Anda di halaman 1dari 36

KERANGKA ACUAN KERJA/TERM OF REFERENCEPELAKSANAAN BANTUAN OPERASIONAL

KESEHATAN PUSKESMAS DANA ALOKASI KHUSUS (DAK) NONFISIK BIDANG


KESEHATANTAHUNANGGARAN 2022

A. LATARBELAKANG
1. Dasar Hukum
a. Undang-undang Nomor 54 tahun 1999 tentang pembentukan Kabupaten Sarolangun,
Kabupaten Tebo, Kabupaten Muara Jambi dan Kabupaten Tanjung Jabung Timur
(lembaran Negara Republik Indonesia Tahun 1999 Nomor 182.Tambahan lembaran
Negara Republik Indonesia Nomor 3903) sebagaimana telah diubah dengan undang-
undang nomor 14 tahun 2000 tentang perubahan atas Undang-Undang no 54 tahun
1999 tentang pembentukan Kabupaten Sarolangun,Kabupaten Tebo, Kabupaten Muara
Jambi, Kabupaten Tanjung Jabung Timur (Lembaran Negara Republik Indonesia Tahun
2000 Nomor 81, tambahan;
b. Undang-undang Nomor 17 Tahun 2003 Tentang Keuangan Negara (Lembaran Negara
Republik Indonesia Tahun 2003 Nomor 47, Tambahan Lembaran Negara Republik
Indonesia Nomor 3969);
c. Undang-Undang Nomor 1 Tahun 2004 tentang Perbendaharaan Negara (Lembaran
Negara Republik Indonesia Tahun 2004 Nomor 5, Tambahan Lembaran Negara
Republik Indonesia Nomor 4286);
d. Undang-Undang Nomor 25 Tahun 2004 tentang Sistem Perencanaan Pembangunan
Nasional (Lembaran Negara Republik Indonesia Tahun 2004 Nomor 104,Tambahan
Lembaran Negara Republik Indonesia Nomor 4421);
e. Undang-Undang Nomor 33 Tahun 2004 tentang Perimbangan Keuangan Negara antar
Pemerintah Pusat dan Daerah (Lembaran Negara Republik Indonesia Tahun 2004
Nomor 126,Tambahan Lembaran Negara Republik Indonesia Nomor 4438);
f. Undang-Undang Nomor 17 Tahun 2007 tentang Rencana Pembagunan Jangka Panjang
(RPJP) Nasional 2002-2025 . (Lembaran Negara Republik Indonesia Tahun 2007 Nomor
33,Tambahan Lembaran Negara Republik Indonesia Nomor 4700);
g. Undang-undang Nomor 36 Tahun 2009 tentang Kesehatan ;
h. Undang-Undang Nomor 23 Tahun 2014 tentang Pemerintah Daerah . (Lembaran
Negara Republik Indonesia Tahun 2014 Nomor 2440,Tambahan Lembaran Negara
Republik Indonesia Nomor 5578);
i. Peraturan Pemerintah Nomor 58 Tahun 2005 tentang Pengelolaan Keuangan Daerah
( Lembaran Negara Republik Indonesia Tahun 2005 Nomor 140, Tambahan Lembaran
Negara Republik Indonesia Nomor 4578);
j. Peraturan Pemerintah Nomor 65 Tahun 2005 tentang Pedoman Penyusunan Standar
Pelayanan Minimal (SPM) (Lembaran Negara Republik Indonesia Nomor 4585);
k. Peraturan Pemerintah Nomor 6 Tahun 2008 tentang Pedoman Evaluasi
Penyelenggaraan Pemerintah Daerah ( Lembaran Negara Republik Indonesia Tahun
2008 Nomor 19, Tambahan Lembaran Negara Republik Indonesia Nomor 4815);
l. Peraturan Pemerintah Nomor 8 Tahun 2008 tentang Tahapan ,Tata Cara Penyusunan,
Pengendalian dan Evaluasi Pelaksanaan Rencana Pembangunan Daerah (Lembaran
Negara Republik Indonesia Tahun 2008 Nomor 21.Tambahan Lembaran Negara
Republik Indonesia nomor 4817);
m. Peraturan Presiden Nomor 2 Tahun 2015 tentang Rencana Pembangunan Jangka
Menengah Nasional 2015-2019;
n. Peraturan Pemerintah Nomor 18 Tahun 2016 tentang Perangkat Daerah;
o. Peraturan Menteri dalam Negeri Nomor 13 Tahun 2006 tentang Pedoman Pengelolaan
Keuangan Daerah sebagaimana telah di ubah terakhir dengan Peraturan Menteri Dalam
Negeri No 13 Tahun 2006 tentang Pedoman Pengelolaan Keuangan Daerah;
p. Peraturan Menteri Kesehatan RI Nomor 43 Tahun 2016 tentang Standar Pelayanan
Minimal Bidang Kesehatan;
q. Peraturan Menteri Dalam Negeri Nomor 86 Tahun 2017 tentang Tata Cara
Perencanaan, Pengendalian dan Evaluasi Pembangunan Daerah, Tata Cara Evaluasi
Rancangan Peraturan Daerah tentang Rencana Pembangunan Jangka Menengah
Daerah dan Rencana Kerja Pembangunan Daerah;
r. Peraturan Menteri Kesehatan Nomor 12 Tahun 2021 tentang Petunjuk Teknis
Penggunaan Dana Alokasi Khusus Nonfisik Bidang Kesehatan ;
s. Keputusan Menteri Kesehatan RI Nomir HK.02.02/MENKES/52/2016 tentang Rencana
Strategis Kementerian Kesehatan Tahun 2015-2019;
t. Peraturan Daerah Propinsi Jambi Nomor 07 Tahun 2016 tentang Rencana
Pembangunan Jangka Menengah Daerah (RPJMD) Propisi Jambi Tahun 2016-2021;
u. Peraturan Daerah Kabupaten Tebo Nomor 3 Tahun 2014 tetang Perubahan Atas
Peraturan Daerah Nomor 3 Tahun 2007 tentang rencana Pembangunan Jangka Panjang
Kabupaten Tebo Tahun 2026-2025;
v. Peraturan Daerah Kabupaten Tebo Nomor 06 Tahun 2013 tentang Rencana Tata Ruang
Wilayah Kabupaten Tebo Tahun 2013-2033;
w. Peraturan Daerah Kabupaten Tebo Nomor 08 Tahun 2016 tentang Pembentukan dan
Susunan Perangkat Daerah Kabupaten Tebo (Lembaran Daerah Kabupaten Tebo
Tahun 2016 Nomor 8);
x. Peraturan Bupati Nomor 42 Tahun 2016 tentang Kedudukan, Susunan Organisasi,
Tugas dan Fungsi serta Tata Kerja Dinas Kesehatan Kabupaten Tebo;

2. GambaranUmum
DAK Nonfisik Bidang Kesehatan adalah dana yang bersumber dari APBN yang
dialokasikan kepada daerah untuk membantu mendanai kegiatan operasional bidang
kesehatan yang merupakan urusan daerah sesuai dengan prioritas nasional.
Bantuan operasional Puskesmas merupakan bagian dari dana DAK non fisik yang
di manfaatkan puskesmas untuk kegiatan UKM esensial dan Kejadian luar biasa serta
dukungan manajemen Puskesmas
UPTD Puskesmas Suo-Suo merupakan unit pelaksana Teknis Dinas Kesehatan
kabupaten Tebo yang bertanggung jawab terhadap penyelenggaraan upaya kesehatan
di wilayah UPTD.Puskesmas Suo-Suo di Kecamatan Sumay Kabupaten Tebo
Berdasarkan Karakteristik wilayah, UPTD Puskesmas Suo-Suo merupakan Puskesmas
kawasan pedesaan, sedangkan berdasarkan kemampuan penyelenggraan termasuk
dalam kategori Puskesmas Rawat Non Rawat Inap.
UPTD Puskesmas Suo-Suo memiliki 4 Desa binaan dengan estimasi jumlah
Penduduk 6.398.000 Kegiatan- kegiatan Puskesmas mencakupi seluruh daerah binaan
Puskesmas tersebut.

No RinciaanMenu/Kompoen Uraian
1 UpayaPenurunanAKI-AKB
A Orientasi kader dalam Merupakanpertemuan/kunjunganlapangankedes
pelacakan kematian wanita a/kelurahan
usia subur untukmemberikaninformasiterkaitupaya
pelacakan kematian wanita usia subur
Harapannya kapasitas danpengetahuankader
meningkatdenganpenyampaianinformasiterkinite
rkaitupayapelacakan kematian wanita usia
subur

