Anda di halaman 1dari 19

DAPATKAN

JANTUNG SEHAT
SELAMANYA
PANDUAN TERBAIK
Oleh edi tOr
S
erangan jantung yang sesungguhnya, mungkin tidak sedramatis
yang sering digambarkan dalam sebuah flm. Jarang ada pria
yang sedang berdiri dalam sebuah jamuan makan malam, atau
sedang berolahraga di suatu sore, tiba-tiba mencengkeram
dadanya, tersengal-sengal, dan kemudian jatuh dalam
keadaan sudah tidak bernyawa. Hal yang sering terjadi adalah
munculnya gejala serangan jantung yang dirasakan seperti rasa
terbakar pada dada.
Namun, dari sekian banyak kasus serangan jantung, kematian mendadak
akibat serangan jantung bukan hal yang mustahil terjadi. Baru-baru ini,
Indonesia kehilangan salah satu tokoh politik yang sebelumnya tampak sehat
dan tidak pernah menunjukkan gejala penyakit apa pun, terlebih penyakit
jantung. Ini menunjukkan bahwa penyakit jantung bisa menyerang siapa saja,
kapan saja, dan pada usia berapa pun.
Berdasarkan data Riset Kesehatan Dasar (Riskesdas) 2007 Kementerian
Kesehatan Indonesia, disebutkan bahwa penyakit jantung masuk dalam lima
besar penyakit yang menyebabkan kematian tertinggi. Rata-rata lebih dari
220 ribu jiwa meninggal setiap tahun akibat penyakit jantung di Indonesia.
Bila Anda ingin memiliki jantung yang sehat dan menikmati hidup
lebih lama, maka Anda membutuhkan lebih dari sekedar semangat. Anda
membutuhkan jantung yang kuat, karena memperkuat jantung juga akan
mengurangi risiko terkena serangan jantung. Tak hanya itu, hal terpenting
dari semua ini adalah memahami gaya hidup Anda selama ini, apakah justru
membuat Anda berisiko terkena penyakit jantung atau tidak. Agar jantung
Anda tetap sehat dan kuat, kami berikan panduan terbaik untuk merawat dan
menyelamatkan jantung Anda sejak dini. Dari mulai memahami penyebab
utama terjadinya penyakit jantung, hingga bagaimana mengatur pola makan
dan latihan yang dapat memperkuat jantung Anda. Semoga panduan dari
kami ini dapat membantu Anda memiliki jantung sehat seumur hidup Anda,
sehingga Anda bisa terus menikmati hari-hari terbaik dalam hidup Anda.
Redaksi
HIDUP
LEBIH LAMA
Daftar isi
Bagian 1
anCaMan
SERangan
JanTUng
MEnDaDaK
Bagian 2
SELaMaTKan
JanTUng anDa
SEKaRang!
OlahragaTerbaik
UntukJantungAnda
10MakananTerbaik
BagiJantungAnda
PenyebabTerjadinya
Penyumbatan
serba-serbiOperasi
SegalayangPerlu
AndaTahuSoalStatin
KapanSerangan
JantungPertama
MenyerangAnda?
KOnTAK
REDaKSi
Alamat: Jl. HR Rasuna Said Kav. B 32-33, Jakarta 12910
Telepon: ( 021) 526 6666, 525 3816, 520 9370 ext. 4122, 4330
Fax: ( 021) 5209366, 526 2131
E-mail :bestlife@feminagroup.com
iKLan
asni agus
Group Advertising Manager
Cellphone: 08161856141
Phone: +62 21 5253816 ext. 3277
E-mail:
asni.agus@feminagroup.com
Yuanita Theodora
jr. Advertising Manager
Cellphone: +6281511203102
Phone: +62 21 5253816 ext. 3290
E-mail:
yuanita.theodora@feminagroup.com
ali achmad
Account Executive
Cellphone: +6285813531531
Phone: +62 21 5253816 ext. 4278
E-mail:
ali.achmad@feminagroup.com
BERLangganan
Alamat : Jl. Rawagel am II /4 Kawasan Industri Pul ogadung, Jakar ta 13930
Telepon:( 021) 4682 1321; Fax: ( 021) 4682 1419
E-mail : si rkul asi @femi nagroup.com ( Si rkul asi )
Berlangganan: ( 021) 4682 5555; Fax: ( 021) 4682 5408
E-mail : l angganan@femi nagroup.com ( Pel ayanan Pel anggan)
oleh david h. newman, m.d.
ancaman
serangan
MEnDaDaK
jantung
Bagaimana mungkin seorang presenter televisi yang lolos pemeriksaan kesehatan jantung,
terkena serangan dua bulan kemudian? Inilah kebenaran tentang tes jantung yang sering menipu.
i sebuah studio rekam
an di kantor berita NBC
di Washington, tanggal
13 Juni 2008 bebe
rapa detik setelah me
nyapa seorang rekan
kerja dengan penuh
semangat Timothy
John Russert Jr. ambruk. Pada saat yang
hampir bersamaan ketika Russert menyapa
koleganya, sebuah plak kolesterol telah
menembus dinding dalam arteri koronernya
dan masuk ke dalam ruang vaskuler. Plak
kolesterol muncul di antara dinding dalam
dan tengah arteri (yang memiliki tiga lapis
dinding), mendorong lapisan dalam ke
tengah sehingga mempersempit jalur aliran
darah. Sebagaimana yang terjadi pada
hampir 40% penduduk Amerika berusia
4050 tahun, plak telah tertimbun di dinding
arteri koroner Russert.
Selsel di arteri dengan cepat bereaksi
terhadap kebocoran tersebut, dengan
segera mengirim sinyal untuk memanggil
dan mengumpulkan platelet dari darah
yang mengalir. Ini merupakan usaha untuk
menutup kebocoran, dan merupakan reaksi
penyelamatan yang bisa dengan cepat
menghentikan pendarahan saat pembuluh
darah terluka atau tertoreh hingga terbuka.
Namun dalam kasus plak koroner, sebenar
nya tidak ada pendarahan. Hanya ada
sobekan tipis di dinding dalam pembuluh
darah, seperti cat tembok yang terkelupas.
Dinding luar pembuluh tetap utuh. Platelet
Russert bereaksi berlebihan, membentuk
semacam sumbat dempul besar yang se
benarnya dirancang untuk menutup lubang
yang menganga. Pada kasus kelupasan cat,
gumpalan dempul itu justru menyumbat ar
teri dan menghambat aliran darah ke hampir
separuh otot jantung. Jantung Russert
berhenti berdetak. Begitulah kejadiannya.
Gagal jantung akut, di mana jantung
korban berhenti berdetak terutama akibat
D
serangan jantung, tidak terasa sakit. Bukan
korbannya yang menderita, melainkan
keluarga dan temanteman. Dalam kasus
Russert, malah mempengaruhi seluruh
Amerika. Kepribadian Russert di depan layar
kombinasi antara kepeduliannya pada
kampung halaman, semangatnya pada
para kelas pekerja, nilainilai keluarga yang
dianutnya, dan optimisme tanpa batas, yang
membuat Russert disayangi telah membuat
penduduk Amerika merasa nyaman dan
akrab dengannya. Kehilangan itu berdam
pak besar dan membangkitkan nuansa
mencekam dalam liputan kematian Russert
ditambah isyuisyu seputar penyakit jantung
yang mematikan. Karena, siapa yang bisa
menjelaskan jatuhnya ikon Amerika yang
terlihat sehat ini? Serangan jantung yang ia
alami adalah satu dari sekitar satu juta kasus
pada tahun yang sama, dan menimbulkan
ketakutan masyarakat tentang penyakit
jantung koroner.
Selang beberapa hari setelah Russert
kolaps, perbincangan tentang kesehatannya
muncul ke permukaan. New York Times,
Washington Post, USA Today, bahkan People
terangterangan mengajukan pertanyaan
apakah kematian Russert sebenarnya bisa
dicegah. Larry King, yang pernah selamat
setelah mengalami serangan jantung,
menayangkan satu program penuh untuk
membahas seputar kesehatan Russert,
dengan panel ahli yang mencakup dokter
pribadi Russert, Michael Newman, ahli
bedah jantung selebriti Mehmet Oz, dan
Usia 40 tahun
Risikomenderita
seranganjantung
pertamaatau
meninggaladalah
0,2%(1dari500
orang).
Risikorata-rata
dalam10tahun:
2,5%(1dari40)
Berdasarkanrisiko
0,2%,jikahasiltes
positif,risikonya
menjadi0,6%
(1dari167).
Jikahasilnyanega-
tif,risikonyamenjadi
0,1%(1dari1000).
Boks 1
RiSiKo SERangan JanTUng
SETELah DiSESUaiKan
DEngan haSiL UJi STRES
poSiTif aTaU nEgaTif
Usia 50 tahun
Risikomenderita
seranganjantung
pertamaatau
meninggal
adalah0,4%
(1dari250).
Risikorata-rata
dalam10tahun:5%
(1dari20).
Berdasarkanrisiko
0,4%,jikahasiltes
positif,risikonya
menjadi1,2%
(1dari84).
Jikahasilnyanegatif,
risikonyamenjadi
0,3%(1dari330).

Be S t l I F e I ndone S I a
3
4 Be S t l I F e I ndone S I a
kardiologis langganan para artis P.K. Shah.
Dr. Newman, dokter umum yang kalem dan
ahli jantung ternama, menyatakan Russert
merupakan pasien yang baik, rajin minum
obat statin dan tekanan darah, berolahraga
setiap hari, dan baru saja menjalani uji stres
(uji kesehatan jantung untuk menentukan
apakah ada sumbatan atau tidak). Kesak
sian ini makin meresahkan penonton yang
kebanyakan beranggapan bahkan sete
ngah berharap bahwa Russert mengabai
kan kesehatannya. Namun dia memperha
tikan kondisi kesehatannya, dan begitu
pula Dr. Newman.
Dr. Newman tidak membahas sejauh
apa uji stres, obatobatan, dan olah raga
bisa efektif dalam membantu mencegah
serangan jantung. Tanpa penjelasan ter
sebut, para penonton hanya dapat men
dugaduga kenapa ketiga hal tersebut
tidak menyelamatkan nyawa Russert. Dr.
