah untuk membentuk kader pendampingan bagi
lansia di masyarakat
Pembinaan Caregiver Merupakan pertemuan dalam rangka kegiatan
Informal di Wilayah pembinaan Caregiver Informal di Wilayah Puskemas.
Puskemas Harapannya untuk dilakukan monitoring dan evaluasi
dari kegiatan pendampingan bagi lansia
COVID-19
Pelacakan kontak dan Merupakan pertemuan / kunjunganlapangankedesa/
Pemantauan harian kelurahan untukPelacakan kontak dan Pemantauan
selama karantina dan/ harian selama karantina dan/ atau isolasi oleh tracer
atau isolasi oleh tracer dan/atau petugas puskesmas. Harapannya agar
dan/atau petugas kontak erat covid-19 dapat terlacak dan terpantau
puskesmas sebagai upaya pencegahan dan penanggulangan
covid-19

Biaya Komunkasi Merupakan pertemuan / kunjunganlapangankedesa/


Pelacakan kontak dan kelurahan untukBiaya Komunkasi Pelacakan kontak
Pemantauan dan Pemantauan. Harapannya komunikasi pelacakan
dan pemantauan dapat berjalan lancar sebagai
upaya pencegahan dan penanggulangan covid-19

Honor Pengolah data Merupakan pertemuan / kunjunganlapangankedesa/


kasus Covid-19 di kelurahan untukHonor Pengolah data kasus Covid-19
puskesmas di puskesmas.Harapannya agar petugas dapat
bekerja lebih baik sebagai upaya pencegahan dan
penanggulangan covid-19

Biaya Komunikasi untuk Merupakan pertemuan / kunjunganlapangankedesa/


pengolah data puskesmas kelurahan untukBiaya Komunikasi untuk pengolah
data puskesmasHarapannya komunikasi pelacakan
dan pemantauan dapat berjalan lancar sebagai
upaya pencegahan dan penanggulangan covid-19

Penyelidikan Epidemiologi Merupakan pertemuan / kunjunganlapangankedesa/


kasus Covid-19 kelurahan untukPenyelidikan Epidemiologi kasus
Covid-19. Harapannya agar kasus covid dapat di
deteksi sebagai upaya pencegahan dan
penanggulangan covid-19