B Pelaksanaan otopsi verbal Merupakanpertemuan/


kematian maternal neonatal kunjunganlapangankedesa/kelurahan untuk
(Bantuan Bantuan transport melakukan otopsi verbal kematian maternal
petugas ) neonatal. Harapannya dapat diketahui penyebab
kematian maternal neonatal sebagai upaya
penurunan AK-AKB
Pendataan dan pemetaan Merupakanpertemuan/
sasaran bumil, bersalin, kunjunganlapangankedesa/kelurahan untuk
nifas dan bayi melakukanPendataan dan pemetaan sasaran
bumil, bersalin, nifas dan bayi . Harapannya
dapat diketahui data sasaran bumil, bersalin,
nifas dan bayi sebagai upaya penurunan AK-
AKB
Pelacakan kasus hipotiroid Merupakan pertemuan/
kongenital kunjunganlapangankedesa/ kelurahan untuk
melakukanPelacakan kasus hipotiroid
kongenital. Harapannya dapat diketahui dan
dilacak kasus hipotiroid kongenital sebagai
upaya penurunan AK-AKB
Rapat koordinasi validasi Merupakan pertemuan /
dan evaluasi data PWS KIA kunjunganlapangankedesa/ kelurahan untuk
Rapat koordinasi validasi dan evaluasi data PWS
KIA. Harapannya data PWS KIA dapat valid
sebagai upaya penurunan AKI-AKB
Merupakan pertemuan /
Fasilitasi dan Pembinaan kunjunganlapangankedesa/ kelurahan untuk
Kegiatan GP2SP Fasilitasi dan Pembinaan Kegiatan GP2SP.
Harapannya agar perempuan produktif
mendapatkan akses pelayanan kesehatan
sebagai upaya penurunan AKI-AKB
Penyeliaan fasilitatif Pustu Merupakan pertemuan /
dan bidan desa kunjunganlapangankedesa/ kelurahan untuk
Penyeliaan fasilitatif Pustu dan bidan desa
Harapannya agar kemampuan bides dan pustu
meningkat dalam memberikan pelayanan
sebagai upaya penurunan AKI-AKB

Bantuan Transport Merupakan pertemuan / kunjunganlapanganke


pengiriman sampel SHK dari desa/ kelurahan untuk Bantuan Transport
FKTP pengiriman sampel SHK dari FKTP Harapannya
agar sampel dapat terkirim tepat waktu sebagai
upaya penurunan AKI-AKB

Pembinaan Posyandu. Merupakan pertemuan /


Poskestren,Posyandu kunjunganlapangankedesa/ kelurahan untuk
remaia,PosUKK, Pembinaan Posyandu. Poskestren, Posyandu
Poskestren, dan UKBM remaia, Pos UKK, Poskestren, dan UKBM lainnya
lainnya Harapannya agar seluruh UKBM dapat terbina
dengan baik sebagai upaya penurunan AKI-AKB

Pembinaan Penerapan Merupakan pertemuan /


Protokol Kesehatan di kunjunganlapangankedesa/ kelurahan untuk
satuan Pendidikan Pembinaan Penerapan Protokol Kesehatan di
satuan Pendidikan Harapannya agar siswa dapat
menerapkan protokol kesehatan sebagai upaya
penurunan AKI-AKB

Penguatan UKS/M dan TP Merupakan pertemuan /


UKS/M kunjunganlapangankedesa/ kelurahan untuk
Penguatan UKS/M dan TP UKS/M. Harapannya
agar pengelolaan UKS di sekolah dapat berjalan
dengan baik sebagai upaya penurunan AKI-AKB

Koordinasi PelayananMerupakan pertemuan /


Kesehatan Peduli Remaja kunjunganlapangankedesa/ kelurahan untuk
Koordinasi Pelayanan Kesehatan Peduli Remaja.
Harapannya agar kesehatan remaja dapat
terpantau sebagai upaya penurunan AKI-AKB

Pengembangan dan Merupakan pertemuan /


Pelaksanaan Posyandu kunjunganlapangankedesa/ kelurahan untuk
remaja Pengembangan dan Pelaksanaan Posyandu
remaja Harapannya agar kesehatan remaja dapat
terpantau DI posyandu remaja sebagai upaya
penurunan AKI-AKB

Pendidikan Kesehatan Merupakan pertemuan /


Reproduksi Pada Remaja kunjunganlapangankedesa/ kelurahan untuk
Pendidikan Kesehatan Reproduksi Pada Remaja
Harapannya agar pengetahuan remaja tentang
kesehatan reproduksi meningkat sebagai upaya
penurunan AKI-AKB

Pelaksanaan Pemeriksaan Merupakan pertemuan /


Kesehatan Anak usia kunjunganlapangankedesa/ kelurahan untuk
sekolah dan Remaja Pelaksanaan Pemeriksaan Kesehatan Anak usia
sekolah dan Remaja Harapannya agar kesehatan
dan anak sekolah dapat terpantau melalui
screning kesehatan sebagai upaya penurunan
AKI-AKB

Pendampingan dan evaluasi Merupakan pertemuan /


Pelaksanaan Pemberian kunjunganlapangankedesa/ kelurahan untuk
TTD Pada Remaja Pendampingan dan evaluasi Pelaksanaan
Pemberian TTD Pada Remaja. Harapannya agar
mengurangi kejadian anemia pada remaja
sebagai upaya penurunan AKI-AKB

Pembinaan Kader Merupakan pertemuan /


Kesehatan Remaja kunjunganlapangankedesa/ kelurahan untuk
Pembinaan Kader Kesehatan Remaja.
Harapannya agar kader keehatan dapat terbina
sebagai upaya penurunan AKI-AKB

Pemberian materi kesehatan Merupakan pertemuan /


pada bimbingan perkawinan kunjunganlapangankedesa/ kelurahan/instansi
atau konseling pranikah di untuk Pemberian materi kesehatan pada
KUA atau lembaga agama bimbingan perkawinan atau konseling pranikah di
KUA atau lembaga agama.Harapannya agar
caten dapat meningkatkan pengetahuan caten
tentang kesehatan sebagai upaya penurunan AKI-
AKB

Penyuluhan dan pelayanan Merupakan pertemuan /


KB di Posyandu/Posbindu kunjunganlapangankedesa/ kelurahan untuk
Penyuluhan dan pelayanan KB di
Posyandu/Posbindu. Harapannya agar peserta
posyandu dan posbibdu mengerti tentang KB
sebagai upaya penurunan AKI-AKB

Edukasi pencegahan KtP/A, Merupakan pertemuan /


pencegahan praktik P2GP, kunjunganlapangankedesa/ kelurahan untuk
pencegahan infertilitas, dan Edukasi pencegahan KtP/A, pencegahan praktik
pentingnya pelayanan P2GP, pencegahan infertilitas, dan pentingnya
kesehatan reproduksi bagi pelayanan kesehatan reproduksi bagi penyandang
penyandang disabilitas disabilitas. Harapannya agar tidak terjadi KtP/A
sebagai upaya penurunan AKI-AKB

Orientasi P4K bagi bidan, Merupakan pertemuan /


kepala desa/kelurahan, kunjunganlapangankedesa/ kelurahan untuk
kader, tokoh masyarakat Orientasi P4K bagi bidan, kepala desa/kelurahan,
desa, dl kader, tokoh masyarakat desa, dll. Harapannya
agar pengetahuan bidan, kepala desa/kelurahan,
kader, tokoh masyarakat desa tentang P4K dapat
meningkat sebagai upaya penurunan AKI-AKB

Pertemuan Koordinasi Merupakan pertemuan /


penguatan P4K kunjunganlapangankedesa/ kelurahan untuk
Pembentukan forum peduli Pertemuan Koordinasi penguatan P4K
KIA dalam mendukung P4K Pembentukan forum peduli KIA dalam mendukung
P4K Harapannya agar koordinasi bidan, kepala
desa/kelurahan, kader, tokoh masyarakat desa
tentang P4K dapat meningkat sebagai upaya
penurunan AKI-AKB

Penyelenqqaraan kelas ibu Merupakan pertemuan /


secara online/offline kunjunganlapangankedesa/ kelurahan untuk
Penyelenqqaraan kelas ibu secara online/offline.
Harapannya agar pengetahuan dan ketrampilan
ibu hamil dapat meningkat sebagai upaya
penurunan AKI-AKB

Kunjungan rumah bagi ibu Merupakan pertemuan /


hamil, ibu nifas, neonatus kunjunganlapangankedesa/ kelurahan untuk
dan bayi oleh Kunjungan rumah bagi ibu hamil, ibu nifas,
kader/mahasiswa.fasilitator/t neonatus dan bayi oleh
enaga lainnya kader/mahasiswa.fasilitator/ tenaga lainnya.
Harapannya agar ibu hamil, ibu nifas, neonatus
dan bayi dapat terpantau kesehatannya sebagai
upaya penurunan AKI-AKB

2 UpayaPerbaikanGiziMasyarakat
A Pendampingan pemantauan Merupakan pertemuan /
pertumbuhan di posyandu kunjunganlapangankedesa/ kelurahan untuk
Pendampingan pemantauan pertumbuhan di
posyandu. Harapannya agar bayi dan balita
dapat terpantau kesehatannya sebagai upaya
penurunan AKI-AKB

B Merupakan pertemuan /
kunjunganlapangankedesa/ kelurahan untuk
Pertemuan analisis Pertemuan analisis pemantauan pertumbuhan .
pemantauan pertumbuhan Harapannya agar bayi dan balita dapat terpantau
kesehatannya sebagai upaya penurunan AKI-
AKB

Pertemuan advokasi LP/LS Merupakan pertemuan /


terkait kegiatan pemantauan kunjunganlapangankedesa/ kelurahan untuk
pertumbuhan Pertemuan advokasi LP/LS terkait kegiatan
pemantauan pertumbuhan. Harapannya agar bayi
dan balita dapat terpantau kesehatannya
sebagai upaya penurunan AKI-AKB

Peningkatan cakupan Merupakan pertemuan /


pelayanan melalui kunjunganlapangankedesa/ kelurahan untuk
Kunjungan rumah dalam Peningkatan cakupan pelayanan melalui
rangka konfirmasi balita Kunjungan rumah dalam rangka konfirmasi balita
risiko gangguan risiko gangguan pertumbuhan maupun status gizi
pertumbuhan maupun status (termasuk balita yang tidak datang timbang.
gizi (termasuk balita yang Harapannya agar mendapatkan informasi dan
tidak datang timbang) data balita yang memiliki gangguan pertumbuhan
sebagai upaya penurunan AKI-AKB

