Anda di halaman 1dari 136
cover_kebatalan perjanjian_v4_arsip_dpn.pdf 1 12/15/10 4:48 PM C M Y CM MY CY CMY K
cover_kebatalan perjanjian_v4_arsip_dpn.pdf
1
12/15/10
4:48 PM
C
M
Y
CM
MY
CY
CMY
K

Elly Erawati Herlien Budiono

cover_kebatalan perjanjian_v4_arsip_dpn.pdf 1 12/15/10 4:48 PM C M Y CM MY CY CMY K Elly Erawati

PENJELASAN HUKUM TENTANG KEBATALAN PERJANJIAN

buku-5.indd

1

12/13/2010

11:00:01 PM

Penjelasan Hukum tentang Kebatalan Perjanjian

Hak cipta dilindungi oleh Undang-Undang. Diterbitkan pertama kali oleh Nasional Legal Reform Program, Jakarta, 2010

Penulis:

Elly Erawati, Herlien Budiono

Editor:

Sebastian Pompe

Pengulas:

Didi Dermawan

Gregory Churchill

Ahli Internasional:

Prof. Dr. Jaap Hijma

Mardjono Reksodiputro

Pelaksana Penelitian:

Komisi Hukum Nasional (KHN)

Binziad Kadafi

Peneliti:

Frans Hendra Winarta

Fritz Edward Siregar

A.F. Elly Erawaty

Harjo Winoto

Mujahid A. Latief T. Rifqy Thantawi M. Djodi Santoso Hardian Aprianto Aryanti Hoed Ikhwan Fakhrojih Diani Indah Rachmitasari Totok Suryawan Wibowo Yuniarti Widyaningsih Jamil Burhan

Fisella Mutiara A.L.Tobing

Dilarang mengutip atau memperbanyak sebagian atau seluruh isi buku ini dalam bentuk apa pun (seperti cetak, fo- tokopi, mikrofilm, VCD, CD-ROM, dan rekaman suara) tanpa izin tertulis dari Penerbit.

Sanksi Pelanggaran Pasal 72 Undang-Undang Nomor 19 Tahun 2002 tentang Hak Cipta.

(1)

Barangsiapa dengan sengaja dan tanpa hak melakukan perbuatan sebagaimana dimaksud dalam Pasal 2 ayat (1)

(2)

atau Pasal 49 ayat (1) dan ayat (2) dipidana dengan pidana penjara masing-masing paling singkat 1 (satu) bulan dan/atau denda paling sedikit Rp1.000.000,00 (satu juta rupiah), atau pidana penjara paling lama 7 (tujuh) tahun dan/atau denda paling banyak Rp5.000.000.000,00 (lima miliar rupiah). Barangsiapa dengan sengaja menyiarkan, memamerkan, mengedarkan, atau menjual kepada umum suatu ciptaan atau barang hasil pelanggaran Hak Cipta atau Hak Terkait sebagaimana dimaksud pada ayat (1) dipidana dengan pidana penjara paling lama 5 (lima) tahun dan/atau denda paling banyak Rp500.000.000,00 (lima ratus juta rupiah).

Dicetak oleh Percetakan PT Gramedia, Jakarta Isi di luar tanggung jawab Percetakan

buku-5.indd

2

12/13/2010

11:00:01 PM

DAFTAR ISI

Kata Pengantar

v

Ringkasan Eksekutif

1

Dokumen Penjelas

3

Perspektif Internasional

35

Laporan Penelitian

45

A.

Analisis Peraturan Perundang-undangan tentang Topik Kebatalan Perjanjian

45

1.

Tidak Terpenuhinya Persyaratan yang Ditetapkan oleh Undang-Undang untuk Jenis Perjanjian Formil, yang Berakibat Perjanjian Batal Demi Hukum

46

2.

Tidak Terpenuhinya Syarat Sah Perjanjian

48

B.

Analisis Literatur tentang Topik Kebatalan Perjanjian

61

1.

Tidak Terpenuhinya Persyaratan yang Ditetapkan oleh Undang-Undang untuk Jenis Perjanjian Formil, yang Berakibat Perjanjian Batal Demi Hukum

61

buku-5.indd

3

Penjelasan Hukum tentang Kebatalan Perjanjian iii

12/13/2010

11:00:01 PM

2.

Tidak Terpenuhinya Syarat Sahnya Perjanjian

64

C.

Analisis Putusan Pengadilan tentang Topik Kebatalan Perjanjian

85

Daftar Putusan

107

Daftar Literatur

109

A. Daftar Literatur Penelitian

109

B. Daftar Skripsi, Tesis, dan Disertasi

112

C. Daftar Artikel/Makalah

115

Daftar Peraturan Perundang-undangan

117

A.

Pengaturan Batal Demi Hukum dalam Peraturan Perundang- Undangan di Luar Kitab Undang-Undang Hukum Perdata/BW (Undang-Undang, Peraturan Pemerintah, dan Keputusan Presiden) dari Tahun 1945 Hingga 2009 yang Masih Berlaku

117

1.

Undang-Undang

117

2.

Peraturan Pemerintah

119

3.

Keputusan Presiden

120

B.

Identifikasi Pengaturan Batal Demi Hukum dalam Peraturan Perundang-undangan di Luar Kitab Undang-Undang Hukum Perdata/BW (Undang-Undang, Peraturan Pemerintah, dan Keputusan Presiden) dari Tahun 1945 Hingga 2009 yang Masih Berlaku

120

1.

Mengisi Kebutuhan Pengaturan Substansi Batal Demi Hukum yang Tidak Terdapat di Dalam BW

122

2.

Keadaan yang Mengakibatkan Atau Tata Cara Terjadinya Atau Akibat

yang Ditimbulkan Batal Demi Hukum

124

3.

Kewenangan untuk Menyatakan Batal Demi Hukum

125

Daftar Pustaka

127

iv iv

buku-5.indd

4

Daftar Isi

Dokumen Penjelas

12/13/2010

11:00:02 PM

KATA PENGANTAR PENJELASAN HUKUM TENTANG KEBATALAN PERJANJIAN

Ketidakpastian hukum merupakan masalah utama di Indonesia pada zaman modern ini. Ketidakpastian hukum merupakan masalah besar dan sistemik yang mencakup keseluruhan unsur masyarakat. Ketidakpastian hukum juga merupakan hambatan untuk mewujudkan perkembangan politik, sosial dan ekonomi yang stabil dan adil. Singkat kata, jika seseorang ditanya apa hukum Indonesia tentang subjek tertentu, sangat sulit bagi orang tersebut untuk menjelaskannya dengan pasti, apalagi bagaimana hukum tersebut nanti diterapkan. Ketidakpastian ini banyak yang bersumber dari hukum tertulis yang umumnya tidak jelas dan kontradiktif satu sama lain. Selain itu, ketidakpastian dalam penerapan hukum oleh institusi pemerintah maupun pengadilan. Yang menjadi garis bawah dari ketidakpastian hukum adalah lemahnya lembaga dan profesi hukum. Itu dapat kita lihat di lingkungan peradilan, di mana hakim terus-menerus tidak menjaga konsistensi dalam putusan mereka. Advokasi pun tidak berhasil untuk betul-betul menjaga standar profesi mereka. Ketidakpastian hukum juga bersumber dari dunia akademik yang ternyata kurang berhasil untuk membangun suatu disiplin ilmiah terpadu dalam analisis peraturan perundangan dan putusan pengadilan. Lemahnya ‘legal method’ di dunia akademik adalah alasan pokok kenapa akuntabilitas pengadilan dan lembaga negara tetap lemah. Proyek restatement ini merupakan upaya untuk menjawab isu ketidakpastian hukum tersebut. Tujuan utama dari proyek ini adalah untuk mewujudkan suatu gambar yang jelas tentang beberapa konsep penting hukum Indonesia modern. Metode yang digunakan adalah analisis terhadap tiga sumber hukum: peraturan perundang-undangan, putusan pengadilan, dan literatur yang otoritatif. Tujuan kedua dari proyek ini adalah untuk membangun kembali ‘the legal method’, yaitu sistem penelitian dan diskursus hukum yang riil oleh kalangan universitas, institusi penelitian dan organisasi swadaya masyarakat. Tentunya restatement ini tidak dimaksudkan sebagai kata terakhir atau tertinggi untuk suatu topik hukum yang dibahas di dalamnya. Namun, restatement ini bisa memperkaya nuansa hukum Indonesia, terutama karena analisisnya bersandarkan pada putusan pengadilan dan literatur yang berwibawa mulai Indonesia merdeka. Ahli hukum, hakim, dan advokat jelas mempunyai kebebasan untuk menyetujui atau menolak hasil analisis dalam restatement ini, namun kami berharap supaya restatement ini bisa mencapai suatu kepastian hukum lebih besar untuk topik-topik tertentu, terutama dalam struktur

buku-5.indd

5

Penjelasan Hukum tentang Kebatalan Perjanjian v

12/13/2010

11:00:02 PM

analisis terhadap disiplin hukum tertentu, agar pembahasan tentang topik tersebut mampu menapak suatu tingkatan intelektual yang lebih tinggi. Alasan kami memilih topik kebatalan perjanjian sebagai salah satu pokok bahasan restatement adalah pentingnya arti restatement sebagai satu rujukan yang mendalam dan sistematik tentang suatu topik yang masih mengandung ketidakpastian di dalamnya. Salah satu isu dalam hukum perdata yang masih mengandung ketidakpastian konsep dan interpretasi adalah masalah kebatalan khususnya masalah batal demi hukum (null and void). Akhir kata, kami berharap “mimpi” kami untuk mewujudkan koherensi, konsistensi dan kesesuaian diskursus hukum perdata dapat terakomodasi dengan baik dalam program restatement ini sehingga mempunyai faedah bagi para stakeholders.