Oz menyatakan olah raga untuk mengura
ngi lemak perut mungkin bisa mencegah
kematian Russert. Sayangnya, ia juga tidak
memberikan data spesifk atau penjelasan
apapun tentang efektiftas langkah terse
but. Dr. Shah, kardiologis Larry King,
menyatakan bahwa CAT scan merupakan
uji yang ideal untuk mendeteksi penyakit
jantung dan bergurau dengan mengatakna
ia mengenal pembuluh koroner King se
perti telapak tangan saya sendiri. Dr. Shah
juga alpa memberikan bukti pendukung
yang menjelaskan bagaimana CAT scan
sebenarnya bisa saja menyelamatkan
Russert. Di Kings show dan ratusan berita
lainnya yang khusus membahas pertanya
an bagaimana seharusnya Russert bisa
selamat, tidak ada yang memaparkan
fsik. Pasien yang terdeteksi mengalami
gangguan adalah mereka yang arterinya
terhambat namun tidak terlalu parah. Jika
arteri hanya terhambat sedikit, otot jantung
tetap mendapat pasokan darah yang me
madai, termasuk pada saat berolahraga.
Jika arteri tersumbat, pasokan darah akan
kurang baik pada saat istirahat maupun
pada saat berolahraga, sehingga EKG
tidak menunjukkan perubahan pada saat
pasien diminta berolah raga. Penyebab lain
uji tersebut gagal adalah bahkan dengan
tingkat sumbatan yang pas, hampir pada
setengah kasus, masalah itu tidak dapat
ditampilkan oleh EKG. Alasan lain, mungkin
yang terpenting, adalah bahwa pengujian
tersebut dirancang untuk mendeteksi
sumbatan arteri, bukan untuk meramalkan
serangan jantung. Meskipun bisa meman
cing masalah, sumbatan itu sendiri bukan
merupakan masalah.
Bagi banyak orang, sumbatan pembu
luh darah merupakan bagian yang normal
dari penuaan, dan tidak akan mempenga
ruhi hidup mereka. Uji stres tidak bisa
meramalkan dengan tepat kapan, atau
apakah, sebuah plak di dinding arteri yang
sebagian tersumbat akan menusuk pem
buluh dan menyebabkan serangan jantung.
Dalam riset terbesar dan terpenting
tentang hal ini, pada tahun 2000, sebuah
kelompok kedokteran preventif di Texas
menerbitkan pengalaman mereka dengan
melakukan uji stres terhadap lebih dari 25
ribu pria. Usia ratarata 43, dan para pria
tersebut dipantau untuk mengetahui kasus
semacam Russert selama hampir 10 tahun
atau lebih setelah mereka menjalani tes.
Para periset menemukan bahwa 158 pria,
kurang dari 1% dari total pasien, meninggal
akibat penyakit jantung selama waktu riset.
Hasil uji stres dilaporkan normal bagi ham
pir 40% dari mereka yang meninggal.
Yang menjadi masalah dengan uji stres
bukanlah tes itu sendiri, melainkan pasien
dan dokter yang salah memahami hasil
tes. Pandangan tradisional kita terhadap
interpretasi uji medis terpusat hanya pada
akurasi tes itu sendiri, kemampuannya
untuk mendeteksi penyakit jika memang
penyakit itu ada. Namun pendekatan yang
kelihatannya masuk akal ini benarbenar
keliru. Sebenarnya makna utama hasil tes
lebih tergantung kepada konteks dibanding
akurasi. Misalkan seorang pria didapati
positif pada tes kehamilan. Meskipun tes
kehamilan yang dilakukan di rumahpun
bisa dibilang akurat, kita segera paham
bahwa hasil tes tersebut tidak benar. Hasil
yang keliru itu bisa diakibatkan oleh kesa
lahan operator, reaksi silang, cacat pada
tes, kekeliruan di lab, dan lainlain. Kita
Catatan:
ujistresdanCAT scanuntukmengeteskalsiumtelah
diselidikikemampuannyameramalkanserangan
jantungataukematianakibatpenyakitjantung.
Angka-angkadaririset-risettersebutmembantu
perhitunganstatistikdiatas.KemampuanujiCRP
(c-reactive protein)untukmeramalkanserangan
jantungataukematianakibatpenyakitjantungbelum
pernahdiselidikisehinggatidakdisertakandisini.
Boks 2
ManfaaT DaRi BERBagai
TES Dan TERapi
Usia 40 tahun
Risikodasarmening-
galkarenaserangan
jantungataumenga-
lamiseranganjan-
tungyangpertama
adalah0,2%.
nilaikalsiumkoroner
denganCAT scan
lebihdari250:0,6%.
nilaikalsiumkoroner
denganCATscan
kurangdari250:0,1%.
peluang seseorang
berusia 40 tahun
dan sehat untuk di
selamatkan jika...
Minumaspirin
sebutirsehari:1dari
5000(0,02%).
Minumstatin:1dari
25000(0,004%).
Minumobattekanan
darahtinggi:1dari
17000(0,006%).
Usia 50 tahun
Risikodasarmening-
galkarenaserangan
jantungataumenga-
lamiseranganjantung
yangpertama
adalah0,4%.
nilaikalsiumkoroner
denganCAT scan
lebihdari250:1%.
nilaikalsiumkoroner
denganCAT scan
kurangdari250:0,2%.
peluang seseorang
berusia 50 tahun
dan sehat untuk
diselamatkan jika...
Minumaspirinsebutir
sehari:1darai2500
(0,004%).
Minumstatin:1dari
12500(0,008%).
Minumobattekanan
darahtinggi:1dari
8500(0,012%).
data, angka nyata, yang bisa membantu
keputusan medis. Namun data statistik
bukanlah yang kita perlukan. Untuk komu
nitas medis, data bukan topik yang nyaman
diperbincangkan. Itulah salah satu rahasia
gelap dunia kedokteran modern.
Uji stres dengan menggunakan treadmill
di mana pasien tersambung dengan me
sin elektrokardiogram dan harus berolahra
ga sementara EKG mereka dipantau untuk
mendeteksi perubahan abnormal meru
pakan salah satu uji medis modern yang
paling umum untuk mengecek kesehatan
jantung. Russert dilaporkan menjalani uji
stres pada bulan April sebelum ia mening
gal, namun pengujian tersebut tidak bisa
mencegah kematiannya ataupun mempe
ringatkan dokternya bahwa ia mengalami
penyumbatan arteri koroner. Mengapa?
Salah satu sebabnya adalah karena pengu
juan tersebut dirancang untuk mendeteksi
otot jantung yang kekurangan pasokan da
rah pada saat pasien melakukan kegiatan
pERTanYaan WaKTU
KematianRussertmembuat
penanganankesehatan
jantungdipertanyakan.
Be S t l I F e I ndone S I a
5
segera menyadari bahwa jauh lebih besar
kemungkinan hasil tes keliru dibanding
peluang seorang pria hamil. Hasil positif
tes kehamilan pria itu salah. Konteks me
ngalahkan akurasi.
Hasil tes tidak bisa menyatakan apakah
suatu penyakit atau gejala itu ada; melain
kan menyatakan peluangnya lebih besar
atau lebih kecil. Seberapa besar atau kecil
peluang tersebut bergantung kepada kom
binasi yang tepat dari konteks dan akurasi.
Dalam hal Russert, pria Amerika berusia
58 tahun, ia memiliki peluang 0,6%, atau
kurang dari 1 dari 100, untuk mengalami
serangan jantung yang pertama dalam
hidupnya setahun ke depan, menurut
sebuah riset yang sedang dilakukan oleh
National Heart Lung Blood Institute. Nilai
risiko patokan umum ini merupakan kon
teks dari tes. Angka ini kemudian dikombi
nasikan dengan akurasi tes, yang disebut
rasio kemungkinan, angka yang didapat
dari riset dan menyatakan akurasi intrinsik
hasil tes. Konteks dan akurasi kemudian
dikombinasikan secara matematis, dikali
kan, dan hasilnya adalah risiko yang telah
disesuaikan. Dengan perhitungan ini, ke
terlalu kecil? Mungkin tidak. Mungkin kita
bisa mengambil pelajaran bahwa bagi
seorang pria berusia 58 tahun, tanpa
sejarah serangan jantung atau sakit
dada atau gejala lain yang menunjukkan
penyakit jantung, peluang masalah jantung
serius terlalu kecil untuk dideteksi oleh
uji stres. Bahkan dengan hasil tes positif,
Russert masih memiliki peluang tes
tersebut 98,2% keliru dalam meramalkan
serangan jantung. Angkaangka yang
secara konsisten tidak membantu ini telah
mendorong American Heart Association
dan US Preventive Services Task Force
untuk merekomendasikan bahwa uji stres
tidak lagi digunakan untuk mendeteksi
penyakit jantung. Besarnya biaya tes,
peluang besar bahwa hasil positif adalah
keliru, dan peluang besar penggunaan
uji berikutnya yang bisa berbahaya (yang
sering dilakukan berdasarkan hasil
positif yang sebenarnya keliru), serta
tekanan psikologis merupakan dasar kuat
untuk tidak menggunakan uji stres, atau
menggunakannya dengan cermat.
Meskipun demikian, uji stres tetap me
rupakan salah satu bentuk tes jantung yang
paling umum. Aplikasi yang berlebihan ini
mewakili budaya kedokteran modern yang
cenderung terobsesi dengan berbagai tes
dan terapi dengan berbagai alasan: ancam
an gugatan, tuntutan pasien, dan keter
batasan waktu. Statistik yang mengece
wakan itu juga berlaku untuk tes prostat,
mamogram, dan langkahlangkah rutin
lainnya, yang semuanya tidak pernah ter
bukti menyelamatkan jiwa, meskipun telah
digunakan bertahuntahun dan menjadi
objek ratusan riset yang berusaha mem
buktikan bahwa testes tersebut efektif.
Sementara teknologi terus berkembang,
dan electron-beam CAT scan, CAT scan
angiography, dan uji stres semua menjadi
lebih umum, patut dicatat bahwa tidak ada
di antara teknologi tersebut yang pernah
terbukti menyelamatkan nyawa pasien.
Karena itu, wajar jika para dokter segan
membahas data uji stres. Uji stres, seba
gaimana halnya dengan mamogram dan
perangkat kedokteran medis umum lain
nya, tampaknya benarbenar tidak banyak
membantu.
Perhatian bahwa di sisi lain semakin
dekat risiko pasien ke 50%, semakin besar
peluang risiko itu tergeser oleh hasil tes.
Tes bisa sangat bermanfaat jika peluang
suatu penyakit sangat tinggi. Sebuah con
toh dalam kasus uji stres adalah perokok
berat yang mengalami sakit dada setiap
RUSSERT DiLapoRKan MEnJaLani UJi STRES
paDa BULan apRiL SEBELUM ia MEninggaL,
naMUn pEngUJian TERSEBUT TiDaK BiSa
MEnCEgah KEMaTiannYa aTaUpUn MEMpE
RingaTKan DoKTERnYa BahWa ia MEngaLaMi
pEnYUMBaTan aRTERi KoRonER. MEngapa?
mungkinan Russert mengalami serangan
jantung yang pertama berkurang dari 0.6%
menjadi 0,4% setelah hasil uji stresnya
yang negatif. Jika hasil uji stresnya positif,
risikonya meningkat menjadi 1,8% (rasio
kemungkinan sebuah tes berbeda untuk
hasil positif dan negatif).
