Anda di halaman 1dari 38

LATIHAN SOAL UKOM D III SANITASI

I. LATIHAN SOAL UKOM AIR

1. SeorangLulusan D3 sanitasiditempatkan pada salah satuRumahSakitUmum Daerah (RSUD).


Lulusantersebutsedangmenanganipengolahantahappertama (primary treatment) air limbah RSUD tersebut.
Pengolahaninibertujuansamadenganpengolaahawal yang membedakanadalah pada proses yang berlangsung.

Proses apakahyang dilakukan oleh lulusan D3 Sanitasi pada kasus di atas?

A. Screen
B. Ion Exchange
C. Sedimentation
D. Activated Sludge
E. Sludge Treatment

2. SeorangLulusan D3 sanitasiditempatkan pada salah satuRumahSakitUmum Daerah (RSUD).


Lulusantersebutsedangmenanganiair limbahuntukmenghilangkanzatterlarutdarilimbah yang
tidakdapatdihilangkandengan proses fisik, dimanapengolahantersebuttermasukdalampengolahantahaptahapkedua
(Secondary treatment).

Proses apakahyang dilakukan oleh lulusan D3 Sanitasi pada kasus di atas?

A. Screen
B. Ion Exchange
C. Sedimentation
D. Activated Sludge
E. Sludge Treatment

3. SeorangLulusan D3 sanitasiditempatkan pada salah satuRumahSakitUmum Daerah (RSUD).


Lulusantersebutsedangmenanganipengolahantahapketiga (Tertiary treatment) pada air limbah RSUD tersebut.
Pengolahaninidilakukanpemisahansecarakimiauntuklebihmemurnikan air yang belumsepenuhnyabersih

Proses apakahyang dilakukan oleh lulusan D3 Sanitasi pada kasus di atas?


A. Screen
B. Ion Exchange
C. Sedimentation
D. Activated Sludge
E. Sludge Treatment
4. Seorang Sanitarian sedangmelakukan proses klorinasi, salah satu yang diperhatikan sanitarian
tersebutadalahdosisklorin yang tepatdimanajumlahklorindalam air yang dapatdipakaiuntukmembunuhkuman
pathogen harussesuai, sertasisaklorinbebasdalam air yang sesuai, adabatasansisaklorinbebasdalam air.

Berapakahnilaibatasan pada kasus di atas?

A. 0,1 mg/l
B. 0,2 mg/l
C. 0,3 mg/l
D. 0,4 mg/l
E. 0,5 mg/l

5. Mahasiswa D III Sanitasisedangmelakukanpraktikumpengolahan air limbah,


mahasiswatersebutmelakukanpraktekproses fisik yang bertujuanuntukmenghilangkanpadatantersuspensi dan
minyakdalamlimbah.

Proses apakah yang terjadi pada pengolahanlimbah pada kasus di atas ?

A. Screen
B. Ion Exchange
C. Sedimentation
D. Activated Sludge
E. Sludge treatment

6. SeorangMahasiswa D III Sanitasisedangmemberikanpaparanmengenaisiklushidrologi pada matakuliahpenyehatan


air. Mahasiswatersebutmenjelaskanmengenaisiklushidrologi yang diawali oleh terjadinyapenguapan air yang ada di
permukaanbumi. Air-air tertampungberubahmenjadiuap air karenaadanyapanasmatahari

Istilahapakah yang menggambarkan proses pada kasus di atas ?

A. Sublimasi
B. Evaporasi
C. Presipitasi
D. Transpirasi
E. Kondensasi

7. Seorang sanitarian sedang melakukan inspeksi Sanitasi di salah satu rumah makan yang terletak di Tempat
wisata. Permasalahan yang ditemukan pada rumah makan tersebut adalah pada pengolahan
pendahuluan limbah cairnya. Sanitarian tersebut memberikan solusi untuk mengatasi permasalahan yang
ada di rumah makan tersebut.

Pengolahanapakah yang tepatuntukkasus di atas?

A. Grease trap
B. Grit chamber
C. Equalization
D. Soap separator
E. Pre sedimentation

8. Petugaslimbah di suatuIndustrisedangmelakukan proses pengolahan air limbah dengan


menghasilkanlumpurdaribaksedimentasi, kemudianmemanfaatkanlumpurtersebutuntukdijadikan paving
block denganmenambahkanbahantambahan (aditif)
untuktujuanmenurunkanlajumigrasibahanpencemardarilimbahsertauntukmengurangitoksisitaslimbahters
ebut.

Apakahproses pengolahan yang dilakukanpada kasus diatas?

A. Adsorpsi
B. Absorbsi
C. Solidification
D. Detoxification
E. Macroencapsulation

9. SeorangSanitarianakanmelakukanPenilaiankinerja (performance) IPAL RSsebagai salah


satubentukkegiatanevaluasi IPAL RumahSakit. Hal pertama yang dilakukanadalahmelakukanpemeriksaan
parameter air limbahdan lokasipengambilansampel yang bertujuanuntukmengetahuiefektifitas IPAL
tersebut..

Dimanakah titik pengambilansampel yang tepatuntukkasus di atas?

A. Effluent IPAL
B. Sumber air limbah
C. influent dan effluent IPAL
D. Bakaerasi dan bak clarifier
E. Unit pengolah air limbah yang utama
10. Seorang Sanitarian memeriksa air sumurwarga yang berwarnakuning dan berbaubesi. Hasil pemeriksaan
kimia air sumur gali tersebut, didapatkan kadar Besi (Fe) melebihi baku mutu lingkungan. Kondisiinidapat
menimbulkan masalah teknis yaitu terjadinya kerusakan pada dinding bak air, oleh karena itu perlu
dilakukan upaya penurunan kadar Fe tersebut.

Apakahupaya yang tepatuntukmasalah tersebut di atas ?

A. Melakukanaerasi
B. Menambahkankaporit
C. Menambahkankoagulan
D. Memasaksampaimendidih
E. Menyaringdengansaringanpasir

11. Seorang sanitarian dimintauntukmelakukanpemeriksaankualitasfisik air berupakekeruhan air pada


sebuahsumurgali yang dimulikimasyarakat. Hasil yang diharapkandaripemeriksaan air
adalahdiketahuinyakadarkekeruhanair dalamsatuan Neptheloremetrik Turbidity Unit (NTU).

Apakah alat yang digunakandalampemeriksaantersebut?

A. Higrometer
B. Anemometer
C. Termometer
D. Turbidimeter
E. Konduktovitimeter

12. Sanitarian Puskesmas Xditugaskanuntukmelakukantindakanintervensimengatasipermasalah yang adayaitu


hasil inspeksi sanitasi dan identifikasi parameter fisik, kimia dan mikrobiologis pada air sumur gali,
menunjukkan bahwa secara fisik dan kimia masih memenuhi syarat sedangkan dari aspek mikrobiologis
mengandung bakteri koliform yang melebihi standard yang telah ditentukan.

Apakahtindakan yang harusdilakukan dari kasus di atas ?

A. Pemberiantawas.
B. Pemberiankaporit
C. Pemberiankarbonaktif
D. Pemberianmangan zeolite
E. Pemberiankapur dan soda ash

13. Seorang Sanitarian Puskesmasmendapatkanlaporandariwargamengenai keberadaan


sumurnyaberdekatandenganperesapan atau septi tank tetangganya, jikadihitungjaraknyakurang dari 6
meter adalah. Wargatersebutkawatir kalau air sumurnya sudah tercemar dan tidak layak untuk digunakan
sebagai kebutuhan sehari hari.

Saran apakah yang tepat diberikan oleh sanitarian untuk kasus di atas ?

A. Pemeriksaan Total count air sumur


B. Pemeriksaan Entamoeba coli air sumur
C. Pemeriksaan kandungan feces air sumur
D. Pemerisaan bakteri patogen pada air sumur
E. Pemeriksaan kandungan Bakteri Escherichia coli

14. Kepala Puskesmas X menginstruksikan kepada sanitarian untuk mengatasi Kejadian Luar Biasa(KLB) Diare
yang menimpa wilayah binaannya. Hasil investigasi dicurigai penyebabnya adalah kualitas air sumur yang
digunakan masyarakat tidak memenuhi syarat bakteriologis.

Berapa nilai yang disyaratkan pada kasus di atas ?

A. 0 per 100 ml sampel


B. 10 per 100 ml sampel
C. 20 per 100 ml sampel
D. 30 per 100 ml sampel
E. 40 per 100 ml sampel

15. Seorang SanitarianPuskesmas X sedangmenganalisa penyebab angka kejadian diare yang meningkat setiap
tahunnya, hasilanalisa didugai penyebabnya adalah karena kualitas air bersih yang digunakan untuk
keperluan sehari hari tidak memenuhi syarat bakteriologis sehingga disarankan memberi sisa chlor
untukmendesinfeksi.

Berapakahdosis minimal yang dibutuhkan untuk kasus diatas?

A. 0,1 mg/l
B. 0,2 mg/l
C. 0,3 mg/l
D. 0,4 mg/l
E. 0,5 mg/l

16. Seorangwarga di Desa X mengeluhkan air yang di konsumsiberwarnacoklat dan berbau,


keluhaninidisampaikanke Sanitarian puskesmas X. Hasil pemerilsaanawalsumber air yang dipergunakan
untuk air minum tidak memenuhi kualitaskhususnya kualitas kimia sehingga air berwarna coklat
kemerahan.

Apakahzat kimia yang terkandung pada kasus diatas?

A. Zat Mn
B. Zat Fe
C. Zat Zn
D. Zat Be
E. Zat Cu

17. Seorangiburumahtangga di Permukiman X seringmembakarsampah dihalamanrumahnya, semuasampah


yang ada di rumah di bakarhinggahabistermasuksampahplastik. Asap
hasilpembakaransampahmembuatbeberapatetanggasekitarrumahnyaterganggu, dan
melaporkannyakepadaPengurus RT setempat
Apa yang sebaiknyadilakukanpengurus RT untukmengatasimasalah di atas??

A. Memarahiibutersebut
B. Melaporkankekelurahan
C. Memberikansangsikepadaibutersebut
D. Menyarankanmenggunakan masker kepadawarga
E. Memberikanpenyuluhantentangsampahkepadawarga

18. BeberapawargaDesa X mengeluhkan air sumur yang biasadigunakanuntukkebutuhansehari-haritidakjernihlagi.


Keluhannyaketika air sumurtersebutdirebusselaluadaendapaputihsepertikapur. Ketika dicobauntukdimasakkembali
air tetapsepertiitu, wargaberinisiatifsetelah air direbusdi diamkandulukemudian air
bagianatasdiambilsementaraendapanputihdibuang.

Kandunganapakah yang terdapat pada air sumurtersebut ?

A. Kalsium
B. Iodium
C. Flour
D. Mangan
E. Besi

19. Seorangpetugaslimbahcair di RumahSakit X


sedangmelakukanusahauntukmemeliharaperalatanmekanikuntukmencapai lifetime
peralatanmekaniksupayadapatberfungsisecaramaksimal. Kegiataninirutindilakukan oleh bagianpemeliharaan agar
terjamin proses pengolahanlimbahcair pada setiaptahapannya.

Pada Tahapanapakahupayatersebutdilakukan?

A. Final treatment
B. Tertiary treatment
C. Primary Treatment
D. Advanced treatment
E. Secondary treatment
20. Petugaspengolahlimbahcair di Industrisedangmelakukanpengolahanlimbahtahap secondary treatment,
iamenambahkanmikroorganismeuntukmengefisiensikantingkatpengolahanlimbah. Penggunaanmikroorganisme
yang dicampurkan pada limbahcair yang akandiolahmerupakan salah satujenispengolahansekunder

Apakah unit pengolahanlimbah yang dimaksud?

A. Tricking filter
B. Flotation Pond
C. Oxidation ditch
D. Wetland process
E. Rotary Biological Contactor

21. Seorang Sanitarian yang bekerja di wilayah yang masihseringmenggunakan air hujanuntukkebutuhanairnya,
memberikaninformasikepadamasyarakatbahwa air hujan yang
terlihatjernihdapatmenimbulkankerusakanterhadapbenda-benda yang terbuatdarilogam (berkarat) yang
diakibatkan oleh kondisiudaradari asap kendaraanbermotor

Kandunganzatapakah yang dapatmerusakbenda-benda pada kasus di atas?

A. NH3
B. CO2
C. SO2
D. NO3
E. CaCo3

22. Seorangwargamelaporkanke sanitarian puskesmasmengenai air yang digunakan di rumahnya. Setelah


didatangikelokasi dan diamati, hasilidentifikasi air tersebutterlihatjernih,
tapisetelahdidiamkanbeberapasaattimbulendapanberwarnacokelat. Ketika dilihat pada bakmandi
banyakbercakberwarnacoklat, sertaairnyaberbauamis.

Parameter kimiaapa yang didugamenyebabkankasustersebut ?

A. Mg
B. Fe
C. Mn
D. CO2
E. CaCo3

23. Seorang sanitarian rumahsakitsedangmengambilsampel air limbahuntukpemeriksaankualitaslimbahrumahsakit.


Salah satu parameter yang akandilihatkualitasnyaadalah BOD air limbah. Selanjutnyasampelakan di
kirimkelaboratoriumkesehatanlingkungan yang lokasinya  memerlukanwaktuperjalananselama 6 jam.

Teknik pengawetanapakah yang bisadilakukan  untukanalisis parameter tersebut?