vi vi

buku-5.indd

6

Kata Pengantar

Dokumen Penjelas

Hormat kami,

Sebastiaan Pompe Program Manager

12/13/2010

11:00:02 PM

RINGKASAN EKSEKUTIF

Restatement penting artinya sebagai satu rujukan yang mendalam dan sistematik tentang suatu topik yang masih mengandung ketidakpastian di dalamnya. Salah satu isu dalam hukum perdata yang masih mengandung ketidakpastian konsep dan interpretasi adalah masalah kebatalan, khususnya masalah batal demi hukum (null and void). Kebatalan menyangkut persoalan tidak terpenuhinya syarat sahnya suatu perjanjian, yaitu (1) sepakat mereka yang mengikatkan dirinya; (2) kecakapan untuk membuat suatu perikatan; (3) suatu hal tertentu; (4) suatu sebab yang halal. Menurut Prof. Subekti, keempat syarat tersebut diklasifikasikan menjadi dua kategori, yaitu syarat subjektif dan syarat objektif. Syarat subjektif meliputi sepakat mereka yang mengikatkan dirinya dan kecakapan untuk membuat suatu perikatan. Sementara syarat objektif meliputi suatu hal tertentu dan suatu sebab yang halal. Tidak terpenuhinya syarat subjektif berakibat suatu perjanjian dapat dibatalkan/ dapat dimintakan pembatalan oleh salah satu pihak, sedangkan tidak terpenuhinya syarat objektif menyebabkan suatu perjanjian batal demi hukum secara serta merta atau perjanjian dianggap tidak pernah ada dan tujuan para pihak yang mengadakan perjanjian tersebut untuk melahirkan suatu perikatan hukum telah gagal. Dengan demikian, tidak ada dasar bagi para pihaknya untuk saling menuntut di depan hakim. Hal ini dalam bahasa Inggris dikatakan bahwa perjanjian yang demikian itu adalah null and void. Sementara menurut Kartini Muljadi dan Gunawan Widjaja, berdasarkan sifat kebatalannya, nulitas dibedakan dalam kebatalan relatif dan kebatalan mutlak. Yang dimaksud dengan kebatalan mutlak dan kebatalan relatif menurut Prof. Dr. R. Wirjono Prodjodikuro, S.H., adalah suatu pembatalan mutlak (absolute nietigheid), apabila suatu perjanjian harus dianggap batal meskipun tidak diminta oleh suatu pihak. Perjanjian seperti ini dianggap tidak ada sejak semula dan terhadap siapa pun juga, sedangkan pembatalan relatif (relatief nietigheid), yaitu hanya terjadi jika diminta oleh orang-orang tertentu dan hanya berlaku terhadap orang-orang tertentu itu. Batal demi hukum selain karena tidak terpenuhinya unsur objektif, juga karena undang-undang merumuskan secara konkret tiap-tiap perbuatan hukum (terutama perjanjian formil) yang mensyaratkan dibentuknya perjanjian dalam bentuk yang ditentukan oleh undang-undang, yang jika tidak dipenuhi, perjanjian tersebut adalah batal demi hukum (tidak memiliki kekuatan dalam pelaksanaannya). Menurut R. Setiawan, dalam bidang kebatalan terdapat ketidakpastian tentang penggunaan istilah, misalnya undang-undang menyebutkan batal demi hukum, tetapi yang dimaksudkan adalah dapat dibatalkan. Hal ini dapat kita jumpai dalam Pasal 1446 BW. Mr. A. Pitlo berpendapat bahwa dalam soal nulitas (kebatalan), alasan-alasan yang ditentukan oleh undang-undang terdapat dalam sekian banyak variasi, dan beraneka ragamnya corak alasan-alasan yang dapat menjadi landasan kebatalan. Masalah yang muncul dalam soal kebatalan, khususnya mengenai batal demi hukum, antara lain

buku-5.indd

1

Penjelasan Hukum tentang Kebatalan Perjanjian 1

12/13/2010

11:00:02 PM

pengertian, batasan, dan unsur-unsur untuk menyatakan tidak terpenuhinya syarat objektif, yaitu hal tertentu dan sebab yang halal. Yang dimaksud hal tertentu adalah suatu perjanjian harus memiliki objek yang diperjanjikan dan objek tersebut harus ditentukan jenisnya. Pasal 1332 KUH Perdata menyatakan bahwa hanya barang-barang yang dapat diperdagangkan yang dapat dijadikan sebagai objek perjanjian sehingga barang-barang yang dipergunakan untuk kepentingan umum tidak dapat dijadikan objek perjanjian. Dalam hal batal demi hukum karena peraturan perundang-undangan menentukan demikian, berdasarkan penelusuran, didapatkan sejumlah peraturan perundang- undangan yang menentukan batal demi hukum, yaitu berupa Undang-Undang (UU), Peraturan Pemerintah (PP) dan Keputusan Presiden (Keppres) dari tahun 1945 sampai dengan 2009. Berdasarkan hasil penelusuran awal tim peneliti, terdapat 22 UU, 13 PP, dan 4 Keppres yang memuat secara tegas ketentuan tentang batal demi hukum. Isu menarik dari ketentuan peraturan perundang-undangan yang mengatur tentang batal demi hukum adalah peraturan perundang-undangan tingkat mana yang seharusnya dapat mengatur tentang ketentuan batal demi hukum, apakah setiap tata urutan perundang- undangan berwenang mengatur tentang batal demi hukum. Dalam perkembangannya, setelah dilakukan seleksi terhadap jumlah tersebut, hanya beberapa UU yang termasuk berkaitan erat dengan tema penelitian. Tim peneliti juga telah melakukan pengumpulan dan analisis awal terhadap putusan-putusan yang menyatakan batal demi hukum. Jumlah putusan yang diteliti, antara lain Yurisprudensi MA RI tahun 1969 sampai dengan tahun 2008 berjumlah 17 yurisprudensi yang menyatakan suatu kebatalan. Dari jumlah tersebut, 11 yurisprudensi menyatakan suatu perjanjian itu batal demi hukum, sedangkan sisanya menyatakan dapat dibatalkan. Selain itu, tim peneliti juga telah melakukan pengumpulan dan analisis awal terhadap putusan pengadilan yang telah berkekuatan hukum tetap yang putusannya menyatakan bahwa suatu perjanjian itu dinyatakan batal demi hukum, dari tingkat PN, PT sampai MA sejak tahun 1980 sampai dengan tahun 2008 sejumlah 49 putusan. Dalam perkembangannya, setelah dilakukan seleksi terhadap jumlah tersebut, hanya sedikit putusan yang termasuk berkaitan erat dengan tema penelitian. Sebagian besar putusan merupakan kasus jual-beli dan kasus sewa-menyewa tanah atau bangunan rumah, serta kasus utang piutang dengan jaminan tanah atau bangunan rumah. Sebagian besar putusan menyatakan bahwa suatu perjanjian itu dinyatakan batal demi hukum karena tidak terpenuhinya unsur sebab yang halal, yaitu bertentangan dengan peraturan perundang-undangan, sebagai contoh adalah Putusan MA No. 381/PK/PDT/1986 dan Yurisprudensi MA No. Reg. 3597 K/PDT/1985, yaitu tentang perjanjian jual-beli tanah dengan hak membeli kembali yang dilakukan oleh para pihak di dalam kasus tersebut dinyatakan batal demi hukum karena jual-beli tanah dengan hak membeli kembali tidak dikenal dalam hukum adat. Jual-beli dengan hak membeli kembali merupakan bentuk perjanjian menurut Pasal 1519 BW, sedangkan jual-beli tanah/rumah harus mengikuti ketentuan di dalam UU Pokok Agraria yang dikuasai hukum adat, dan hukum adat tidak mengenal bentuk jual-beli dengan hak membeli kembali.

2 2

buku-5.indd

Dokumen Penjelas

Ringkasan Eksekutif

2

12/13/2010

11:00:02 PM

DOKUMEN PENJELAS TENTANG KEBATALAN PERJANJIAN

A. Maksud dan Tujuan Penulisan Restatement

Penulisan restatement hukum tentang kebatalan dalam perjanjian ini dimaksudkan untuk menyatakan atau menegaskan kembali secara tertulis apa yang merupakan kaidah atau norma hukum tentang persoalan kebatalan dalam perjanjian, sesuai dengan hukum tertulis, yaitu Kitab Undang-Undang Hukum Perdata Indonesia (KUH Perdata), yang dikuatkan oleh keputusan hakim dan pendapat para ahli hukum di bidang hukum perdata. Dengan demikian, diharapkan restatement ini dapat dimanfaatkan sebagai rujukan bagi para praktisi dan akademisi hukum ketika mereka menghadapi persoalan mengenai kebatalan dalam perjanjian. Oleh karena itu, restatement ini bukan merupakan norma hukum baru, melainkan pengulangan kembali norma hukum yang telah ada untuk mempertegas atau memperjelas.

B. Metode Penulisan Restatement

Restatement ini ditulis berdasarkan hasil penelitian normatif terhadap (1) KUH Perdata sebagaimana diterbitkan dalam Himpunan Peraturan Perundang-undangan Republik Indonesia Menurut Sistem Engelbrecht, Vol. 1, PT Ichtiar Baru Van Hoeve, Cetakan I, Jakarta, 2006; (2) pendapat para ahli hukum perdata yang ditulis dalam buku teks ataupun artikel ilmiah; (c) beberapa putusan hakim yang telah menjadi yurisprudensi. Hasil penelitian tersebut kemudian dirumuskan dalam bentuk draf oleh seorang penulis untuk kemudian diperiksa isi dan sistematikanya oleh seorang praktisi yang juga sebagai akademisi hukum perdata untuk dipastikan kebenaran dan ketepatannya. Draf tersebut kemudian didiskusikan dalam forum diskusi (focused group discussion) dan kemudian dipresentasikan melalui forum seminar, keduanya dihadiri oleh para pakar hukum, seperti pengacara, konsultan hukum, notaris, hakim, corporate lawyers, dan dari kalangan akademisi. Setelah melalui serangkaian uji publik tersebut, draf restatement diedit dan ditulis ulang sehingga menghasilkan naskah final restatement sebagaimana berikut ini. Karena topik restatement ini hanyalah tentang persoalan kebatalan dalam perjanjian maka isinya tidak berupa penegasan kembali beberapa persoalan elementer yang berkait dengan persoalan pokok, seperti tentang arti dan jenis perjanjian, perbedaan dan keterkaitan antara perjanjian dengan perikatan, maupun tentang unsur atau bagian perjanjian. Penulisan berbagai persoalan tersebut hanya akan tepat apabila restatement ini tentang Hukum Kontrak secara utuh.

buku-5.indd

3

Penjelasan Hukum tentang Kebatalan Perjanjian 3

12/13/2010

11:00:02 PM

C.