Pelacakan dan Merupakan pertemuan /


Pendampingan intervensi kunjunganlapangankedesa/ kelurahan untuk
gizi pada bumil KEK, balita Pelacakan dan Pendampingan intervensi gizi
yang memliki gangguan pada bumil KEK, balita yang memliki gangguan
pertumbuhan/bermasalah pertumbuhan/bermasalah status gizinya.
status gizinya Harapannya agar bumil KEK, balita yang memliki
gangguan pertumbuhan/bermasalah status
gizinya dapat dilacak sebagai upaya penurunan
AKI-AKB

Edukasi penyuluhan kepada Merupakan pertemuan /


masyarakat pentingnya kunjunganlapangankedesa/ kelurahan untuk
pemantauan pertumbuhan Edukasi penyuluhan kepada masyarakat
dan peningkatan ketahanan pentingnya pemantauan pertumbuhan dan
gizi peningkatan ketahanan gizi. Harapannya agar
masyarakat dapat mengetahui tentang
pemantauan pertumbuhan dan peningkatan
ketahanan gizidilacak sebagai upaya penurunan
AKI-AKB

Pendataan dan Merupakan pertemuan /


pemutakhiran sasaran kunjunganlapangankedesa/ kelurahan untuk
program kesehatan Pendataan dan pemutakhiran sasaran program
terintegrasi dalam upaya kesehatan terintegrasi dalam upaya perbaikan gizi
perbaikan gizi masyarakat masyarakat. Harapannya agarsasaran program
gizi dapat di data sebagai upaya penurunan AKI-
AKB

Peningkatan cakupan Merupakan pertemuan /


pelayanan melalui kunjunganlapangankedesa/ kelurahan untuk
kunjungan rumah, sweeping Peningkatan cakupan pelayanan melalui
balita yang tidak datang ke kunjungan rumah, sweeping balita yang tidak
posyandu datang ke posyandu. Harapannya agar balita yang
tidak datang ke posyandu dapat di pantau
pertumbuhannya sebagai upaya penurunan AKI-
AKB

Kegiatan edukasi pada ibu Merupakan pertemuan /


hamil dan balita (ke kunjunganlapangankedesa/ kelurahan untuk
masyarakat): konseling Kegiatan edukasi pada ibu hamil dan balita (ke
PMBA, ASI eksklusif, Gizi masyarakat): konseling PMBA, ASI eksklusif, Gizi
seimbang seimbang. Harapannya agar pengetahuan ibu
hamil dan masyarakat meningkat tentang gizi
sebagai upaya penurunan AKI-AKB

Penimbangan rutin balita, Merupakan pertemuan /


dan pemantauan tumbuh kunjunganlapangankedesa/ kelurahan untuk
kembang Penimbangan rutin balita, dan pemantauan
tumbuh kembang . Harapannya agar bayi dan
balita dapat terpantau kesehatannya sebagai
upaya penurunan AKI-AKB

Pelaksanaan stimulasi, Merupakan pertemuan /


deteksi, dan intervensi dini kunjunganlapangankedesa/ kelurahan
tumbuh kembang (SDIDTK) untukPelaksanaan stimulasi, deteksi, dan
di posyandu, PAUD, TK intervensi dini tumbuh kembang (SDIDTK) di
posyandu, PAUD, TK . Harapannya agar
balita/anak di Tk atau di PAUD dapat terpantau
kesehatannya sebagai upaya penurunan AKI-
AKB

lnspeksi kesehatan Merupakan pertemuan /


lingkungan untuk sarana air kunjunganlapangankedesa/ kelurahan
minum dan sarana sanitasi untuklnspeksi kesehatan lingkungan untuk sarana
dasar air minum dan sarana sanitasi dasar. Harapannya
agar sarana air minum dan sarana sanitasi dasar
dapat terpantau sebagai upaya penurunan AKI-
AKB
Pengambilan data sanitasi Merupakan pertemuan /
dan air tingkat rumah tangga kunjunganlapangankedesa/ kelurahan
untukPengambilan data sanitasi dan air tingkat
rumah tangga
Pengambilan sampel dalam Merupakan pertemuan /
rangka surveilans kualitas air kunjunganlapangankedesa/ kelurahan
minum untukPengambilan sampel dalam rangka
surveilans kualitas air minum

3 UpayaGerakanMasyarakatHidupSehat(GERMAS)
A Kegiatan penggerakkan Merupakan pertemuan /
tokoh masyarakat, tokoh kunjunganlapangankedesa/ kelurahan untuk
agama, kader, fasilitator Kegiatan penggerakkan tokoh masyarakat, tokoh
desa, kelompok masyarakat agama, kader, fasilitator desa, kelompok
lainnya untuk melakukan masyarakat lainnya untuk melakukan kegiatan
kegiatan Germas. Germas. Harapannya agar masyarakat, tokoh
agama, kader, fasilitator desa, kelompok
masyarakat dapat ikut dapat mealkukan kegiatan
germas sebagai upaya gerakan masyarakat hidup
sehat (GERMAS)

B Aktifikas fisik (senam rutin, Merupakan pertemuan /


senam hamil, senam lansia, kunjunganlapangankedesa/ kelurahan untuk
kelompok komorbid, dll), Aktifikas fisik (senam rutin, senam hamil, senam
lansia, kelompok komorbid, dll),Harapannya agar
lansia,bumi dapat melakukan aktifitas fisik secara
rutin germas sebagai upaya gerakan masyarakat
hidup sehat (GERMAS)
Edukasi gizi seimbang Merupakan pertemuan /
(makan buah dan sayuQ di kunjunganlapangankedesa/ kelurahan untuk
semua tatanan
(sekolah/UKS, ibadah,
kantor pemerintahan/non
pemenntahan, melibatkan
organisasi profesi, ormas,
forum pemuda, serta melalui
UKBM (Posbindu, Posyandu
Lansia, Posyandu Remaja,
Dasa Wsma, Karang
Taruna, Pos UKK, dII
Pembinaan kesehatan Merupakan pertemuan /
olahraga pada kelompok kunjunganlapangankedesa/ kelurahan untuk
masyarakat (Kelompok
olahraga, ASN tk
kecamatan, anak sekolah,
dan Jemaah haji)
4 Upayadeteksidini,preventifdanresponspenyakit
a Surveilans Kejadian Ikutan Merupakan pertemuan /
Paska Imunisasi (KIPI) kunjunganlapangankedesa/ kelurahan
pelaksanaan imunisasi untukSurveilans Kejadian Ikutan Paska Imunisasi
(KIPI) pelaksanaan imunisasi. Harapannya agar
kejadian ikutan pasca imunisasi dapat dideteksi
sebagai upaya deteksi dini, preventif dan respons
penyakit

b Validasi sasaran, hasil Merupakan pertemuan /


cakupan imunisasi dan kunjunganlapangankedesa/ kelurahan
Rapid Convinience untukValidasi sasaran, hasil cakupan imunisasi
Assessment (RCA) dan Rapid Convinience Assessment (RCA)
Harapannya agar sasaran dan cakupan dapat
valid Validasi sasaran, hasil cakupan imunisasi
dan Rapid Convinience Assessment (RCA)
sebagai upaya deteksi dini, preventif dan respons
penyakit

Pengambilan dan Merupakan pertemuan /


Pengiriman spesimen kunjunganlapangankedesa/ kelurahan untuk
penyakit berpotensi KLB ke Pengambilan dan Pengiriman spesimen penyakit
laboratorium kesehatan berpotensi KLB ke laboratorium kesehatan daerah
daerah atau laboratorium atau laboratorium rujukan pemerintah di kab/kota.
rujukan pemerintah di Harapannya agar spesimen dapat diperiksa
kab/kota secara cepat dan tepat sebagai upaya deteksi
dini, preventif dan respons penyakit

Pelacakan kasus Kronis atau Merupakan pertemuan /


kasus ikutan atau hasil kunjunganlapangankedesa/ kelurahan untuk
reaksi minum obat pada Pelacakan kasus Kronis atau kasus ikutan atau
Pemberian Obat Pencegah hasil reaksi minum obat pada Pemberian Obat
Masal (POPM). Pencegah Masal (POPM. Harapannya agar reaksi
ikutan POPM dapat di lacak sebagai upaya
deteksi dini, preventif dan respons penyakit
Surveilans binatang Merupakan pertemuan /
pembawa penyakit serta kunjunganlapangankedesa/kelurahan
pengiriman spesimen untuk untukSurveilans binatang pembawa penyakit serta
konfirmasi. pengiriman spesimen untuk konfirmasi.
Harapannya agar dapat diketahui sebagai upaya
deteksi dini, preventif dan respons penyakit
Validasi sasaran, hasil Merupakan pertemuan /
cakupan GME, Depresi, kunjunganlapangankedesa/ kelurahan
ODGJ Berat, untukValidasi sasaran, hasil cakupan GME,
Penyalahgunaan Napza dan Depresi, ODGJ Berat, Penyalahgunaan Napza
Bunuh Diri dan Bunuh Diri.Harapannya data sasaran dapat
valid. sebagai upaya deteksi dini, preventif dan
respons penyakit

Deteksi dini kasus HIV/AIDS, Merupakan pertemuan /


TBC, Hepatitis, Malaria dan kunjunganlapangankedesa/ kelurahan
penyakit menular lainnya untukDeteksi dini kasus HIV/AIDS, TBC, Hepatitis,
pada Ibu hamil dan Malaria dan penyakit menular lainnya pada Ibu
kelompok berisiko. hamil dan kelompok berisiko. Harapannya agar
kasus HIV/AIDS, TBC, Hepatitis, Malaria dan
penyakit menular lainnya pada Ibu hamil dan
kelompok berisiko dapat terdeteksi sebagai upaya
deteksi dini, preventif dan respons penyakit