A. Pemanasan
B. Pendinginan
C. Penambahan HCL
D. Penambahan HNO3
E. Penambahan H2SO4

24. Seorang Sanitarian sedangmelakukaninspeksisanitasi air sumur di permukiman, hasilinspeksisanitasi dan identifikasi
parameter fisik, kimia dan mikrobiologis pada air sumurgali, menunjukkanbahwasecarafisik dan
kimiamasihmemenuhisyaratsedangkandariaspekmikrobiologimasihbelummemenuhisyarat.

Tindakan apakah yang cocokdilakukanterhadapkualitas air sumurgalitersebut?

A. Pemberiankapur
B. Pemberiantawas
C. Pemberiankaporit
D. Pemberiankarbonaktif
E. Pemberian manganesezeolit

25. Seorang Sanitarian sedangmelakukaninspeksisanitasi air sumur di permukiman, hasilinspeksisanitasi dan identifikasi
parameter fisik, kimia dan mikrobiologis pada air sumurgali, menunjukkanbahwasecarafisik dan
kimiamasihmemenuhisyaratsedangkandariaspekmikrobiologimasihbelummemenuhisyarat.

Kemungkinanapakah yang menyebabkan air sumurtersebuttidakmemenuhisyarat?


a. Kekeruhantinggi
b. Kesadahantinggi
c. Mengandungbesi
d. Mengandunglogamberat
e. Mengandungbakterikoliform

26. Seorangpetugaskesehatanlingkunganrumahsakitdiberikantugas oleh pimpinannyauntukmengecekefektivitas IPAL.


Dari hasil dan pengambilansampelsertapengecekansecarafisik, effluent IPAL tersebutterlihatkeruh dan
berbautidaksedap. Oksigenterlarutdalam air limbah<4 mg/l.

Parameter kimiaapa yang berpengaruhterhadapkasustersebut?

A. Phospat
B. BOD
C. Nitrat
D. Nitrit
E. pH

27. Saudarasebagaiseorangahlisanitasilingkungan, ditugaskanuntukmelakukaninspeksisanitasi dan pengambilansampel


air darisumurgali di suatudaerah, dikarenakanangkakejadiandiaremerupakankasus yang endemis, dan
didugapenyebabnyaadalahkualitas air bersihdarisumurgali yang ada di daerahtersebut, yang
digunakanuntukkeperluanseharihari.

Apalah zat yang harusditambahklankedalamsumurtersebut, untukmengatasikasus di atas?

A. Kaporit  
B. Tawas
C. Kapur
D. NaOH
E. PAC

28. MahasiswaSanitasiLingkunganmendapattugasprakteklapangan di kolamrenang, untukmengetahuibagaimana


proses pengolahan air yang dilakukan. Salah satu proses pengolahan air
tersebutadalahpemakaian/pembubuhanchlordalam reservoir yang bertujuanuntukmembunuhmikroba
pathogen, sehingga air kolamrenangamandigunakan oleh perenang

Berapakadarchlor/sisachlor yang diperbolehkan pada air kolamrenangtersebut?

A. 0,1 mg/l   
B. 0,5 mg/l
C. 1,0 mg/l
D. 5,0 mg/l
E. 10 mg/l

29. Seorangahlikesehatanlingkungandiminta oleh PejabatWalikota, untukmerencanakanpenyediaan air bersih di


permukimanpenduduk yang dekatdengankawasanindustri. Perencanaanmencakupkualitas dan kuantitas,
sertapendistribusiankerumah-rumahpenduduk.

Selainbesarkecilnyakota dan keberadaanindustri, apa yang menjadipertimbangandalamperencanaantersebut ?

A. kualitas air, harga air, dan aliran air


B. kualitas air,iIklim, dan kondisitanah
C. kualitas air, hargabahanbakarminyak
D.kualitas air, kontourtanah, dan tekanan air
E. kualitas air, iklim, dan karakteristikpenduduk

30. Sebagaiseorangtenagakesehatanlingkungan, Saudaraakanmelakukanpengambilansampel air


sumuruntukpemeriksaanmikroba air di LaboratoriumMikrobiologi. Botolsampelsterilsudahdipersiapkan dan
sudahdilengkapidengantalipengikat. Kemudianbotolditurunkankedalam air sumur.

Apaprosedur yang harusSaudaradilakukan, sebelumbotoldiberilabel ?

A. Mengisibotolsampaipenuh, difiksasi, laluditutup


B. Mengisibotolsampaipenuh, ditutup, laludifiksasi
C. Mengisibotolsampai ½ penuh, difiksasi, laluditutup
D. Mengisibotolsampai 2/3 penuh, ditutup, laludifiksasi
E. Mengisibotolsampai 2/3 penuh, difiksasi, laluditutup

31. Sebagaiseorangtenagakesehatanlingkungan, sdrakanmelakukanpengambilansampel air


sumuruntukpemeriksaanmikroba air di LaboratoriumMikrobiologi. Botolsampelsterilsudahdipersiapkan dan
sudahdilengkapidengantalipengikat. Selanjutnyaakandilakukanpengambilansampelairnya.

Dimanakahtitikpengambilansampel yang paling tepat ?

A. Di bagianpinggir  dasarsumur
B. Di bagiantengahsekitardasar air
C. Di bagiantepidarisekitarpermukaan air
D. Di bagiantengah  sekitarpermukaan air
E. Di bagiantengahantarapermukaan dan dasarsumur

32. Pada wilayah pemukiman di kota-kotabesaruntukkebutuhan air bersihnya pada umumnyamenggunakanfasilitas


yang telahdisediakan oleh perusahaan air minum. tetapikeadaantersebutmasihadamasyarakat yang
mengeluhterhadaprendahnyakualitas air yang dihasilkan oleh penyedia air bersih  yangmenggunakan air
sungaisebagaisumber air bakunya. Pada umumnya

Apakah penyebabrendahnyakualitas air tersebut ?

A. Air sungai yang keruh dan debitnyasemakinkecil


B. Tenaga pengelola air PDAM yang sangatterbatas
C. Banyaknyaindustri yang menggunakan air sungai
D. Adanyatingkatpencemaran air sungai yang tinggi
E. Terlalubanyakpenduduk yang harusdilayani PDAM

33. Sebuahrestoranmenggunakan ember untukcucitangannyakarenatidakadawastafel.Saudaradiminta oleh


pihakRestoranuntukmembuatwastafeluntukcucitangan yang dilengkapidengan accessories yang
dapatberfungsimembuka dan menutupaliran air pada wastafeltersebut.

Apanama accessories tersebut di atas?

A. Stop Kran
B. Socket
C. Union
D. Valve
E. Kran

34. Saudaramenggunakan air bersih yang bersumberdarisumurpompalistrik, untukkeperluansehari-hari, ternyatawarna


air berubahmenjadikuningkecoklatan dan berbaubesisetelahditampung di reservoir (ember),
sehinggaperludilakukanpengolahanterlebihdahulusebelum air tersebutdimanfaatkan (dikonsumsi).
Metodepengolahan yang dipakaiadalahdengancaramelewatkan pada media filter. 

Apanamabahan/media yang paling baikuntukpengolahan air tersebut di atas?

A. Mangan zeolite
B. Karbon aktif
C. Pasiraktif
D. Perrolite
E. Zeolite

35. Saudaramerencanakanpembuatanrumahberlantaitiga yang dilengkapidengansaranapenyediaan air


bersihberupaground reservoir (reservoir bawah) mengingatketerbatasankondisipenyediaan air bersih pada
daerahtersebut. Sumber air bersih yang akanmensuplaikebutuhan air bersihberasaldari air PDAM.

Apaalasanutamasaudaramembuat reservoir tersebut?

A. Memenuhipersyaratankelengkapanbangunanperumahan
B. Memehuhipersyaratan IMB (IjinMendirikanBangunan)
C. Memenuhipersyaratankontinuitas
D. Memenuhipersyaratankuantitas
E. Memenuhipersyaratankualitas
II. LATIHAN SOAL UDARA

1. Seorang sanitarian melakukanpemantauanpencemaranudara di suatu Kota industri,


denganmelakukanpengukuranvariasisuhuudarasecara vertical menggunakanbalonudara. Dari
hasilpengukurandiperolehinformasibahwasuhuudara di permukaanadalah 24oC ,namunsuhuudara
di ketinggian 100 meter daripermukaantanahmempunyaisuhuudara yang lebihtinggiyaitu 28 o C.

Apakah Nama fenomenasuhuudara pada kasustersebut?

A. Sub adiabatic
B. Super adiabatic
C. Normal
D. Inversi
E. Subsidence

inversisuhu, adalahpenyimpangandariperubahan normal properti atmosfer denganketinggian.


Inihampirselalumengacu pada inversidarilajuselangtermal. Biasanya,
suhuudaramenurunseiringdenganpeningkatanketinggian. Selamapembalikan, udara yang lebihhangatditahan di
atasudara yang lebihdingin; profilsuhu normal denganketinggiandibalik. Inversi juga
dapatmenekankonveksidenganbertindaksebagai "penutup". Jika tutupinirusakkarenabeberapaalasan,
konveksikelembapan yang adakemudiandapatmeletusmenjadibadaipetir yang dahsyat.
Pembalikansuhuterkenaldapatmenyebabkanhujanbeku di iklimdingin.
Sub adiabaticsistem yang tidakmelakukanpertukaranpanasdenganlingkungannya
Super adiabatic lajupenurunansuhu yang lebihbesardaripadalajupenurunansuhu adiabatik kering
SubsidenceTurunnyaMuka Tanah ... bidangtanahakibat proses tertentu,

2. Seorang sanitarian dimintamenentukantingkatpencemaran pada suatu wilayah


denganmenghitungIndeksStandarPencemaran Udara (ISPU). Parameter pencemar yang
sudahdiketahuikonsentrasinyaadalah NO2, SO2, CO, dan O3. Namun sanitarian
tersebutbelumbisamenentukanindeksnya, karenasatu parameter pencemarbelum di lakukanpengukuran.

Parameter pencemaranapa yang harus di lakukanpengukuran pada kasustersebut?

A. O2
B. HC
C. CO2
D. PM10
E. H2S

IndeksStandarPencemar Udara adalahangka yang tidakmempunyaisatuan yang


menggambarkankondisikualitas udara ambien di lokasi dan waktutertentu yang
didasarkankepadadampakterhadapkesehatanmanusia, nilaiestetika dan makhlukhiduplainnya.
ISPU ditetapkanberdasarkan 5 pencemar utama, yaitu: karbonmonoksida (CO), sulfur dioksida (SO2),
nitrogen dioksida (NO2), Ozon permukaan (O3), dan partikeldebu (PM10).

3. Seorang sanitarian diminta saran untukperbaikankualitasudara di suatupermukiman di


suatudesatelahdilakukanevaluasidengankualitasudaradalamruangkurangbaik. Jarak antararumah yang
satudengan yang lain berjauhan. Konstruksidindingrumahsebagianbesarterbuatdarikayu. Rata-rata
rumahtidakmemilikijendela.

Sarana ventilasiapa yang paling tepatditerapkan pada kasustersebut ?


A. Cyclone
B. Kipasangin
C. Exhaust fan
D. Air conditioner
E. lubangudara

Cyclone Suatudaerahtekananrendahdimanaanginbertiupberlawananarahjarum jam di BelahanBumi Utara


(BBU) dan searahjarum jam di BelahanBumi Selatan (BBS).

KipasanginKipasanginmerupakansuatualat yang dipergunakanuntukmenghasilkanangingunamendinginkanudara,


sertamemberikanefekmenyegarkan di saatudaraterasapanas. Selainitu, kipasangin juga
dapatbertindaksebagai exhaust fan sertaalatpengering.

Exhaust fan kipasanginpengeluar


Air conditioner (pendingin) mesin yang dibuatuntukmenstabilkansuhu dan kelembapanudara di suaturuangan
lubangudaraVentilasiadalahpertukaranudaradidalamruangandenganudara segar diluarruangan, yang
bertujuanuntukmengurangi dan menggantikanudaraberpolutan (zat yang berbahayabagimanusia) didalambangunan.

4. Seorang sanitarian melakukan evaluasi tekanan panas pada suatu ruang kerja bagian produksi di
perusahaan pengolahan logam. Sanitarian tersebutmendugaada factor lingkunganfisikberupasuhuradiasi
pada lingkungankerjaperusahaantersebut.

Apanamaalat yang dibutuhkan oleh sanitarian pada kasustersebut ?

A. Hygrometer = kelembaban
B. Anemometer = Kecepatanangin
C. Spirometer = pernafasa n
D. Lux Meter = pencahayaan
E. Termometer bola = alatiniberfungsiuntukmengukurtemperaturudara

5. Disuatukotadengansaranatransportasi yang padat, terjadipencemaranudara yang


sangatberatsehinggawarnalangit pada kotatersebutkecoklatan. Seorang sanitarian
ditugaskanuntukmelakukanidentifikasibahanpencemar yang mencemariudara di kotatersebut.

Apakahbahanpencemar yang menyebabkanterjadinyakasustersebut ?

A. Ozon (O3) =
B. Partikulat (PM10) = debu
C. Nitrogen oksida (NOx) =
D. Sulfur oksida (SOx)
E. PeroksiAcilNitrat (PAN)

Nitrogen oksida (NOx) = asap putih-abu-abu yang diikutidenganledakan yang melepaskanawan asap
besarberwarnamerahkecokelatan dan 'awanjamur' putihbesar," Hal inimenujukkanbahwa gas yang
dilepaskanadalahuapamoniumnitratputih, nitrogenoksidamerahataucokelat dan air. NOX menimbulkan PAN

Ozon (O3) :ozon pada lapisantroposfermerupakanpencemarudara yang dapatmerusakfungsipernafasan pada


manusiasertatumbuhan. dihasilkanmelaluipercampurancahaya ultraviolet denganatmosfer bumi dan
membentuksuatu lapisanozon pada ketinggian 50 kilometer. UV dikaitkandenganpembentukankankerkulit dan
kerusakangenetik. 