Luas Lingkup Isi Restatement

Dalam Buku III KUH Perdata ditemukan banyak pasal yang menyebut kata “batal, batalnya,membatalkan,pembatalan,kebatalan,danbataldemihukum”.Sehubungan dengan hal itu maka isi keseluruhan restatement ini akan menegaskan kembali:

1. Pengertian beberapa istilah, yaitu ‘batal’, ‘batal demi hukum’, ‘dapat dibatalkan’, ‘membatalkan’, ‘pembatalan’, dan ‘kebatalan’.

2. Dalam hal apa atau kondisi bagaimana suatu perjanjian yang menimbulkan perikatan bagi pihak yang membuatnya akan batal demi hukum atau dapat dibatalkan.

3. Siapa yang dapat meminta atau menuntut pembatalan suatu perjanjian, syarat agar tuntutan tersebut berhasil, dan siapa yang berwenang membatalkan perjanjian.

4. Batas waktu penuntutan pembatalan suatu perjanjian.

5. Akibat hukum dari perjanjian yang batal demi hukum atau yang dapat dibatalkan.

Frasa ‘batal demi hukum’ merupakan frasa khas bidang hukum yang bermakna ‘tidak berlaku, tidak sah menurut hukum’. Dalam pengertian umum, kata batal (saja) sudahberartitidakberlaku,tidaksah. 1 Jadi,walaupunkata‘batal’sesungguhnyasudah cukup menjelaskan bahwa sesuatu menjadi tidak berlaku atau tidak sah, rupanya frasa ‘batal demi hukum’ lebih memberikan kekuatan sebab tidak berlaku atau tidak sahnya sesuatu tersebut dibenarkan atau dikuatkan menurut hukum, bukan hanya tidak berlaku menurut pertimbangan subjektif seseorang atau menurut kesusilaan/ kepatutan. Batal demi hukum berarti bahwa sesuatu menjadi tidak berlaku atau tidak sah karena berdasarkan hukum (atau dalam arti sempit, berdasarkan peraturan perundang-undangan) memang begitulah adanya. Dengan demikian, ‘batal demi hukum’ menunjukkan bahwa tidak berlaku atau tidak sahnya sesuatu tersebut terjadi seketika, spontan, otomatis, atau dengan sendirinya, sepanjang persyaratan atau keadaan yang membuat batal demi hukum itu terpenuhi. Frasa ‘dapat dibatalkan’ sangat berbeda maknanya dengan frasa ‘batal demi hukum’ sebab ‘dapat dibatalkan’ menyiratkan makna perlunya suatu tindakan aktif untuk membatalkan sesuatu, atau batalnya sesuatu itu terjadi tidak secara otomatis, tidak dengan sendirinya, tetapi harus dimintakan agar sesuatu itu dibatalkan. Kecuali itu, frasa ‘dapat dibatalkan’ juga berarti bahwa sesuatu yang menjadi pokok

1

Arti lain dari lema atau kata ‘batal’ dalam Bahasa Indonesia adalah tidak jadi dilangsungkan, ditunda, urung, tidak berhasil, gagal. Lihat, Pusat Bahasa, Kamus Besar Bahasa Indonesia, Edisi Keempat, Gramedia Pustaka Utama, 2008.

4

Dokumen Penjelas

buku-5.indd

4

12/13/2010

11:00:02 PM

persoalan tidak selalu harus dibatalkan, tetapi bila dikehendaki maka sesuatu itu dapat dimintakan pembatalannya. Dengan kata lain, bila sesuatu hal ‘dapat dibatalkan’ maka bisa terjadi dua kemungkinan:

1. sesuatu itu benar-benar menjadi batal karena dinyatakan pembatalannya akibat adanya permintaan untuk membatalkan, atau

2. sesuatu itu tidak jadi batal karena tidak dimintakan pembatalan sehingga tidak ada pernyataan batal.

Dalam Kamus Besar Bahasa Indonesia (Pusat Bahasa 2008), pada lema ‘batal’ tercantum bentuk derivasinya, yaitu membatalkan dan pembatalan, tidak tercantum bentuk derivasi ‘kebatalan’. 2 Hal ini berbeda dengan lema absah, yang bentuk derivasinya mengabsahkan, pengabsahan, dan keabsahan. Tampaknya, bentuk derivasi ‘kebatalan’ dianggap tidak lazim dalam Bahasa Indonesia, berbeda dengan ‘keabsahan’ yang mungkin lebih banyak digunakan dalam bahasa lisan maupun tulis. Namun demikian, karena dalam Hukum Perjanjian selalu ditemukan persoalan tentang perjanjian yang dapat dibatalkan dan yang batal demi hukum, agar isi restatement ini mencakup kedua hal itu, istilah yang dipakai adalah ‘kebatalan’ sebagai kata benda yang berarti ‘sifat yang batal’. 3

D. Isi Restatement

1. Hal atau Kondisi yang Menyebabkan Batalnya Perjanjian

Dalam konteks Hukum Perjanjian Indonesia menurut KUH Perdata, terdapat

beberapa alasan untuk membatalkan perjanjian. Alasan itu dapat dikelompokkan ke dalam lima kategori sebagai berikut:

a. tidak terpenuhinya persyaratan yang ditetapkan oleh undang-undang untuk jenis perjanjian formil, yang berakibat perjanjian batal demi hukum;

b. tidak terpenuhinya syarat sahnya perjanjian, yang berakibat:

1)

perjanjian batal demi hukum, atau

2)

perjanjian dapat dibatalkan;

c. terpenuhinya syarat batal pada jenis perjanjian yang bersyarat;

d. pembatalan oleh pihak ketiga atas dasar actio pauliana;

2 Ibid.

3 Menurut Kamus Besar Bahasa Indonesia (Pusat Bahasa: 2008), keabsahan adalah kata benda yang berarti sifat yang sah, atau kesahan. Ibid.

buku-5.indd

5

Penjelasan Hukum tentang Kebatalan Perjanjian 5

12/13/2010

11:00:02 PM

e. pembatalan oleh pihak yang diberi wewenang khusus berdasarkan undang- undang.

2. Perjanjian Batal Demi Hukum (Null and Void; Nietig)

Apabila perjanjian batal demi hukum, artinya dari semula tidak pernah dilahirkan suatu perjanjian, dan dengan demikian tidak pernah ada suatu perikatan. Tujuan para pihak yang membuat perjanjian semacam itu, yakni melahirkan perikatan hukum, telah gagal. Jadi, tidak ada dasar untuk saling menuntut di muka hakim. 4 Berikut ini restatement tentang alasan mengapa perjanjian batal demi hukum.

a. Batal Demi Hukum Karena Syarat Perjanjian Formil Tidak Terpenuhi Pada perjanjian yang tergolong sebagai perjanjian formil, tidak dipenuhinya ketentuan hukum tentang, misalnya bentuk atau format perjanjian, cara pembuatan perjanjian, ataupun cara pengesahan perjanjian, sebagaimana diwajibkan melalui peraturan perundang-undangan, berakibat perjanjian formil batal demi hukum. Ahli hukum memberikan pengertian perjanjian formil sebagai perjanjian yang tidak hanya didasarkan pada adanya kesepakatan para pihak, tetapi oleh undang-undang juga disyaratkan adanya formalitas tertentu yang harus dipenuhi agar perjanjian tersebut sah demi hukum. 5 Formalitas

tertentu itu, misalnya tentang bentuk atau format perjanjian yang harus dibuat dalam bentuk tertentu, yakni dengan akta otentik ataupun akta di bawah tangan. Akta otentik yang dimaksud adalah akta yang dibuat oleh notaris atau pejabat hukum lain yang memiliki kewenangan untuk membuat akta otentik menurut undang-undang. Beberapa contoh perjanjian di bidang Hukum Kekayaan yang harus dilakukan dengan Akta Notaris sebagai berikut. 6

Hibah, kecuali pemberian benda bergerak yang bertubuh atau surat penagihan utang atas tunjuk dari tangan ke tangan: Pasal 1682 dan 1687 KUH Perdata.

Pendirian perseroan terbatas: Pasal 7 butir 1 UU No 40 tahun 2007 tentang Perseroan Terbatas.

4

Subekti, Hukum Perjanjian, Intermasa, Cetakan V, 1978, hlm. 19.

5

Herlien Budiono, Ajaran Umum Hukum Perjanjian dan Penerapannya di Bidang Kenotariatan, Citra Aditya Bakti, 2009, hlm. 47–48; Subekti, ibid., hlm. 15.

6

Herlien Budiono, ibid., hlm. 47–48; Subekti, Catatan No. 4, hlm. 15. Cessie (Pasal 613 KUH Perdata) dan dading (Pasal 1851 KUH Perdata) dapat dibuat dengan akta otentik ataupun di bawah tangan sebab KUH Perdata hanya mensyaratkan pembuatan dalam bentuk tertulis.

6

Dokumen Penjelas

buku-5.indd

6

12/13/2010

11:00:02 PM

Jaminan fidusia: Pasal 5 butir 1 UU No. 42 tahun 1999 tentang Jaminan Fidusia.

Perjanjian penyelesaian sengketa melalui arbitrase setelah sengketa terjadi:

Pasal 9 UU No. 30 tahun 1999 tentang Arbitrase dan Alternatif Penyelesaian Sengketa.

Surat Kuasa Membebankan Hak Tanggungan (SKMHT): Pasal 15 ayat (1) UU No. 4 tahun 1996 tentang Hak Tanggungan atas Tanah Beserta Benda-Benda yang Berkaitan denganTanah. SKMHT dapat pula dibuat dengan Akta Pejabat Pembuat Akta Tanah (PPAT) menurut Pasal 15 ayat (1) UU tersebut.