Menyesuaikan dan memahami risiko
serangan jantung sangatlah penting dalam
membantu mengambil keputusan dalam
hal terapi, tindakan pencegahan, dan pe
ngobatan. Namun perhatikan besarnya
variasi seperti tertera di Boks 1. Angka
angka tersebut membuat para dokter tidak
nyaman dan sering tidak diketahui pasien.
Perhatikan bahwa uji stres hampir tidak ada
manfaatnya. Dalam setiap kasus, persenta
se risiko aktual hampir tidak berubah. Bah
kan dalam kasus orang dengan risiko terting
gi, pria berusia 50 tahun, pergeseran angka
risiko terbesar setelah uji stres hanyalah
sebesar 0,8% (dari 0,4% di baseline men
jadi 1,2% dengan hasil positif uji stres).
Apakah ini berarti uji stres itu menjadi
tidak perlu karena manfaatnya yang
kali naik tangga atau mengerahkan tenaga.
Orang tersebut memiliki peluang mengidap
penyakit jantung aktif, dan bisa menarik
manfaat dari terapi lebih lanjut (misalnya
obatobatan, pembedahan, atau stenting).
Namun semakin dekat peluang seseorang
ke 0% atau 100%, dan semakin jauh dari
50%, semakin sedikit efek hasil tes ter
hadap risiko total. Ini berarti konteks bisa
membuat tes hampir tidak ada gunanya,
sebagaimana halnya dengan uji stres
untuk meramalkan serangan jantung pada
orangorang tanpa gejala penyakit jantung.
Dalam prakteknya, ini berarti dokter
dan pasien harus membahas risiko aktual
serangan jantung atau penyakit jantung
yang berbahaya sebelum melakukan uji
stres, dan menggunakan faktor risiko untuk
menentukan bagaimana mengartikan hasil
positif/negatif tes tersebut dan apakah tes
tersebut memang perlu dilakukan.
Sebagai catatan akhir, uji medis penya
kit jantung idealnya bisa melacak bukan
hanya sumbatan arteri, gejala yang sering
tidak berbahaya dan tidak relevan, namun
juga mendeteksi orangorang yang akan
mengalami serangan jantung. Kemampuan
uji stres untuk melakukan hal tersebut
sangat terbatas, sebagaimana juga tes
darah, CAT scan, MRI, atau angiogram.
Ilmu saja tidak bisa memprediksi atau
menjelaskan kenapa plak bisa pecah.
Itulah sebabnya 50% pria yang meninggal
akibat penyakit jantung koroner tidak punya
gejala sebelumnya, menurut American
Heart Association. Namun anggap saja
prediksi tes ini selalu akurat. Jika demikian,
tes tersebut akan memicu peningkatan
1 | Berhubungan
seks.Priayang
mengalami3kali
orgasmeataulebih
setiapminggunya
mengurangi
risikomengalami
seranganjantung
hingga50%,
menurutsebuah
risetdiInggris.
2 | Minum 2 porsi
sehari.Duaporsi
minumansehari
-baikitubir,
anggur,atau
minumankeras
lainnya-dapat
mengurangirisiko
seranganjantung
hingga30%,
menurutrisetdi
Harvard.
3 | dinginkan
kepala.Lebih
dari30ribu
kasusserangan
jantungsetiap
tahunnyadipicu
olehkemarahan
sesaat,menurut
sebuahrisetdi
Harvard.Kendalikan
amarahAnda
denganbeberapa
kalimenarik
nafasdalam-
dalamdengan
menggunakan
perut,bukandada.
4 | Makan buah
dan sayuran.
Sekitar80%pria
tidakmemakan
5porsibuahdan
sayursetiapharinya,
padahalitubisa
mengurangirisiko
seranganjantung
hingga12%menurut
risetdiHarvard.
Makansepotong
buahsetiapkali
makandanmakan
sayurpadasaat
makansiangdan
malam.Gampang
bukan?
5 | Jalankan
mesin dengan
kecepatan tinggi.
Denganhanya2jam
olahragaaerobik
seminggu(berlari,
spinning,hoop)
-yangdibagidalam
sesiselamaminimal
30menit-bisa
mengurangirisiko
seranganjantung
hinggaseparuh,
katarisetdiKanada.
6 | angkat badan
anda. Tigakali
latihantotal-body-
weightseminggu
bsiamenurunkan
tekanandarah
diastolikhingga
8poin,menurut
risetdiMichigan
Technological
University.Itucukup
untukmengurangi
risikoserangan
jantunghingga15%.
7 | Hilangkan
perut buncit
anda. Risiko
seranganjantung
meningkathingga
3kalilipatjikaAnda
buncitdanmemiliki
duadariindikator
berikut:trigliserida
tinggi,HDLrendah,
guladarahtinggi,
atautekanandarah
tinggi.Jagaukuran
pinggangAnda
kurangdari36inci
danlemakbadan
kurangdari18%.
8 | tenggak
vitamin d.Pria
yangkekurangan
vitaminDmemiliki
risikolebihtinggi
mengalami
seranganjantung
dibandingkanpria
normal,menurut
risetdiHarvard.
Dosisharianyang
terbaikadalah
hingga800I.U.
9 | Makan
ikan berlemak.
Konsumsitinggi
asamlemak
omega-3-hingga
9gramseharidari
suplemendanikan
berminyakseperti
salmonliar-dapat
mengurangirisiko
seranganjantung
hingga59%,
menurutrisetdi
Circulationdan
Hypertension.
10 | Perkuat
dengan kacang.
Kacangbaikuntuk
jantungAnda.
Orangyang
mengkonsumsi3
onskacanghitam
seharimengurangi
risikoserangan
jantunghingga38%,
menurutrisetdi
Journalofnutrition.
t r e v o r t h i e m e
KURangi RiSiKo anDa MEngaLaMi
SERangan JanTUng
Perubahan pola makan dan gaya hidup bisa sama efektifnya dengan statin dalam
mengurangi risiko anda mengalami serangan jantung. Berikut ini 10 cara untuk
memperpanjang masa hidup jantung anda.
terapi medis termasuk terapi statin, antihi
pertensi, aspirin harian, dan pembedahan.
Namun tes untuk mendeteksi penyakit
hanya sanggup menyelamatkan nyawa
melalui terapi yang dilakukan sesudahnya.
Boks 2 menunjukkan manfaat masingma
sing dan gabungan dari terapiterapi terse
but, berdasarkan beberapa riset besar.
Dengan menganggap terapi tersebut bisa
digabung tanpa mengurangi efek masing
masingnya, potensi terapi bisa menyela
matkan nyawa bagi pasien patuh seperti
Russert berkisar antara 2% atau kurang.
Sayangnya, Tim Russert termasuk dalam
98% dari mereka yang tidak mendapat
manfaat dari obatobatan dan tes.
Tindakan medis preventif yang paling
ampuh yang kita ketahui saat ini adalah
olah raga, berhenti merokok, dan mengu
bah pola makan, yang semuanya tampak
nya lebih efektif daripada obatobatan
ataupun tes manapun. Jika kita mengabdi
kan uang, tenaga, dan pikiran kita untuk
olah raga dan diet sebanyak yang kita beri
kan untuk obatobatan dan tes, kita akan
menjadi lebih sehat secara fsik maupun
fnansial. Namun kita tetap saja memburu
obat sakti, tes sakti, atau scan sakti.
Baik dokter maupun pasien dibuat
frustrasi dan dibingungkan oleh penyakit
jantung. Namun harapan hidup Tim
Russert pada saat ia lahir adalah 66 tahun,
yang telah ia jalani hampir 90%, sambil
menyentuh kehidupan temantemannya,
rekanrekan, bahkan dunia dengan caran
ya yang mengagumkan. Ada pelajaran
yang bisa diambil dari kematiannya: kita
tidak perlu menjalani lebih banyak tes kita
hanya perlu menjalani hidup dengan lebih
berarti. Meskipun potensi manfaat dari ter
api kedokteran modern relatif kecil diband
ing dengan risikonya, terapi tersebut layak
dijalani. Kemungkinan sabuk pengaman
bisa menyelamatkan nyawa Anda dari hari
ke hari amat sangat kecil, namun Anda
sepatutnya memakai sabuk pengaman
karena risiko dan biayanya juga kecil.
Sebagai tambahan, jika satu juta orang
memakai sabuk pengaman atau meng
konsumsi obat tertentu, dan jika hanya
1% dari para pengguna tersebut yang
berhasil diselamatkan, itu sama dengan
10 ribu orang jumlah yang besar. Dengan
memahami angkaangka tersebut, dan
kekuatan nyata sains serta kekuatan yang
lebih besar lagi dari olah raga dan gaya
hidup yang kita jalani, kita bisa mengambil
alih kendali dari dokter, sinar X dan pil. Dan
kita akan memahami bahwa kekuatan yang
sangat besar pengaruhnya bagi kesehatan
kita berada di dalam diri kita sendiri
6 Be S t l I F e I ndone S I a
SELaMaTKan
JanTUng anDa
SEKaRang!
Penyakit jantung sering tidak menunjukkan gejala apa pun, menyerang tanpa
peringatan, dan membunuh satu orang di antara jutaan orang di dunia setiap menit.
Tapi Anda bisa mengurangi risiko dari serangan jantung sebesar 80%. Ini caranya.
O l a h r a g a
1
olahraga Terbaik
untuk Jantung anda
Latih jantung Anda untuk memompa
lebih banyak darah
Catatan: Jika Anda tidak biasa melakukan aktivitas penuh energy, minta dokter
mengevaluasi kesehatan jantung Anda sebelum memulai program olahraga.
aktivitas:
Berlari, atau akti
vitas kardio lain
yang melibatkan
kelompok otot
besar (misalnya
bersepeda, atau
berenang).
pemanasan:
Jogging selama
lima menit pada
kecepatan
sedang yang
memungkinkan
Anda masih bisa
mengobrol dengan
mudah saat
melakukannya.
interval lima
menit:
Menit 1: Larilah
pada 9095% dari
denyut jantung
maksimal Anda.
Menit 2: Larilah
pada 7580% dari
denyut jantung
maksimal Anda.
Menit 3: Larilah
pada 90 95% dari
denyut jantung
maksimal Anda.