Partikulat (PM10) Partikeludara yang berukuranlebihkecildari 10 mikron (mikrometer). Nilai Ambang Batas (NAB)
adalah Batas konsentrasipolusiudara yang diperbolehkanberadadalamudaraambien. NAB PM10 = 150 µgram/m3.

Sulfur oksida (SOx)Sulfur dioksida adalah salah satuspesiesdari gas-gas oksida sulfur (SOx). Gas
inisangatmudahterlarutdalam air, memilikibaunamuntidakberwarna,

PeroksiAcilNitrat (PAN) PeroxiAcetil Nitrates inimenyebabkan iritasi pada mata yang


menyebabkanmataterasapedih dan berair. Campuran PAN bersamasenyawakimialainnya yang ada di
udaradapatmenyebabkanterjadinya kabutfotokimiaatau Photo Chemistry Smog yang
sangatberdampakterhadaplingkungan dan bersifatkarsiogenik. Salah
satudampaknyaterhadaplingkunganyaituakibattimbulnya asap tebaldapatmenyebabkanterhentinyaalat-
alattransportasikarenadikhawatirkanakanterjaditabrakan. 

6. Seorangkaryawanpabrikpemintalan yang menggunakanbahanbakukapas, mengeluhsesak napas yang


dialamisetiapharisenin (haripertamamasuk, setelahliburharisabtu dan minggu).
Diabekerjatanpamenggunakan masker sehinggakemungkinanterpapardebu di tempatkerjanya.

ApaJenispenyakit yang kemungkinan di alami oleh karyawan pada kasustersebut ?

A. Silikosis
B. Bysinosis
C. Berytosismengarang
D. Gasteritis
E. Asbestosis

Silikosispenyakit yang terjadiakibatberlebihnyasilika di dalamtubuh,


karenaterlalubanyakmenghirupdebusilikadalamjangkawaktu lama. Silikaadalah mineral sepertikristal
yang banyakditemukan di pasir, batu, dan kuarsa.

Bysionosispenyakitparuataugangguanpernapasan yang terkaitpekerjaan.


Penyakitiniumumnyamenyerangpekerja yang berada di industripengolahankapas, rami, ataulenan
(buruhpabriktekstil). Kondisiini juga dikenaldengannama Monday fever, brown lung disease, mill fever,
atau cotton worker's lung.
Berytosistidakada

Gasteritis = lambung

Asbestosis adalahpenyakitparu-paru yang disebabkan oleh paparanseratasbesdalamjangkapanjang.


Gejala asbestosis biasanyabarumunculbertahun-tahunsetelahseseorangterpaparseratasbes.

7. SebuahperusahaanPembangkit Listrik Tenaga Uap (PLTU) denganbahanbakar batu bara,


diantaranyamenghasilkanemisi gas SO2. Untukmengendalikanpencemaran,
makadipasangalatpembersihudaradenganmelewatkan gas buangdalamruang yang disemprotkan
air kedalamnya.

Apakahnamajenisalatpengendali yang digunakan pada kasustersebut ?

A. Adsorption
B. Mechanical
C. Precipitaton
D. Inceneration
E. Scrubber

Adsorption : penyerapan adalahsuatu proses yang terjadiketikasuatu fluida, cairan maupun gas,


terikatkepadasuatu padatan atau cairan (zatpenyerap, adsorben) dan akhirnyamembentuksuatulapisan tipis
atau film (zatteryerap, adsorbat) pada permukaannya. Berbedadengan absorpsi yang
merupakanpenyerapanfluida oleh fluidalainnyamembentuksuatu larutan.
Mechanicalyang berhubungdenganmesin.
Precipitaton:pengendapan.
Inceneration : pembakaransampah
Scrubber :alat yang digunakanuntukmemisahkanbutircairan yang masihterkandungdalam gas
hasilpemisahanpertama, selainitu Gas Scrubber juga digunakanuntukmenyaringfluida gas
dariberbagaipartikelkotoran yang bergabungdalamaliran gas dalam pipa.

8. Seorang Sanitarian, mengidentifikasipenyebabkasussepasangmudamudi yang ditemukantewasdalammobil


di pantai. Dari olah TKP yang dilakukan oleh polisi dan petugaskesehatanditemukanbeberapafakta yang
dapatdijadikansebagaipetunjukbahwakematiandisebabkan oleh gas beracun. Tanda-tandatersebutantara
lain: badan membiru, mesinmobildalamkeadaanhidup, AC mobilhidup.

Apakahnama Gas pencemar yang didugamenjadipenyebab pada kasustersebut ?

A. Ozon
B. Karbon dioksida
C. Karbon monoksida
D. Nitrogen oksida
E. Hidrogensulfida

Karbon Monoksida (CO) Gas yang tidakmemilikibau dan warna. Gas iniumumnyaberasaldari asap
kompor dan kendaraanbermotorsertapembakaransampah. Ketika terhirup, karbonmonoksidadapatmerusak
organ dalamtubuh dan menimbulkanberbagaimasalahkesehatan

9. Seorang Sanitarian yang bekerja di industri semen mencobamenerapkanprinsippengendalian pada


ruangproduksi yang mempunyaikadarpartikulatsangattinggi. Partikulat yang ada,
dilewatkankedalammedanlistrik, yaitu 2 (dua) plat logam yang dialirimuatanpositif dan negatif.
Makapartikulat yang bermuatanakanmenempel pada plat yang
bermuatanberlawanandenganmuatanpartikel.

Apakahnamametodapengendalian yang diterapkan pada kasustersebut?

A. Ventury Scrubber
B. Cyclone Collectors
C. Mechanical Separator
D. Elektrostatispresipitators
E. Combustion Incinerators
VenturyScrubber :peralatanpenangkap PM yang memilikibeberapakeunggulan,
yaitumampumengatasipartikeleksplosif dan rawanterbakardenganresikokecil, biayaperawatan yang
relatifrendah, mudahdalamdesain dan pemasangan, efisiensipengoleksian yang dapatbervariasi,
menyediakanpendinginanuntuk gas
Cyclone Collectors:memisahkan material semen denganudarabersih
Mechanical SeparatorPerala!anpemisah mekanik
Electrostatic Precipitator adalahalatpenangkapabudarihasilpembakaran boiler yang
menggunakanprinsipelektrostatis. Partikelabu yang
awalnyabermuatannetralakanterionisasimenjadibermuatannegatifsetelahmelewati discharge electrode
yang memilikimuatannegatif.

Incinerator adalahtungkupembakaranuntukmengolahlimbahpadat, yang mengkonversimateripadat


(sampah) menjadimateri gas, dan abu, (bottom ash dan fly ash). ... Gas yang
dihasilkanharusdibersihkandaripolutansebelumdilepaskeatmosfer. Panas yang
dihasilkanbisadimanfaatkansebagaienergipembangkitlistrik.

10. Seorang sanitarian melakukanpengukuranhkadar NitrogenDioksida (NO2) di


suatupermukimandenganwaktu sampling 24 jam.
Pengukurantersebutdimaksudkanuntukmenentukankualitasudara pada lingkunganpermukiman.
Berapakadarbakumutulingkunganbahanpencemar pada kasustersebut?
A. 400 ug/Nm3
B. 350 ug/Nm3
C. 300 ug/Nm3
D. 200 ug/Nm3
E. 150 ug/Nm3 (Baku mutuudaraambiennasionalmenurut PP No 41 tahun 1999)

0,04 (24 jam) ppm pemukiman

11. Pemerintah di suatukotabesartelahmelakukanberbagaiupayapengendalianpencemaranudara. Salah


satuupaya yang dilakukanadalahmengembalikanfungsiruangterbukahijau,
misalnyadenganmelakukanpembongkaran SPBU yang berada di tengahkota.
Berdasarkanteorisimpul, upayapegendalian pada kasustersebutdilakukan pada simpulberapa ?
A. Simpul 1 = sumberpenyakit
B. Simpul 2 = komponenlingkungan
C. Simpul 3 = penduduk
D. Simpul 4= sehat/sakit
E. Simpul 5 = variable yang berpengaruh

12. Di suatyu wilayah pegununganterletakjauhdarikawasanindustri, diperolehhasilpengukurankadar SO2


dalamudaranyatinggi. Setelah dievaluasiternyatasumberpencemarannyaberasaldariemisi pada
kawasanindustri yang bergerakmenujusuatuwilayah danterhalangpegunungansehinggaterakumulasi.
Faktorklimatologiapa yang paling berperan pada kasustersebut ?
A. Suhu
B. Curah hujan
C. Kelembaban
D. Arahangin
E. Kecepatanangin

KlimatologiadalahIklim

13. Seorang sanitarian mengidentifikasikasuspemaparan pada pekerja di industri cat yang


ditemukanpingsanditempatkerjanya.
Pekerjatersebutbertugasmelakukanpencampuranbahanaktifdenganpelarut dan tidakmenggunakan masker.
Sebelumpingsanpekerjatersebutmerasa badan melayang, dayatangkapkacau, jantungberdegupkencang
dan berhalusinasi.
Bahanpencemarapa yang di dugatelahmemaparpekerja pada kasustersebut ?
A. Partikulat
B. Logamberat
C. Karbon dioksida
D. Karbon monoksida
E. Pelarutorganic

14. Sanitarian melakukankegiatan uji emisikendaraandenganpengambilancontoh gas Nitrogen Dioksida (NO2).


Pada saatpengambilancontohemisi, asap dariknalpotkendaraandialirkankedalam midget impinger yang
berisilarutanabsorben.
Selanjutnyaterjadiperubahanwarnadaribeningmenjadimerahsebagaiindikasiadanya gas yang terikat
oleh absorbentersebut.

Absorbenapa yang digunakan pada kasustersebut?


A. Asamnitrat = absorbenlogam
B. Asamasetat =
C. Asamsulfat
D. Natrium korida
E. Natrium hidroksida

Asamasetat = karenaada proses pembakaran pada suhutinggi gas No akandioksidasimenjadi No2


sedangkan No adalah gas ygtidakbewarna, tidakberbau dan sedikitlarutdalam air sedangkan no2
merupakan gas yagberwarnacoklatkemerahandenganbautajam
Asamasetat = senyawaorganik

15. Sanitarian melakukanpengendalianpencemaranudara pada kasuskebakaranhutan, denganudara di


sebagaianbesar wilayah tertutup asap. Melihat proses pencemaran yang sudahterjadi,
sangatsulitdilakukanpengendalian pada simpul A dan simpul B. Upaya yang paling
mungkindilakukanadalahpengendalian pada simpul C.

Upayaapa yang sebaiknyadilakukan pada kasustersebut ?

A. Penghijauan
B. Menghilangkan asap
C. Pemadamankebakaran
D. Penggunaan masker (simpul C itumanusia)
E. Pengobatanterhadappenderita

16. Sanitarian rumahsakitmelakukanpengukurankualitasudararuangrawatinap. Rumahsakittersebutmemiliki 90


ruangrawatinap. Pengukurandilakukanhanya di beberaparuangsebagaisampel.
Pengukurandilakukandenganmerujuk Keputusan Menteri Kesehatan Nomor
1335/MENKES/SK/X/2002.

Berapajumlahsampel minimal yang harusdiukur pada kasustersebut ?

A. 30ruang
B. 10 ruang
C. 5 ruang
D. 9ruang = 10% sampel minimal
E. 45 ruang

17. Sanitarian mengidentifikasidampakpencemaranudara di kota-kotabesar yang bersifat regional.


Dampakpencemaranudara yang terjadiberupabanyaknyabahanbangunan yang
terbuatdaribesicenderungmudahberkarat. Hal tersebutterjadikarenaterbentuknyasenyawa-
senyawakorosifmelaluipersenyawaanantarazatpencemardengan ion hidrogen yang adaatmosfer.

Apakahfenomenapencemaranudara yang terjadi pada kasustersebut ?

A. Hujanasam
B. Pemanasan global
C. Perubahaniklim global
D. Kerusakanlapisanozon
E. Berkurangnyakadaroksigen di udara

18. Sanitarian yang bekerja di


industripeleburanlogammengidentifikasiadanyafaktorlingkunganberupapanasradiasi yang
dipancarkandariruangpeleburanlogam. Untukmengetahuitingkatpanasradiasitersebut,
makadilakukanpengukuran pada ruangpeleburanlogamtersebut.

Apakahnamaalat yang diperlukan pada kasustersebut?

A. Termohigrometer = Thermohygrometermerupakanalat yang digunakanuntukmengukursuhu dan


kelembabandalamsuaturuangan
B. Termometer bolatermometerinidigunakanuntukmengukursuhuudara pada lingkungansangkar.
C. Termometerbasah
D. Lux Meter = pencahayaan
E. Anemometer = kecepatanangin

19. Sanitarian yang bekerja di industrikayu lapis, akanmengendalikanpencemaranudara di tempatkerja yang


menghasilkanemisiberupasenyawabenzene dan formaldehydekeudaratempatkerja yang berasaldarilem
yang digunakandenganmenerapkan system ventilasi yang baik.
Keduasenyawainimemilikitoksisitastinggisehinggadikatagorikansebagaizatkarsinogen.

Apakahjenisventilasi yang baikditerapkan pada kasustersebut ?