Pengaturan oleh undang-undang tentang formalitas tertentu yang harus dipenuhi untuk perjanjian formil di atas, memang merupakan pengecualian dari asas konsensualisme dalam hukum perjanjian yang berlaku secara umum. 7 Sebab, menurut asas konsensualisme, suatu perjanjian sudah terbentuk dengan adanya kesepakatan dari para pihak yang membuatnya. Kemudian, agar perjanjian itu sah adanya maka harus memenuhi syarat-syarat dalam Pasal 1320 KUH Perdata. Namun, asas tersebut tidak cukup untuk perjanjian formil karena masih ada formalitas lain yang diatur dalam undang-undang yang harus dipatuhi. Jadi, perjanjian formil memang tidak cukup bila hanya berdasarkan pada asas konsensualisme. Apabila perbuatan hukum yang wajib dilakukan dalam bentuk formal tertentu yang diwajibkan oleh UU tidak dipatuhi, akan berakibat bahwa perbuatan hukum tersebut batal demi hukum. 8 Hal ini ditegaskan, antara lain, dalam:

1)

Pasal 617 ayat (1) KUH Perdata yang berbunyi “Tiap-tiap akta dengan

2)

mana kebendaan tak bergerak dijual, dihibahkan, dibagi, dibebani, atau dipindahtangankan, harus dibuat dalam bentuk otentik, atas ancaman kebatalan”. Pasal 1682 KUH Perdata yang berbunyi “Tiada statu hibah, kecuali yang

3)

disebutkan dalam Pasal 1687, dapat, atas ancaman batal, dilakukan selainnya dengan status akta notaris yang aslinya disimpan oleh notaris itu”. Pasal 22 KUHDagang yang menyebut “Tiap firma harus didirikan dengan akta otentik, tetapi ketiadaan akta tidak dapat dikemukakan untuk merugikan pihak ketiga”.

7 Subekti, Ibid.

8 Subekti, ibid.; Herlien Budiono, Ibid.

buku-5.indd

7

Penjelasan Hukum tentang Kebatalan Perjanjian 7

12/13/2010

11:00:02 PM

4) Pasal 15 ayat (6) UU No. 4 Tahun 1996 tentang Hak Tanggungan atas Tanah Beserta Benda-Benda yang Berkaitan dengan Tanah, menyebutkan bahwa “(6) Surat Kuasa Membebankan Hak Tanggungan yang tidak diikuti dengan pembuatan Akta Pemberian Hak Tanggungan dalam waktu yang ditentukan sebagaimana yang dimaksud pada ayat (3) atau ayat (4), atau waktu yang ditentukan menurut ketentuan sebagaimana yang dimaksud pada ayat (5) batal demi hukum”.

5) Pasal 9 UU No. 30 Tahun 1999 tentang Arbitrase dan Alternatif Penyelesaian Sengketa: “(1) Dalam hal para pihak memilih penyelesaian sengketa melalui arbitrase setelah sengketa terjadi, persetujuan mengenai hal tersebut harus dibuat dalam suatu perjanjian tertulis yang ditandatangani oleh para pihak. (2) Dalam hal para pihak tidak dapat menandatangani perjanjian tertulis sebagaimana dimaksud dalam ayat (1), perjanjian tertulis tersebut harus dibuat dalam bentuk akta notaris. (3) Perjanjian tertulis sebagaimana dimaksud dalam ayat (1) harus memuat: (a) masalah yang dipersengketakan; (b) nama lengkap dan tempat tinggal para pihak; (c) nama lengkap dan tempat tinggal arbiter atau majelis arbitrase; (d) tempat arbiter atau majelis arbitrase akan mengambil keputusan; (e) nama lengkap sekretaris; (f) jangka waktu penyelesaian sengketa; (g) pernyataan kesediaan dari arbiter; (h) pernyataan kesediaan dari pihak yang bersengketa untuk menanggung segala biaya yang diperlukan untuk penyelesaian sengketa melalui arbitrase. (4) Perjanjian tertulis yang tidak memuat hal sebagaimana dimaksud dalam ayat (3) batal demi hukum.

b. Batal Demi Hukum Karena Syarat Objektif Sahnya Perjanjian Tidak Terpenuhi Menurut Pasal 1320 KUH Perdata, untuk sahnya suatu perjanjian harus ada suatu hal tertentu dan suatu sebab yang halal. Keduanya sering disebut sebagai syarat objektif untuk sahnya perjanjian. Syarat objektif pertama, yaitu suatu hal tertentu diartikan oleh Mariam Darus Badrulzaman 9 dan Herlien Boediono 10 sebagai objek atau pokok perjanjian, atau apa yang menjadi hak dari kreditor dan kewajiban bagi debitor menurut Subekti. 11 Objek perjanjian berupa barang, sebagaimana disebut dalam Pasal 1332, 1333, dan 1334 ayat (1). 12

9 Mariam Darus Badrulzaman, “Perikatan pada Umumnya”, dalam buku berjudul Kompilasi Hukum Per- ikatan, Citra Aditya Bakti, 2001, hlm. 79–80.

10 Herlien Budiono, Catatan No. 5 di atas, hlm. 106–110.

11 Subekti, Catatan No. 4 di atas, hlm. 18.

12 Istilah barang dalam ketiga pasal tersebut harus ditafsirkan secara ekstensif sehingga mencakup penger- tian objek perjanjian yang prestasinya adalah untuk melakukan sesuatu, dengan demikian dapat men- cakup pengertian jasa juga. Hal ini penting karena dalam transaksi bisnis modern, objek perjanjian tidak hanya terbatas pada barang, tetapi juga berupa jasa.

8 Dokumen Penjelas

buku-5.indd

8

12/13/2010

11:00:02 PM

Pasal 1332: “Hanya barang-barang yang dapat diperdagangkan saja dapat menjadi pokok persetujuan”. Pasal 1333 “Suatu persetujuan harus mempunyai pokok suatu barang yang paling sedikit ditentukan jenisnya. Tidaklah menjadi halangan bahwa jumlah barang tidak tentu, asal saja jumlah itu kemudian dapat ditentukan atau dihitung”. Pasal 1334 ayat (1) “Barang yang baru akan ada di kemudian hari dapat menjadi pokok suatu persetujuan”.

Berdasarkan Pasal 1332 dan 1333 KUH Perdata, jelaslah bahwa untuk sahnya perjanjian maka objeknya haruslah tertentu, atau setidaknya cukup dapat ditentukan. Objek perjanjian tersebut dengan demikian haruslah: 13

1)

dapat diperdagangkan;

2)

dapat ditentukan jenisnya;

3)

dapat dinilai dengan uang, dan

4)

memungkinkan untuk dilakukan/dilaksanakan.

Selain itu, objek perjanjian dapat juga berupa barang yang baru akan ada, sebagaimana disebut dalam Pasal 1334 ayat (1). 14 Maksudnya adalah ketika perjanjian dibuat barang yang diperjanjikan itu belum ada sebab mungkin belum dibuat atau sedang dalam proses pembuatan, dan bukan berarti bahwa barang tersebut tidak ada. Perjanjian yang objeknya tidak jelas karena tidak dapat ditentukan jenisnya, atau tidak dapat diperdagangkan, atau tidak dapat dinilai dengan uang, atau yang tidak mungkin dapat dilakukan, menjadi batal demi hukum. Tanpa objek yang jelas, perjanjian akan sulit atau bahkan mustahil dilakukan oleh para pihak. Perjanjian yang tidak jelas objeknya bukanlah perjanjian yang sah sehingga ipso jure batal demi hukum. Syarat objektif kedua untuk sahnya perjanjian adalah suatu sebab atau kausa yang halal. Tidak ada penjelasan dalam KUH Perdata tentang makna‘sebab yang

13 Herlien Budiono, Catatan No. 5 di atas, hlm. 107.

14 Namun, pasal ini juga menyebutkan “Tetapi tidaklah diperkenankan untuk melepaskan suatu warisan yang belum terbuka, ataupun untuk meminta diperjanjikan sesuatu hal mengenai warisan itu, sekalipun dengan sepakatnya orang yang nantinya akan meninggalkan warisan yang menjadi pokok persetujuan itu; dengan tidak mengurangi ketentuan-ketentuan Pasal 169, 176, dan 178 yang dilarang oleh un- dang-undang untuk dijadikan pokok perjanjian adalah benda-benda yang berada di luar perdagangan dan warisan yang belum terbuka”. Artinya, perjanjian dengan objek warisan yang belum jatuh terbuka adalah batal demi hukum.

buku-5.indd

9

Penjelasan Hukum tentang Kebatalan Perjanjian 9

12/13/2010

11:00:02 PM

halal’ itu, tetapi para ahli hukum sepakat memaknainya sebagai isi atau dasar perjanjian, 15 bukan sebagai penyebab ataupun motif dibuatnya perjanjian. 16 Perjanjian yang dibuat tanpa adanya sebab yang halal maka perjanjian tersebut tidak sah, tidak berkekuatan hukum. Hal ini ditegaskan dalam Pasal 1335 KUH Perdata yang berbunyi “Suatu perjanjian tanpa sebab atau yang telah dibuat karena sesuatu sebab yang palsu atau terlarang, tidak mempunyai kekuatan”. 17 Kausa suatu perjanjian dinyatakan bukan merupakan sebab yang halal sehingga terlarang, apabila kausa tersebut menurut Pasal 1337 KUH Perdata merupakan kausa yang “dilarang oleh undang-undang atau apabila berlawanan dengan kesusilaan, baik atau ketertiban umum”. Perjanjian seperti ini tidak boleh atau tidak dapat dilaksanakan sebab melanggar hukum atau kesusilaan atau ketertiban umum. Kondisi semacam itu menurut Subekti, sudah sangat jelas dapat diketahui seketika oleh hakim dan juga oleh umum sehingga untuk alasan ketertiban dan keamanan umum maka perjanjian semacam itu dengan sendirinya batal demi hukum. 18

Untuk mengetahui ketentuan manakah dalam peraturan perundang- undangan yang bersifat memaksa sehingga tidak boleh disimpangi para pihak, perlu diperhatikan apakah rumusan ketentuan itu menyebut secara eksplisit akibat hukum bila apa yang diatur dalam perundang-undangan itu dilanggar. Terdapat beberapa UU yang secara jelas dan eksplisit menyatakan bahwa menjadikan apa yang terlarang menurut UU sebagai kausa perjanjian, berakibat perjanjian itu batal demi hukum. Berikut ini beberapa di antaranya:

1)

UU No. 5 tahun 1960 tentang Peraturan Dasar Pokok-Pokok Agraria Pasal 26 ayat (2) yang menyatakan bahwa “Setiap jual-beli, penukaran, penghibahan, pemberian dengan wasiat dan perbuatan-perbuatan lain

15 Subekti, Catatan No. 4 di atas, hlm. 18 dan Herlien Budiono, Catatan No. 5 di atas, hlm. 113.

16 Subekti, ibid.; Mariam Darus Badrulzaman, Catatan No. 9 di atas, hlm. 81.

17 Pasal 1335 seperti dipatahkan oleh Pasal 1336 KUH Perdata yang menyatakan bahwa “Jika tak dinya- takan sesuatu sebab, tetapi ada suatu sebab yang halal, atau jika ada sebab lain yang tidak dilarang selain dari yang dinyatakan itu, persetujuan itu adalah sah”. Namun, menurut Herlien Boediono, Pasal 1336 dimaksudkan untuk perjanjian yang kausanya tidak dinyatakan secara eksplisit oleh para pihak atau kausanya berbeda dari apa yang dinyatakan, namun tetap merupakan sebab yang halal se- hingga perjanjian seperti itu tetap sah. Tampaknya, latar belakang rumusan pasal ini berkaitan dengan pengakuan utang. Dalam perjanjian pengakuan utang asal mula timbulnya utang tidak disebut secara

eksplisit, atau dikenal sebagai utang tanpa kausa. Lihat, Herlien Budiono, Catatan No. 5 di atas, hlm.