B. PENERIMAMANFAAT
Menggambarkansiapapenerimamanfaatmisalnya,ibuhamil,ibubersalin,bayibarulahir,kaderposya
ndu,tokohmasyakarakat,lintas sektordan lain-lain.
NamaKegiata Jumlah Penerima
n Manfaat
1 Surveilans Kesehatan Ibu dan Bayi 288 Orang (staf
puskesmas,
kader,bides,pust
u)
2 Gerakan Perempuan Pekerja Sehat Produktif 24 Orang (staf
(GP2SP) Puskesmas,
masyarakat
perempuan
pekerja)
3 66 Orang (staf
Peningkatan Mutu Layanan Ibu dan Bayi Baru Lahir puskesmas,bides
di Puskesmas dan Rumah Sakit ibu dan bayi baru
lahir, masyarakat)
4 347 Orang (staf
Peningkatan Pemberdayaan masyarakat melalui
puskesmas,bides,
UKBM dalam Upaya penurunan AKI AKB terintegrasi
pustu,
dengan upaya perbaikan gizi masyarakat
masyarakat)
5 Pemeriksaan Kesehatan, Pemberian Tablet Tambah 986 Orang (staf
puskesmas, anak
Darah,Edukasi Gizi Seimbang dan Pendidikan
usia sekolah,
Kespro Pada Anak Usia Sekolah dan Remaja
remaja)
6 327 Orang (staf
Pelayanan Kesehatan Reproduksi Bagi calon puskesmas,
Pengantin, Pasangan Usia Subur (PUS) pasangan usia
subur)
7 48 Orang (staf
Program Perencanaan dan Pencegahan Komplikasi puskesmas,
Terintegrasi Desa Siaga kader,bides,pustu)
)
8 Pelaksanaan Kelas Ibu ( Kelas Ibu Hamil, Kelas Ibu 588 Orang (ibu hamil,
Balita) balita)
9 Pendampingan ibu hamil, ibu nifas, dan bayi 180 Orang (staf
(termasuk pemantauan faktor resiko/ komplikasi) puskesmas,
oleh kader/mahasiswa/fasilitator/tenaga lainnya kader,)
10 760 Orang (staf
Surveilans Gizi puskesmas,bides,
pustu)
11 1512 Orang (staf
puskesmas,
Pendidikan Gizi Melalui peningkatan konsumsi gizi
kader,bides
pada ibu hamil dan balita
,kader,
masyarakat
12 60 Orang (staf
puskesmas,
Konvergensi LP/LS dalam upaya percepatan kader,bides,pustu,
perbaikan gizi masyarakat kader, tokoh
masyarakat,linsek,
guru)
13 628 Orang (staf
Pemantauan Tumbuh Kembang Balita puskesmas,bides,
pustu)
14 564 Orang (staf
Pemeriksaan dan Pengawasan Kualitas Air dan
puskesmas,bides,
Sanitasi Dasar
pustu)
15 84 Orang (staf
Penggerakan Gerakan Masyarakat Hidup Sehat puskesmas,bides,
pustu)
16 Pelaksanaan Germas, Aktifitas Fizik, Pemeriksaan 758 Orang (staf
Kesehatan Berkala dan Edukasi Gizi Seimbang di puskesmas)
Tingkat kecamatan/ Wilayah puskesmas
17 384 Orang (staf
Upaya Kesehatan Olahraga puskesmas,kader
masyarakat,
18 Surveilans Kejadian Ikutan Paska Imunisasi (KIPI) 92 Orang (staf
pelaksanaan imunisasi puskesmas)

19 Validasi sasaran, hasil cakupan imunisasi dan Rapid 72 Orang (staf


Convinience Assessment (RCA) puskesmas,bides,
pustu)
20 Pelacakan kasus Kronis atau kasus ikutan atau hasil 88 Orang (staf
reaksi minum obat pada Pemberian Obat Pencegah puskesmas,
Masal (POPM). kader,bides,pustu,
kader, tokoh
masyarakat,linsek,
guru)
21 Penyelidikan Epidemiologi (PE) penyakit potensi KLB 48 Orang (staf
dan penanggulangan KLB. puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linsek,
guru)
22 Analisa hasil Penyelidikan Epidemiologi (PE) dan 48 Orang (staf
diseminasi informasi di wilayah kerja puskesmas. puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linsek,
guru)
23 Pelacakan kontak kasus KLB 18 Orang (staf
puskesmas,bides,
pustu)
24 Pelaksanaan surveilans migrasi malaria. 27 Orang (staf
puskesmas,bides,
pustu)
25 Surveilans Penyakit Tidak Menular (PTM) dan 18 Orang (staf
penyakit berpotensi KLB termasuk Penyakit Infeksi puskesmas,bides,
Emerging (PIE) di masyarakat pustu)
26 Survei anak sekolah dalam rangka pencegahan dan 10 Orang (staf
pengendalian penyakit puskesmas,bides,
pustu)
27 Validasi sasaran, hasil cakupan GME, Depresi, 18 Orang (staf
ODGJ Berat, Penyalahgunaan Napza dan Bunuh Diri puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linse)
28 Deteksi dini kasus HIV/AIDS, TBC, Hepatitis, Malaria 144 Orang (staf
dan penyakit menular lainnya pada Ibu hamil dan puskesmas,bides,
kelompok berisiko. pustu)