A. Natural ventilation = ventilasialami
B. Dilution ventilation =
C. Comfort ventilation
D. General ventilation
E. Local exhaust ventilation

Dilution ventilationketikakontaminanmasuk di suaturuanganmakaiaakanbercampurdenganudara yang ada


di ruangantersebut. umlahkontaminan yang ada di ruangankecil. Ada jarak yang
cukupjauhantarapekerjadengansumberkontaminan. Ventilasidilusibiasanyadengancaramengencerkanudara yang
terkontaminasiataumengandung
Adapun persyaratanbagiruangan yang akanmenggunakansistemventilasidilusi :
a. Kuantitaskontaminanharuskecil
b. Dayaracunkontaminanrendah

Comfort ventilationContohventilasiinidengandigunakanyya Air Conditioner (AC) pada suaturuangan.


Jenisventilasiiniberfungsimenciptakankondisitempatkerja agar menjadiinyaman, hangatbagitempatkerja
yang dingin, ataumenjadisejuk pada tempatkerja yang panas.

General ventilationventilasiumumbiasanyadigunakan pada tempatkerjadenganemisi gas yang sedang dan


derajatpanas yang tidakbegitutinggi. Jenisventilasiinibiasanyadilengkapidenganalatmekanikberupakipas

Local exhaust ventilationpengeluaransetempat" ,adalah proses pengisapan dan


pengeluaranudaraterkontominasisecaraserentakdarisumberpencemaransebelumudaraberkontominasiberda pada
ketinggian zona pernapasan dan menyebarkeseluruhruangkerja, umummnyaventilasijenisini di
temapatkansangatdekatdengansumberemisi

20. Sanitarian mengidentifikasiadanyakebisingan pada industripemintalanbenang yang


memilikiintensitaskebisingan yang tinggi. Kebisingantersebutberasaldarimesinproduksi yang
bersuarakonstanselamawaktukerja.Sebelummelakukanpengukuran sanitarian tersebutmembuat site
plan untukmenentukantitik-titikpengukurannya.

Jeniskebisinganapa yang terjadi pada kasustersebut ?

A. Impulsif
B. Kontinyu
C. Impulsifberulang
D. Intermittendenganspektrumluas
E. Intermittendenganspektrumsempit

21. Seorang sanitarian melakukanupayapenyehatanudara pada sebuahrumahmemilikidapur yang


menyatudenganruangmakan. Ruangandapurtersebuttidakmemilikiaksesventilasialami. Desain ruangan
juga tidakmemungkinkanuntukmembuatsaranaventilasialami. Pada saatadaaktivitasmasak, Ruang
sekitardapurmenjadipanas, berasap dan beraromamasakan.

Apakahsaranaventilasiyang paling tepatuntukkasustersebut ?

A. Dilution Ventilation
B. Conford Ventilation
C. Local Exhaust Ventilation
D. Exhausted Enclosure
E. Cleap Room Ventilation

22. Seorang sanitarian melakukanpengukurankadardebu total di sebuahpemukimanpendudukdenganwaktu


sampling 24 jam. Pengukurantersebutdimaksudkanuntukmenilaikualitasudaraambienberdasarkanstandar
Baku MutuLingkungan.

Berapakahstandarbakumutu pada kasustersebut ?

A. 60 ug/Nm3
B. 80 ug/Nm3
C. 90 ug/Nm3
D. 200 ug/Nm3
E. 230 ug/Nm3

23. Seorang sanitarian mengidentifikasiadanyapenyakitakibatkerja pada pekerjapenambangpasir yang


mengeluhsakit pada sistempernafasannya. Sehari-
haridiamelakukanpenggaliantanahuntukmendapatkanpasir. Diabekerjatanpamenggunakan masker
sehinggaterpapardebubatuan.

Apanamapenyakit yang kemungkinandideritapekerja pada kasustersebut ?


A. Bysinosis
B. Silikosis
C. Berytosis
D. Gasteritis
E. Asbestosis

24. Seorang sanitarian, pada saatakanmelakukanpengukurankadardebu di suatu wilayah permukiman,


perlumengukur parameter-parameter lain yang dapatmempengaruhikadardebuudaralingkungan. Salah
satu parameter yang harusdiukuradalah parameter yang mempegaruhi area permukiman mana yang
kemungkinanakanterpapar oleh debu pada saatitu.

Apakahnama parameter pada kasustersebut ?

A. Suhuudara
B. Arahangin
C. Curah hujan 
D. Kecepatanangin
E. Kelembabanudara

25. Seorang sanitarian melakukanidentifikasiadanyakebisingan pada sebuahPerumahan yang berjaraksekitar


1 km dari Bandara Internasional. Frekuensipenerbangansangatpadatdenganjeda take off setiap 15 menit,
intensitasbunyi yang ditimbulkan oleh pesawatwaktu take off sangattinggi.

ApakahJeniskebisingan pada kasustersebut ?


A. Kontinue
B. Stagnan
C. Impaktif
D. Impulsive
E. Intermitten

26. Seorang sanitarian melakukanidentifikasikemungkinanadanyapemaparan factor lingkungan pada


pembangunanjaringanlistrikberupaSaluran Udara TeganganEkstra Tinggi (SUTET) yang
ternyatamelewatisubuahpermukiman dan dikawatirkanmenimbulkangangguankesehatan.

Apajenis factorlingkungan pada kasustersebut ?

A. Panas
B. Radiasi
C. Getaran
D. Tekanan
E. Kebisingan

27. Seorang sanitarian melakukankegiatanevaluasiadanyapemaparan pada pekerjabengkel di


lokasipadatlalulintas. Bengkelnyasangatmaju dan banyakpelanggan, selama 24 jam pekerjatersebuttinggal
di tempattersebutsehinggamenghirupudara yang telahtercemar Pb. Sanitarian
tersebutmelakukanpemeriksaantingkatpemaparan Pb pada pekerjatersebut.

Apajenissampelbiologis yangcocokuntukpemeriksaan pada kasustersebut ?

A. Urine
B. Kuku
C. Kulit
D. Faeses
E. Darah

28. Seorang sanitarian yang bekerja di suatu wilayah pedesaanakanmelakukanupayapengendaliankebisingan


yang disebabkan oleh generator yang digunakansebagaipembangkittenagalistrik. Dari hasilpengukuran,
tingkatkebisingannyamelebihiambangbatasuntukdaerahpermukimanyaitudiatas 55 dB
sehinggamayarakatmerasaterganggu.

Apakahcarapengendalian yang tepat pada kasustersebut ?


A. Memindahkan generatorketempat lain
B. Mengganti generatordenganmesin lain
C. MelakukanIsolasiterhadap generator.
D. Mengurangiwaktuoperasional generator
E. Penanamanpohon di sekitarlokasi

29. Seorang sanitarian melakukan survey dan pengukurankebisingan di suatupemukiman. Hasil


pengukuranintensitaskebisingan di pemukimantersebutadalah 82 dBA. Dari
hasilwawancarapenghunipermukimandiperolehhasiladanyakeluhandarimasyarakatyaituberupakesulitanko
munikasisesamaanggotakeluarga di dalamrumah, dan susahtidur.

Berapakahstandarkebisingan yang diperuntukkan pada kasustersebut?

A. 45 - 55 dBA
B. 55 - 65 dBA
C. 65 - 75 dBA
D. 75 - 85 dBA
E. > 85 dBA

30. Seorang sanitarian melakukan survey terhadappekerja di sebuahpabrikbatako di suatukota. Dari hasil
survey di dapatkanadanyakeluhandaripekerjaberupabatuk dan sesak napas.
Dalambekerjapekerjatidakmenggunakanalatpelindungdiri dan tidakadanya shift kerja.

Jenispencemarudaraapakah yang kemungkinanterjadi pada kasustersebut?

A. Kebisingan
B. Partikulat
C. Sox
D. Nox
E. H2S

31. Seorang sanitarian mengidentifikasiadanyapencemaran di sebuahkotabesar. Dari hasilsuvey pada


penggunajalanterdapatkeluhan yang dirasakanadalahadanya gas yang berbaumenyengat dan
berwarnakuningkecoklatan. Gas tersebutdidugadihasilkandariemisikendaraanbermotor yang
sebagianbesarmenggunakanbensin, namun gas
inidihasilkanbukankarenabahanbakarnyamelainkankarenasuhuruangpembakaran yang tinggi.

Apanama gas pencemar yang dimungkinkandalam kasus tersebut ?

A. Sulfur dioksida (SO2)


B. Ozon (O3)
C. Nitrogen dioksida (NO2)
D. Karbon monoksida (CO)
E. Karbon dioksida (CO2)

32. Seorang sanitarian mengidentifikasiadanya pencemar dalam ruangan kantor yang baruakandigunakan.
Dari hasilidentifikasidiketahuiadanyapencemar yang berbentuk gas tidakberwarnadenganbau yang
menyengat yang kemungkinandi emisikan oleh bahanplafon, kayu lapis, furniture kantor, lemkarpet,
plastik, seratsintetisdalamkarpet, pestisida, cat, dan kertas.

Adalah jenispencemar yang teridentifikasi pada kasustersebut ?

A. Carbon Monooksida
B. Carbon Dioksida
C. Sulfur Dioksida
D. Formaldehid
E. Ozon (O3)

III. LATIHAN SOAL MAKANAN MINUMAN

1. Mahasiswa semester VII pada Perguruan Tinggi X, 60% mengalamikeracunanmakanan pada


pestaperayaantahunbaru. Seorang sanitarian
melakukanpemeriksaanlaboratoriumdarisampelmakanantersebut dan diperoleh ikan yang
dikonsumsimengandungmerkuri.
Apakahperanan ikan dalamkasus di atas?

A. host
B. agent
C. media
D. vehicle
E. produsen

2. Pak Arman mengalamigejalakesakitan yang miripdengankeracunanlogamberat. Hasil investigasipetugas


KLB Puskesmas X menyimpulkanbahwa ikan nila yang dikonsumsisebagaipenyebabnya. Ikan yang
dikonsumsitersebutternyatadipelihara pada sungai yang menjadibuanganpenambangemastanpaijin
(PETI) .

Apakahkemungkinanpencemardarikasusdiatas?.

A. Arsen
B. Cu
C. Fe
D. Hg
E. Pb
.
3. Petugas sanitarian melakukanpemeriksaanberkalaangkakumanperalatanmakanan pada 5 kantin di
wilayah Puskesmas Y. Hasil pemeriksaansebagaiberikut; kelompokkantin`Akantin B 86 kol/cm 2 , kantin
C 56 kol/cm2, kantin D 115 kol/cm2 dan kantin E 145 kol/cm2.

ManakahKantin yang memenuhisyarat?

A. A dan B
B. A dan C
C. A dan D
D. B dan C
E. B dan D

4. Penjualmieayamkeliling di KomplekPerumahan GZ mencucimangkoknyamenggunakanair satu ember


dipakaisecaraberulang, sehinggakemungkinanmangkoktercemar oleh bakteri. Kemudianpetugas
sanitarian inginmengetahuiapakahcemaran pada mangkokmelebihipersyaratankesehatan yang
diperkenankandalamsatuankoloni/cm2.

Jenispemeriksaanapakah yang tepat?

A. MPN
B. E. coli
C. Salmonella
D. angkakuman
E. Staphylococcus

5. Karyawanrestoran X yang bekerja di bagiandapurmelakukanpencucianperalatanmakanansepertipiring


dan mangkokdenganmemisahkanterlebihdahulusegalakotoran dan sisamakanan yang akandicuci agar
dapatmenghematpenggunaansabun dan mengurangi lemak.

Apanamatekniktersebut ?

A. Sanitaizing
B. Scrapping
C. Flushing
D. Washing
E. Rinsing
6. Ibu rumahtangga X akanmembelikangkung di Pasar, Setelah di lihat pada salah satupenjual,
kangkungterlihatberdebu dan ternyatasetelahditanyakangkungtersebutdiambildarikebunsendiri yang
berada di pinggirjalanraya.

Bahancemaranapakah yang kemungkinan paling banyakterjadi?

A. Air Raksa
B. Plumbum
C. Currum
D. Arsen
E. Besi

7. Restoran Y memilikipelanggan yang cukupbanyaksehinggamemasakdalamjumlah yang besar,


untukmenyimpanmakanan yang benarsesuaiprinsipsanitasimakasebagaiseorang sanitarian
dapatmenyarankan agar makanantidakdisimpan pada suhuzona danger.

Maksuddarikasus di atasadalah?

A. 0-50C
B. 0-100 C
C. 5-100C
D. 10-600C
E. 10-1000C

8. Petugas sanitarian di Dinas Kesehatan Kota Pontianak sedangmelakukaninspeksidengan BPOM ke


minimarket yang ada di wilayah binaannya, ditemukanmakanankaleng yang dijual pada minimarket X
telahmenggelembung, walaupunmasihbelummelampuitanggalbataskadaluarsa.

Apa saran saudarasebagai sanitarian?

A. Mendiskonmakanantersebut
B. Menarikmakanantersebut
C. Menggantidengankaleng lain
D. Memberikanmakanantersebutkepadapantiasuhan
E. Tetapuntukmenjualkarenabelumhabis masa kadaluarsa

9. Petugas sanitarian di Dinas Kesehatan Kota Pontianak sedangmelakukaninspeksidengan BPOM ke


minimarket yang ada di wilayah binaannya, ditemukanmakanankaleng yang dijual pada minimarket X
telahmenggelembung, halinimenunjukkanbahwamakanantersebutterkontaminasi oleh bakterianaerob.

Apakahjenisbakteri yang khas pada kasus di atas?

A. Salmonella
B. Staphylococcus
C. Eschericia coli
D. Clostridium Botulinum
E. Enterobactericeae

10. Pada saatmelakukanpraktikumuntukmengetahuijenisbakteri pada


makanandapatdilakukandenganberbagaimetode, namunprinsip yang harusdilakukanadalahalat dan
media yang digunakanharusdisterilkanterlebihdahulumenggunakanalattertentu.