112.

18 Subekti, Catatan No. 4, hlm. 19.

10 Dokumen Penjelas

buku-5.indd

10

12/13/2010

11:00:02 PM

2)

yang dimaksudkan untuk langsung atau tidak langsung memindahkan hak milik kepada orang asing, kepada seorang warga negara yang di samping kewarganegaraan Indonesianya mempunyai kewarganegaraan asing atau kepada suatu badan hukum kecuali yang ditetapkan oleh Pemerintah termaksud dalam Pasal 21 ayat (2), adalah batal karena hukum dan tanahnya jatuh kepada Negara, dengan ketentuan, bahwa hak-hak pihak lain yang membebaninya tetap berlangsung serta semua pembayaran yang telah diterima oleh pemilik tidak dapat dituntut kembali”.

UU No. 13 tahun 2003 tentang Ketenagakerjaan Pasal 124: “(3) Dalam hal isi perjanjian kerja bersama bertentangan dengan peraturan perundang-undangan yang berlaku sebagaimana dimaksud dalam ayat (2), maka ketentuan yang bertentangan tersebut batal demi hukum dan yang berlaku adalah ketentuan dalam peraturan perundang- undangan”.

Pasal 127: “(1) Perjanjian kerja yang dibuat oleh pengusaha dan pekerja/ buruh tidak boleh bertentangan dengan perjanjian kerja bersama. (2) Dalam hal ketentuan dalam perjanjian kerja sebagaimana dimaksud dalam ayat (1) bertentangan dengan perjanjian kerja bersama, maka ketentuan dalam perjanjian kerja tersebut batal demi hukum dan yang berlaku adalah ketentuan dalam perjanjian kerja bersama”.

3) UU No. 4 tahun 1996 tentang Hak Tanggungan atas Tanah Beserta Benda- Benda yang Berkaitan dengan Tanah Pasal 12: “Janji yang memberikan kewenangan kepada pemegang Hak Tanggungan untuk memiliki objek Hak Tanggungan apabila debitor cidera janji, batal demi hukum”.

Pasal 20: “(4) Setiap janji untuk melaksanakan eksekusi Hak Tanggungan dengan cara yang bertentangan dengan ketentuan pada ayat (1), ayat (2), dan ayat (3) batal demi hukum”.

4)

UU No. 42 tahun 1999 tentang Jaminan Fidusia Pasal 32: “Setiap janji untuk melaksanakan eksekusi terhadap Benda yang menjadi objek Jaminan Fidusia dengan cara yang bertentangan dengan ketentuan sebagaimana dimaksud dalam Pasal 29 dan Pasal 31, batal demi hukum”.

Pasal 33: “Setiap janji yang memberikan kewenangan kepada Penerima Fidusia untuk memiliki Benda yang menjadi objek Jaminan Fidusia apabila debitor cidera janji, batal demi hukum”.

5)

UU No. 8 tahun 1999 tentang Perlindungan Konsumen Pasal 18: “(3) Setiap klausula baku yang telah ditetapkan oleh pelaku usaha pada dokumen atau perjanjian yang memenuhi ketentuan sebagaimana dimaksud pada ayat (1) dan ayat (2) dinyatakan batal demi hukum” .

buku-5.indd

11

Penjelasan Hukum tentang Kebatalan Perjanjian 11

12/13/2010

11:00:03 PM

6)

UU No. 25 tahun 2007 tentang Penanaman Modal

7)

Pasal 33: ”(1) Penanam modal dalam negeri dan penanam modal asing yang melakukan penanaman modal dalam bentuk perseoran terbatas dilarang membuat perjanjian dan/atau pernyataan yang menegaskan bahwa kepemilikan saham dalam perseroan terbatas untuk dan atas nama orang lain. (2) Dalam hal penanam modal dalam negeri dan penanam modal asing membuat perjanjian dan/atau pernyataan sebagaimana dimaksud pada ayat (1), perjanjian dan/atau pernyataan itu dinyatakan batal demi hukum”. UU No. 40 tahun 2007 tentang Perseroan Terbatas

8)

Pasal 37: ”(2) Pembelian kembali saham, baik secara langsung maupun tidak langsung, yang bertentangan dengan ayat (1) batal karena hukum. (3) Direksi secara tanggung renteng bertanggung jawab atas kerugian yang diderita pemegang saham yang beritikad baik, yang timbul akibat pembelian kembali yang batal karena hukum sebagaimana dimaksud pada ayat (2)” . UU No. 25 tahun 2009 tentang Pelayanan Publik

9)

Pasal 27: ”(1) Saham penyelenggara yang berbentuk badan usaha milik negara dan badan usaha milik daerah yang berkaitan dengan pelayanan publik dilarang dipindahtangankan dalam keadaan apa pun, baik langsung maupun tidak langsung melalui penjualan, penjaminan atau hal-hal yang mengakibatkan beralihnya kekuasaan menjalankan korporasi atau hilangnya hak-hak yang menjadi milik korporasi sebagaimana diatur dalam peraturan perundang-undangan. (2) Perbuatan sebagaimana dimaksud pada ayat (1) dinyatakan batal demi hukum”. UU No. 14 tahun 2001 tentang Paten Pasal 66: “(1) Paten dapat beralih atau dialihkan baik seluruhnya maupun sebagian karena: a. pewarisan, b. hibah, c. wasiat, d. perjanjian tertulis, atau e. sebab lain yang dibenarkan oleh peraturan perundang-undangan. (2) Pengalihan Paten sebagaimana dimaksud pada ayat (1) huruf a, huruf b, dan huruf c, harus disertai dokumen asli Paten berikut hak lain yang berkaitan dengan Paten itu. (3) Segala bentuk pengalihan Paten sebagimana dimaksud pada ayat (1) wajib dicatat dan diumumkan dengan dikenai biaya. (4) Pengalihan Paten yang tidak sesuai dengan ketentuan Pasal ini tidak sah dan batal demi hukum”.

c. Batal Demi Hukum Karena Dibuat oleh Orang yang Tidak Berwenang Melakukan Perbuatan Hukum Ketidakcakapan seseorang untuk melakukan tindakan hukum (handelingson- bekwaamheid) harus dibedakan dengan ketidakwenangan seseorang untuk melakukan tindakan hukum (handelingsonbevoegdheid). Mereka yang tidak

12 Dokumen Penjelas

buku-5.indd

12

12/13/2010

11:00:03 PM

berwenang melakukan tindakan hukum adalah orang-orang yang oleh undang- undang dilarang melakukan tindakan hukum tertentu. 19 Jadi, seseorang yang oleh undang-undang dikualifikasi sebagai tidak berwenang melakukan tindakan hukum tertentu, tidak berarti bahwa ia juga tidak cakap. Dengan kata lain, orang yang menurut undang-undang adalah cakap atau mampu melakukan tindakan hukum ternyata dapat tergolong sebagai tidak berwenang melakukan tindakan hukum tertentu menurut undang-undang. Perjanjian yang dilakukan oleh orang atau pihak yang menurut undang- undang dinyatakan tidak berwenang, berakibat batal demi hukum. Artinya, ketentuan dalam undang-undang tertentu yang menyatakan bahwa orang atau pihak tertentu tidak berwenang, merupakan aturan hukum yang bersifat memaksa sehingga tidak dapat disimpangi. Orang atau pihak tersebut adalah mereka yang karena jabatan atau pekerjaannya, berdasarkan undang-undang tertentu, dikategorikan tidak berwenang melakukan perbuatan hukum tertentu. Dapat pula terjadi seseorang dinyatakan tidak wenang melakukan perbuatan hukum tertentu karena menurut undang-undang, orang tersebut tidak memenuhi kualifikasi atau persyaratan tertentu. Contoh: UU No. 23 tahun 1999 tentang Bank Indonesia, Pasal 55 yang berbunyi: “(4) Bank Indonesia dilarang membeli untuk diri sendiri surat-surat utang negara sebagaimana dimaksud pada ayat (1), kecuali di pasar sekunder. (5) Perbuatan hukum Bank Indonesia membeli surat utang negara untuk diri sendiri tidak di pasar sekunder sebagaimana dimaksud pada ayat (4), dinyatakan batal demi hukum”. Pasal 56:

“(1) Bank Indonesia dilarang memberikan kredit kepada Pemerintah. (2) Dalam hal Bank Indonesia melanggar ketentuan sebagaimana dimaksud pada ayat (1), perjanjian pemberian kredit kepada Pemerintah tersebut batal demi hukum”.

d. Batal Demi Hukum Karena Ada Syarat Batal yang Terpenuhi Syarat batal dalam sebuah perjanjian adalah suatu peristiwa atau fakta tertentu yang belum tentu akan terjadi di masa depan, namun para pihak dalam perjanjian itu sepakat bahwa bila peristiwa atau fakta tersebut benar terjadi maka perjanjian tersebut menjadi batal. Syarat batal ini merupakan kebalikan dari syarat tangguh, yang apabila peristiwa atau fakta yang belum tentu terjadi di masa depan itu benar terjadi adanya maka justru membuat lahirnya per-