Menit 4: Larilah
pada 75 sampai
80% dari denyut
jantung maksimal
Anda.
Menit 5: Larilah
pada 9095% dari
denyut jantung
maksimal Anda.
pemulihan aktif:
Berjalan atau
jogging selama
tiga menit selama
periode istirahat.
Ulangi seluruh
siklus dari interval
lima menit tersebut
sampai pemulihan
aktif sebanyak tiga
kali.
pendinginan:
Berjalan atau
jogging selama
lima menit pada
kecepatan
sedang yang
memungkinkan
Anda masih bisa
mengobrol dengan
mudah saat
melakukannya.
Bonus:
Cross Training
Tingkatkan latihan
jantung Anda
dengan sesekali
menyelinginya
dengan interval
antara treadmill
dan peralatan
lain. Semakin
banyak kelompok
otot besar yang
Anda gunakan,
dan semakin
beragam peralatan
yang Anda pakai,
semakin baik hasil
nya bagi latihan
kardiovaskular,
ujar Robbins.
Tip 1: Pastikan ada
12 kali lari sprint
selama satu menit
dalam latihan.
Tujuan Anda
adalah memper
tahankan konsis
tensi dari sprint
pertama sampai
terakhir, dan jika
mungkin, akhiri
dengan lebih kuat
dibandingkan saat
Anda memulai.
Tip 2: Awalnya,
lakukan istirahat
lebih lama di antara
lari sprint jika diper
lukan agar performa
Anda tetap bagus
sepanjang olahraga.
Kalau denyut
jantung Anda tidak
turun sampai 20
lebih denyut di
antara interval,
lakukan istirahat lagi
dan lewati sebuah
interval.
ni col e col l i ns
Semuaolahragaitubagus:Iabisamenurunkankolesterol,mengurangirisiko
penyumbatandarah,danbahkanmencegahpenyakitjantung.Ahlijantungkini
merekomendasikanolahragaminimal30menityangterdiridariolahragasedang
sampaipenuhenergitigakaliseminggu.Tapisatuaktivitasyangterbaikadalah
latihaninterval.Menurutpenelitianterbaru,olahragainimembangunkekuatan
jantungdenganmeningkatkankapasitasmemompanya.Untukmeningkatkan
semuakekuatanotot,Andaharusmemberipenekanandibagiantersebut,
ujarPaulRobbins,spesialismetabolismedariAthletessPerformancedi
Arizona.Latihanintervalberfungsilebihbaikdarilatihanlainnyakarenainterval
memungkinkankitamelakukanolahragasingkatdalamintensitasyanglebih
tinggi.KamimemintaRobbinsdanahlifsiologiolahragaUlrikWislfff,PhD,untuk
merancangregimenpenguatanjantungyangterbaik.Lakukanprogram42menit
ini(Andabutuhsebuahmonitorpemantaudenyutjantung)duakaliseminggu,
sambilmengombinasikannyadengansesipenambahkekuatanAndasendiri.
2
Di e t
10 Makanan Terbaik
Bagi Jantung anda
Manfaatkan makanan untuk menurunkan
kolesterol
1. KAcANG-KAcANGAN.
Orang yang menyantap 1,5 ons
kacangkacangan pistachio,
almond, dan walnut lebih dari
empat kali seminggu memiliki
risiko penyakit jantung koroner
37% lebih rendah ketimbang
mereka yang jarang makan
kacangkacangan, menurut
penelitian terakhir di British
Journal of Nutrition.
2. IKAN. Menyantap dua
hidangan ikan kaya omega3
dalam seminggu sudah cukup
untuk mengurangi risiko penya
kit jantung secara signifkan,
menurut American Heart
Association. Docosahexaenoic
acid (DHA) dan elcosapentae
onic acid (EPA) adalah asam
lemak omega3 dalam ikan
yang bisa melawan penyakit
jantung koroner. Salmon liar
dan makerel dari Atlantik adalah
sumber terbaik.
3. GANDUM. Menyantap
ratarata 2,5 sajian whole grain
per hari (seperti gandum, beras
merah, dan barley) mengurangi
risiko Anda terhadap penyakit
kardiovaskular sebesar 21%,
menurut studi terbaru dalam
jurnal Nutrition, Metabolism &
Cardiovascular Diseases.
4. ALPUKAT. Sarat dengan
lemak tak jenuh tunggal
dan betasitosterol, alpukat
menawarkan ledakan penghan
cur LDL dosis ganda. Alpukat
juga kaya folat, vitamin B yang
larut dalam air dan membantu
menurunkan tingkat homocys
teine, asam amino yang bisa
menghalangi aliran darah di
dalam pembuluh.
5. KAcANG HITAM. Orang
yang makan tiga ons kacang
hitam sehari mengurangi risiko
mereka terhadap serangan
jantung sebesar 38%, menurut
studi terakhir dalam Journal of
Nutrition. Kacang hitam sarat
dengan nutrisinutrisi paling top,
yaitu protein, lemak yang sehat,
folat, magnesium, berbagai vita
min B, potassium, dan serat.
6. BIJI RAMI. Sebuah pene
litian barubaru ini terhadap
orangorang berkolesterol
tinggi (lebih dari 240 mg/dL)
membandingkan efek dari
pengobatan dengan statin dan
konsumsi 20 gram biji rami
per hari. Setelah 60 hari, mer
eka yang menyantap biji rami
menunjukkan hasil yang sama
baiknya dengan mereka yang
menggunakan obatobatan
statin. Taburkan biji rami ke
bubur gandum, yogurt, dan
salad Anda.
7. TEH HIJAU. EGCG, zat
antioksidan yang membantu
memerangi penyakit jantung,
banyak ditemukan di dalam teh
hijau. Minum teh ini seperti Anda
minum air putih: Lima cangkir
teh hijau sehari bisa meningkat
kan kesehatan jantung Anda,
menurut sejumlah penelitian
terbaru. Tapi jangan tambahkan
susu, karena bisa melenyapkan
manfaatnya.
8. SEMANGKA. Sarat akan
potassium yang dapat menu
runkan tekanan darah, sumber
yang bagus dari vitamin C yang
bisa mengurangi peradangan,
dan kaya akan lycopene, sepo
tong semangka atau satu gelas
jus semangka harus menjadi
bagian menu makan Anda
seharihari.
9. BAYAM. Kaya akan sejumlah
mineral penting, yaitu potas
sium dan magnesium, bayam
adalah sumber terbaik dari
lutein, zat antioksidan yang bisa
membantu mencegah terjadinya
penyumbatan dalam pembuluh
darah. Santaplah secangkir
bayam segar atau setengah
cangkir bayam matang sehari.
10. RED wINE. Dengan kan
dungan resveratrol tinggi zat
alami yang dapat menurunkan
LDL, meningkatkan HDL, dan
mencegah penyumbatan darah
red wine bisa benarbenar
menjadi penyelamat hidup An
da. American Heart Association
merekomendasikan dua gelas
per hari. Vin rouge juga sumber
yang kaya akan favonoid, anti
oksidan yang membantu melin
dungi lapisan pembuluh darah
di dalam jantung Anda. Bukan
peminum wine? Makanlah dark
chocolate. Kandungan favonoid
nya sama dengan red wine.
SebenarnyaAndatahuapayangseharusnyaAndamakan,tapitidak
menganggapseriuspolamakanyangkayawholegrain,buah,sayur,dan
ikan.Komitmenyangmasihkurangtersebut,bisaberakibatfatal.Pola
makanyangsehatbagijantungbisamenurunkantingkatLDL,sikolesterol
jahat,sampai30%-jumlahyangsamadenganyangAndadapatkandari
obat-obatanstatin.Sepuluhmakananberikutmengandungkeajaiban:
MerekabisamenurunkantingkatkolesterolLDL,meningkatkankolesterol
baikHDL,dan,yangpalinghebat,tidakmembutuhkanresepdokter.
PArAkonsulTAn: suzanne Farrell, ahli diet terdaftar dan juru bicara American Dietetic Association
Phyllis McCarron, ahli diet terdaftar di Johns Hopkins university Mark Moyad, MD, direktur Phil F. Jenkins
dari pengobatan pencegahan dan alternatif di university of Michigan Medical Center Michael roizen, MD,
kepala petugas kesehatan di Cleveland Clinic dan Walter Willet, MD, profesor epidemiologi dan nutrisi di
Harvard school of Public Health.
S e P t e MBe R 2 0 1 0
7
8 Be S t l I F e I ndone S I a

Be S t l I F e I ndone S I a
9
Angioplastydenganstentselang
penghubungdarilogamyangberfungsi
menahanpembuluhdarahtetapmembuka
merupakancontohpesatnyapertumbuhan
industriperawatanmedis.Pada1994,
FDAmenyetujuistentyangpertama,dan
padatahun2006,sebanyak615.000stent
dimasukkankedalamtubuhpasien,dengan
biaya36.000dolarAmerikaperpasien.
Biasanya,ahlijantungmemasangstent
melaluisebuahkateterkedalampembuluh
darahkoronerditempatpenyumbatan
terjadi.Doktermenggembungkansebuah
balondidalamstent,danvoil:Semua
kotorantersebuttergencetkedinding
pembuluhdarah,membukajalurdan
memulihkanalirandarahkeototjantung.
Angioplastydenganbalonsebenarnya
sudahadasejak1970an,namunpara
doktermenemukanbahwa30sampai
50%penyumbatanterjadikembalidalam
enambulansetelahdipasang.Penemuan
stentpadapertengahan1990anberhasil
menekanangkakemunculanulangtersebut
sampai25%,danprosedurinitelahmenjadi
penyelamathidupparapasienserangan
jantung.Buktiyangtakdapatdibantah
adalahbahwajikaAndamembukasebuah
pembuluhdarahdalam12jampertama
setelahseranganjantung,nyawabisa
diselamatkan,ujarJudithS.Hochman,MD,
profesorkardiologiHaroldSnyderFamilydi
newYorkUniversitySchoolofMedicine.
Tapikinisebagianbesarangioplasty
tepatnya85%-tidakdilakukanterhadap
pasienseranganjantung,tapimenjadi
prosedurpilihanyangdilakukanpada
orang-orangyangmungkinmemilikigejala-
gejalapenyakitjantungkoronernyeri
dada(angina),sesaknapas,keterbatasan
aktivitasfsiktapitidaksedangdalam
camankematiandalamwaktusingkat.Tahun
2004,72.000angioplastydilakukanpada
priadibawahusia44tahun,dan550.000pria
berusia45sampai64tahun.