Apakahalat yang dimaksud ?

A. Inkubator
B. Autoklaf
C. Desikator

D. Evaporator

E. Komparator

11. Pedagangkerupuk di desa R


menambahkanbahantambahanmakanandenganharapanuntukmembuatkerupukmengembang dan
lebihawet. Kerupuktersebutdiambil oleh mahasiswasebagaisampeldalampraktek. Hasil
Pemeriksaankerupukmenggunakan BTM yang dilarang dan baksomemilikicirisecarafisikkenyal,
jikadilemparmemantul, warnaagakputih.

Apakah BTM yang digunakan pada kasusdiatas?

A. Borak
B. Formalin
C. Chitosan
D. Asap cair
E. Methanyl Yellow

12. Penjamahmakanan di restoran X melakukanpemeriksaankesehatan,


karenarestorantempatbekerjaakanmengajukanlaiksehat.
Berdasarkanhasilpemeriksaanternyatamenderita Hepatitis A.

Apakahjeniskelompokmikroorganismepenyebabpenyakitkasus di atas?

A. Virus
B. Parasit
C. Bakteri
D. Khamir
E. Kapang

13. Penderitadiabetes mellitusinginmelakukandiitmakanandenganmengurangikonsumsi gula


sebagaipemanis pada makanan, kemudianmendatangipetugasPuskesmas dan meminta saran pengganti
gula tersebut yang aman.

Apakahbahanpengganti yang dimaksudkasus di atas?

A. Vetsin
B. Sakarin
C. Emulsifier
D. Antioksidan
E. Pengemulsi

14. Pemilikrestoran B melayanibanyakpelanggan pada


hariminggusehinggakekurangantenagapenjamahmakanan, sehinggamerekruttenagaharian. Tenaga
barutersebutmenggunakanpisauuntukmembelahbuahtanpamencuciterlebihdahulu,
padahalpisaubarudiguakanuntukmemotongdagingmentah.

Apakahnamapencemaran yang akanterjadi pada kasusdiatas?

A. Kontaminasibuatan
B. Kontaminasisilang
C. Kontaminasikembali
D. Kontaminasilangsung
E. Kontaminasitidaklangsung

15. Penumpang bus antarprovinsimengkonsumsimakanan yang dibeli di rest area, makanan yang
dibeliadalah nasi kotakdenganlaukdidalamnya, namun pada saatmembuka ikan
pepesterdapatisistrapples dan batu kerikil.
Apakahnamagolonganpencemaran pada kasus di atas?

A. Fisik
B. Kimia
C. Biologi
D. Mekanis
E. Mikrobiologi

16. Makananselainberfungsisebagaizatsumber energy, pelindung dan zatpengatur, juga


dapatmenimbulkanpenyakit (food borne desease). Masyarakat
seringmengalamikeracunanakibatmengkonsumsijengkol dan singkongberacun.

Apakahperananmakanan pada kasustersebut?

A. Media
B. Waste
C. Agent
D. Hazard
E. Vehicle

17. Tenaga sanitarian melaporkanbahwaada 10 orang


keracunanmakanansetelahmengkonsumsimakananHajatan. Hasil
investigasidiperolehgambaranbahwamakanantersebuttercemar oleh pestisida yang dibawa oleh tikus.
Tikustersebutdiketahuitelahmenjamahmakanansiapsaji (telahdiolah).

Pada tahapataufaseapakahmakanantercemar?

A. Tahapproduksi
B. Tahappemilihanbahanmakanan
C. Tahappengangkutanbahanmakanan
D. Tahappengolahanbahanmakanan
E. Tahappenyimpananmakanan

18. Pedagangpecellelemembelisayurlalapanlangsungkepadapetani, kemudianmerendamnyadengan garam


dapurdengantujuanuntukmenghilangkanmikroorganisme yang menempelsepertitelur taenia saginata
dan taenia solium.
Apakahnamagolonganpencemar pada kasus di atas?

A. Virus
B. Jamur
C. Parasit
D. Bakteri
E. Kapang

19. MahasiswaJurusan Kesehatan Lingkungansedangmelakukanpraktikumpemeriksaanangkakuman pada


peralatanmakanan, setelahmelakukanusapalat, sampeldimasukkankedalamcawan petri dan diberi
media Plate Count Agar (PCA), kemudiandimasukkankekedalamalatuntukmenumbuhkanangkakuman.

Apakahnamaalattersebut?

A. Autoklaf
B. Desikator
C. Inkubator
D. Flokulator
E. Incenerator

20. Mahasiswasedangmelakukanpraktikumusapalatsendok, gelas dan piring,


langkahpertamamerekamelakukanpembuatan media dan persiapanalat yang akandigunakan,
kemudianmengambilsampeldengancaradiusapmenggunakanlidikapas dan memasukkankedalam media
transport.
Apakahlangkahselanjutnya yang harusdilakukan?

A. Mensterilkansampel
B. Melakukanpengenceran
C. Menanamsampel di dalaminkubator
D. Menghitungjumlahkoloni pada cawan petri
E. Menyimpulkanhasildenganmembandingkanstandar

21. Si Fulanmengalamisakitsetelahseminggumemakanjajanan yang dibelidisekitar di SD “Y”,


setelahberobatkedokter, didiagnosismenderita types, karenahasilcekdarah di
labratoriummenunjukkanpositif salmonella.

Apakahnamapenyakitkarenamakanan pada kasusdiatas?

A. Food infection
B. Food intoxication
C. Food contamination
D. Food parasitic infection
E. Food borne virus infection

22. Dinas Kesehatan Kota “P” melakukanpemeriksaan gratis kepadapenjamahmakanan agar


diketahuibahwapenjamahtersebutmemenuhisyaratkesehatansesuaijenispekerjaannya. Cara
pemeriksaandilakukandenganbeberapatahapansebelumpembacaanhasil dan kesimpulan.

Apakahlangkahawal yang harusdilakukan pada kasusdiatas?

A. Eyes swab
B. Dental swab
C. Finger swab
D. Mouth swab
E. Rectal swab

23. Industrirumahtanggapangan (IRTP) memproduksisayuran dan buah yang


dikalengkandengancaramencelupkansayuran dan buahkedalam air mendidihselama 3-5
menitdengantujuanuntukmenginaktifkanenzimsebelumdimasukkankedalamkaleng.

Apakahnama proses pengolahantersebut?

A. Blansing
B. Sterilisasi
C. Sublimasi
D. Fermentasi
E. Pasteurisasi

24. Pemilikrumahmakanpecellelemenggunakanlalapansawikeritingsebagai menu tambahan yang


dibelilangsungdaripetani. Untukmenghilangkantelurcacing, sayurdirendammenggunakanlarutan yang
memilikiberatjenislebihbesarsehinggatelur casing terangkatkeatas dan setelahitudibilasmenggunakan
air bersih.

Apakahlarutan yang digunakan?

A. Gula
B. MSG
C. Madu
D. Asam
E. Garam
25. Mahasiswasedangmembuatlaporanpraktikumusapalatsendok, gelas dan piring,
untukmengambilkesimpulanhasildibandingkandenganstandarPermenkesnomor 1098/permenkes/2003
tentangPersyaratan Hygiene SanitasiRestoran/RumahMakan
Berapakahstandar yang dimaksud pada kasus di atas?

A. 50 koloni/cm2
B. 100 koloni/cm2
C. 150 koloni/cm2
D. 200 koloni/cm2
E. 250 koloni/cm2

26. PengusahaRestoran X inginmendapatkansertifikatlaiksehat, kemudianmengajukankepadaDinas


Kesehatan ditempatusahanya, kemudianPetugasmelakukanpemeriksaan hygiene sanitasi pada
rumahmakan dan restorandenganmenggunakanformulirPermenkesnomor 1098/permenkes/2003.

Berapakahnilai minimal yang harusdicapai?

A. 500
B. 600
C. 700
D. 800
E. 900

27. Pemilikpeternakansapimenjual susu segar kepadaindustrikecil di daerah lain denganperjalanansekitar 5


jam, susu tersebutdibawatanpadiolahterlebihdahulusehinggasampai di tujuan susu menjadibasi.

Apakahtindakanysngseharusnyadilakukan agar kasusdiatastidakterjadi?

A. Blansing
B. Sterilisasi
C. Hardening
D. Hidrogenasi
E. Pasteurisasi

28. Petani di desa X


menyimpangabahdenganterlebihdahuludijemurdibawahterikmataharitujuanmengurangikadar air
sehinggatidakmudahlapuk dan menjadilebihawetsertamudah pada saatdigiling.

Manakahmetodepengawetan yang cocokuntukkasus di atas?

A. Pembekuan
B. Pengasapan
C. Pengalengan
D. Penggaraman
E. Pengeringan

29. Petugas sanitarian Puskesmas B akanmelakukanpenyelidikan KLB keracunan yang terjadi di wilayah
binaannya. Langkah yang
akandilakukansesuaidenganjuknispenanganandariPermenkessepertimembuatperizinan, suratmenyurat
dan kuesioner.

Apakahtahap yang dimaksud pada kasus di atas?

A. Persiapan
B. Konfirmasi
C. Pengumpulan data
D. Analisishasilpenyelidikan
E. Membuatkesimpulan dan penanggulangan
30. Petugasbulog Kota P
dalammenyimpanberasmenggunakanpetunjukdaripermenkestentangpersyaratansanitasigudangdiantar
anyajarak pallet darilantai dan atap,
selainitumenerapkanprinsiplalulintaskeluarmasukbarangsesuaiperaturantersebut.

Apakahprinsip yang dimaksud?

A. FIFO
B. OFIF
C. VIVO
D. FIVE
E. EFIF

IV. LATIHAN SOAL TANAH DAN SAMPAH

1. PengelolaRumahSusun (Rusun)memintabantuanSanitarian
untukmemberikanpemahamanmengenaipengelolaansampahplastikkepadawargarusun. Sanitarian
tersebutmemberikancontoh pada wargabagaimanacaramengolahsampahplastik yang ada di rusun,
diantaranyadenganmembuattasdarisampahplastik dan vas bungadariplastik.

Termasukjenissampahapakah yang ada pada kasus di atas?

A. Ashes
B. Rubbish
C. Garbage
D. Dead animals
E. Street sweeping

2. PengelolaRumahSusun (Rusun)memintabantuanSanitarian
untukmemberikanpemahamanmengenaipengelolaansampahplastikkepadawargarusun. Sanitarian
tersebutmemberikancontoh pada wargabagaimanacaramengolahsampahplastik yang ada di rusun,
diantaranyadenganmembuattasdarisampahplastik dan vas bungadariplastik.

Apakahnamaprinsippengolahansampah yang dicontohkan Sanitarian tersebut ?

A. Reduce
B. Reuse
C. Recycle
D. Replace
E. Recovery

3. PengelolaRumahSusun (Rusun)memintabantuanSanitarian
untukmemberikanpemahamanmengenaipengelolaansampahplastikkepadawargarusun. Sanitarian
tersebutmemberikancontoh pada wargabagaimanacaramengolahsampahplastik yang ada di rusun,
diantaranyadenganmembuattasdarisampahplastik dan vas bungadariplastik.

Apakahsatuantimbulansampah yang tepat pada kasus di atas ?

A. Liter/m/hari
B. Liter/m2/hari
C. Liter/m3/hari
D. Liter/bad/hari
E. Liter/orang/hari

4. PengelolaRumahSusun (Rusun)memintabantuanSanitarian
untukmemberikanpemahamanmengenaipengelolaansampahplastikkepadawargarusun. Sanitarian
tersebutmemberikancontoh pada wargabagaimanacaramengolahsampahplastik yang ada di rusun,
diantaranyadenganmembuattasdarisampahplastik dan vas bungadariplastik.

Termasukdalamfaseapakahkasus yang terjadiatas ?

A. FasePewadahan/Storage
B. FasePengumpulan/Collection
C. FasePengangkutan/Transport
D. FasePembuangan/Disposal
E. FasePeralihan/Transfer

5. SeorangpetugaspengangkutsampahmendatangiPuskesmas di lingkungantinggalnya, iamengeluhkangatal-gatal pada


tubuhnyaterutama di bagiantelapaktangan dan lengan. Seminggukemudian di
dapatkanhasildiagnosadaridokterternyatapetugastersebutmengalamipenyakit sarcoptesscabiei.

Melaluimekanismeapakahmasuknyapenyakitkedalamtubuh pada kasus di atas?

A. Mata
B. Kulit
C. Mulut
D. Pernafasan
E. Pencernaan

6. SeorangpetugaspengangkutsampahmendatangiPuskesmas di lingkungantinggalnya, iamengeluhkangatal-gatal pada


tubuhnyaterutama di bagiantelapaktangan dan lengan. Seminggukemudian di
dapatkanhasildiagnosadaridokterternyatapetugastersebutmengalamipenyakit sarcoptesscabiei.

Kemungkinanapakah yang menyebabkanpetugastersebutmenderitapenyakit?

A. Tidakmenggunakantopi padasaatbekerja
B. Tidakmenggunakan masker pada saatbekerja
C. Tidakmenggunakansarungtangan pada saatbekerja
D. Tidakmenggunakan Sepatu Boots pada saatbekerja
E. TidakmengunakanGerobaksampah pada saatbekerja

7. Seorang sanitarian rumahsakitakanmelakukanpengukurantimbulansampahmedisdenganmengukur


volume sampah yang ada pada ruangrawatinap. Hal
inidilakukanuntukmembuatperencanaanwadahsampahmedis yang dibutuhkanselama 1 tahun pada
rumahsakittersebut.