Deteksi dini faktor risiko Merupakan pertemuan /


PTM di posbindu PTM dan kunjunganlapangankedesa/ kelurahan
Posyandu lansia. untukDeteksi dini faktor risiko PTM di posbindu
PTM dan Posyandu lansia. Harapannya faktor
risiko PTM di posbindu PTM dan Posyandu lansia
dapat terdeteksi. sebagai upaya deteksi dini,
preventif dan respons penyakit

Penemuan kasus PD3I, Merupakan pertemuan /


kasus kontak TB dan kasus kunjunganlapangankedesa/ kelurahan
mangkir, kasus kontak kusta untukPenemuan kasus PD3I, kasus kontak TB
serta orang dengan dan kasus mangkir, kasus kontak kusta serta
gangguan jiwa serta orang dengan gangguan jiwa serta penyakit
penyakit lainnya. lainnya. Harapannya agar kasus PD3I, kasus
kontak TB dan kasus mangkir, kasus kontak kusta
serta orang dengan gangguan jiwa serta penyakit
lainnya dapat ditemukan
sebagai upaya deteksi dini, preventif dan respons
penyakit

Konseling dan deteksi dini Merupakan pertemuan /


masalah kesehatan jiwa dan kunjunganlapangankedesa/ kelurahan
napza. untukKonseling dan deteksi dini masalah
kesehatan jiwa dan napza. Harapannya agar
masalah kesehatan jiwa dan napza dapat
terdeteksi secara dini
sebagai upaya deteksi dini, preventif dan respons
penyakit

Pelaksanaan pelayanan Merupakan pertemuan /


imunisasi baik imunisasi kunjunganlapangankedesa/ kelurahan
rutin, pengenalan antigen untukPelaksanaan pelayanan imunisasi baik
baru, imunisasi tambahan, imunisasi rutin, pengenalan antigen baru,
maupun kegiatan defaulter imunisasi tambahan, maupun kegiatan defaulter
tracking. tracking. Harapannya agar pelayanan imunisasi
baik imunisasi rutin, pengenalan antigen baru,
imunisasi tambahan, maupun kegiatan defaulter
tracking dapat terlaksana. sebagai upaya deteksi
dini, preventif dan respons penyakit
Pemberian Obat Pencegah Merupakan pertemuan /
Masal (POPM) untuk kunjunganlapangankedesa/ kelurahan
pencegahan penyakit. untukPemberian Obat Pencegah Masal (POPM)
untuk pencegahan penyakit. Harapannya agar
obat cacing dapat di berikan kepada sasaran
sebagai upaya deteksi dini, preventif dan respons
penyakit
Advokasi/sosialisasi/lokakary Merupakan pertemuan /
a/rapat koordinasi Lintas kunjunganlapangankedesa/ kelurahan
Sektor (LS)/ Lintas Program untukAdvokasi/sosialisasi/lokakarya/rapat
(LP) terkait pencegahan dan koordinasi Lintas Sektor (LS)/ Lintas Program (LP)
pengendalian penyakit. terkait pencegahan dan pengendalian penyakit.
Harapannya agar koordinasi linsek berjalain baik
terkait pencegahan dan pengendalian penyakit.
sebagai upaya deteksi dini, preventif dan respons
penyakit

Penyediaan bahan media Merupakan pertemuan /


Komunikasi, Informasi dan kunjunganlapangankedesa/ kelurahan
Edukasi (KIE). untukPenyediaan bahan media Komunikasi,
Informasi dan Edukasi (KIE). Harapannya agar
bahan bahan media Komunikasi, Informasi dan
Edukasi (KIE) tersedia. sebagai upaya deteksi
dini, preventif dan respons penyakit
Pendataan sasaran POPM. Merupakan pertemuan /
kunjunganlapangankedesa/ kelurahan
untukPendataan sasaran POPM. Harapannyaagar
sasasran POM terdata. sebagai upaya deteksi
dini, preventif dan respons penyakit
Pengambilan obat POPM ke Merupakan pertemuan /
dinas kesehatan kunjunganlapangankedesa/ kelurahan
kabupaten/kota. untukPengambilan obat POPM ke dinas
kesehatan kabupaten/kota. Harapannya agar
logistik POM tersedia sebagai upaya deteksi dini,
preventif dan respons penyakit
Sweeping untuk Merupakan pertemuan /
meningkatkan cakupan kunjunganlapangankedesa/ kelurahan
POPM, imunisasi dan untukSweeping untuk meningkatkan cakupan
penyakit menular lainnya. POPM, imunisasi dan penyakit menular lainnya.
Harapannya agar cakupan POPM dapat tercapai
sebagai upaya deteksi dini, preventif dan respons
penyakit
Pengendalian vektor nyamuk Merupakan pertemuan /
(Pemberantasan Sarang kunjunganlapangankedesa/ kelurahan
Nyamuk, larvasidasi, untukPengendalian vektor nyamuk
fogging, Indoor Residual (Pemberantasan Sarang Nyamuk, larvasidasi,
Spraying (IRS), modifikasi fogging, Indoor Residual Spraying (IRS),
lingkungan). modifikasi lingkungan). Harapannya agar vektor
nyamuk dapat di kendalikan sebagai upaya
deteksi dini, preventif dan respons penyakit
Pemantauan jentik secara Merupakan pertemuan /
berkala. kunjunganlapangankedesa/ kelurahan
untukPemantauan jentik secara berkala.
Harapannya agar jentik nyamuk dapat terpantau
sebagai upaya deteksi dini, preventif dan respons
penyakit

Penerapan Kawasan Tanpa Merupakan pertemuan /


Rokok (KTR) untuk Desa kunjunganlapangankedesa/ kelurahan
Tanpa Asap Rokok untukPenerapan Kawasan Tanpa Rokok (KTR)
untuk Desa Tanpa Asap Rokok. Harapannya agar
desa dapat memiliki kawasan tanpa asap rokok
sebagai upaya deteksi dini, preventif dan respons
penyakit
Pelatihan petugas konseling Merupakan pertemuan /
Upaya Berhenti Merokok kunjunganlapangankedesa/ kelurahan
(UBM) di Puskesmas bagi untukPelatihan petugas konseling Upaya Berhenti
kader kesehatan Merokok (UBM) di Puskesmas bagi kader
masyarakat. kesehatan masyarakat. Harapannya agar kader
kesehatan dapat mengetahui tentang UBM.
sebagai upaya deteksi dini, preventif dan respons
penyakit

Monitoring, bimbingan teknis Merupakan pertemuan /


pelaksanaan kegiatan pos kunjunganlapangankedesa/ kelurahan
pembinaan terpadu untukMonitoring, bimbingan teknis pelaksanaan
(posbindu) penyakit tidak kegiatan pos pembinaan terpadu (posbindu)
menular oleh petugas penyakit tidak menular oleh petugas puskesmas.
puskesmas. Harapannya agar posbindu dapat termonitor
dengan baik. sebagai upaya deteksi dini, preventif
dan respons penyakit

Pendampingan penderita Merupakan pertemuan /


penyakit menular menahun kunjunganlapangankedesa/ kelurahan
dan penyakit tidak menular untukPendampingan penderita penyakit menular
menahun dan penyakit tidak menular. Harapannya
agar penderita peyakit menahun dapat di di
pantau dan di rawat secara berkala. sebagai
upaya deteksi dini, preventif dan respons penyakit

Follow up tatalaksana dan Merupakan pertemuan /


pencegahan cacat kasus kunjunganlapangankedesa/ kelurahan
kusta dan penyakit menular untukFollow up tatalaksana dan pencegahan
lainnya serta gangguan jiwa. cacat kasus kusta dan penyakit menular lainnya
serta gangguan jiwa. Harapannya agar
mengurangi resiko cacat pada kasus kusta dan
penyakit menular lainnya serta gangguan jiwa.
sebagai upaya deteksi dini, preventif dan respons
penyakit

Orientasi/pembekalan/penin Merupakan pertemuan /


gkatan kapasitas SDM bagi kunjunganlapangankedesa/ kelurahan
kader kesehatan untuk untukOrientasi/pembekalan/peningkatan kapasitas
peningkatan P2P. SDM bagi kader kesehatan untuk peningkatan
P2P. Harapannya agar pengetahuan kader dapat
meningkat. sebagai upaya deteksi dini, preventif
dan respons penyakit

Pertemuan berkala kader Merupakan pertemuan /


kesehatan untuk P2P. kunjunganlapangankedesa/ kelurahan
untukPertemuan berkala kader kesehatan untuk
P2P. Harapannya agar pengetahuan kader dapat
meningkat. sebagai upaya deteksi dini, preventif
dan respons penyakit

Monitoring dan bimbingan Merupakan pertemuan /


teknis kader kesehatan oleh kunjunganlapangankedesa/ kelurahan
petugas puskesmas. untukMonitoring dan bimbingan teknis kader
kesehatan oleh petugas puskesmas. Harapannya
agar kegiatan kader kesehatan dapat terpantau.
sebagai upaya deteksi dini, preventif dan respons
penyakit

Koordinasi terpadu lintas Merupakan pertemuan /


program/lintas sektor kunjunganlapangankedesa/ kelurahan
tentang pencegahan dan untukKoordinasi terpadu lintas program/lintas
pengendalian penyakit sektor tentang pencegahan dan pengendalian
tingkat puskesmas penyakit tingkat puskesmas. Harapannya agar
koordinasi dengan linsek dapat terjalin dengan
baik. sebagai upaya deteksi dini, preventif dan
respons penyakit