Kitaharustetapingatperbedaan
antaraseranganjantungdanpenyakit
jantungkoroner,kataMarcusReidenberg,
MD,profesorfarmakologidiWeillCornell
MedicalCollege.Seranganjantung
adalahkondisidarurathidup-atau-mati
yangakut,sedangkanpenyakitjantung
koronerituterjadisecarabertahap,
kronis,danprofresif.Plakberakumulasi
danmenyebabkanpenyumbatandalam
pembuluhdarahkoronersecaraperlahan,
kadangtimbulgejala,kadangtidak.Orang
tidakakanlangsungmatisaatterjadi
penyumbatan,ujarRichardLange,MD,
kepalakardiologiklinisdiJohnsHopkins
UniversitySchoolofMedicine.Mereka
meninggalbilapenyumbatanpembuluh
darahtersebutmengakibatkanserangan
jantung.
Paraahlijantungkiniyakinbahwa
penyebabpalingseringterjadinya
penyumbatanketikaplakyangrapuh
pecah,menariksel-seldarahmerah
danmembentukpenyumbatanyang
menutuppembuluhdarah.Caraterbaik
untukmengurangirisikodariserangan
jantungmacaminiadalahdengan
mengontroltingkatkolesterol(khususnya
tingkatLDL)dantekanandarahuntuk
mencegahberkembangnyaplaksejakdini.
Angioplastyhanyamengobatisatucabang
daripohonkoroner;namuntidakmampu
menjagakesehatandaripohonitusendiri.
Jadi,tidakmengejutkankalau
pasienyangmenjalaniangioplastyuntuk
meringankangejalapenyakitjantung
koronernyatidakhiduplebihlamadan
mengalamiseranganjantungyanglebih
banyakdibandingkanmerekayangdirawat
denganobat-obatan,sepertiditunjukkan
dalamberbagaimacampenelitian
terbaru.Meskiangioplastymemang
meringankanpenderitaanpasiendengan
cepat,namunkesehatannyaperlahan-
lahanakanmenurun.Sebelumpenelitian
tersebut,banyakorangpasienmaupun
dokteryangpunyaanggapansalahbahwa
jikaAndamenemukanpenyumbatan
danmembukanya,Andabisamencegah
seranganjantung,ujarDr.Lange.
Ternyatainitidakbenar.
Penelitiantentangstentitusendiri
masihberlanjut.Stentlogam,yang
digunakanuntukmerawatpasienserangan
jantung,cenderungdipenuhioleh
jaringanluka,sehinggapasienseringkali
haruskembalikerumahsakit,biasanya
dalamwaktusekitarenambulan,untuk
mengeluarkannyaharusdipasangstent
baru,ataumenjalanioperasibypass.Pada
tahun2003,paraprodusenmulaimelapisi
stentdenganobatyangdapatmencegah
timbulnyajaringanluka,namunstentini,
yangdikenalsebagaiDrug-Eluting Stent
atauDES,meningkatkanrisikojangka
panjangterhadappenyumbatan.Dengan
DES,[penyumbatan]trombosisstenttidak
terlaluseringterjadihanyasekitarsatudari
200pasien,ujarDr.Lange.Tapiketikahal
itubenar-benarterjadi,mautakandatang.
Separuhdaripasienmeninggaldunia.
Gagalnyapenelitiantersebut
berdampakbesarbagiduniamedis
JPMorganChasememperkirakanbahwa
penjualanDESmerosotsebesar23%pada
2007patutdiketahuibahwaAmerican
CollegeofCardiologymerekomendasikan
angioplastyhanyasetelahusaha-usaha
lainditerapkan,yaitudenganmemperbaiki
polamakan,meningkatkanolahraga,dan
menggunakanobat-obatan.n a n c y f . s m i t h
O p e r a s i
Angioplasty (prosedur mengecek dan membersihkan jantung dari sumbatan) digembar-gemborkan
sebagai gebrakan yang dapat mencegah serangan jantung, tapi penelitian terbaru memaksa para
dokter untuk mengevaluasi kembali kemujarabannya.
Serbaserbi operasi
4
a N at O Mi s e r a N g a N J a N t U N g
1. Partikel kolesterol ldl diserap ke dalam dinding pembuluh darah, memicu sel-sel di dalam dinding
pembuluh untuk memanggil sistem kekebalan tubuh.
2. Sel-sel darah putih dari sistem kekebalan tubuh mendesak masuk ke dalam dinding pembuluh
darah. Sel-sel darah putih ini memancarkan sinyal kimiawi yang mengakibatkan peradangan, terutama
duri-duri kecil dalam pembuluh darah yang disebut molekul pelekat, yang menjerat semakin banyak
sel-sel sistem kekebalan tubuh yang sedang mengapung.
3. Sel-sel darah putih berkembang menjadi macrophages, yang tumbuh dan menelan partikel-partikel
kolesterol ldl. Inilah awal terbentuknya plak.
4. Sebagian sel-sel darah putih mati dan melepaskan racun. Plak membesar, dan tubuh menutupnya
dengan pembungkus dari jaringan luka berserabut dan sel-sel otot.
5. Pembungkus tersebut pecah, entah karena duri di dalam tekanan darah atau terjadi peradangan
kronis tak ada yang bisa memastikan. Plak campuran dari molekul lemak, kolesterol, dan sel-
sel darah putih yang mati merembes keluar dari luka tersebut menuju pembuluh darah. Hal ini
menarik sel-sel darah merah, yang membentuk penyumbatan di dalam pembuluh darah dan memicu
serangan jantung.
penyebab Terjadinyapenyumbatan Membesar
Sejakakhir1990an,parailmuwanterusmeningkatkanpenelitianuntukmempelajariperadangan
dalampembuluhdarahagarbisamemahamiterjadinyaseranganjantung.Kinimerekameyakini
bahwa85%seranganjantungtimbulketikakolesterolberlebihdidalamdinding-dindingpembuluh
darahmemicuperadangandanpertumbuhanplak,yanglantaspecahdanmengakibatkan
penyumbatanyangmerintangialirandarahkejantung.StevenE.nissen,MD,direktur
departemenpengobatankardiovaskulardariClevelandClinicFoundation,memberigambaransecaraurut:
3
pEMBULUh DaRah
SEL
DaRah
pUTih
SEL
DaRah
MERah
KoLESTERoL
LDL
pEnYUMBaTan
Segala Yang perlu
anda Tahu Soal Statin
Perawatan dengan obat-obatan statin terus
meningkat, namun para dokter masih
mempertanyakan efek sampingnya.
O b at- O b at a N
5
nSaat ini, ada enam obatobatan statin
di pasaran, tiga di antaranya tersedia
dalam bentuk generik. Setiap obat
memiliki potensi yang sedikit berbeda dan
dapat berinteraksi dengan obat-obatan
lain dengan cara berbeda (lihat Mana
Statin Untuk Anda?). Obat-obatan
statin melakukan tugasnya dengan
memperlambat produksi kolesterol dari
hati, sehingga ia bisa menarik lebih banyak
kolesterol jahat ldl dari aliran darah
tanpa ikut menurunkan kolesterol baik
hdl. Obat-obatan statin mengurangi
kolesterol yang bisa membentuk plak
sejak dini, ujar Steven r. erickson,
Pharmd, profesor farmasi di University
of Michigan, dan mereka juga bisa
mengerutkan plak yang sudah terbentuk
dan membuatnya menjadi stabil kembali,
sehingga risiko plak akan pecah jadi lebih
kecil dan mengakibatkan penyumbatan.
nKalau anda pernah kena serangan
jantung, terapi statin harus segera
dilakukan. Konsumsi obat ini seumur
hidup, kata Marcus reidenberg, Md,
profesor farmakologi di Weill Cornell
Medical College. Untuk pencegahan awal
(misalnya, orang yang punya faktor risiko
tapi tidak punya gejala-gejala penyakit
jantung), khasiatnya tidak terlalu kuat.
Baru-baru ini, panduan edukasi kolesterol
yang dibuat National institutes of health
merekomendasikan statin untuk pria
dengan kolesterol ldl di atas 160 mg/dl
jika mereka juga punya satu faktor risiko
lain (seperti berusia di atas 45 tahun,
merokok, punya tekanan darah tinggi, atau
punya sejarah keluarga yang menderita
penyakit jantung) dan untuk pria dengan
kadar ldl antara 130 sampai 160 mg/dl
yang punya dua atau lebih faktor risiko lain.
Kalau saya punya pasien yang berusia 40-
an tahun yang punya tekanan darah tinggi,
kelebihan berat badan, kolesterolnya
tidak bagus tapi tidak melebihi ambang
batas, dan tidak punya nyeri dada, maka
saya akan fokus dulu untuk memintanya
mengubah gaya hidupnya dengan
berolahraga, diet, mejaga tekanan
darah untuk mengurangi faktor risiko,
ujar dr. reidenberg. Untuk memutuskan
penggunaan statin, maka pasien saya itu
harus tetap memiliki faktor-faktor risiko
tersebut meski ia sudah mengubah gaya
hidupnya. dengan kombinasi pendekatan
seperti ini, ahli jantung memperkirakan
risiko terkena serangan jantung bisa
dikurangi sampai 80%.
nSaat ini diharapkan penggunaan statin
dapat lebih efektif dengan memberikan
tipe stain yang lebih kuat dengan
dosis lebih tinggi untuk menurunkan
kadar LDL. Menurut data terbaru dari 14
percobaan klinis, mengurangi kolesterol
ldl sampai tingkat yang amat rendah
(hingga 70 mg/dl) akan mengurangi risiko
timbulnya masalah kardiovaskular. Untuk
bisa mencapai target 70 mg/dl, panduan
American heart Association menyarankan
untuk melakukannya secara bertahap.
diawali dengan target sekitar 160 mg/dl
untuk orang-orang berisiko rendah, 130
mg/dl untuk pasien berisiko sedang,
100 mg/dl untuk mereka yang punya
penyakit jantung koroner, dan amat rendah
bagi pasien yang pernah kena serangan
jantung. Banyak dokter yang menghitung
jauh di atas rekomendasi, ujar Judith S.
hochman, Md, profesor kardiologi harold
Snyder Family di New York Universty
School of Medicine. Jika seorang dokter
memiliki pasien yang berada pada risiko
tinggi, ia mungkin mencoba untuk
menurunkan kadar tersebut sampai di
bawah 70.
nMenurunkan tingkat LDL sampai
amat rendah biasanya membutuhkan
tipe statin yang paling kuat dan dalam
dosis paling tinggi. Walaupun penelitian
terhadap konsumsi statin terkuat dalam
dosis tinggi belum sebanyak penelitian
terhadap dosis rendah dari versi yang
lebih ringan, bukti awal menunjukkan
bahwa statin yang amat kuat memiliki efek
samping lebih banyak. dalam percobaan
klinis sejauh ini, efek samping timbul pada
nyaris 10% pasien dan terdiri dari sakit
kepala, mual, dan diare sampai depresi,
impotensi, dan insomnia. efek samping
yang paling mengganggu melibatkan
cedera otot dan penyakit hati, yang
dapat dengan mudah terdeteksi dan bisa
langsung ditangani dengan menghentikan
konsumsi obat. Jelas bahwa myopathy
[cedera otot] timbul terkait dosis obat
yang diminum, ujar dr. reidenberg.