19 Lihat, Pasal 907, 1467, 1468, 1469, 1470, 1471 KUH Perdata. Herlien Budiono, Catatan No. 5 di atas, hlm. 105.

buku-5.indd

13

Penjelasan Hukum tentang Kebatalan Perjanjian 13

12/13/2010

11:00:03 PM

janjian yang bersangkutan. Ketentuan tentang kedua syarat ini diatur dalam Pasal 1253 KUH Perdata yang menyebut bahwa “Suatu perikatan adalah bersyarat jika digantungkan pada suatu peristiwa yang mungkin terjadi dan memang belum terjadi, baik dengan cara menangguhkan berlakunya perikatan itu sampai terjadinya peristiwa itu, maupun dengan cara membatalkan perikatan itu, tergantung pada terjadi tidaknya peristiwa itu”. Perjanjian bersyarat yang pelaksanaannya semata-mata digantungkan pada kemauan orang yang membuat perjanjian itu menurut Pasal 1256 KUH Perdata adalah batal demi hukum. Pasal 1256 KUH Perdata menegaskan bahwa “Semua perikatan adalah batal, jika pelaksanaannya semata-mata tergantung pada kemauan orang yang terikat. Tetapi jika perikatan tergantung pada suatu perbuatan yang pelaksanaannya berada dalam kekuasaan orang tersebut, dan perbuatan itu telah terjadi, maka perikatan itu adalah sah”. Alasan dari ketentuan ini masuk akal mengingat bahwa mengharapkan terjadinya suatu perjanjian semata-mata hanya pada kehendak atau kemauan seseorang merupakan hal aneh kalau tak dapat disebut sia-sia, sebab perjanjian seperti itu tidak akan terjadi bila orang itu tidak menghendakinya. Demikian pula bila perjanjian memuat syarat yang bertujuan melakukan sesuatuyangtakmungkinterlaksana,atauyangbertentangandengankesusilaan yang baik, atau bahkan yang dilarang oleh undang-undang, adalah batal demi hukum. Hal ini ditegaskan dalam Pasal 1254 KUH Perdata yang berbunyi “Semua syarat yang bertujuan melakukan sesuatu yang tak mungkin terlaksana, sesuatu yang bertentangan dengan kesusilaan yang baik, atau sesuatu yang dilarang oleh UU adalah batal dan mengakibatkan persetujuan yang digantungkan padanya tak berlaku.” Aturan ini mirip dengan syarat objektif untuk sahnya perjanjian, yaitu syarat kausa yang halal. Perjanjian dengan syarat batal yang menjadi batal demi hukum karena syarat batal tersebut terpenuhi, menimbulkan akibat kembalinya keadaan pada kondisi semula pada saat timbulnya perikatan itu atau dengan kata lain, perjanjian yang batal demi hukum seperti itu berlaku surut hingga ke titik awal perjanjian itu dibuat. Akibat selanjutnya adalah pihak yang telah menerima prestasi atau sesuatu dari pihak lain maka ia harus mengembalikannya. Pasal 1265 KUH Perdata mengatur hal ini dengan menyebut bahwa“Suatu syarat batal adalah syarat yang bila dipenuhi akan menghapuskan perikatan dan membawa segala sesuatu kembali pada keadaan semula, seolah-olah tidak pernah ada suatu perikatan. Syarat ini tidak menunda pemenuhan perikatan; ia hanya mewajibkan kreditur mengembalikan apa yang telah diterimanya, bila peristiwa yang dimaksudkan terjadi”.

14 Dokumen Penjelas

buku-5.indd

14

12/13/2010

11:00:03 PM

3. Perjanjian Dapat Dibatalkan (Voidable atau Vernietigbaar)

Secara teoretik, terdapat perbedaan antara perjanjian yang batal demi hukum dengan perjanjian yang dapat dibatalkan. Hal yang disebut terakhir ini terjadi apabila perjanjian tersebut tidak memenuhi unsur subjektif untuk sahnya perjanjian sebagaimana diatur dalam Pasal 1320 KUH Perdata, yaitu kesepakatan para pihak dan kecakapan para pihak untuk melakukan perbuatan hukum. Berikut ini restatement tentang hal tersebut.

a. Dapat Dibatalkan Karena Ada Cacat pada Kehendak Pihak yang Membuatnya Unsur subjektif pertama untuk sahnya perjanjian adalah kesepakatan antarpihak yang membuatnya. KUH Perdata tidak menjelaskan tentang apa yang diartikan dengan sepakat, tetapi sebaliknya justru mengatur tentang kondisi yang menyebabkan tidak adanya kata sepakat dari para pihak yang membuatnya. Dengan kata lain, KUH Perdata menyebutkan beberapa jenis keadaan atau kondisi tertentu yang menjadikan perjanjian menjadi cacat sehingga terancam kebatalan. Pasal-pasal tersebut adalah 1321, 1322, 1323, 1324, 1325, 1328 sebagai berikut.

Pasal 1321: “Tiada suatu persetujuan pun mempunyai kekuatan jika diberikan karena kekhilafan atau diperoleh dengan paksaan atau penipuan”.

Pasal 1322: “Kekhilafan tidak mengakibatkan batalnya suatu persetujuan, kecuali jika kekhilafan itu terjadi mengenai hakikat barang yang menjadi pokok persetujuan. Kekhilafan tidak mengakibatkan kebatalan, jika kekhilafan itu hanya terjadi mengenai diri orang yang dengannya seseorang bermaksud untuk mengadakan persetujuan, kecuali jika persetujuan itu diberikan terutama karena diri orang yang bersangkutan”.

Pasal 1324: “Paksaan telah terjadi apabila perbuatan itu sedemikian rupa hingga dapat menakutkan seorang yang berpikiran sehat, dan apabila perbuatan itu dapat menimbulkan ketakutan pada orang tersebut bahwa dirinya atau kekayaannya terancam dengan suatu kerugian yang terang dan nyata. Dalam mempertimbangkan hal itu, harus diperhatikan usia, kelamin dan kedudukan orang-orang yang bersangkutan”.

Pasal 1323: “Paksaan yang dilakukan terhadap orang yang mengadakan suatu persetujuan mengakibatkan batalnya persetujuan yang bersangkutan, juga bila paksaan itu dilakukan oleh pihak ketiga yang tidak berkepentingan dalam persetujuan yang dibuat itu”.

Pasal 1325: “Paksaan menjadikan suatu persetujuan batal, bukan hanya bila dilakukan terhadap salah satu pihak yang membuat persetujuan, melainkan

buku-5.indd

15

Penjelasan Hukum tentang Kebatalan Perjanjian 15

12/13/2010

11:00:03 PM

juga bila dilakukan terhadap suami atau istri atau keluarganya dalam garis ke atas maupun ke bawah”. Pasal 1328: “Penipuan merupakan suatu alasan untuk membatalkan suatu persetujuan bila penipuan yang dipakai oleh salah satu pihak adalah sedemikian rupa sehingga nyata bahwa pihak yang lain tidak akan mengadakan perjanjian itu tanpa adanya tipu muslihat. Penipuan tidak dapat hanya dikira-kira melainkan harus dibuktikan”.

Subekti menjelaskan bahwa kekhilafan terjadi bila salah satu pihak khilaf tentang hal-hal yang pokok dari apa yang diperjanjikan atau tentang sifat-sifat yang penting dari barang yang menjadi objek perjanjian, ataupun mengenai orang dengan siapa diadakan perjanjian itu. 20 Mariam Darus Badrulzaman menguraikan bahwa kekhilafan dapat terjadi mengenai orang yang dinamakan errorinpersona, dan kekhilafan atau kesesatan mengenai hakikat barangnya yang disebut error in substantia. 21 Lebih lanjut, menurut Herlien Budiono, kekhilafan atau kekeliruan atau kesesatan itu dapat bersifat sebenarnya dan dapat pula bersifat semu. 22 Kekeliruan yang sebenarnya terjadi dalam hal antara kehendak dan pernyataan para pihak saling berkesesuaian, namun kehendak salah satu pihak atau kedua pihak terbentuk secara cacat. Artinya, perjanjian memang telah terbentuk namun terjadinya perjanjian itu berada di bawah pengaruh kekeliruan atau kesesatan sehingga bila kekeliruan itu diketahui sebelumnya maka tidak akan terbentuk perjanjian. 23 Subekti juga menyebutkan bahwa “kekeliruan itu harus sedemikian rupa sehingga seandainya orang itu tidak khilaf mengenai hal-hal tersebut, ia tidak akan memberikan persetujuannya.” 24 Dalam kekeliruan yang bersifat semu, menurut Herlien Budiono, sebenarnya tidak terbentuk perjanjian sebab pada situasi seperti itu belum terbentuk kata sepakat di antara para pihak sehingga belum memenuhi unsur subjektif pertama untuk sahnya perjanjian. 25 Tentang paksaan dalam KUH Perdata adalah paksaan secara kejiwaan atau rohani, atau suatu situasi dan kondisi di mana seseorang secara melawan hukum mengancam orang lain dengan ancaman yang terlarang menurut