29 Deteksi dini faktor risiko PTM di posbindu PTM dan 378 Orang (staf
Posyandu lansia. puskesmas,bides,
pustu)
30 Penemuan kasus PD3I, kasus kontak TB dan kasus 390 Orang (staf
mangkir, kasus kontak kusta serta orang dengan puskesmas,
gangguan jiwa serta penyakit lainnya. kader,bides,pustu,
kader, tokoh
masyarakat,linse)
31 Kunjungan ulang kasus Acute Flaccyd Paralysis 36 Orang (staf
(AFP). puskesmas,bides,
pustu)
32 Konseling dan deteksi dini masalah kesehatan jiwa 180 Orang (staf
dan napza. puskesmas,bides,
pustu)
33 Pelaksanaan pelayanan imunisasi baik imunisasi 318 Orang (staf
rutin, pengenalan antigen baru, imunisasi tambahan, puskesmas,
maupun kegiatan defaulter tracking. kader,bides,pustu,
kader, tokoh
masyarakat,linse)
34 Sosialisasi pelaksanaan imunisasi rutin kepada 102 Orang (staf
orangtua dan Bulan Imunisasi Anak Sekolah (BIAS) puskesmas,bides,
kepada guru dan wali murid. pustu)

35 Pemberian Obat Pencegah Masal (POPM) untuk 132 Orang (staf


pencegahan penyakit. puskesmas,bides,
pustu)
36 Advokasi/sosialisasi/lokakarya/rapat koordinasi 108 Orang (staf
Lintas Sektor (LS)/ Lintas Program (LP) terkait puskesmas,bides,
pencegahan dan pengendalian penyakit. pustu)
37 Pendataan sasaran POPM. 264 Orang (staf
puskesmas,bides,
pustu)
38 Pengambilan obat POPM ke dinas kesehatan 2 Orang (staf
kabupaten/kota. puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linse)
39 Sweeping untuk meningkatkan cakupan POPM, 240 Orang (staf
imunisasi dan penyakit menular lainnya. puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linse)
40 Pengendalian vektor nyamuk (Pemberantasan 18 Orang (staf
Sarang Nyamuk, larvasidasi, fogging, Indoor puskesmas,
Residual Spraying (IRS), modifikasi lingkungan). kader,bides,pustu,
kader, tokoh
masyarakat,bumil,l
inse)
41 Pemantauan jentik secara berkala. 144 Orang (staf
puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linse)
42 Survei habitat jentik dan nyamuk dewasa. 18 Orang (staf
puskesmas,bides,
pustu)
43 Distribusi kelambu ke kelompok sasaran di desa. 9 Orang (staf
puskesmas)
44 Monitoring penggunaan kelambu malaria. 9 Orang (staf
puskesmas)
45 Penerapan Kawasan Tanpa Rokok (KTR) untuk 36 Orang (staf
Desa Tanpa Asap Rokok puskesmas,bides,
pustu)
46 Pelatihan petugas konseling Upaya Berhenti 50 Orang (staf
Merokok (UBM) di Puskesmas bagi kader kesehatan puskesmas,bides,
masyarakat. pustu)

47 Monitoring, bimbingan teknis pelaksanaan kegiatan 36 Orang (staf


pos pembinaan terpadu (posbindu) penyakit tidak puskesmas)
menular oleh petugas puskesmas.

48 Pelaksanaan Dukungan Kesehatan Jiwa dan 36 Orang (staf


Psikososial pada Bencana puskesmas,bides,
pustu)
49 Pendampingan penderita penyakit menular menahun 36 Orang (staf
dan penyakit tidak menular puskesmas,bides,
pustu)
50 Validasi data laporan hasil POPM dan manajemen 52 Orang (staf
kasus filariasis. puskesmas,bides,
pustu)
51 Kunjungan rumah untuk tatalaksana/manajemen 36 Orang (staf
kasus filariasis. puskesmas,bides,
pustu)
52 Follow up tatalaksana dan pencegahan cacat kasus 72 Orang (staf
kusta dan penyakit menular lainnya serta gangguan puskesmas,bides,
jiwa. pustu)

53 Pendampingan rujukan kasus gangguan jiwa dan 12 Orang (staf


napza puskesmas,bides,
pustu)
54 Pembentukan dan pengaktifan, serta pembinaan 24 Orang (staf
kader kesehatan program P2P serta masalah puskesmas,
kesehatan jiwa dan Napza. kader,bides,pustu,
kader, tokoh
masyarakat,linse)
55 Orientasi/pembekalan/peningkatan kapasitas SDM 48 Lembar
bagi kader kesehatan untuk peningkatan P2P.