Sebagian pasien mengeluhkan nyeri
dan kelelahan pada otot-otot mereka.
Untuk mengurangi nyeri otot, sejumlah
dokter merekomendasikan 100 miligram
coenzyme-Q10 setiap hari, semacam
vitamin yang penting untuk fungsi sel.
(Konsultasikan dulu dengan dokter Anda
sebelum mulai mengonsumsi co-Q10.)
npara dokter juga makin waspada ter
hadap efek samping dari penggunaan
jangka panjang.
Kami tidak tahu apakah menurunkan
tingkat kolesterol sampai ke level amat
rendah bisa menimbulkan efek samping
untuk jangka panjang, ujar Shannon
Brownlee, rekan senior di New America
Foundation dan penulis Overtreated: Why
Too Much Medicine Is Making Us Sicker
and Poorer. erickson setuju: Kolesterol
berfungsi menjaga membran sel di
seluruh tubuh. Kalau Anda menguranginya
sampai terlalu rendah, secara teori
itu bisa merusak. Para ahli juga tidak
yakin. Namun, ratusan juta orang di
seluruh dunia yang mengonsumsi statin
menunjukkan hasil yang baik dan hanya
mengalami sedikit masalah. Para dokter
belum bisa memastikan tentang risiko
jangka panjang sampai lebih banyak data
dikumpulkan.
MEvaCoR
(lovastatin)
pRavaChoL
(pravastatin)
ZoCoR
(simvastatin)
LipiToR
(atorvastatin)
LESCoL
(fuvastatin)
CRESToR
(rosuvastatin)
Disetujui fDa:
1987
produsen:
Merck
danprodusen
generik
pro: Studiklinis
menunjukkanbahwa
obatinimengurangi
LDLsampai3040%;
bisadikonsumi
bersamaniacin,
vitaminBslow-release
yangtelahterbukti
meningkatkanHDL;
murah
Kontra: Bukan
jenisstatin
yangpaling
efektifuntuk
pasienyang
membutuhkan
penurunan
kolesterolyang
lebihbanyak
Terbaik untuk:
Pasiendengan
tingkatLDL
sedang(130
sampai159mg/
dL)danmereka
yangpunyadana
terbatasuntuk
menebus
resepobat
Disetujui fDa:
1991
produsen:
BristolMyers
Squibbdanpro-
dusengenerik
pro: Jenisyangpaling
banyakditeliti;Punya
kemungkinanpaling
kecildalamberinteraksi
denganobat-obatan
lain
Kontra: Efek
menurunkan
trigliserida
amatkecil
Terbaik untuk:
Pasiendengan
tingkatkolesterol
diambangbatas
(120sampai140
mg/dL)danyang
mengonsumsiobat
lainyangbisa
berinteraksi
denganstatin
tipelain
Disetujui fDa:
1991
produsen:
Merckdan
produsen
generik
pro: Banyakditeliti;
efektifdalammening-
katkanHDLdanmen-
gurangirisikoserangan
jantungpadatingkat
LDLberapapun
Kontra:Dalam
dosistertinggi
(80miligram),
adarisikolebih
besarterhadap
cederaotot
Terbaik untuk:
Pasiendengan
tingkatLDL
cukuptinggi
(150sampai
180mg/dL),
terutamayang
punyaHDLren-
dah(40mg/dL)
ataulebihkecil
Disetujui fDa:
1996
produsen:
Pfzer(kehilangan
perlindungan
merkpada2010)
Disetujui fDa:
2000
Produsen:
novartis
Disetujui fDa:
2003
produsen:
AstraZeneca
pro: Salahsatu
jenisstatinpalingkuat
untukmenurunkanLDL
(sampai55%dalam
penelitian);mengurangi
trigliseridalebih
banyakdariZocor,
tapimeningkatkan
HDLtidaksebanyak
Zocor;telahterbukti
menunjukkanberhasil
mengatasiserangan
jantungataukasus
anginayangtidakstabil
Kontra: Mahal;
dalamdosis
tertinggi,hanya
menghasilkan
sedikit
peningkatan
HDL
Terbaik untuk:
Pasiendengan
tingkatLDL
amattinggi(160
sampai190
mg/dLataulebih
tinggi)
pro: Risikoefeksamp-
ingamatrendah
Kontra:Salah
satutipestatin
yangkurang
kuat
Terbaik untuk:
Pasiendengan
LDLdiambang
batas(120sam-
pai140mg/dL)
pro:Jenisyang
palingkuat;Anda
bisamemperoleh
penguranganLDL
yangsamadengan
dosislebihrendah
(510miligram)
ketimbangjenislain
yangmenggunakan
dosis40miligram;
dosisyanglebihtinggi
bisamenghasilkan
60%penurunan;
meningkatkanHDL
lebihbesardaritipe
statinlain
Kontra:Salah
satutipeyang
palingjarang
diteliti;mahal
Terbaik untuk:
Pasiendengan
tingkatLDL
amattinggi(160
sampai190
mg/dLataulebih
tinggi)
Mana Statin yang Tepat untuk anda?
semua obat-obatan statin berada dalam keluarga
obat yang sama, tapi kekuatan atau sifat toksin
mereka tidak sama. untuk memahami pro dan
kontra dari masing-masing obat tersebut, kami
berkonsultasi dengan steven r. Erickson, PharmD,
profesor farmasi di university of Michigan.
Pada desember 2007, saat panel ahli FdA memberikan 10 suara melawan dua suara,
dengan satu suara abstain, untuk menolak tawaran Merck menjual bebas Mevacor, obat
penurun kolesterol, terkuaklah dilema yang sedang dihadapi komunitas medis terhadap
obat-obatan statin. Sebagian ahli jantung menganggap statin, yang menghancurkan
kolesterol jahat ldl dan mengurangi peradangan, sebagai obat ajaib yang harus
dikonsumsi semua pria berusia 50 tahun ke atas, semudah mereka mengonsumsi aspirin.
Pertama kali disetujui FdA pada akhir 1980an, statin dibuat untuk pasien-pasien dengan
kolesterol tinggi yang memiliki penyakit jantung. Obat ini dengan cepat menjadi populer
untuk mencegah serangan jantung karena dalam percobaan-percobaan klinis, obat statin
menurunkan kadar kolesterol ldl secara efektif versi awal sebesar 30%, dan yang
terbaru 60%. Namun, para peneliti mengingatkan bahwa semua efek samping potensial
belum diketahui, dan sebagian khawatir kalau obat-obatan statin bisa menjadi versi lain
dari Vioxx: sebuah obat yang tampak menjanjikan tapi akhirnya terbukti berbahaya untuk
jangka panjang. Karena itulah FdA menolak memberikan status bebas resep pada obat ini.
8 Be S t l I F e I ndone S I a

Be S t l I F e I ndone S I a
9
CapTion TK hERE
TKKTKT-LouiseParker,
photographedin
BeverlyHills,
California,April2007
Kapan Serangan Jantung pertama Menyerang anda?
Seperempatdariseluruhpriadiduniamengalamiseranganjantungusiarata-rataadalah65danuntuk80.000darimereka,
gejalapertamaadalahmenjadigejalayangterakhir:kematian.IsikuisiniuntukmengetahuiapakahjantungAndasedang
menjadibomwaktubagiAnda.OL E H T R E v OR T H I E ME
0 10
risiko rendah
Berada pada kategori
ini bukan berarti Anda
bebas hidup seena-
knya penelitian
menunjukkan bahwa
50% pria memiliki ma-
salah kardiovaskular
pada satu masa dalam
hidup mereka tapi
kemungkinan jantung
Anda tak akan
mengecewakan Anda
selama 30 tahun ke
depan, terutama jika
Anda mempertahank-
an gaya hidup yang
sehat bagi jantung.
11 25
risiko Sedang
Walaupun risiko Anda
terkena serangan jan-
tung saat ini cukup
rendah, prediksi Anda
untuk 20 tahun ke de-
pan tidak terlalu men-
janjikan. lakukan
pemeriksaan darah
setiap tahun, terma-
suk hdl, ldl, dan tri-
gliserida, untuk me-
mantau kondisi kese-
hatan jantung dan mu-
lailah menyesuaikan
gaya hidup demi jan-
tung Anda.
29 39
Zona Waspada
Kecenderungan gene-
tis, gaya hidup, kondi-
si fsik, atau sejarah
keluarga Anda menun-
jukkan bahwa Anda bi-
sa saja terkena seran-
gan jantung dalam 15
tahun ke depan.
Segera temui dokter
Anda dan tanyakan
apakah Anda perlu
menjalani tes lanjutan,
dan ubah gaya hidup
Anda.
40 atau lebih
Zona Bahaya
Anda bak menunggu
bom waktu meledak.
Anda butuh bantuan
medis dan mengubah
gaya hidup secara ra-
dikal untuk mencegah
serangan jantung
dalam lima tahun ke
depan. Segera temui
dokter untuk men-
jalani tes lanjutan dan
mendapatkan pan-
duan.
6
Q U i z
catatan: Kuis ini bukan alat diagnosa, dan skor hasil Anda bukan sebuah diagnosa. Kuis ini dibuat untuk memberi Anda gambaran umum dari tingkat risiko Anda. Kalau
skor Anda menimbulkan kekhawatiran atau pertanyaan, buat janji dengan dokter untuk mendiskusikan kuis ini menggunakan hasil tes Anda.
1. Berapa usia Anda?
lebih dari 83% orang yang meninggal
karena penyakit jantung berusia 65 tahun
atau lebih, tapi risiko anda terhadap
atherosclerosis (dan akhirnya menyerah
pada serangan jantung yang fatal) mulai
meningkat setelah usia 40.
a. 35 atau kurang 0
b. 36 sampai 50 1
c. 51 sampai 60 2
d. 61 atau lebih 3
2. Apakah keluarga Anda ada
yang mengidap penyakit
jantung?