5 STBM Desa/ Kelurahan Prioritas

Pelaksanaan STBM Desa/ Merupakan pertemuan /


Kelurahan Prioritas kunjunganlapangankedesa/ kelurahan
untukPelaksanaan STBM Desa/ Kelurahan
Prioritas tingkat puskesmas. Harapannya agar
Desa STBM dapat tercapai untuk semua Desa

6 Dukungan operasional UKM Tim Nusantara

Penyediaan Tenaga dengan Perjanjian Kerja


7
Honorarium Merupakan perekrutan tenaga kontrak
honorarium BOK untuk membantu kegiatan
puskesmas sebagi upaya penyediaan tenaga
dengan perjanjian kerja
Asuransi Merupakan jaminan kesehatan dan kematian
bagi tenaga kontrak honorarium BOK sebgai
upaya penyediaan tenaga dengan perjanjian
kerja
Akselerasi Program Indonesia Sehat dengan Pendekatan Keluarga (PIS-
8 PK)

A Pelaksanaan kunjungan Merupakan pertemuan / kunjunganlapangankedesa/


keluarga dan intervensi kelurahan untuk Pelaksanaan kunjungan keluarga
awal dalam rangka dan intervensi awal dalam rangka deteksi dini dan
deteksi dini dan pengelolaan masalah kesehatan terintegrasi melalui
pengelolaan masalah pendekatan keluarga. Harapannya agar masalah
kesehatan terintegrasi kesehatan keluarga dapat di intervensi sebagai
melalui pendekatan upaya Akselerasi Program Indonesia Sehat dengan
keluarga Pendekatan Keluarga (PIS-PK)

B Pelaksanaan intervensi Merupakan pertemuan / kunjunganlapangankedesa/


lanjut termasuk kelurahan untuk Pelaksanaan intervensi lanjut
Perkesmas dalam rangka termasuk Perkesmas dalam rangka intervensi hasil
intervensi hasil PIS-PK PIS-PK. Harapannya agar masalah kesehatan
keluarga dapat di intervensi lanjut sebagai upaya
Akselerasi Program Indonesia Sehat dengan
Pendekatan Keluarga (PIS-PK)

 
Fungsi Manajemen
Puskesmas (P1, P2, P3)
Lokakarya mini dalam Merupakan pertemuan / kunjunganlapangankedesa/
rangka penguatan kelurahan untukLokakarya mini dalam rangka
perencanaan (P1), penguatan perencanaan (P1), penggerakan
penggerakan pelaksanaan (P2), pengawasan pengendalian dan
pelaksanaan (P2), penilaian (P3) kinerja Puskesmas serta kegiatan
pengawasan koordinasi lintas sektor lainnya.
pengendalian dan Lokakarya mini dalam rangka penguatan
penilaian (P3) kinerja perencanaan (P1), penggerakan pelaksanaan (P2),
Puskesmas serta pengawasan pengendalian dan penilaian (P3) kinerja
kegiatan koordinasi lintas Puskesmas serta kegiatan koordinasi lintas sektor
sektor lainnya. lainnya. Harapannya agar perencanaan (P1),
penggerakan pelaksanaan (P2), pengawasan
pengendalian dan penilaian (P3) kinerja Puskesmas
dapat berjalan dan koordinasi dengan linsek lebih
terjalin dengan baik sebagai Upaya penguatan
Fungsi Manajemen Puskesmas (P1, P2, P3)

COVID-19

Pelacakan kontak dan Merupakan pertemuan / kunjunganlapangankedesa/


Pemantauan harian kelurahan untukPelacakan kontak dan Pemantauan
selama karantina dan/ harian selama karantina dan/ atau isolasi oleh tracer
atau isolasi oleh tracer dan/atau petugas puskesmas. Harapannya agar
dan/atau petugas kontak erat covid-19 dapat terlacak dan terpantau
puskesmas sebagai upaya pencegahan dan penanggulangan
covid-19

Biaya Komunkasi Merupakan pertemuan / kunjunganlapangankedesa/


Pelacakan kontak dan kelurahan untukBiaya Komunkasi Pelacakan kontak
Pemantauan dan Pemantauan. Harapannya komunikasi pelacakan
dan pemantauan dapat berjalan lancar sebagai
upaya pencegahan dan penanggulangan covid-19

Honor Pengolah data Merupakan pertemuan / kunjunganlapangankedesa/


kasus Covid-19 di kelurahan untukHonor Pengolah data kasus Covid-19
puskesmas di puskesmas.Harapannya agar petugas dapat
bekerja lebih baik sebagai upaya pencegahan dan
penanggulangan covid-19

Biaya Komunikasi untuk Merupakan pertemuan / kunjunganlapangankedesa/


pengolah data kelurahan untukBiaya Komunikasi untuk pengolah
puskesmas data puskesmasHarapannya komunikasi pelacakan
dan pemantauan dapat berjalan lancar sebagai
upaya pencegahan dan penanggulangan covid-19

Penyelidikan Merupakan pertemuan / kunjunganlapangankedesa/


Epidemiologi kasus kelurahan untukPenyelidikan Epidemiologi kasus
Covid-19 Covid-19. Harapannya agar kasus covid dapat di
deteksi sebagai upaya pencegahan dan
penanggulangan covid-19

B. PENERIMAMANFAAT
Menggambarkansiapapenerimamanfaatmisalnya,ibuhamil,ibubersalin,bayibarulahir,kaderpo
syandu,tokohmasyakarakat,lintas sector dan lain-lain.
No NamaKegiata Jumlah Penerima
n Manfaat
1 Orientasi kader dalam pelacakan kematian wanita 50 Orang (staf
usia subur puskesmas,
kader,bides,pust
u)
2 Pelaksanaan otopsi verbal kematian maternal 40 Orang (staf
neonatal (Bantuan Bantuan transport petugas ) Puskesmas)

3 Pendataan dan pemetaan sasaran bumil, bersalin, 20 Orang (staf


nifas dan bayi puskesmas,bides,
pustu)
4 Pelacakan kasus hipotiroid kongenital 40 Orang (staf
puskesmas,bides,
pustu)
5 Rapat koordinasi validasi dan evaluasi data PWS 40 Orang (staf
KIA puskesmas,
kader,bides,pustu)
)
6 24 Orang (staf
Fasilitasi dan Pembinaan Kegiatan GP2SP puskesmas,
kader)
7 Penyeliaan fasilitatif Pustu dan bidan desa 120 Orang (staf
puskesmas,
kader,bides,pustu)
)
8 Bantuan Transport pengiriman sampel SHK dari 50 Orang (Bikor)
FKTP

9 Pembinaan Posyandu. Poskestren, Posyandu 1185 Orang (staf


remaia, Pos UKK, Poskestren, dan UKBM lainnya puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linsek)
10 Pembinaan Penerapan Protokol Kesehatan di satuan 288 Orang (staf
Pendidikan puskesmas,bides,
pustu)
11 Penguatan UKS/M dan TP UKS/M 216 Orang (staf
puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linsek,
guru)
12 Koordinasi Pelayanan Kesehatan Peduli Remaja 36 Orang (staf
puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linsek,
guru)
13 Pengembangan dan Pelaksanaan Posyandu remaja 432 Orang (staf
puskesmas,bides,
pustu)
14 Pendidikan Kesehatan Reproduksi Pada Remaja 88 Orang (staf
puskesmas,bides,
pustu)
15 Pelaksanaan Pemeriksaan Kesehatan Anak usia 472 Orang (staf
sekolah dan Remaja puskesmas,bides,
pustu)
16 Pendampingan dan evaluasi Pelaksanaan 88 Orang (staf
Pemberian TTD Pada Remaja puskesmas)
17 Pembinaan Kader Kesehatan Remaja 144 Orang (staf
puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linsek,
guru)
18 Pemberian materi kesehatan pada bimbingan 36 Orang (staf
perkawinan atau konseling pranikah di KUA atau puskesmas)
lembaga agama
19 Penyuluhan dan pelayanan KB di 54 Orang (staf
Posyandu/Posbindu puskesmas,bides,
pustu)
20 Edukasi pencegahan KtP/A, pencegahan praktik 90 Orang (staf
P2GP, pencegahan infertilitas, dan pentingnya puskesmas,
pelayanan kesehatan reproduksi bagi penyandang kader,bides,pustu,
disabilitas kader, tokoh
masyarakat,linsek,
guru)
21 Orientasi P4K bagi bidan, kepala desa/kelurahan, 135 Orang (staf
kader, tokoh masyarakat desa, dl puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linsek,
guru)
22 Pertemuan Koordinasi penguatan P4K Pembentukan 135 Orang (staf
forum peduli KIA dalam mendukung P4K puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linsek,
guru)
23 Penyelenqqaraan kelas ibu secara online/offline 504 Orang (staf
puskesmas,bides,
pustu)
24 Kunjungan rumah bagi ibu hamil, ibu nifas, neonatus 108 Orang (staf
dan bayi oleh kader/mahasiswa.fasilitator/ tenaga puskesmas,bides,
lainnya pustu)