20 Subekti, Catatan No. 4 di atas, hlm. 22.

21 Mariam Darus Badrulzaman, Catatan No. 9 di atas, hlm. 75.

22 Herlien Budiono, Catatan No. 5 di atas, hlm. 98.

23 Ibid.

24 Subekti, Catatan No. 4 di atas, hlm. 22–23.

25 Herlien Budiono, Catatan No. 5 di atas, hlm. 98.

16 Dokumen Penjelas

buku-5.indd

16

12/13/2010

11:00:03 PM

hukum sehingga orang yang berada di bawah ancaman itu berada di bawah ketakutan dan akhirnya memberikan persetujuannya dengan tidak secara bebas. 26 Ancaman itu menimbulkan ketakutan sedemikian rupa sehingga meskipun kehendak orang yang diancam itu betul telah dinyatakan, kehendak tersebut menjadi cacat hukum karena terjadi akibat adanya ancaman. Tanpa adanya ancaman, kehendak itu tidak akan pernah terwujud. Paksaan juga dapat dilakukan oleh pihak ketiga yang sebenarnya tidak berkepentingan dalam perjanjian tersebut, hal ini terlihat dari Pasal 1323 KUH Perdata. 27 Apa yang diancamkan berupa kerugian pada orang atau kebendaan milik orang tersebut atau kerugian terhadap pihak ketiga atau kebendaan milik pihak ketiga. 28 Hal ini tampak dari ketentuan dalam Pasal 1325. Namun demikian, perlu diperhatikan bahwa pembuat undang-undang membedakan antara paksaan yang membuat perjanjian mengandung unsur cacat kehendak dari pihak yang membuatnya sehingga terancam pembatalan, dengan rasa takut karena hormat kepada anggota keluarga dalam garis lurus ke atas. Hal ini tampak dari bunyi Pasal 1326, yaitu bahwa “Rasa takut karena hormat terhadap ayah, ibu atau keluarga lain dalam garis lurus ke atas, tanpa disertai kekerasan, tidak cukup untuk membatalkan persetujuan”. Alat atau sarana yang dipakai untuk mengancam dapat berupa sarana yang tergolong legal ataupun illegal, misalnya senjata tajam atau pistol, sedangkan sarana yang legal, misalnya ancaman penyitaan harta benda ataupun ancaman kepailitan. 29 Penipuan terjadi bila satu pihak dengan sengaja memberikan keterangan palsu atau tidak benar disertai akal cerdik atau tipu muslihat untuk membujuk pihak lawan agar memberikan persetujuannya. Pihak yang menipu bertindak aktif untuk menjerumuskan pihak lawan. 30 Herlien Budiono juga menjelaskan bahwa penipuan terjadi tidak saja jika suatu fakta tertentu dengan sengaja disembunyikan atau tidak diungkap, tetapi juga bila suatu informasi yang keliru sengaja diberikan, atau bisa juga terjadi dengan tipu daya lainnya. 31 Dalam hal penipuan ini, jarang terjadi bahwa si pelaku hanya melakukan kebohongan suatu hal, melainkan ia melakukan suatu rangkaian kebohongan. Hal ini tampak dari

26 Subekti, Catatan No. 4 di atas, hlm. 22; Herlien Budiono, Catatan No. 5 di atas, hlm. 97–98.

27 Subekti, Ibid.

28 Herlien Budiono, Catatan No. 5 di atas, hlm. 97.

29 Ibid.

30 Subekti, Catatan No. 4 di atas, hlm. 22.

31 Herlien Budiono, Catatan No. 5 di atas, hlm. 99.

buku-5.indd

17

Penjelasan Hukum tentang Kebatalan Perjanjian 17

12/13/2010

11:00:03 PM

pilihan frasa dalam pasal di atas, yaitu ‘tipu muslihat’. Untuk menetapkan dan membuktikan adanya hubungan kausalitas antara penipuan dan dilakukannya perbuatan hukum berupa membuat persetujuan, harus dapat ditunjukkan bahwa tanpa adanya penipuan itu, persetujuan untuk membuat perjanjian tidak akan pernah dilakukan. Akibat hukum bagi perjanjian yang dibuat karena adanya cacat pada kehendak pihak yang membuatnya sehingga tidak ada kata sepakat, adalah dapat dibatalkan. Hal ini didasarkan pada ketentuan Pasal 1449 KUH Perdata yang menegaskan bahwa “Perikatan yang dibuat dengan paksaan, penyesatan atau penipuan, menimbulkan tuntutan untuk membatalkannya”. Kalimat terakhir pasal itu, yaitu ‘menimbulkan tuntutan untuk membatalkannya’ menunjukkan bahwa perjanjian yang cacat pada kehendak pihak-pihak yang membuatnya tidak otomatis batal demi hukum atau batal dengan sendirinya, tetapi menjadi batal apabila ada penuntutan untuk membatalkannya. Subekti mengatakan bahwa ketidakbebasan seseorang dalam memberikan persetujuan pada sebuah perjanjian, memberikan hak kepada pihak yang tidak bebas dalam menyatakan kesepakatannya itu untuk meminta pembatalan perjanjian. 32 Lebih lanjut, disebutkan bahwa “dengan sendirinya harus dimengerti bahwa pihak lawan dari orang tersebut tidak boleh minta pembatalan itu; hak meminta pembatalan hanya ada pada satu pihak, yaitu pihak yang oleh undang-undang diberi perlindungan tersebut”. 33

b. Dapat Dibatalkan Karena Dibuat oleh Orang yang Tidak Cakap Melakukan Tindakan Hukum Syarat subjektif kedua untuk sahnya perjanjian adalah kecakapan para pihak untuk membuat perjanjian. Pada prinsipnya, setiap orang sepanjang tidak ditentukan lain oleh undang-undang, dianggap cakap atau mampu melakukan tindakan hukum yang dalam konteks ini adalah membuat perjanjian sehingga menimbulkan perikatan. Hal ini ditegaskan dalam Pasal 1329 KUH Perdata yang berbunyi “Setiap orang adalah cakap untuk membuat perikatan-perikatan, terkecuali ia oleh undang-undang dinyatakan tidak cakap”. Orang yang oleh undang-undang dinyatakan tidak cakap, dilarang melakukan tindakan hukum

32 Subekti, Catatan No. 4 di atas, hlm. 23.

33 Ibid.

18 Dokumen Penjelas

buku-5.indd

18

12/13/2010

11:00:03 PM

termasuk membuat perjanjian. 34 Pasal 1330 KUH Perdata menyebut bahwa “Tidak cakap untuk membuat persetujuan-persetujuan adalah

a. orang-orang yang belum dewasa;

b. mereka yang ditaruh di bawah pengampuan”.

Mereka ini, kecuali melalui perwakilan, dinyatakan tidak dapat melakukan tindakanhukum.Orangyangdapatmewakilimerekamelakukantindakanhukum adalah orang tua atau wali yang sah menurut undang-undang, atau pengampu dalam hal orang yang tidak cakap itu berada di bawah pengampuan. 35 Akibat hukum bagi perikatan yang ditimbulkan dari perjanjian yang dibuat oleh mereka yang tidak cakap hukum, diatur dalam Pasal 1446 yang menyatakan bahwa “(1) Semua perikatan yang dibuat oleh anak-anak yang belum dewasa atau orang-orang yang berada di bawah pengampuan adalah batal demi hukum, dan atas tuntutan yang diajukan oleh atau dari pihak mereka, harus dinyatakan batal, semata-mata atas dasar kebelumdewasaan atau pengampuannya; (2) Perikatan yang dibuat oleh perempuan yang bersuami dan oleh anak-anak yang belum dewasa yang telah disamakan dengan orang dewasa, tidak batal demi hukum, sejauh perikatan tersebut tidak melampaui batas kekuasaan mereka”. Walaupun Pasal 1446 ayat (1) menyebutkan bahwa perikatan tersebut batal demi hukum, para ahli hukum berpendapat bahwa frasa ‘batal demi hukum’ itu tidak tepat. Mereka berpendapat akibat hukum dari perjanjian seperti itu yang benar adalah ‘dapat dibatalkan’. Hal ini ditegaskan oleh Subekti, Mariam Darus Badrulzaman, dan Herlien Budiono. Menurut Subekti, “Perjanjian yang tidak memenuhi syarat subjektif, tidak begitu saja dapat diketahui oleh Hakim jadi harus dimajukan oleh pihak yang berkepentingan, dan bila dimajukan kepada Hakim mungkin sekali disangkal oleh pihak lawan sehingga memerlukan pembuktian. Oleh karena itu maka dalam halnya ada kekurangan mengenai syarat subjektif, oleh undang-undang diserahkan kepada pihak yang berkepentingan, apakah ia menghendaki pembatalan perjanjiannya atau tidak.

34 Istilah undang-undang di sini dipakai karena Pasal 1329 KUH Perdata menyebutnya demikian. Namun, sebaiknya perlu diingat bahwa undang-undang lebih sempit maknanya daripada perundang-undangan sebab yang terakhir ini mencakup peraturan hukum yang tidak hanya berupa undang-undang.

35 Perwalian untuk anak di bawah umur atau belum dewasa dapat dibedakan menjadi perwalian menurut undang-undang (Pasal 50 ayat 1 UU No. 1 tahun 1974 tentang Perkawinan juncto Pasal 345 KUH Per- data), perwalian orang tua atas anak yang diakui, perwalian berdasarkan penetapan hakim (Pasal 331a KUH Perdata), perwalian menurut wasiat (Pasal 51 ayat 1 UU No. 1 tahun 1974 tentang Perkawinan juncto Pasal 355–357 KUH Perdata). Sumber: Herlien Budiono, Catatan No. 5 di atas, hlm. 103–104.

buku-5.indd

19

Penjelasan Hukum tentang Kebatalan Perjanjian 19

12/13/2010

11:00:03 PM

Jadi, perjanjian yang demikian itu bukannya batal demi hukum, tetapi dapat dimintakan pembatalan.” 36 Mariam Darus Badrulzaman juga menegaskan bahwa “karena alasan-alasan yang dapat menimbulkan kebatalan suatu perikatan ialah kalau perikatan tersebut cacat pada syarat-syarat objektif saja. Oleh karena itu, kata-kata batal demi hukum pada Pasal 1446 KUH Perdata itu harus dibaca dengan dapat dibatalkan”. 37 Dengan kata lain, sebenarnya yang dimaksud dengan batal demi hukum dalam Pasal 1446 ayat (1) KUH Perdata adalah dapat dibatalkan. Herlien Budiono juga memberi penegasan sekaligus menambah penjelasan dengan menyebut bahwa“Perjanjian yang dibuat oleh pihak yang tidak wenang galibnya batal demi hukum (nietig), sedangkan perjanjian yang dilakukan oleh mereka

yang tidak cakap tidak ipso jure batal, tetapi dapat dibatalkan (vernietigbaar)”. 38 Artinya, harus dibedakan antara orang yang tidak wenang melakukan tindakan hukum dengan orang yang tidak cakap melakukan tindakan hukum. 39 Perjanjian yang dilakukan oleh orang yang masuk kategori pertama, berakibat batal demi hukum. Sementara perjanjian yang dibuat oleh orang yang masuk kelompok kedua berakibat dapat dibatalkan. Tampaknya, pendapat para ahli hukum di atas paralel dan memang kuat apabila melihat ketentuan dalam Pasal 1331 KUH Perdata yang berbunyi “Oleh karena itu, orang-orang yang dalam pasal yang lalu dinyatakan tidak cakap untuk membuat persetujuan, boleh menuntut pembatalan perikatan yang telah mereka buat dalam hal kuasa itu tidak dikecualikan oleh UU. Orang-orang yang cakap untuk mengikatkan diri, sama sekali tidak dapat mengemukakan sangkalan atas dasar ketidakcakapan anak-anak yang belum dewasa, orang-orang yang ditaruh di bawah pengampuan, dan perempuan-perempuan yang bersuami”. Pasal 1331 ini merujuk ke ‘pasal yang lalu’, yaitu Pasal 1330 yang menyebutkan bahwa “Belum dewasa adalah mereka yang belum mencapai umur genap 21 (dua puluh satu) tahun dan sebelumnya belum kawin”. Dengan demikian, kalimat ‘orang- orang yang dalam pasal yang lalu dinyatakan tidak cakap untuk membuat