56 Pertemuan berkala kader kesehatan untuk P2P. 48 Orang (staf


puskesmas,bides,
pustu)
57 Monitoring dan bimbingan teknis kader kesehatan 18 Orang (staf
oleh petugas puskesmas. puskesmas)

58 Koordinasi terpadu lintas program/lintas sektor 100 Orang (staf


tentang pencegahan dan pengendalian penyakit puskesmas,bides,
tingkat puskesmas pustu)

59 Pemicuan 5 Pilar STBM 20 Orang (staf


puskesmas,
masyarakat)
60 Identifikasi Masalah dan Analisis Situasi Perilaku 40 Orang (staf
Kesehatan puskesmas,
masyarakat)
61 Monitoring Paska Pemicuan Pembuatan dan Update 40 Orang (staf
Peta Sanitasi dan Buku Kader puskesmas,
masyarakat)
62 Kampanye 5 Pilar STBM 20 Orang (staf
puskesmas,
masyarakat)
63 Kampanye Higiene Sanitasi Sekolah 8 Orang (staf
puskesmas,
masyarakat,
sekolah)
64 Surveilans Kualitas Air Minum 3 Orang (staf
puskesmas,
masyarakat)
65 Verifikasi Desa Stop Buang Air Besar Sembarangan 3 Orang (staf
puskesmas,
masyarakat)
66 Penyediaan Tenaga dengan Perjanjian Kerja (tenaga 1 Orang ( staff
sanitasi lingkungan) puskesmas)

67 Pelaksanaan kunjungan keluarga dan intervensi awal 324 Orang (staf


dalam rangka deteksi dini dan pengelolaan masalah puskesmas,bides,
kesehatan terintegrasi melalui pendekatan keluarga pustu)

68 Pelaksanaan intervensi lanjut termasuk Perkesmas 297 Orang (staf


dalam rangka intervensi hasil PIS-PK puskesmas,bides,
pustu)
69 Lokakarya mini dalam rangka penguatan 320 Orang (staf
perencanaan (P1), penggerakan pelaksanaan (P2), puskesmas,bides,
pengawasan pengendalian dan penilaian (P3) kinerja pustu)
Puskesmas serta kegiatan koordinasi lintas sektor
lainnya.

70 Upaya kesehatan Lanjut Usia 100 Orang (staf


puskesmas,keder,
lansia)
71 Pelacakan kontak dan Pemantauan harian selama 1696 Orang (staf
karantina dan/ atau isolasi oleh tracer dan/atau puskesmas,bides,
petugas puskesmas pustu,tracer)

72 Biaya Komunkasi Pelacakan kontak dan 36 Paket data


Pemantauan

73 Honor Pengolah data kasus Covid-19 di puskesmas 24 Orang (staf


puskesmas)
74 Biaya Komunikasi untuk pengolah data puskesmas 12 Paket data

75 Penyelidikan Epidemiologi kasus Covid-19 600 Orang (staf


puskesmas,
masyarakat)
76 Pengiriman spesimen suspect dan kontak erat COVID-19 260 Orang (staf
ke laboratorium kesehatan daerah atau laboratorium puskesmas,
rujukan pemerintah di kab/kota masyarakat)

C. STRATEGIPECAPAIANKELUARAN
Rincian Output Metode Tahapan
No
Menu/Komponen Satuan Volume Pelaksanaan Pelaksana
A UKM ESENSIAL
I UpayaPenurunanAKI-AKB
1 Surveilans Kesehatan Ibu dan Bayi