Genetik adalah satu-satunya tanda terbesar
yang bisa menunjukkan apakah anda akan
mengalami kasus henti jantung. Semakin
dekat hubungan keluarga tersebut dan
semakin muda usia mereka ketika
mengalami serangan jantung, semakin tinggi
seharusnya kewaspadaan anda.
a. Ya* 5
b. tidak 0
* Gandakan skor Anda kalau ayah Anda
meninggal karena serangan jantung sebelum
berusia 50 tahun. kalikan tiga kalau kakek Anda
mengalami nasib serupa.
3. Apakah Anda merokok atau
sering terpapar asap rokok?
Zat-zat kimiawi di dalam rokok beraksi seperti
kertas ampelas bagi pembuluh darah dan mem-
beri pegangan bagi plak untuk bertahan.
a. Ya 5
b. tidak 0
4. Berapa tekanan darah
Anda?
tekanan darah tinggi punya efek yang sama
dengan merokok, yaitu merusak dinding
pembuluh darah dan memfasilitasi
arteriosclerosis.
a. lebih besar dari 140/190 5
b. Antara 121/81 dan 139/89 2
c. Kurang dari 120/80 0
5. Berapa tingkat kolesterol
Anda?
Semakin jauh jarak antara Hdl dan ldl
anda, semakin besar risiko anda terhadap
serangan jantung. anda harus mengecek
profl lemak anda lima tahun sekali sejak usia
30 tahun, dan setiap kali dokter anda
menganjurkan.
a. hdl kurang dari 40 mg/dl 5
b. ldl lebih dari 130 mg/dl 5
c. total kolesterol di bawah
200 mg/dl 0
6. Berapa level trigliserida
Anda?
trigliserida adalah bentuk kimiawi dari lemak
dalam darah anda. Jika levelnya tinggi, hal
ini bisa meningkatkan risiko pembentukan
plak dalam dinding-dinding pembuluh darah.
(Profl lemak anda selama lima tahun sekali
akan mencakup level trigliserida.)
a. lebih besar dari 150 mg/dl 5
b. Kurang dari 150 mg/dl 0
c. tidak tahu 2
7. Berapa level glukosa darah
puasa Anda?
Semakin banyak gula yang anda miliki dalam
darah, semakin kental darah anda. Ini bisa
meningkatkan tekanan darah dan
memfasilitasi pembentukan plak. Para
peneliti di Johns Hopkins University
menemukan bahwa orang-orang dengan
level gula darah tinggi (yaitu prediabetes dan
diabetes) memiliki risiko terkena penyakit
jantung dua kali lebih besar dari mereka
yang nondiabetes. anda harus menjalani
pemeriksaan satu kali setahun saat
menginjak berusia 35.
a. lebih dari 125 5
b. Antara 100 dan 124 2
c. Kurang dari 99 0
d. tidak tahu 2
8. Berapa ukuran lingkar
pinggang Anda?
lemak viskeral yang terletak di balik perut
anda, membentuk perut buncit yang keras
mengeluarkan hormon yang meningkatkan
tekanan darah dan mengakibatkan
peradangan.
a. lebih dari 36* 2
b. Kurang dari 36 0
* risiko Anda terhadap serangan jantung
meningkat sebesar 300% jika Anda memiliki perut
buncit dan dua dari penyakit-penyakit berikut:
trigliserida tinggi, HDl rendah, gula darah
tinggi, atau tekanan darah tinggi. (Tambahkan 5
kalau ya.)
9. Bisakah Anda merasakan
denyut nadi pada kaki Anda?
Jika anda menempatkan jari-jari anda di
atas telapak kaki, yaitu di tengah-tengah
antara pergelangan kaki dan bagian bawah
jempol kaki, anda seharusnya bisa
merasakan denyut nadi yang kuat. Jika tidak
ada, itu adalah gejala arteriosclerosis, yang
sering muncul pertama kali di pembuluh
darah yang ada di kaki.
a. Ya 0
b. tidak 2
10. Apakah ereksi Anda
sekeras ketika Anda berusia
20an?
arteriosclerosis juga pertama kali bisa
menyerang pembuluh darah kecil yang ada
di penis, menghalangi aliran darah dan
mengakibatkan disfungsi ereksi.
a. Ya* 0
b. tidak 2
* Mengalami tiga atau lebih orgasme dalam
seminggu dapat mengurangi risiko Anda dari
serangan jantung sampai separuh, menurut para
peneliti di university of Bristol, di Inggris.
(kurangi 1 angka.)
11. Ukur tingkat stres Anda.
Stres memicu hormon lawan-atau-lari, yang
meningkatkan tekanan darah dan
memfasilitasi penyumbatan yang, pada
waktunya, merintangi aliran darah.
a. Sangat tinggi 2
b. Sedang 1
c. Sedikit atau nol 0
12. Seberapa sering Anda
minum wine?
Menenggak dua gelas per hari mengurangi
risiko anda dari serangan jantung sebesar
30%, menurut para peneliti Harvard. tapi,
risiko anda terkena serangan jantung malah
meningkat bila anda meminum lebih banyak
lagi setiap harinya.
a. tiga atau lebih setiap hari 2
b. Pesta minuman setiap
akhir pekan 2
c. Satu atau dua minuman per hari -1
d. tidak pernah 0
13. Apakah Anda mendengkur?
terjadinya apnea (yaitu ketika anda berhenti
bernapas sesaat pada waktu tidur) membuat
jantung kekurangan oksigen dan bisa
mengakibatkan aritmia jantung, yang bisa
berujung pada serangan jantung fatal.
a. Ya setiap malam dengan suara
mirip gergaji kayu yang konsisten 0
b. Ya geraman dan dengusan,
lalu diam 2
c. tidak 0
14. Anda gampang
marah?
lebih dari 30.000 kasus
serangan jantung terjadi setiap
tahun karena terpicu emosi
sesaat, menurut sebuah
studi di Harvard
University. Pria yang
sering marah-marah juga
dua kali lebih mungkin mengalami stroke,
menurut penelitian terbaru dalam jurnal
Stroke.
a. Ya 2
b. tidak 0
15. Seberapa sering Anda
berolahraga?
Cukup dua jam olahraga aerobik seminggu
(yang terbagi dalam sesi-sesi setengah jam)
dapat mengurangi risiko anda terhadap
serangan jantung sampai separuhnya,
menurut para peneliti Kanada. latihan
kekuatan juga membantu: Studi terbaru dari
Michigan technological University
menunjukkan bahwa pria yang melakukan
olahraga angkat beban selama tiga kali
seminggu menurunkan kadar dialostik dalam
darah sebesar delapan poin, yang dapat
mengurangi risiko mereka dari serangan
jantung sebesar 15%.
a. empat kali atau lebih seminggu,
masing-masing 30 menit -2
b. dua atau tiga kali seminggu -1
c. tak ada olahraga rutin 2
16. Seberapa mirip pola
makan Anda dengan piramida
makanan?
Menyantap lima sajian buah dan sayur sehari
bisa mengurangi risiko anda dari serangan
jantung sebesar 12%, menurut studi terbaru
dari Harvard University. Fokuslah pada
sayuran berdaun hijau. Satu sajian saja per
hari dapat mengurangi risiko serangan
jantung anda sebesar 11%.
a. Sama persis -2
b. Cukup mirip 0
c. Sama sekali tidak mirip 2
Jadi, bagaimana kondisi jantung Anda?
Jumlahkan poin Anda dan gunakan kunci jawaban ini untuk mengukur risiko Anda terhadap serangan jantung, sekaligus menentukan apakah
Anda butuh pemeriksaan lanjutan.
lemak,
Minyak,
& Gula-
gula
Susu,
Yogurt,
& Keju
Sayur
daging Merah,
Unggas, ikan,
Kacang yang
dikeringkan,
telur &
Kacang-
kacangan
Buah
roti,
Sereal,
Nasi &
Pasta
PeMeriKSAAN lANJUtAN: Kalau dokter menduga Anda memiliki risiko tinggi sakit jantung, ia
mungkin akan segera meresepkan obat statin atau melakukan tes-tes berikut untuk mengukur
kesehatan pembuluh darah Anda dan mengetahui dengan tepat letak area yang bermasalah.
Ct Scan 64 Slice: Scanner ultrafast ini dapat merekam setiap denyut jantung Anda dalam versi
3-d, sehingga ia bisa memberi gambaran kondisi pembuluh darah koroner Anda dengan lebih
jelas ketimbang jenis scanner lain. Pemeriksaan ini juga dapat mendeteksi plak keras maupun
lunak di dalam pembuluh darah dan memberi tahu skor kalsium untuk mengukur risiko Anda
dari serangan jantung di kemudian hari. electron Beam Computed tomography atau eBCt juga
memberikan pembacaan serupa, tapi tidak sesensitif 64 Slice.
tes CrP Sensitivitas tinggi: 50% serangan jantung terjadi pada orang-orang dengan tingkat
kolesterol ldl normal, jadi kalau Anda berada pada kelompok risiko tinggi karena tekanan
darah atau sejarah keluarga, misalnya Anda bisa memanfaatkan tes darah yang satu ini. tes
ini memeriksa peningkatan kadar protein C-reactive, yang diproduksi hati sebagai respon
terhadap peradangan dan bisa menjadi petunjuk untuk penyakit jantung, sama seperti tingkat
kolesterol yang tinggi.
Stress test: Jika dokter menduga Anda mengalami penyumbatan pembuluh darah, ia akan
meminta Anda mengikuti tes ini untuk memastikan aktivitas fsik (karena olahraga di atas
treadmill) telah memicu gejala-gejala penyakit jantung (seperti nyeri dada, kemerosotan
tekanan darah selama berolahraga, atau denyut atau ritme jantung yang tidak normal). Untuk
meningkatkan sensitivitasnya, tes ini kerap dikombinasikan dengan echocardiogram atau tes
nuklir (yang mengambil gambar jantung menggunakan gelombang suara dan zat radioaktif
secara berturut-turut).
Para konsultan: John A. Elefteriades, MD, kepala bedah cardiothoracic di Yale university dan direktur Yale Center for Thoracic Aortic Disease Prediman krishan (P.k.) shah, MD,
direktur pusat penelitian kardiologi dan atherosclerosis di Cedars-sinai Medical Center, di los Angeles Arthur Agatston, MD, spesialis jantung dan associate professor kedokteran di
university of Miami Miller school of Medicine Dr. Agatston juga penulis seri buku laris The south Beach Diet dan The south Beach Heart Program.
10 Be S t l I F e I ndone S I a

Be S t l I F e I ndone S I a S e P t e MBe R 2 0 0 8
11
10 Be S t l I F e I ndone S I a

Be S t l I F e I ndone S I a S e P t e MBe R 2 0 0 8
11
WHAT IS BEST LIFE
MAGAZINE?