Wadah/kantongplastikwarnaapakah yangtepatdigunakanuntuksampahtersebut?

A. Ungu
B. Hitam
C. Merah
D. Kuning
E. Coklat

8. Seorangpetugaskebersihan Pasar Tradisionalmengeluhkanbanyakanyalalat yang ada pada salah


satusaranapengolahansampahyaitu TPS di Pasar. TPS berbentukkontainer dan selaluterbuka,
selainitubanyaksampahberserakandisekitar TPS.

Kontainerapakah yang tepatdigunakan pada kasus di atasadalah :

A. Kontainer Kecil
B. KontainerBesar
C. Kontainer Sedang
D. Kontainertetap
E. Kontainerangkut

9. Seorangpetugaskebersihan Pasar Tradisionalmengeluhkanbanyakanyalalat yang ada pada salah


satusaranapengolahansampahyaitu TPS di Pasar. TPS berbentukkontainer dan selaluterbuka,
selainitubanyaksampahberserakandisekitar TPS

Persyaratansaranaapakah yang tidakterpenuhi pada kasus di atas ?


A. TidakKuat
B. TidakKonus
C. TidakKedap air
D. Tidakmemilikitutup
E. TidakMudahdibersihkan
10. Seorangpetanimengeluhkantanah yang digarapnyamengalamiperubahan, tanaman yang
ditanammengalamikegagalanpanen, padahalpemupukansudahdilakukan.
Petugaskesehatanmelakukanintervensiterhadaptanahtersebutdenganmengukurderajatkeasamantanah,
dimanahasil yang diperolehnilai pH = 4.

Sifat tanahapakah yang sedangdiukurpetugaskesehatantersebut?

A. Fisik
B. Kimia
C. Biologi
D. Topografi
E. Mikrobiologi

11. Seorangpetanimengeluhkantanah yang digarapnyamengalamiperubahan, tanaman yang


ditanammengalamikegagalanpanen, padahalpemupukansudahdilakukan.
Petugaskesehatanmelakukanintervensiterhadaptanahtersebutdenganmengukurderajatkeasamantanah,
dimanahasil yang diperolehnilai pH = 4.

Alat ukurapa yang digunakan oleh petugaskesehatan pada kasus di atas?

A. Soil tester
B. Lux meter
C. Barometer
D. Termometer
E. Soil musell color chart

12. Seorangpetanimengeluhkantanah yang digarapnyamengalamiperubahan, tanaman yang


ditanammengalamikegagalanpanen, padahalpemupukansudahdilakukan.
Petugaskesehatanmelakukanintervensiterhadaptanahtersebutdenganmengukurderajatkeasamantanah,
dimanahasil yang diperolehnilai pH = 4.

Termasukdalamkatagoriapakahhasilpengukuranderajatkeasamantersebut?

A. Basa
B. Asam
C. Netral
D. Normal
E. Standard

13. Seorangpetanimengeluhkantanah yang digarapnyamengalamiperubahan, tanaman yang


ditanammengalamikegagalanpanen, padahalpemupukansudahdilakukan.
Petugaskesehatanmelakukanintervensiterhadaptanahtersebutdenganmengukurderajatkeasamantanah,
dimanahasil yang diperolehnilai pH = 4.

Intervensiapakah yang dapatdilakukan agar pH tanahtersebutmenjadinetral?

A. Menambahkan air
B. Memberikankapur
C. Memberikanbubukbelerang
D. MenambahkanBahanorganik
E. MendiamkansajasampainetralKembali

14. Seorangpenelitilingkungansedangmelakukanpengujianterhadaptanah- tanah yang ada di wilayah X


untukmenjadidasarperencanaanpengembangan pada wilayah tersebut. Hasil uji
tanahdiperolehadanyaperbedaan pada beberapatanahdiantaranyaada yang kasar, sedang dan
agakhalus.
Sifat tanahapakah yang sedangdiujipenelititersebut?

A. Fisik
B. Kimia
C. Biologi
D. Topografi
E. Mikrobiologi
15. Seorangpenelitilingkungansedangmelakukanpengujianterhadaptanah- tanah yang ada di wilayah X
untukmenjadidasarperencanaanpengembangan pada wilayah tersebut. Hasil yang di
dapatmemilikiperbedaan pada beberapatanahdiantaranyaada yang kasar, sedang dan agakhalus.

Jenispengukurantanahapa yang sedang di uji penelititersebut ?

A. Suhu
B. Warna
C. Tekstur
D. Struktur
E. Konsistensi

16. Seorangpenelitilingkungansedangmelakukanpengujianterhadaptanah- tanah yang ada di wilayah X


untukmenjadidasarperencanaanpengembangan pada wilayah tersebut. Hasil yang di
dapatmemilikiperbedaan pada beberapatanahdiantaranyaada yang berbentuklempeng, prisma dan
tiang.

Jenispengukurantanahapa yang sedang di uji penelititersebut ?

A. Suhu
B. Warna
C. Tekstur
D. Struktur
E. Konsistensi

17. Seorangmahasiswasedangmelakukanpenelitianmengenaimakrofaunatanah yang


berperanpentingsebagaipenyelaras dan keberlangsunganekosistem yang sehat, baikbagi biota
tanahlainnyamaupunbagihewan dan manusia. Penelitianinidilakukandalampenyelesaiantugasakhir.

Apakah yang sedang di teliti oleh mahasiswa pada kasus di atas?

A. Fungi
B. Bakteri
C. Jamur
D. Cacing
E. Mikroba

18. Seorangiburumahtangga di Permukiman X seringmembakarsampah dihalamanrumahnya, semuasampah


yang ada di rumah di bakarhinggahabistermasuksampahplastik. Asap
hasilpembakaransampahmembuatbeberapatetanggasekitarrumahnyaterganggu, dan
mealporkannyakepadaPengurus RT setempat.

Zatberbahayaapakah yang kemungkinanakantimbul pada kasus di atas?

A. Etanol
B. Dioxin
C. Timbal
D. Marcury
E. Air raksa
19. Petugaskebersihan di salah satu pasar melaporkanke pada pimpinannyabahwapengangkutansampah oleh
dinaskebersihandilakukanseminggu 2 x, sehinggamenyebabkanterjadinyapenumpukansampah di TPS pasar.
Kondisiinimenyebabkanbau yang menyengatdisekitar TPS. Yang ditimbulkan oleh gas yang ada pada sampah yang
membusuk

Pengolahanapakah yang tepatuntukkasus di atas?

A. Recycle
B. Komposting
C. BriketBioarang
D. Open dumping
E. Sanitary landfill

20. Seorang petugaspengangkutsampah di Permukiman X mendapattegurandaribeberapawarga,


karnaketikamengangkutsampah air sampahmenetessepanjangjalan yang dilewatinya. Hal
inimembuatwargamerasadirugikankarna air sampah yang menetesmenimbulkanbau dan lalat di sekitarnya. Alat
angkut yang digunakanpetugastersebutberupagerobaksampah yang tertutup.

Apakah yang menyebabkanmasalahutama pada kasus di atas?

A. Lalat
B. Sludge
C. Bakteri
D. Amoniak
E. Leacheat

21.Seorang Sanitarian sedangmengambilsampeltanah di lahandekatperkebunan, pada sampel tanah yang terambil


ditemukan banyak sampahorganikdariorganismesepertisisatanaman yang membusukataupunbahanorganik lain yang
masihdalam proses membusuk.

Lapisantanahapakah yang diambil oleh sanitarian tersebut ?

A. Horizon O
B. Horizon A
C. Horizon B
D. Horizon C
E. Horizon R

22. SeorangPetanimerasakanadanyapencemarantanah pada lahanpertaniannya, ketikaiamelaporkankepadapetugas


sanitarian baru di ketahuikemungkinantanahnyatercemar oleh pupuk yang selamainidigunakan.
Penggunaanpupuksecaraberlebihandapatmenyebabkanterjadinyapencemaran pada tanahpertanian di wilayah
tersebut.

Kontaminanapakah yang dapatmenyebabkanpencemarantanahtersebut?

A. Arsen
B. Posfat
C. Klorida
D. Cadmium
E. Magnesium

23. Seorangmahasiswa Program Studi Diploma III Sanitasi, sedangmelakukanpengukuransifatfisiktanah, salah satu yang
akandiukuradalahderajatkeasamantanah. Hasil pengukuranmenunjukan pH tanahtersebutberada pada phnetral

Berapahasilpengukuranph yang di dapatmahasiswatersebut?

A. 2,0 – 3,0
B. 4,0 – 5,0
C. 5,0 – 6,0
D. 6,0 – 7,0
E. 8,0 – 9,0

24. KepalaPuskesmasmenugaskan sanitarian untukmelakukanperbaikantanahpendudukyang di


dugatercemarlogamberatdaribuangan industry logam. Sanitarian
tersebutmelakukantindakanuntukmemperbaikitanah yang tercemardengancaramembersihkantanah yang
tercemarlangsung di tempatnya.

Dinamakanapakahpembersihantanah yang dilakukan pada kasus di atas?

A. Insitu
B. Off situ
C. Kombinasi
D. Remidiasi
E. Fitoremidiasi

25. KepalaPuskesmasmenugaskan sanitarian untukmelakukanperbaikantanahpendudukyang di


dugatercemarlogamberatdaribuanganindustrilogam. Sanitarian tersebutmelakukantindakanpembersihantanah
yang tercemardengancaramembawatanahtersebutketempat lain

Dinamakanapakahpembersihantanah yang dilakukan pada kasus di atas?

A. Insitu
B. Off situ
C. Kombinasi
D. Remidiasi
E. Fitoremidiasi

26. Pada tanah yang tercemar oleh legamberatdari salah satu industry, seorang sanitarian yang bertugas di wilayah
tersebutsedangmelakukanperbaikan agar tanahsehatkembali.Untukmemulihkantanah yang telahtercemar
Sanitarian tesebutmenanamtanaman yang dapatmenyeraplogamberat.

Dinamakanapakah proses pemulihantanah pada kasus di atas?

A. Fitoremediasi
B. Bioremediasi
C. Alkalomediasi
D. Reduksomediasi
E. Chemical remediasi

27. Seorang Sanitarian sedangmelakukaninspeksisanitasi di TempatPembuanganakhirSampah (TPA). Salah satu element


yang sedang di Inspeksiadalahfasilitas untuk mengendalikanaliran dan konsentrasimethan di
dalamlandfill ,karnajikatidakbaikakanmenimbulkanbahaya ledakan akibat aliran methan yang tidak terkendali di
dalam tanah.

Fasilitas apayang dimaksud pada kasus di atas?

A. gas ventilation system


B. leachate extraction system
C. leachate treatment system
D. methane gas recovery well
E. groundwater monitoring wells

28. SeorangwargaDesa X mengembangkanvermikompostinguntukmengolahsampahsisaolahanpertanian. Kompos yang


dihasilkannyalebih kaya unsure N yang merupakan unsure dasarpembentukan protein nabati. Unsur N
tersebutberasalddari N2 non simbiotik yang diikat oleh salah satumikroba di dalamkompos.

Jeniscacingapakah yang biasadigunakanuntukkasus di atas?

A. Lumbricusrubellus
B. Rubella manitukus
C. Ascaris lumbricoides
D. Nematoda americanus
E. Enterobius vermicularis
29. Seorangmahasiswa D III Sanitasisedangmelakukanpenelitiantentang biogas, bahanutama yang
akandigunakanterdiridarisampahsayuran dan kotoransapi.Alat yang digunakanadalahtabung yang terbuatdari plat,
alattersebutdilengkapidengan pipa untukmenangkap gas yang keluardaribahanorganik.

Gasapakah yang dimaksud pada kasus di atas ?

A. NH4
B. CH4
C. Na4
D. CO4
E. MN04

30. Seorang sanitarian mendatangipeternakansapi yang ada di pinggirandesa, halinidilakukankarnakotoransapi yang


dihasilkanmeresahkanmasyaraktsekitarpeternakan. Setelah diamatikemudian sanitarian
tersebutmemintapeternaksapiuntukdapatmengolahkotoransapinyasehinggatidakmenumpukbegitusaja.

Pengolahanapakah yang tepatuntukmenaganikasus di atas?

A. Biogas
B. Komposting
C. Hog feeding
D. Pembakaran
E. Briket bioarang

31. Seorangmahasiswa D III Sanitasisedangmelakukanpenelitianmengenaikomposdarisampahdaun, untukmempercepat


proses pengomposan, mahasiswatersebutmenambahkancairan yang
dibuatdarisampahbuahtomatkemudiandilakukan proses fermentasi dan ditambahkan air cucianberas.

Disebutapakahcairan yang dimaksudtersebut ?

A. Lindi
B. Leacheat
C. Cairantomat
D. MikroorganismeLokal (MOL)
E. EvektifMikroorganisme 4 (EM4)

32. Seorangmahasiswa D III Sanitasisedangmelakukanpraktikumtimbulansampah pada sumbersampah Pasar


Traditional. Pengukurantimbulansampahdilakukan di TPS yang terletak di belakang pasar.
Mahasiswatersebutmelakukanduamacamukurantimbulansampah.

Sebutkankeduamacamukurantersebut

A. Isi dan Volume


B. Berat dan volume
C. Jarak dan volume
D. Jarak dan Berat
E. Jarak dan waktu

V. LATIHAN SOAL VEKTOR

1. Seorang Sanitarian melakukanpengendalianterhadaptikus yang ada di wilayah kerjanya,


karenattikusadalahbinatangpengerat, selaindapatmerugikankarenamerusakbarang-barang dan
membuatkotorlingkungan, tikus juga berperanmembawa vector penyebabpenyakit.