25 Pendampingan pemantauan pertumbuhan di 50 Orang (staf


posyandu puskesmas,bides,
pustu)
26 Pertemuan analisis pemantauan pertumbuhan 412 Orang (staf
puskesmas,bides,
pustu)
27 Pertemuan advokasi LP/LS terkait kegiatan 414 Orang (staf
pemantauan pertumbuhan puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linse)
28 Peningkatan cakupan pelayanan melalui Kunjungan 81 Orang (staf
rumah dalam rangka konfirmasi balita risiko puskesmas,bides,
gangguan pertumbuhan maupun status gizi pustu)
(termasuk balita yang tidak datang timbang)
29 Pelacakan dan Pendampingan intervensi gizi pada 162 Orang (staf
bumil KEK, balita yang memliki gangguan puskesmas,bides,
pertumbuhan/bermasalah status gizinya pustu)
30 Edukasi penyuluhan kepada masyarakat pentingnya 675 Orang (staf
pemantauan pertumbuhan dan peningkatan puskesmas,
ketahanan gizi kader,bides,pustu,
kader, tokoh
masyarakat,linse)
31 Pendataan dan pemutakhiran sasaran program 414 Orang (staf
kesehatan terintegrasi dalam upaya perbaikan gizi puskesmas,bides,
masyarakat pustu)
32 Peningkatan cakupan pelayanan melalui kunjungan 116 Orang (staf
rumah, sweeping balita yang tidak datang ke puskesmas,bides,
posyandu pustu)

33 Kegiatan edukasi pada ibu hamil dan balita (ke 414 Orang (staf
masyarakat): konseling PMBA, ASI eksklusif, Gizi puskesmas,
seimbang kader,bides,pustu,
kader, tokoh
masyarakat,linse)
34 Penimbangan rutin balita, dan pemantauan tumbuh 600 Orang (staf
kembang puskesmas,bides,
pustu)
35 Pelaksanaan stimulasi, deteksi, dan intervensi dini 96 Orang (staf
tumbuh kembang (SDIDTK) di posyandu, PAUD, TK puskesmas,bides,
pustu)
36 lnspeksi kesehatan lingkungan untuk sarana air 256 Orang (staf
minum dan sarana sanitasi dasar puskesmas,bides,
pustu)
37 Pengambilan data sanitasi dan air tingkat rumah 540 Orang (staf
tangga puskesmas,bides,
pustu)
38 Pengambilan sampel dalam rangka surveilans 56 Orang (staf
kualitas air minum puskesmas,bides,
pustu)
39 Kegiatan penggerakkan tokoh masyarakat, tokoh 495 Orang (staf
agama, kader, fasilitator desa, kelompok masyarakat puskesmas,
lainnya untuk melakukan kegiatan Germas. kader,bides,pustu,
kader, tokoh
masyarakat,linse)
40 Aktifikas fisik (senam rutin, senam hamil, senam 306 Orang (staf
lansia, kelompok komorbid, dll), puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linse)
41 Edukasi gizi seimbang (makan buah dan sayuQ di 306 Orang (staf
semua tatanan (sekolah/UKS, ibadah, kantor puskesmas,
pemerintahan/non pemenntahan, melibatkan kader,bides,pustu,
organisasi profesi, ormas, forum pemuda, serta kader, tokoh
melalui UKBM (Posbindu, Posyandu Lansia, masyarakat,bumil,l
Posyandu Remaja, Dasa Wsma, Karang Taruna, inse)
Pos UKK, dII
42 Pembinaan kesehatan olahraga pada kelompok 40 Orang (staf
masyarakat (Kelompok olahraga, ASN tk kecamatan, puskesmas,
anak sekolah, dan Jemaah haji) kader,bides,pustu,
kader, tokoh
masyarakat,linse)
43 Surveilans Kejadian Ikutan Paska Imunisasi (KIPI) 270 Orang (staf
pelaksanaan imunisasi puskesmas,bides,
pustu)
44 Validasi sasaran, hasil cakupan imunisasi dan Rapid 64 Orang (staf
Convinience Assessment (RCA) puskesmas)

45 Pengambilan dan Pengiriman spesimen penyakit 40 Orang (staf


berpotensi KLB ke laboratorium kesehatan daerah puskesmas)
atau laboratorium rujukan pemerintah di kab/kota
46 Pelacakan kasus Kronis atau kasus ikutan atau hasil 36 Orang (staf
reaksi minum obat pada Pemberian Obat Pencegah puskesmas,bides,
Masal (POPM). pustu)
47 Surveilans binatang pembawa penyakit serta 24 Orang (staf
pengiriman spesimen untuk konfirmasi. puskesmas,bides,
pustu)
48 Validasi sasaran, hasil cakupan GME, Depresi, 2 Orang (staf
ODGJ Berat, Penyalahgunaan Napza dan Bunuh Diri puskesmas)

49 Deteksi dini kasus HIV/AIDS, TBC, Hepatitis, Malaria 108 Orang (staf
dan penyakit menular lainnya pada Ibu hamil dan puskesmas,bides,
kelompok berisiko. pustu)

50 Deteksi dini faktor risiko PTM di posbindu PTM dan 1008 Orang (staf
Posyandu lansia. puskesmas,bides,
pustu)
51 Penemuan kasus PD3I, kasus kontak TB dan kasus 407 Orang (staf
mangkir, kasus kontak kusta serta orang dengan puskesmas,bides,
gangguan jiwa serta penyakit lainnya. pustu)

52 Konseling dan deteksi dini masalah kesehatan jiwa 136 Orang (staf
dan napza. puskesmas,bides,
pustu)
53 Pelaksanaan pelayanan imunisasi baik imunisasi 2076 Orang (staf
rutin, pengenalan antigen baru, imunisasi tambahan, puskesmas,bides,
maupun kegiatan defaulter tracking. pustu)

54 Pemberian Obat Pencegah Masal (POPM) untuk 210 Orang (staf


pencegahan penyakit. puskesmas,bides,
pustu)
55 Advokasi/sosialisasi/lokakarya/rapat koordinasi 657 Orang (staf
Lintas Sektor (LS)/ Lintas Program (LP) terkait puskesmas,
pencegahan dan pengendalian penyakit. kader,bides,pustu,
kader, tokoh
masyarakat,linse)
56 Penyediaan bahan media Komunikasi, Informasi dan 2400 Lembar
Edukasi (KIE).
57 Pendataan sasaran POPM. 70 Orang (staf
puskesmas,bides,
pustu)
58 Pengambilan obat POPM ke dinas kesehatan 2 Orang (staf
kabupaten/kota. puskesmas)
59 Sweeping untuk meningkatkan cakupan POPM, 70 Orang (staf
imunisasi dan penyakit menular lainnya. puskesmas,bides,
pustu)
60 Pengendalian vektor nyamuk (Pemberantasan 315 Orang (staf
Sarang Nyamuk, larvasidasi, fogging, Indoor puskesmas,
Residual Spraying (IRS), modifikasi lingkungan). kader,bides,pustu,
kader, tokoh
masyarakat,linse)
61 Pemantauan jentik secara berkala. 144 Orang (staf
puskesmas,bides,
pustu)
62 Penerapan Kawasan Tanpa Rokok (KTR) untuk 60 Orang (staf
Desa Tanpa Asap Rokok puskesmas,bides,
pustu)
63 Pelatihan petugas konseling Upaya Berhenti 102 Orang (staf
Merokok (UBM) di Puskesmas bagi kader kesehatan puskesmas,
masyarakat. kader,bides,pustu,
kader, tokoh
masyarakat,linse)
64 Monitoring, bimbingan teknis pelaksanaan kegiatan 108 Orang (staf
pos pembinaan terpadu (posbindu) penyakit tidak puskesmas,bides,
menular oleh petugas puskesmas. pustu)

65 Pendampingan penderita penyakit menular menahun 513 Orang (staf


dan penyakit tidak menular puskesmas,bides,
pustu)
66 Follow up tatalaksana dan pencegahan cacat kasus 54 Orang (staf
kusta dan penyakit menular lainnya serta gangguan puskesmas,bides,
jiwa. pustu)

67 Orientasi/pembekalan/peningkatan kapasitas SDM 116 Orang (staf


bagi kader kesehatan untuk peningkatan P2P. puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linse)
68 Pertemuan berkala kader kesehatan untuk P2P. 80 Orang (staf
puskesmas,
kader,bides,pustu,
kader, tokoh
masyarakat,linse)
69 Monitoring dan bimbingan teknis kader kesehatan 80 Orang (staf
oleh petugas puskesmas. puskesmas,bides,
pustu)
70 Koordinasi terpadu lintas program/lintas sektor 80 Orang (staf
tentang pencegahan dan pengendalian penyakit puskesmas,
tingkat puskesmas kader,bides,pustu,
kader, tokoh
masyarakat,linse)
71 Pelaksanaan kunjungan keluarga dan intervensi awal 135 Orang (staf
dalam rangka deteksi dini dan pengelolaan masalah puskesmas,bides,
kesehatan terintegrasi melalui pendekatan keluarga pustu)

72 Pelaksanaan intervensi lanjut termasuk Perkesmas 135 Orang (staf


dalam rangka intervensi hasil PIS-PK puskesmas,bides,
pustu)
73 Lokakarya mini dalam rangka penguatan 1406 Orang (staf
perencanaan (P1), penggerakan pelaksanaan (P2), puskesmas,bides,
pengawasan pengendalian dan penilaian (P3) kinerja pustu)
Puskesmas serta kegiatan koordinasi lintas sektor
lainnya.