Best Life is the Lifestyle magazine for
the man who has arrived. Confident,
accomplished, and at the very peak of
his powers, the Best Life reader is more
emotionally engaged than he has ever
been with family, friends, and the world
around him. He is committed to healthy,
active lifestyle, to continually expanding
his horizons and to enjoying his success by
giving back to others while experiencing
the very best that life has to offer. Best
Life magazine provides this man with the
information he needs to achieve his more
important goals: personal growth, physical
and fnancial vitality, and a more meaningful,
more vibrant life.
BEST LIFE
MISSION
STATEMENT
Best Life empowers men to
continually improve their physical,
emotional, and fnancial well-being
to better enjoy the most rewarding
years of their lives.
Our
rEAdErS
DEMogRaphiCS:
Men
Who are in the best time of their
life.
Who enjoy their personal and
professional echievements.
Who are in high positions.
Who redefine their life values,
priorities and lifestyle. They are
more reflective and think of what
they have obtained.
Who pay more attention to their
health and lifes condition.
Who share their experiences
and knowledge to help others.
They are more caring toward their
environment and society.
35+
Well Educated (Graduated College+)
Successful Career (Professional,
Managerial, Business Owner)
SES A+
TREnD SETTER & fLUEnT
(Source: Best Life Readers Survey)
93
%
own1to3
personalcars
79
%
avid
travellers
85
%
own1-2
properties
(house&
apartment)
78
%
have
highbrand
watches
19
%
own
privateboat
or
sailingship
88
%
investin
stocks/mutual
fundswithin
thenext
12months
CiRCULaTion
print Run: 30.000 Copies per-edition
Magazine to be Sent to: directors, executive Board/Member, association/Club,
VIP ( Indonesian Wealthy list , top leaders / businessmen )
Special Distribution to: High end Fashion Boutique, airport executive lounge, Five Star Club
A uNIquE EdITOrIAL ENvIrONMENT
tailored to what is important to Best Life
readers
20%
Health, Fitness
and Longevity
Stories about the male body,
and how to take control of
your physical wellbeing.
Include food stories with
nutrition angles.
15%
Life Balance:
Spiritual and
Emotional Wellness
Practical advice on how to take
control of your emotional well
being and overcome any midlife
challenge with confdence.
15%
Enjoyment
of the Good Life
An insiders guide to
appreciating the fner things in
life. Includes a unique
viewpoint on fction, music,
books, flm, food,
entertainment, and pop
culture.
10%
Wealth and
Financial
Well-Being
How to be a better leader, a
smarter decision maker, and a
more competent fnancial
planer. Expert advice to
ensure fnancial independence
and longterm success,
whatever your income is.
10%
Sex and
Relationship
The complete guide to
enjoying a more meaningful
and intimate relationship.
Includes advice on prolonging
your sexual prime and
nurturing your most important
personal relationship.
10%
Style and
Grooming
An update on the most
sophisticated looks for every
season, with style and grooming
news to help you stay confdent
about the way you look.
A showcase of inspirational
photography and classic style.
10%
Family and
Fatherhood
Explores the topic of being a
better father, looking after your
parents and practical solutions
for providing for your future.
5%
Cars, Gear,
Technology
The latest pieces of
useful luxury, tested,
and recommended by
the editors.
5%
Other
Q&a SECTion
The Best Advice
It provides defnitive answer
from top expert on your most
urgent questions on health,
fnance, nutrition, fatherhood,
sex, relationships, and career.
fRonTofBooK
The Best List
This section consists of short,
practical items about body,
mind, relationships, travel,
family, investment, rewards,
success, style, grooming, gear,
technology, food, cars, flm,
book, and music.
pERSonaL ESSaY
It Works For Me
Features six or seven one
to three page stories profling
how successful men
(sometimes celebrities)
achieved their best life.
Includes subsections:
My Bag, My Workout, My Diet,
My Space, and My Passion.
hEaLTh anD fiTnESS
Body Shop
A maintenance guide for active
men. Combines ftness, injury
prevention and repair, and
weightloss.
faThERhooD
Reality Check
Modern fatherhood made easy.
An essay about how to be a
successful father.
finanCE
The Green Zone
How to safeguard, protect,
invest, and manage your
money.
SEx anD RELaTionShip
Hard Science
Firstperson humor column on
the upsanddowns, insand
outs of modern sex. The story
is built around interviews with
experts and the latest studies.
BaCK pagE
My Defning
Moment
Back page profle features one
celebritys defning moment in
life a key anecdote from life
that helped change him
forever.
BEST LIFE dEPArTEMENTS
2011 EdITOrIAL SCHEduLE
iSSUE on SaLE DaTE SpaCE DEaDLinE MaTERiaL DEaDLinE
JANUARY 2011 Feel Young & Adventurous January 12
th
2011 December 15
th
2011 December 22
nd
2011
FEBRUARI2011 Fatherhood&Sport February09
th
2011 January11
th
2011 January20
th
2011
MARCH 2011 Fashion & Gadget March 09
th
2011 February 10
th
2011 February 17
th
2011
APRIL2011 Food&nutrition April12
th
2011 March15
th
2011 March22
nd
2011
MAY 2011 Travel & Health May 11
th
2011 April 20
th
2011 April 20
th
2011
JUnE2011 WatchSpecialIssue June08
th
2011 May20
th
2011 May19
th
2011
JULY 2011 Keep Your Passion Alive July 13
th
2011 June 22
nd
2011 June 22
nd
2011
AUGUST2011 Mind&Soul August10
th
2011 July20
th
2011 July20
th
2011
SEPTEMBER 2011 Gadget Issue September 14
th
2011 August 15
th
2009 August 15
th
2011
OCTOBER2011 Fashion&Style October12
th
2011 September21
s
t2011 September21
th
2011
NOVEMBER 2011 Anniversay Issue November 09
th
2011 October 19
th
2011 October 19
th
2011
DECEMBER2011 BestofTheBest December14
th
2011 november23
rd
2011 november23
rd
2011
(InspiringPeople)
Editorial Themes Are Subject To Change.
TESTIMONIAL
Bestlife adalah salah satu acuan terkini bagi
pembaca pria yang mengerti fashion dan lifestyle.
Oleh karena itu, menurut kami dengan
memasang iklan di Bestlife dapat
mengakomodasikan produk-produk kami dengan
baik dan sesuai dengan target yang kami bidik.
ESTER fEBE
Advertising & Promotion Optik Melawai
Majalah pria dewasa di Indonesia didominasi oleh
content-content sport, otomotif, adult content dan
metrosexual lifestyle. Bestlife datang dengan
image smart, established dan cool family man.
Hal tersebut menciptakan positioning yang kuat
sehingga mempermudah kami sebagai media
planner untuk membangun relevancy antara brand
dan content media yang digunakan.
Dian gEMiano
Associate Business Manager Mediaedge
Banyak majalah di
rumah, tapi yang saya
sangat enjoy baca
adalah Best Life.
aDDiE MS
Komposer dan Produser
Best Life buat saya
adalah majalah
panduan wajib
untuk pria sukses
yang modern,
stylist, dan bergaya
hidup sehat.
MaRCELLino
LEfRanDT
Aktor & Model
prices above are not include discount + ppn 10%
MaTERiaL SoURCE
digital Files should be supplies on Mac formated Cds
plus print out. File format is Photoshop / Illustrator /
indesign / PdF / tIFF 300 dpi or higher.
all fonts and images loaded.
TEChniCaL DaTa
Raster: 133 150 line/inch
Density proof: Y 120 135
M 140 150
C 140 150
K 180 - 190
Type of paper: art cartoon laminating doff
Cover Stock: art cartoon 210 gr
inside Stock: MC 90 gr
number of pages: 140 including cover
Shipping & CoRRESponDEnCE
all advertising material should be sent to:
advertising Dept.
Bestlife indonesia feminagroup
Wisma Kodel, 7th foor,
Jl.HR. Rasuna Said Kav.B4, Jakarta Selatan
tel. +62-21-5253816, 5266666
ext 3290 / 4278 / 4299
2010 AdvErTISING rATES
TRiM SiZE BLEED SiZE pRiCE
inSiDE pagE
1 page inside 21,4 cm x 28,4 cm 22 cm x 29,2 cm Rp 28.000.000,
page vertikal 10,7 cm x 28,4 cm 11 cm x 29,2 cm Rp 14.500.000,
page horisontal 21,4 cm x 14,2 cm 22 cm x 14,6 cm Rp 14.500.000,
Page 3 21,4 cm x 28,4 cm 22 cm x 29,2 cm Rp 35.000.000,
Display Spread 42,8 cm x 28,4 cm 43.6 cm x 29,2 cm Rp 54.000.000,
CovERS
COVER 2 21,4 cm x 28,4 cm 22 cm x 29,2 cm Rp 35.000.000,
COVER 3 21,4 cm x 28,4 cm 22 cm x 29,2 cm Rp 30.000.000,
COVER 4 21,4 cm x 28,4 cm 22 cm x 29,2 cm Rp 42.000.000,
Cover 2 + Page 3 42,8 cm x 28,4 cm 43.6 cm x 29,2 cm Rp 65.000.000,
1 pagE aDvERToRiaL Rp 40.500.000,
ConTaCT
asni agus
Group Advertising Manager
Cellphone: 08161856141
Phone: +62 21 5253816 ext. 3277
E-mail:
asni.agus@feminagroup.com
ConTaCT
Yuanita Theodora
jr. Advertising Manager
Cellphone: +6281511203102
Phone: +62 21 5253816 ext. 3290
E-mail:
yuanita.theodora@feminagroup.com
or
ali achmad
Account Executive
Cellphone: +6285813531531
Phone: +62 21 5253816 ext. 4278
E-mail:
ali.achmad@feminagroup.com
CALENdAr OF EvENTS
series
Best Life Insight
Series is a series of
talkshow or seminar
events that inspire
and motivate the
participants who are
also Best Life
readers. The events'
themes varry from
economy, health,
luxury products, to
family.
ClieNt OPPOrtUNitieS
Socialize your products to the
market target
Share information effectively to
the market target
Builtin produk dan slot
presentasi/pembicara
Branding pada acara
Sales spot & product sampling
Movie Screening
Co-Branding Event
Charity & Golf Tournament
BEST STyLE
Fashion pages
Best Life highlights the most recent creation
from either local or international designers, a
sophisticated fashion reference for men with
upscale appreciation.
Detil
Best Life regularly displays high quality and premium fashion
product or accesories - watches, shoes, belts, ties and glasses - from
the most notable brands and designers.
Style Guide issue
Every seasons, Best Life features
fashion special edition that brings
trend of style from the fashion
capitals all over the world.