Apanamapenyakit yang disebabkan oleh vector pada kasustersebut ?

A. Penyakit hepatitis
B. Penyakit pneumonia
C. Penyakit pes
D. Penyakit filariasis
E. Penyakit Malaria

2. Seorang Sanitarian melakukansurvailalat, dan berhasilmenangkapbeberapaekorlalat yang mempunyaiciri-ciri dada


dan peruttidakmengkilap/pudar, ukuransedangdenganpanjangnya ± 6 mm, pada bagian punggung terdapat 4 garis
yang biasanya nampakjelas ,bagiansisiperutpucat, waktuistirahattegak, dan tidakadanodapucat pada bagian dada.
Apanamalalat yang diidentifikasi pada kasustersebut ?

A. Lalatkecil (Fanniacanicularis)
B. LalatRumah (Musca Domestica)
C. Lalatkandang (Stomaxyscalaitrans)
D. Lalatdaging (Sarcophaga)
E. Lalathijau (Luciliasertica)

3. Seorang Sanitarian mendugaadanyaresistensi pada nyamuksehinggabanyak yang tidakdapatterbunuh oleh


insektisida.
Peristiwaperkembangankekebalaninimenjadifaktorpenghambatutamadalammelakukanpengendalianvektormenggun
akaninsektisida. Sanitarian tersebutmelakukansesuatu uji untukmengetahuiapakahsudahterjadikekebalanterhadap
vector.

Apanama uji yang dilakukan pada kasustersebut ?

A. Uji bio assay


B. Uji bio kerentanan
C. Identifikasiparasitdalamtubuhvektor
D. Uji kerentanan
E. Analisis BI, CI, HI

4. Seorang Sanitarian melakukanpengendalian vector nyamuk pada suatu wilayah


kerjanyadengancaramemanfaatkanmusuhalamiah (predator), sepertipenebaran ikan kepalatimah di
persawahanuntukmengendalikannyamuk Anopheles yang merupakan vector penyakit malaria.

Apanamametodapengendalian pada kasustersebut ?

A. Pengendalianmekanik
B. Pengendaliankimia
C. Pengendalianfisika-mekanika
D. Pengendalianbiologi
E. Pengendalianpengolahanlingkungan

5. Seorang Sanitarian melakukan pengendalian vektor dengan menggunakan beberapa metode yang bersinergi
sehingga mampu menurunkan potensi penularan penyakit. Pengendalian ini bersifat rasional, ramah lingkungan
serta berkelanjutan.

Apa nama pengendalian dalam kasus tersebut ?


a. Pengendalianvektorterpadu
b. Pengendalianvektormekanika
c. Pengendalianvektorbiologis
d. Pengendalianvektorkimia
e. PengendalianvektorFisika

6. Seorang sanitarian sedangmengidentifikasibinatang yang bisamenjadipenularpenyalkitbersumberbinantang.


Binatang yang diidentifikasimempunyaiciri-ciriadanyasepasanggigiseri ( incisor ) pada setiaprahang,
tidakmempunyai taring sehinggaterdapatkekosongangigi yang disebut diastema , dan mempunyaiekor yang
hampirgundul dan beruas – ruaskecil.

Binatangapakah yang diidentifikasi pada kasustersebut ?


a. Kecoa
b. Nyamuk
c. Tikus
d. Kucing
e. Anjing

7. Seorang sanitarian
melakukansurvaiperilakunyamukuntukmemudahkanpelaksanaanpengendaliannyasepertiperilakumenggigitmanusia.
Dari hasilsurvai, diketahuibanyaknyamuk yang tidakmenggigitmanusia,
tetapinyamuktersebutbanyakmengginggithewan.
Apakahistilahperilakuinyamuk pada kasustersebut?

a. Endofilik
b. Eksopagic
c. Zoophilic
d. Eksofilik
e. Anthropilic

8. Seorang sanitarian melakukanidentifikasi vector pada fasetelurnyadenganmelakukansurvaitelurnyamuk.. Sanitarian


tersebutberkesimpulanbahwatelurnyamuk yang ditemukanmemilikiciriciritelurnyamuk yang
bertindaksebagaivektorpenyakit malaria.

Apakahtandatandadaritelurnyamuk pada kasustersebut ?

a. Denganpelampung, satupersatu di air


b. Tanpapelampung, satupersatu pada bejana
c. Tanpapelampung,tersusunsepertirakit di air
d. Denganpelampungbergerombol pada dindingbejana
e. Denganpelampung, bergerombol dan menempel pada tumbuhan air

9. Seorang sanitarian melakukansurveiidentifikasi vector lalat di pasar tradisionaldenganmelakukanpenangkapanlalat..


Dari hasilsurveitersebutdidapatkanlalatdenganmorfologimempunyai 3 garis hitam pada toraknya dan abdomen yang
menyerupaipapancatur.

Jenislalatapakah yang ditemukan pada kasustersebut?

a. Lalatkandang (Stomaxyscalaitrans)
b. Lalatdaging (Sarcophaga)
c. Lalathijau (Luciliasertica)
d. Lalatkecil (Fanniacanicularis)
e. LalatRumah (Musca Domestica}

10. Hasil survey yang dilakukan oleh seorang sanitarian yang bekerja di pelabuhan, ditemukanbanyaktikusdengan
habitat di gudangpelabuhan, saluranpembuangan air permukiman dan pada riul.

Jenistikusapakah yang kemungkinanditemui pada kasustersebut ?

a. Mus musculus
b. Rattus exulans
c. Rattus norvegicus
d. Rattus tiomanicus
e. Rattus rattusdiardi

11. Seorang sanitarian melakukansurveijentiknyamuk di wilayah kerjanya, denganmelakukanpemeriksaanterhadap 300


container. Dari hasilpemeriksaan di ditemukan container yang positifterdapatjentiknyamukadalahsebanyak 45
container.

BerapakahContainer Indek (CI) pada kasustersebut?

a. 5%
b. 10 %
c. 15 %
d. 30 %
e. 45 %

12. Seorang sanitarian melakukansurveijentiknyamuk di wilayah kerjanya, denganmelakukanpemeriksaanterhadap 500


rumah.. Hasil surveidiperolehjumlahrumah yang positifjentik 125 rumah,
sedangkannyamuktertangkapsementaraistirahat 820 ekor, nyamuktertangkapmenggigit 120 ekor.

BerapaHouse Index (HI) pada kasustersebut ?

a. 10 %
b. 15 %
c. 25 %
d. 35 %
e. 40 %

13. Seorang sanitarian melakukanpengukurantingkatkepadatannyamuk di wilayah kerjanya,


denganmelakukanpenangkapannyamuk pada 95 rumah oleh 5 orang penangkapselama 2 jam.
Hasilnyadiperolehnyamuktertangkap di dindingrumahsebanyak 80 ekor.

BerapaMan Hour Density (MHD) pada kasustersebut ?

a. 8
b. 10
c. 12
d. 20
e. 30

14. Seorang sanitarian melakukanpengukurantingkatkepadatannyamuk di wilayah kerjanya,


denganmelakukanpenangkapannyamuk pada 200 rumah oleh 4 orang penangkapselama 4 jam.
Hasilnyadiperolehnyamuktertangkapsedangmenggigitsebanyak 160 ekor.

BerapaMan Baiting Rate (MBR) pada kasustersebut ?

a. 5
b. 10
c. 15
d. 20
e. 30

15. Seorang sanitarian melakukanpengukurantingkatkepadatannyamuk di wilayah kerjanya,


denganmelakukanpemeriksaanjentik di persawahanselama 3 jam..JumlahjentikspesiesAnsundaicus yang
tertangkapsebanyak 50 ekor. Jumlahcidukanuntukmenangkap An. sundaicussebanyak 25 ciduk.

BerapakahtingkatkepadatanjentikAnsundaicus pada kasustersebut?

a. 0,5
b. 1,0
c. 2,0
d. 5,0
e. 7,0

16. Seorang warga masyarakat pergi ke tempat pelayanan kesehatan dan diduga menderita penyakit yang
ditularkanmelaluibinatangtikus. Penyakit demam akut ini ditandai dengangejala klinis yang luas.yaituleptospirosis.

Apakah penyebab penyakit pada kasus tersebut ?

a. Bakteri Yersinia Pestis


b. Bakterithyposa
c. Bakteri Leptospira
d. Bakteri salmonella
e. BakteriTubercolosa

17. Seorang sanitarian mengamatibahwapada pergantianmusim penghujan dan musimkemaraubanyak ditemukan kasus
penyakit demam berdarah di wilayah kerjanya, sehingga harus segera melakukan pengukuran tingkat kepadatan
nyamuk yang menjadi vektorpenyakittersebut.

Jenisnyamukapakah yang menjadi vector penyakit pada kasustersebut ?


a. Nyamuk Anopheles sp.
b. NyamukMansonia sp.
c. Nyamuk Culex sp.
d. NyamukToxorhynchitessp
e. NyamukAedes sp.

18. Pada musimhujanbanyakwarga masyarakat yang terkenabanjir, dan haliniharus di antisipasiadanyapenyakit yang
terjadikarenabanjirtersebut. Di Puskesmasadawargadiduga menderita penyakit yang ditularkanmelaluibinatangtikus.
Penyakit demam akut ini ditandai dengangejala klinis yang luas.yaituleptospirosis.

Bagaimanacaratransmisi penyakit pada kasus tersebut ?

a. Kontak urine tikus


b. Kontakudara
c. Kontaminasimakanan
d. Bersentuhandengantikus
e. Kontakdenganpinjaltikus

19. Untukmelakukanidentifikasiperilakumenggigitnyamuk, seorang sanitarian


melakukanpengamatanperilakunyamukdalammemperolehdarahuntukkelangsunganhidupnyadapatdarimanusiaatau
hewan. Untukmengetahuiperilakunyamuktersebutmakaperludilakukan uji terhadapjenispakandarahnya.

Apakahnama uji pada kasustersebut?

a. Presipitin test
b. Torniquet test
c. Bioassay test
d. Susceptybiliti test
e. Screening test

20. Seorang sanitarian melakukankegiatan fogging dalampemberantasannyamuk vector DBD yang dilakukan pada
pagihariatau sore hari pada wilayah yang adakasus DBD dengan radius 100 meter.

Apakahmanfaat yang paling tepatdaritindakantersebut?

a. Mengurangiangkakesakitan
b. Mencegahpenularanpenyakit
c. Menghilangkantempatperindukan
d. Membunuhseranggabukansasaran
e. Mengurangipopulasinyamukdewasa

21. Seorang sanitarian melakukanpengukurantingkatkepadatanlalatdengan survey fly grill. Sanitarian


tersebutmeletakanalat fly grill pada breeding places,kemudianlalat yang hinggapdihitung dan diulangbeberapa kali
pengukuran.

Berapawaktu yang dibutuhkanuntuksatu kali perhitungan pada kasustersebut ?


a. 5 detik
b. 20 detik
c. 10 detik
d. 30 detik
e. 15 detik

22. Seorang sanitarian melakukan survey kepadatanlalat di sebuahpermukiman di sekitar TPA menggunakanmetodefly
grill. Hasil pencatatan yang lalathinggapdisusunsecaraarraysebagaiberikut: 12, 9, 9, 8, 7, 5, 4, 4, 3, 2

Berapadensitaslalat pada kasustersebut?


a. 3,6
b. 6
c. 6,3
d. 9
e. 12,6
23. Seorang sanitarian melakukanpengukurantingkatkepadatannyamuk pada suatu area
permukimandengancaramenangkapnyamukmenggunakanalatpenghisap pada
saatnyamukmenggigitatauberistirahat.

Apanamaalat pada kasustersebut?


a. Ovitrap
b. mosquito net
c. Aspirator
d. paper cup
e. Dipper

24. Seorang sanitarian melakukanupayapengendaliansecarakimia pada nyamukdewasadenganmetodapengabutan


(fogging) di wilayah yang terkenapenyakitdemamberdarah. Sanitarian memutuskanmenggunakanjenisinsektisida
pada kegiatanpengabutantersebutadalahcynof 25 EC.

Apakahjenisbahanpelarut yang sebaiknyadigunakan pada kasustersebut ?


a. Air
b. Solar
c. Gasolin
d. Premium
e. Pertamax

25. Seorang sanitarian melakukan kegiatan survei kepadatan jentik nyamuk di wilayah kerjanyadenganmenggunakan
parameter breteau index (BI). Kemudian sanitarian tersebut melakukan suvey jentik dengan melakukan pengamatan
pada kontainer-kontainer pada rumah-rumah yang diperiksa.

Bagaimanakah cara menghitung tingkat kepadatan pada kasus tersebut ?


a. Jumlah larva dibagi jumlah kontainer yang diperiksa
b. Jumlah rumah positif larva di bagi jumlah rumah yang diperiksa kali 100 %
c. Jumlah kontainer positif jentik di bagi jumlah rumah yang diperiksa kali 100 %
d. Jumlah kontainer positif jentik di bagi jumlah kontainer yang diperiksa kali 100 %
e. Jumlah ovitrap yang positif larva dibagi jumlah ovitrap yang digunakan kali 100 %

26. Seorang sanitarian akanmelakukanpengendaliannyamuk pada suatudesa yang terjangkitkasus filariasis dan
telahmeluas pada wilayah desatersebut. Sanitarian
tersebutinginmelakuakanpengendalianmetodabiologidenganmemelihara ikan di kolam/selokan yang
selamainitidakterurus.