74 Pelacakan kontak dan Pemantauan harian selama 1620 Orang (staf


karantina dan/ atau isolasi oleh tracer dan/atau puskesmas,bides,
petugas puskesmas pustu,tracer)

75 Biaya Komunkasi Pelacakan kontak dan 108 Paket data


Pemantauan

76 Honor Pengolah data kasus Covid-19 di puskesmas 1152 Orang (staf


puskesmas)
77 Biaya Komunikasi untuk pengolah data puskesmas 24 Paket data

78 Penyelidikan Epidemiologi kasus Covid-19 60 Orang (staf


puskesmas,bides,
pustu)
C. STRATEGIPECAPAIANKELUARAN
Outpu Metode Tahapan
No RincianMenu/Komponen
t Pelaksanaa Pelaksana
Satuan Volum n
e
1 UpayaPenurunanAKI-AKB
a. Orientasi kader dalam Dokume 1 Swakelola 1. Persiapan
pelacakan kematian wanita nLapora Administra
usia subur n si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
Lapora
nAkhir
b. Pelaksanaan otopsi verbal DokumenL 1 Swakelola 1. Persiapan
kematian maternal neonatal aporan Administra
(Bantuan Bantuan transport si
petugas )
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
c Pendataan dan pemetaan DokumenL 1 Swakelola 1. Persiapan
sasaran bumil, bersalin, aporan Administra
nifas dan bayi si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
d Pelacakan kasus hipotiroid DokumenL 1 Swakelola 1. Persiapan
kongenital aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
e Rapat koordinasi validasi DokumenL 4 Swakelola 1. Persiapan
dan evaluasi data PWS KIA aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
f DokumenL 2 Swakelola 1. Persiapan
Fasilitasi dan Pembinaan aporan Administra
Kegiatan GP2SP si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
g Penyeliaan fasilitatif Pustu DokumenL 2 Swakelola 1. Persiapan
dan bidan desa aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
h Bantuan Transport DokumenL 2 Swakelola 1. Persiapan
pengiriman sampel SHK dari aporan Administra
FKTP si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
i Pembinaan Posyandu. DokumenL 2 Swakelola 1. Persiapan
Poskestren, Posyandu aporan Administra
remaia, Pos UKK, si
Poskestren, dan UKBM
2. Pelaksanaa
lainnya
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
j Pembinaan Penerapan DokumenL 2 Swakelola 1. Persiapan
Protokol Kesehatan di aporan Administra
satuan Pendidikan si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
k Penguatan UKS/M dan TP DokumenL 2 Swakelola 1. Persiapan
UKS/M aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
l Koordinasi Pelayanan DokumenL 2 Swakelola 1. Persiapan
Kesehatan Peduli Remaja aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
m. Pengembangan dan DokumenL 12 Swakelola 1. Persiapan
Pelaksanaan Posyandu aporan Administra
remaja si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
n. Pendidikan Kesehatan DokumenL Swakelola 1. Persiapan
Reproduksi Pada Remaja aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
o. Pelaksanaan Pemeriksaan DokumenL 2 Swakelola 1. Persiapan
Kesehatan Anak usia aporan Administra
sekolah dan Remaja si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
p. Pendampingan dan evaluasi DokumenL 2 Swakelola 1. Persiapan
Pelaksanaan Pemberian aporan Administra
TTD Pada Remaja si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
q. Pembinaan Kader DokumenL 2 Swakelola 1. Persiapan
Kesehatan Remaja aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
r. Pemberian materi kesehatan DokumenL 12 Swakelola 1. Persiapan
pada bimbingan perkawinan aporan Administra
atau konseling pranikah di si
KUA atau lembaga agama
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
s. Penyuluhan dan pelayanan DokumenL 2 Swakelola 1. Persiapan
KB di Posyandu/Posbindu aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
t. Edukasi pencegahan KtP/A, DokumenL 1 Swakelola 1. Persiapan
pencegahan praktik P2GP, aporan Administra
pencegahan infertilitas, dan si
pentingnya pelayanan
2. Pelaksanaa
kesehatan reproduksi bagi
penyandang disabilitas nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
u. Orientasi P4K bagi bidan, DokumenL 1 Swakelola 1. Persiapan
kepala desa/kelurahan, aporan Administra
kader, tokoh masyarakat si
desa, dl
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
v. Pertemuan Koordinasi DokumenL 1 Swakelola 1. Persiapan
penguatan P4K aporan Administra
Pembentukan forum peduli si
KIA dalam mendukung P4K
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
w. Penyelenqqaraan kelas ibu DokumenL 12 Swakelola 1. Persiapan
secara online/offline aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
x. Kunjungan rumah bagi ibu DokumenL 2 Swakelola 1. Persiapan
hamil, ibu nifas, neonatus aporan Administra
dan bayi oleh si
kader/mahasiswa.fasilitator/
2. Pelaksanaa
tenaga lainnya
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
2. UpayaPerbaikanGiziMasyarakat
a. Pendampingan pemantauan DokumenL 4 Swakelola 1. Persiapan
pertumbuhan di posyandu aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
b. DokumenL 1 Swakelola 1. Persiapan
aporan Administra
Pertemuan analisis si
pemantauan pertumbuhan
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
c. Pertemuan advokasi LP/LS DokumenL 1 Swakelola 1. Persiapan
terkait kegiatan pemantauan aporan Administra
pertumbuhan si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
d. Peningkatan cakupan DokumenL Swakelola 1. Persiapan
pelayanan melalui aporan Administra
Kunjungan rumah dalam si
rangka konfirmasi balita
2. Pelaksanaa
risiko gangguan
pertumbuhan maupun status nKegiatan
gizi (termasuk balita yang 3. Waktu
tidak datang timbang) Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
e. Pelacakan dan DokumenL 3 Swakelola 1. Persiapan
Pendampingan intervensi aporan Administra
gizi pada bumil KEK, balita si
yang memliki gangguan
2. Pelaksanaa
pertumbuhan/bermasalah
nKegiatan
status gizinya 3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
f. Edukasi penyuluhan kepada DokumenL 3 Swakelola 1. Persiapan
masyarakat pentingnya aporan Administra
pemantauan pertumbuhan si
dan peningkatan ketahanan
2. Pelaksanaa
gizi
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
g. Pendataan dan DokumenL 1 Swakelola 1. Persiapan
pemutakhiran sasaran aporan Administra
program kesehatan si
terintegrasi dalam upaya
2. Pelaksanaa
perbaikan gizi masyarakat
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
h. Peningkatan cakupan DokumenL 4 Swakelola 1. Persiapan
pelayanan melalui aporan Administra
kunjungan rumah, sweeping si
balita yang tidak datang ke
2. Pelaksanaa
posyandu
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
i. Kegiatan edukasi pada ibu DokumenL 1 Swakelola 1. Persiapan
hamil dan balita (ke aporan Administra
masyarakat): konseling si
PMBA, ASI eksklusif, Gizi
2. Pelaksanaa
seimbang
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
j. Penimbangan rutin balita, DokumenL 12 Swakelola 1. Persiapan
dan pemantauan tumbuh aporan Administra
kembang si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
k. Pelaksanaan stimulasi, DokumenL 2 Swakelola 1. Persiapan
deteksi, dan intervensi dini aporan Administra
tumbuh kembang (SDIDTK) si
di posyandu, PAUD, TK
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. L.Pembuata
n
LaporanAkhir
m. lnspeksi kesehatan DokumenL 2 Swakelola 1. Persiapan
lingkungan untuk sarana air aporan Administra
minum dan sarana sanitasi si
dasar
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
n. Pengambilan data sanitasi DokumenL 3 Swakelola 1. Persiapan
dan air tingkat rumah tangga aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
o. Pengambilan sampel dalam DokumenL 2 Swakelola 1. Persiapan
rangka surveilans kualitas air aporan Administra
minum si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir

3. UpayaGerakanMasyarakatHidupSehat (GERMAS)
a. Kegiatan penggerakkan DokumenL 1 Swakelola 1. Persiapan
tokoh masyarakat, tokoh aporan Administra
agama, kader, fasilitator si
desa, kelompok masyarakat
2. Pelaksanaa
lainnya untuk melakukan
kegiatan Germas. nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
b. Aktifikas fisik (senam rutin, DokumenL 1 Swakelola 1. Persiapan
senam hamil, senam lansia, aporan Administra
kelompok komorbid, dll), si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
c. Edukasi gizi seimbang DokumenL 1 Swakelola 1. Persiapan
(makan buah dan sayuQ di aporan Administra
semua tatanan si
(sekolah/UKS, ibadah,
2. Pelaksanaa
kantor pemerintahan/non
pemenntahan, melibatkan nKegiatan
organisasi profesi, ormas, 3. Waktu
forum pemuda, serta melalui Pelaksanaa
UKBM (Posbindu, Posyandu n(Januari
Lansia, Posyandu Remaja, -Des)
Dasa Wsma, Karang 4. Pembuatan
Taruna, Pos UKK, dII LaporanAkhir
d. Pembinaan kesehatan DokumenL 1 Swakelola 1. Persiapan
olahraga pada kelompok aporan Administra
masyarakat (Kelompok si
olahraga, ASN tk
2. Pelaksanaa
kecamatan, anak sekolah,
dan Jemaah haji) nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
4 Upayadeteksidini,preventifdanresponspenyakit
a. Surveilans Kejadian Ikutan DokumenL 3 Swakelola 1. Persiapan
Paska Imunisasi (KIPI) aporan Administra
pelaksanaan imunisasi si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
b. Validasi sasaran, hasil DokumenL 12 Swakelola 1. Persiapan
cakupan imunisasi dan aporan Administra
Rapid Convinience si
Assessment (RCA)
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
c. Pengambilan dan DokumenL 20 Swakelola 1. Persiapan
Pengiriman spesimen aporan Administra
penyakit berpotensi KLB ke si
laboratorium kesehatan
2. Pelaksanaa
daerah atau laboratorium
rujukan pemerintah di nKegiatan
kab/kota 3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
d. Pelacakan kasus Kronis atau DokumenL 2 Swakelola 1. Persiapan
kasus ikutan atau hasil aporan Administra
reaksi minum obat pada si
Pemberian Obat Pencegah
2. Pelaksanaa
Masal (POPM).
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
e. Surveilans binatang DokumenL 2 Swakelola 1. Persiapan
pembawa penyakit serta aporan Administra
pengiriman spesimen untuk si
konfirmasi.
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
f. Validasi sasaran, hasil DokumenL 2 Swakelola 1. Persiapan
cakupan GME, Depresi, aporan Administra
ODGJ Berat, si
Penyalahgunaan Napza dan
2. Pelaksanaa
Bunuh Diri
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
g. Deteksi dini kasus HIV/AIDS, DokumenL 2 Swakelola 1. Persiapan
TBC, Hepatitis, Malaria dan aporan Administra
penyakit menular lainnya si
pada Ibu hamil dan
2. Pelaksanaa
kelompok berisiko.
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
h. Deteksi dini faktor risiko DokumenL 12 Swakelola 1. Persiapan
PTM di posbindu PTM dan aporan Administra
Posyandu lansia. si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
i. Penemuan kasus PD3I, DokumenL 2 Swakelola 1. Persiapan
kasus kontak TB dan kasus aporan Administra
mangkir, kasus kontak kusta si
serta orang dengan
2. Pelaksanaa
gangguan jiwa serta
penyakit lainnya. nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
j. Konseling dan deteksi dini DokumenL 2 Swakelola 1. Persiapan
masalah kesehatan jiwa dan aporan Administra
napza. si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
k. Pelaksanaan pelayanan DokumenL 12 Swakelola 1. Persiapan
imunisasi baik imunisasi aporan Administra
rutin, pengenalan antigen si
baru, imunisasi tambahan,
2. Pelaksanaa
maupun kegiatan defaulter
tracking. nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
l. Pemberian Obat Pencegah DokumenL 2 Swakelola 1. Persiapan
Masal (POPM) untuk aporan Administra
pencegahan penyakit. si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
m. Advokasi/sosialisasi/lokakary DokumenL 1 Swakelola 1. Persiapan
a/rapat koordinasi Lintas aporan Administra
Sektor (LS)/ Lintas Program si
(LP) terkait pencegahan dan
2. Pelaksanaa
pengendalian penyakit.
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
n. Penyediaan bahan media DokumenL 1 Swakelola 1. Persiapan
Komunikasi, Informasi dan aporan Administra
Edukasi (KIE). si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
o. Pendataan sasaran POPM. DokumenL 1 Swakelola 1. Persiapan
aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
p. Pengambilan obat POPM ke DokumenL 2 Swakelola 1. Persiapan
dinas kesehatan aporan Administra
kabupaten/kota. si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
q. Sweeping untuk DokumenL 1 Swakelola 1. Persiapan
meningkatkan cakupan aporan Administra
POPM, imunisasi dan si
penyakit menular lainnya.
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
r. Pengendalian vektor nyamuk DokumenL 1 Swakelola 1. Persiapan
(Pemberantasan Sarang aporan Administra
Nyamuk, larvasidasi, si
fogging, Indoor Residual
2. Pelaksanaa
Spraying (IRS), modifikasi
lingkungan). nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
s. Pemantauan jentik secara DokumenL 4 Swakelola 1. Persiapan
berkala. aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
t. Penerapan Kawasan Tanpa DokumenL 1 Swakelola 1. Persiapan
Rokok (KTR) untuk Desa aporan Administra
Tanpa Asap Rokok si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
u. Pelatihan petugas konseling DokumenL 1 Swakelola 1. Persiapan
Upaya Berhenti Merokok aporan Administra
(UBM) di Puskesmas bagi si
kader kesehatan
2. Pelaksanaa
masyarakat.
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
v. Monitoring, bimbingan teknis DokumenL 2 Swakelola 1. Persiapan
pelaksanaan kegiatan pos aporan Administra
pembinaan terpadu si
(posbindu) penyakit tidak
2. Pelaksanaa
menular oleh petugas
puskesmas. nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
w. Pendampingan penderita DokumenL 6 Swakelola 1. Persiapan
penyakit menular menahun aporan Administra
dan penyakit tidak menular si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
q. Follow up tatalaksana dan DokumenL 1 Swakelola 1. Persiapan
pencegahan cacat kasus aporan Administra
kusta dan penyakit menular si
lainnya serta gangguan jiwa.
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
y. Orientasi/pembekalan/penin DokumenL 1 Swakelola 1. Persiapan
gkatan kapasitas SDM bagi aporan Administra
kader kesehatan untuk si
peningkatan P2P.
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
z. Pertemuan berkala kader DokumenL 1 Swakelola 1. Persiapan
kesehatan untuk P2P. aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
aa. Monitoring dan bimbingan DokumenL 1 Swakelola 1. Persiapan
teknis kader kesehatan oleh aporan Administra
petugas puskesmas. si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
ab. Koordinasi terpadu lintas DokumenL 1 Swakelola 1. Persiapan
program/lintas sektor aporan Administra
tentang pencegahan dan si
pengendalian penyakit
2. Pelaksanaa
tingkat puskesmas
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
STBM Desa/ Kelurahan
5 Prioritas

6 Dukungan operasional
UKM Tim Nusantara

Penyediaan Tenaga
7 dengan Perjanjian Kerja

a. Honorarium DokumenL 12 1. Persiapan


aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
b. Asuransi DokumenL 12
aporan
Akselerasi Program Indonesia Sehat dengan Pendekatan Keluarga (PIS-PK)
8
a. Pelaksanaan kunjungan DokumenL 1 Swakelola 1. Persiapan
keluarga dan intervensi awal aporan Administra
dalam rangka deteksi dini si
dan pengelolaan masalah 2. Pelaksanaa
kesehatan terintegrasi nKegiatan
melalui pendekatan keluarga
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
b. Pelaksanaan intervensi DokumenL 1 Swakelola 1. Persiapan
lanjut termasuk Perkesmas aporan Administra
dalam rangka intervensi si
hasil PIS-PK
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
 
Fungsi Manajemen
Puskesmas (P1, P2, P3)

Lokakarya mini dalam DokumenL 12 Swakelola 1. Persiapan


rangka penguatan aporan Administra
perencanaan (P1), si
penggerakan pelaksanaan
2. Pelaksanaa
(P2), pengawasan
pengendalian dan penilaian nKegiatan
(P3) kinerja Puskesmas 3. Waktu
serta kegiatan koordinasi Pelaksanaa
lintas sektor lainnya. n(Januari
-Des)
4. Pembuatan
LaporanAkhir
COVID-19

a. Pelacakan kontak dan DokumenL 12 Swakelola 1. Persiapan


Pemantauan harian selama aporan Administra
karantina dan/ atau isolasi si
oleh tracer dan/atau petugas
2. Pelaksanaa
puskesmas
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
b. Biaya Komunkasi Pelacakan DokumenL 12 Swakelola 1. Persiapan
kontak dan Pemantauan aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
c. Honor Pengolah data kasus DokumenL 12 Swakelola 1. Persiapan
Covid-19 di puskesmas aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
d. Biaya Komunikasi untuk DokumenL 12 Swakelola 1. Persiapan
pengolah data puskesmas aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir
e. Penyelidikan Epidemiologi DokumenL 12 Swakelola 1. Persiapan
kasus Covid-19 aporan Administra
si
2. Pelaksanaa
nKegiatan
3. Waktu
Pelaksanaa
n(Januari
-Des)
4. Pembuatan
LaporanAkhir

D. KURUNWAKTUPENCAPAIANKELUARAN
Kurun waktu pencapaian kegiatan diharapkan dapat dilakukan dalam waktu1tahun

E. BIAYAYANGDIPERLUKAN
BiayayangdiperlukanuntukpencapaiankeluaranBantuanOperasionalKesehatanPuskesmassebesa
rRp. 534.985,108 (Lima Ratus Juta Tiga Puluh Empat Ribu Sembilan Ratus Delapan Puluh Lima
Ribu Seratus Delapan rupiah) dengan kebutuhan per rincian menukegiatansebagaiberikut:

No RincianMenuKegiatan KebutuhanBiaya
1 UpayaPenurunanAKI,AKB 112.804.148
2 UpayaPercepatanperbaikangizimasyarakat 78.280.000

3 UpayaGerakanMasyarakatHidupSehat(GERMAS) 22.764.900

4 Upayadeteksi dini,preventif danresponspenyakit 101.794.000


5 STBM Desa/ Kelurahan Prioritas
15.000.000
Dukungan operasional UKM Tim Nusantara -
6
Penyediaan Tenaga dengan Perjanjian Kerja 48.480.048
7 - Tenaga Promosi Kesehatan dan Ilmu Perilaku
- Tenaga Nutrisionis
- Tenaga Administrasi Keuangan
- Apoteker

Akselerasi Program lndonesia Sehat dengan


8
PendekatanKeluarqa(PlS-PK) 6.000.000
Fungsi Manajemen Puskesmas (P1, P2, P3) 65.847.400
9
Upaya Kesehatan Lanjut Usia -
10
UpayaPencegahandanPengendalianCoronaVirus
11 84.180.960
Disease19(COVID19)
Total Rp. 534.985.108

RincianAnggaranBiaya(RAB)terlampir

Kepala Puskesmas
Suo-Suo

Eldawati, Am.keb
NIP. 19751219 200604 2 007