1. Persiapan Administrasi
2. Pelaksanaan Kegiatan
Orientasi Kader dalam
Dokumen 3. Waktu
a Pelacakan Kematian 2 Swakelola
Laporan Pelaksanaan(Januari -Des)
WUS
4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
2. Pelaksanaan Kegiatan
Pelaksanaan Otopsi
Dokumen 3. Waktu
b Verbal Kematian 2 Swakelola
Laporan Pelaksanaan(Januari -Des)
Maternal Neonatal
4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
Pendataan dan 2. Pelaksanaan Kegiatan
Pemetaan Sasaran Dokumen 3. Waktu
c 2 Swakelola
Bumil, Bersalin, Nifas Laporan Pelaksanaan(Januari -Des)
dan Bayi 4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
2. Pelaksanaan Kegiatan
Pelacakan Kasus Dokumen 3. Waktu
d 2 Swakelola
Hipotiroid Kongenital Laporan Pelaksanaan(Januari -Des)
4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
2. Pelaksanaan Kegiatan
Dokumen 3. Waktu
e Orientasi E-Kohort 2 Swakelola
Laporan Pelaksanaan(Januari -Des)
4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
2. Pelaksanaan Kegiatan
Rapat Koordinasi
Dokumen 3. Waktu
f Validasi dan Evaluasi 2 Swakelola
Laporan Pelaksanaan(Januari -Des)
Data PWS KIA
4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
2. Pelaksanaan Kegiatan
Pertemuan Kemitraan Dokumen 3. Waktu
g 1 Swakelola
Bidan dan Dukun Laporan Pelaksanaan(Januari -Des)
4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
2. Pelaksanaan Kegiatan
Sosialisasi pentingnya
Dokumen 3. Waktu
h persalinan di fasilitas 2 Swakelola
Laporan Pelaksanaan(Januari -Des)
kesehatan
4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
Pertemuan evaluasi 2. Pelaksanaan Kegiatan
penatalaksanaan balita Dokumen 3. Waktu
i 1 Swakelola
sakit mengunakan Laporan Pelaksanaan(Januari -Des)
manajemen MTBS 4. Pembuatan
Laporan Akhir

1. Persiapan Administrasi
2. Pelaksanaan Kegiatan
Perjalanan Dinas Dokumen 3. Waktu
j 4 Swakelola
Konsultasi Program Laporan Pelaksanaan(Januari -Des)
4. Pembuatan
Laporan Akhir
D. KURUNWAKTUPENCAPAIANKELUARAN
Kurun waktu pencapaian kegiatan diharapkan dapat dilakukan dalam waktu1tahun

E. BIAYAYANGDIPERLUKAN
Biaya yang diperlukan untuk pencapaian keluaran Bantuan Operasional Kesehatan Puskesmas
sebesar Rp. 679,338,072.00 (enam ratus tujuh puluh Sembilan juta tiga ratus tiga puluh delapan
ribu tujuh puluh dua rupiah) dengan kebutuhan per rincian menukegiatan sebagai berikut:

No RincianMenuKegiatan KebutuhanBiaya
1 UpayaPenurunanAKI,AKB 112,076,
540,00
116,201,5
2 UpayaPercepatanperbaikangizimasyarakat
20.00

45,242,5
3 UpayaGerakanMasyarakatHidupSehat(GERMAS)
40.00
121,905,4
4 Upayadeteksidini,preventildanresponspenyakit
00.00
5 STBM Desa/ Kelurahan Prioritas 7,500,0
00.00
Dukungan operasional UKM Tim Nusantara -
6
Penyediaan Tenaga dengan Perjanjian Kerja 12,120,012.00
7
Akselerasi Program lndonesia Sehat dengan 20,426,8
8 00.00
PendekatanKeluarqa(PlS-PK)
Fungsi Manajemen Puskesmas (P1, P2, P3) 86,041,3
9 40.00

Upaya Kesehatan Lanjut Usia 7,633,360.00


10
UpayaPencegahandanPengendalianCoronaVirus 150,190,560.00
11
Disease19(COVID19)
Rp. 679,338,072.00
Total
RincianAnggaranBiaya(RAB)terlampir

Kepala Puskesmas Bangun


Seranten

Dr. Dewi Adrian


NIP. 19791011 201412 2 001