Apajenis ikan yang efektifsebagaipengendalian pada kasustersebut ?

a. Ikan kepalatimah
b. Ikan sapusapu
c. Ikan gurameh
d. Ikan emas
e. Ikan nila

27. Petugas Kesehatan melakukankegiatansurveinyamuk di suatudesadalam wilayah kerjanya.


Nyamukhasilsurveidilakukanidentifikasi dan menemukancirinyamuk yang paling dominanberupa palpi
samapanjangdenganproboscis, buluantenajarang, sayapberbercakhitam, terdapatgelangpucat di ujung palpi.

Apakahnama genus yang dominan pada kasustersebut ?

a. Aedes sp.
b. Mansonia sp.
c. Anopheles sp.
d. Armigeres sp.
e. Toxorhynchites sp.

28. Petugas Kesehatan mengidentifikasijentiknyamuk yang diperolehdarihasil survey pada suatu wilayah kerjanya.
Jentikdiletakkan di dalam masing-masing wadah yang telahterisi air. Setelah berkembangmenjadidewasa,
nyamukdiidentifikasi dan terlihatjenisnyamuk yang memiliki palpi lebihpendekdari proboscis, antenaberbulujarang.

Nyamukapakah yang memilikiciri pada kasustersebut?

a. Aedes sp.
b. Mansonia sp.
c. Anopheles sp.
d. Armigeres sp.
e. Toxorhynchites sp.

29. Petugas Kesehatan mengidentifikasitikus yang diperolehdarihasil survey tikus di wilayah kerjanya. Hasil
identifikasidiperolehciri-ciritikusyaitumoncongsampai anus = 210 mm, anus sampaiujungekor = 220 mm,
tumithinggaujung kuku = 40 mm. Bagian yang diamatiwarnabulu dan jumlahmamae = 3+3=12.

Apakahnamaspesiestikushasilidentifikasi pada kasustersebut ?

a. Bandicota indica
b. Ratus norvegicus
c. Ratus ratusdiardi
d. Ratus argentiventer
e. Bandicota bengalensis

30. Petugassanitarian melakukan survey perilakunyamuk di wilayah kerjanya. Hasil survey


terhadapnyamukAnopelesspmenunjukkanbahwadindingrumahadalahtempatistirahatsementaranyamuk,
baiksebelummenggigit dan setelahmenggigit.

Metodepengendalianapa yang paling tepat pada kasustersebut ?

A. Indoor Residual Sparying


B. Insect Growth Regulatory
C. Exit Window-Trap
D. Light Trap
E. Bed-Net Trap

31. Seorang sanitarian yang bekerja di Kantor Kesehatan Pelabuhan (KKP), melakukansurveijentiknyamuk di wilayah
kerjanya. Sanitarian tersebutmenemukanbanyakjentik pada kontainer-kontainertempat di
sekitarpelabuhantersebut.

Apaupaya yang seharusnyadilakukan oleh sanitarian pada kasustersebut?

A. Melakukan fogging
B. Melakukan larvaciding
C. Melarangkapalsandar
D. Membersihkan kapal yang sandar
E. Pemberantasan sarang nyamuk

VI. LATIHAN PEMBERDAYAAN MASYARAKAT

1. Promosikesehatan (Promkes) adalahupayauntukmencegahkelompokmasyarakat yang sehat agar


tidaksakitsertamasyarakat yang sakittidakkambuh/sakitkembalidenganpenyakit yang sama. Salah
satutugaspetugasPuskesmasadalahmemberikanPenyuluhan, menyebarkan poster/leaflet agar
masyarakatmempunyaipemahaman dan berperilakuhidupsehat.

Apakahnamatingkatandaritugaspromkes yang dilakukanpetugas ?


A. Kuratif
B. Promotif
C. Preventif
D. Persuasif
E. Rehabilitatif

2. Promosikesehatan (Promkes) adalahupayauntukmencegahkelompokmasyarakat yang sehat agar


tidaksakitsertamasyarakat yang sakittidakkambuh/sakitkembalidenganpenyakit yang sama. Salah
satutugaspetugasPuskesmasadalahmengajak dan bersamamasyarakatmelakukanpemberantasansarangnyamuk (PSN)
untukmeningkatkanangkabebasjentik (ABJ) hingga> 95%.

Apakahnamatingkatandaritugaspromkes yang dilakukanpetugas ?


A. Rehabilitatif
B. Persuasif
C. Promotif
D. Preventif
E. Kuratif

3. Strategi Promosi Kesehatan (promkes) yang dianutKemenkesmeliputiAdvokasi, Bina Suasana, Gerakan


Pemberdayaan,danKemitraan. PetugasPuskesmasmenjalankan salah satu strategi
tersebutdiatasdenganhasil/output: adanyakegiatanarisan (bertemusebulansekali) dengan para
kaderkesehatandiwilayahkerjanyadimana pada moment tersebutpetugasmenyampaikankembali program-program
promkes.

Apakahnama strategi yang dimaksuddiatas?


A. Advokasi
B. Kemitraan
C. Bina Suasana
D. Gerakan Pemberdayaan
E. Bina Suasana dan Kemitraan

4. Strategi Promosi Kesehatan (promkes) yang dianutKemenkesmeliputiAdvokasi, Bina Suasana, Gerakan


Pemberdayaan,danKemitraan. PetugasPuskesmasmenjalankan salah satu strategi
tersebutdiatasdenganhasil/output: adanyajadwal dan
pelaksanaankerjabaktidalamrangkapemberantasansarangnyamuk (PSN) yang melibatkanpetugas, tokohmasyarakat,
kader dan seluruhmasyarakatsetiapminggu.

Apakahnama strategi yang dimaksuddiatas?


A. Advokasi
B. Kemitraan
C. Bina Suasana
D. Gerakan Pemberdayaan
E. Bina Suasana dan Kemitraan

5. Sanitarian Puskesmas XYZ inginmengembangkanberbagaispandukpromosiperilaku 3M (menguras, menutup dan


mengubur) tempatpenampungan air dalamrangkameningkatkanangka ABJ (angkabebasjentik). Spandukakan di
pasang di perempatanjalan-jalanrayadiwilayahPuskesmas.

Apanamametodepromosikesehatan yang dipakai sanitarian tersebut ?

A. MetodepromosikesehatanMandiri
B. MetodepromosikesehatanPerorangan
C. MetodepromosikesehatanKelompok
D. Metodepromosikesehatan Massa
E. MetodepromosikesehatanTerpadu

6. SeksiPromosikesehatanDinkesKabXYZ mempunyai program Bina suasana yang


dilakukankepadamasyarakatumummelaluipengembangankemitraan dan pemanfaatan media komunikasiseperti
radio, televisi, koran , majalah, situs internet.

Apakatagoribinasuasanasepertipenjelasandiatas?

A. Publik
B. Individu
C. Kelompok
D. Perorang
E. Grup

7. Program PHBS Institusi Pendidikan di Puskesmas XYZ mempunyaitigatingkatansasaranyaitusasaran Primer,


sasaranSekunder dan sasaranTersier. Sanitarian melakukanpromosikesehatantentang PHBS kepada Guru, Osis,
PengelolaKantin.

MasukKatagorisasaranmanakah yang dilakukan sanitarian tersebut ?

A. Primer
B. Sekunder
C. Tersier
D. Primer dan sekunder
E. Sekunder dan Tersier

8. Program PHBS Institusi Pendidikan di Puskesmas XYZ mempunyaitigatingkatansasaranyaitusasaran Primer,


sasaranSekunder dan sasaranTersier. Sanitarian melakukanpromosikesehatantentang PHBS kepadakepalasekolah
dan kepadayayasanpemiliksekolah.
MasukKatagorisasaranmanakah yang dilakukan sanitarian tersebut ?
a. Primer
b. Sekunder
c. Tersier
d. Primer dan sekunder
e. Sekunder dan Tersier

9. Penduduk Dusun SukarMajumempunyaikebiasaanbuang air besar di kebun dan sungai. Sedangkan air
untukkeperluansehari-haridiperolehdarisungai. PetugasPuskesmassecaraberkalamemberikanpenyuluhan stop
BABS, namunpenyakitakibat BABS masihtinggi.

Penyakitapa yang timbul pada kasusdiatas?


A. Kecacingan dan malaria.
B. Tifusabdominalis dan Filariasis.
C. Disentri dan Pneumonia.
D. Cholera dan kecacingan.
E. Hepatitis dan Flu

10. Pemerintahmelakukansuatustudikebijakantentangpencapaian programPencanangan Gerakan Nasional Sanitasi


Total Berbasis Masyarakat,
dalamhaliniakandihasilkansuatukeputusanataukesepakatanakandilanjutkanatautidaknya program ini.

Kegiatan yang dilakukan oleh pemerintahmerupakanlangkahdaripelaksanaan program


pemberdayaanmasyarakatyakni?

A. Penjajakan
B. Monitoring
C. Evaluasi
D. Implementasi
E. Pengorganisasian

11. Hasil survey ditemukan pada suatudaerahbanyakterdapatkasusdiare, dimanamasyarakatnyamasihbelumbanyak


yang punya jamban, walauada yang punyapunmasihbuang air besar (BAB) di sungai. Pada
kondisitersebutpetugaskesehatanmemberikanpenyuluhan demi memperkecilkasusdiare

Tujuanakhirkeegiatan yang dilaksanakan oleh petugaskesehatantersebutadalah :

A. Pembinaan
B. Tercapainya target program yang dilaksanakan
C. Bertambahnyapengetahuan
D. PerubahanPerilaku
E. Pengembanganwawasan.

12. Banyak upaya yang dapatdilakukanuntukmeningkatkanpengetahuan,sikap dan


tindakanmasyarakatdalamupayamembantumengenali/mengatasimasalahsendiridlmtatanan masing-masing agar
dapatmenerapkan cara2 hidupbersih&sehat.
UpayatersebutdapatdilakukandenganmenciptakansuatukondisibagiPerorangan/Kelompok& Masyarakat
denganmembukajalurkomunikasiinformasi&edukasimelaluipendekatanpimpinan ,binasuasana&pemberdayaanm
asyarakat.

Termasukupaya yang manakankegiatantersebut ?

A. PerilakuHidupBersih dan Sehat


B. Pemberdayaanmasyarakat
C. Penyuluhan
D. Advokasi
E. Promosi

13. Kegiatanpemyuluhanuntukpeningkatanpengetahuanmasyarakatdihadiri oleh banyak orang dan


hampirseluruhwargadesadatangkelapangan.
Petugasmeyampaikanlangsungsebuahmateritentangkesehatanmasyarakatdengantujuanuntukmerubahpengetah
uan, agar merekadapatmengatasisendirimasalahnya.

Metodaapa yang digunakan oleh petugasuntukmenyampaikanmateritersebut ?

A. Lokakarya
B. Simposium
C. Ceramah.
D. Simulasi.
E. Diskusi

14. Pemerintah mencanangkan Pelaksanaan paradigma sehat kegiatan tersebut merupakan upaya pelayanan
kesehatankepada masyarakat

Pelayanan yang tidak menekankan pada upaya tersebut adalah sebagai berikut

A. Rehabilitation
B. Health Promotion
C. Specific Protection
D. Disability Limitation
E. Early diagnosis

15. Program Nasional Promosi Kesehatan memfokuskan pada


upayameningkatkankesadaranmasyarakatuntukmelaksanakanPerilakuHidupBersih dan Sehat

Dari pernyataan dibawah ini yang tidak termasuk dalam program PHBS adalah

A. Kebiasaan berolah raga


B. Stop merokok
C. Membiasakan mencuci tangan
D. Membuang sampah pada tempatnya
E. Membiasakan makanan siap saji

16. Program pelayanan kesehatan sering meminta bantuan para kader kesehatan untk membantu
pelaksanaan program contohnya adalah para kader jumantik, dan salah satu prestasinya adalah apabila
lingkungan dimana para jumantik tinggal dan prestasinya perlu diberikan penghargaan

Pemberian penghargaan pada kader kesehatan tersebut merupakan salah satu pemenuhan kebutuhan
dari

A. Jhon Gordon
B. Maslow
C. Level and Clark
D. Rogers
E. L Green

17. Proses penyampaian informasi tentang pentingbya pemberantasan penyakit Demam Berdarah kepada
masyarakat sering tidak dipahami oleh masyakat karena masalah komunikasi sehingga masyarakat sering
memaksalingkunganrumahnya untuk difoging

Berikut ini yang bukan merupakan faktor penghambat dalam komunikasi adalah

A. Individu
B. Masyarakat
C. Interaksi
D. Situasi
E. Kompetensi

18. Misi dari Promosi Kesehatan adalah mempengaruhi stakeholder untuk mau terlibat dalam program
pembangunan kesehatan termasuk pemerintah, swasta, lintas sektor dan masyrakat

Peran apakah yang dimaksud pada Kasus tersebut ?


A. Mediate
B. Advocate
C. Intimate
D. Enable
E. Expert

19. Kader Kesehatan perlu ditingkatkan kompetensinya baik secara teknis maupun manajerial dalam
menangani masalah kesehatan

Pemberian pelatihan pada kader kesehatan adalah bentuk perubahan perilaku yang disebut

A. Natural change
B. Predisposing
C. Reinforcing
D. Enabling
E. Training

20. Perilaku membuang sampah sembarangan mengakibatkan banjir di beberapa wilayah di DKI Jakarta
banyak penduduk yang tidak memiliki tempat sampah dqn tidak mau membayar iuran untuk buang
sampah. Faktor tersebut merupakan salah satu faktor yang mempengaruhi perubahan perilaku
membuang sampah

Menurut sdr termasuk faktor apakah haltersebutdiatas ?

A. Enabling
B. Reinforcing
C. Predisposing
D. Empowering
E. Transforming

Anda mungkin juga menyukai