bahwa

persetujuan, boleh menuntut pembatalan

orang yang belum dewasa (yang berarti tidak cakap hukum) yang membuat persetujuan, boleh menuntut pembatalan. Konsekuensinya, perjanjian seperti

perikatan

’,

bermakna

36 Subekti, Catatan No. 4 di atas, hlm. 22.

37 Mariam Darus Badrulzaman, Catatan No. 9 di atas, hlm. 147.

38 Herlien Budiono, Catatan No. 5 di atas, hlm. 106.

39 Tentang hal ini, lihat kembali penjelasan nomor 20–21 dari restatement ini.

20 Dokumen Penjelas

buku-5.indd

20

12/13/2010

11:00:03 PM

itu dapat dimintakan pembatalannya, dan bukannya secara otomatis batal demi hukum. Jadi, apabila syarat subjektif untuk sahnya perjanjian tidak terpenuhi, baik itu karena dibuat oleh pihak yang tidak cakap hukum atau karena tidak adanya kehendak bebas atau kesepakatan, sesungguhnya ‘nasib’ perjanjian seperti itu tidaklah pasti dan bergantung pada kesediaan satu pihak untuk menaatinya, yaitu pihak yang tidak cakap melakukan tindakan hukum atau pihak yang tidak memiliki kehendak bebas tersebut. Apabila pihak ini menerima, dan tidak menuntut pembatalan perikatan maka perjanjian tersebut tetap akan mengikat. Sebaliknya, apabila pihak tersebut menuntut pembatalan perikatan, perjanjian tersebut menjadi batal. Perjanjian seperti itu selalu terancam dengan pembatalan.

c. Penuntutan Pembatalan, dan Penguatan atau Penetapan, atas ‘Perjanjian yang Dapat Dibatalkan’ Terhadap perjanjian yang dapat dibatalkan karena dibuat tanpa memenuhi unsur subjektif pertama ataupun kedua untuk sahnya perjanjian, dapat dilakukan penuntutan pembatalan, atau penguatan/penetapan sehingga membuat perjanjian tersebut tetap berlaku dan memiliki kekuatan mengikat. Berikut ini restatement tentang kedua hal ini.

buku-5.indd

21

1) Penuntutan Pembatalan Perjanjian ‘Yang Dapat Dibatalkan’ Pihak-pihak yang tidak memiliki kehendak bebas ketika membuat perjanjian karena ada paksaan, atau kekeliruan/kekhilafan, atau penipuan, dapat menuntut pembatalan terhadap perjanjian tersebut dalam kurun waktu tidak lebih dari 5 tahun terhitung sejak hari ketika paksaan itu berhenti, atau dalam hal

kekhilafan atau penipuan sejak hari diketahuinya kekhilafan atau penipuan itu. Batas waktu penuntutan pembatalan perjanjian ini dapat lebih pendek apabila hal ini diatur demikian oleh undang-undang. Norma hukum ini ditemukan dalam Pasal 1454 KUH Perdata ayat (1) yang berbunyi “Bila suatu tuntutan untuk pernyataan batalnya suatu perikatan tidak dibatasi dengan suatu ketentuan UU khusus mengenai waktu yang lebih pendek, maka waktu itu adalah lima tahun.

dalam hal paksaan sejak hari paksaan itu berhenti;

dalam hal penyesatan atau penipuan sejak hari diketahuinya penyesatan atau penipuan itu”. Pihak-pihak yang ketika membuat perjanjian tidak memiliki kecakapan hukum untuk melakukan perbuatan hukum, dapat menuntut pembatalan

Waktu tersebut mulai berlaku

Penjelasan Hukum tentang Kebatalan Perjanjian 21

12/13/2010

11:00:03 PM

perjanjian yang dibuatnya itu. Hal ini ditegaskan dalam Pasal 1331 KUH

orang yang tidak cakap membuat persetujuan boleh

menuntut pembatalan perikatan yang telah mereka buat

seorang anak yang belum dewasa, adalah sang anak itu sendiri apabila ia sudah mencapai usia dewasa atau orang tua atau walinya. Apabila pihak yang tidak cakap melakukan tindakan hukum tersebut adalah orang yang berada di bawah pengampuan, pihak yang berhak meminta pembatalan perikatan adalah sang pengampunya. Kemudian, Pasal 1450 KUH Perdata juga menyebutkan bahwa “Dengan alasan telah dirugikan, orang-orang dewasa, dan juga anak-anak yang belum dewasa bila mereka dapat dianggap sebagai orang dewasa, hanyalah dapat menuntut pembatalan perikatan yang telah mereka buat dalam hal-hal khusus yang ditetapkan dengan undang-undang”. Dengan kata lain, menurut Subekti, perjanjian yang tidak memenuhi syarat subjektif berupa kecakapan melakukan tindakan hukum dari si pembuat perjanjian, tetap mengikat selama tidak dibatalkan oleh hakim atas permintaan pihak yang berhak meminta pembatalan tersebut. 40 Pihak yang tidak cakap melakukan tindakan hukum dapat menuntut pembatalan perjanjian yang telah dibuatnya dalam jangka waktu maksimum

5 tahun, terhitung sejak tanggal kedewasaan dalam hal pihak tersebut

Pihak ini, dalam hal

Perdata sebagai berikut

”.

belum dewasa ketika membuat perjanjian, atau sejak tanggal pencabutan pengampuan dalam hal pihak tersebut berada dalam pengampuan ketika membuat perjanjian. Norma ini ditemukan dalam Pasal 1454 KUH Perdata yang berbunyi “Bila suatu tuntutan untuk pernyataan batalnya suatu perikatan tidak dibatasi dengan suatu ketentuan UU khusus mengenai waktu yang lebih pendek, maka waktu itu adalah lima tahun. Waktu tersebut mulai berlaku dalam hal kebelumdewasaan sejak hari kedewasaan, dalam hal pengampuan sejak hari pencabutan pengampuan Walaupun pihak yang tidak cakap melakukan tindakan hukum dapat meminta pembatalan perjanjian yang telah dibuatnya, hal ini tidak berlaku apabila perikatan itu ternyata diterbitkan dari suatu kejahatan atau pelanggaran atau yang telah menerbitkan kerugian bagi orang lain. Hal ini ditemukan dalam ketentuan Pasal 1447 KUH Perdata yang berbunyi “Ketentuan pasal yang lalu tidak berlaku untuk perikatan yang timbul dari suatu kejahatan atau pelanggaran atau dari suatu perbuatan yang telah menimbulkan kerugian bagi orang lain. Begitu juga

40 Subekti, Catatan No. 4 di atas, hlm. 19.

22 Dokumen Penjelas

buku-5.indd

22

12/13/2010

11:00:03 PM

kebelumdewasaan tidak dapat diajukan sebagai alasan untuk melawan perikatan yang dibuat oleh anak-anak yang belum dewasa dalam perjanjian perkawinan dengan mengindahkan ketentuan Pasal 151, atau dalam persetujuan perburuhan dengan mengingat ketentuan Pasal 1601 g, atau persetujuan perburuhan yang tunduk pada ketentuan Pasal 1601 h”. Harus diperhatikan pula bahwa batas waktu 5 tahun yang ditetapkan dalam Pasal 1454 KUH Perdata hanya berlaku untuk penuntutan pembatalan, dan tidak berlaku terhadap kebatalan yang dimajukan di depan hakim sebagai pembelaan atau tangkisan. Untuk hal terakhir ini, dapat dilakukan kapan saja. Artinya, terbuka 2 cara untuk meminta pembatalan perjanjian yang tidak memenuhi unsur subjektif untuk sahnya perjanjian. 41 Pertama, pihak yang berkepentingan dapat secara aktif bertindak sebagai penggugat agar perjanjian tersebut dibatalkan. Kedua, pihak yang berkepentingan menunggu sampai ia digugat di muka hakim untuk memenuhi isi perjanjian tersebut. Pada saat itulah, dia di depan hakim dapat mengemukakan bahwa ketika membuat perjanjian itu, ia belum cakap hukum, atau dia memberi persetujuan karena paksaan, kekhilafan, atau penipuan sehingga kemudian dia meminta agar perjanjian tersebut dibatalkan oleh hakim. 42 Dalam situasi terakhir inilah tidak berlaku batas waktu 5 tahun tersebut. Norma hukum ini tampak dalam Pasal 1454 ayat (2) KUH Perdata yang menyebutkan: “Waktu tersebut di atas, yaitu waktu yang ditetapkan untuk mengajukan tuntutan, tidak berlaku terhadap kebatalan yang diajukan sebagai pembelaan atau tangkisan yang selalu dapat dikemukakan”.

2) Penguatan/Penetapan Perjanjian ‘Yang Dapat Dibatalkan’ Apabila jangka waktu lima tahun dalam Pasal 1454 terlewati, namun mereka yang berada dalam keadaan paksaan, kekhilafan, penipuan, ataupun tidak cakap melakukan perbuatan hukum, tidak mengajukan pembatalan perjanjian, akibatnya perjanjian tersebut tetap berlaku dan mengikat para pihak walau tidak memenuhi unsur subjektif sahnya perjanjian. Hal ini ditegaskan dalam Pasal 1327 KUH Perdata yang menyatakan bahwa “Pembatalan suatu persetujuan berdasarkan paksaan tidak dapat dituntut lagi bila setelah paksaan berhenti persetujuan itu dibenarkan, baik secara tegas maupun secara diam-diam, atau jika telah dibiarkan lewat waktu yang ditetapkan oleh UU untuk dapat dipulihkan seluruhnya ke keadaan sebelumnya”.

41 Ibid., hlm. 24.

42 Ibid.

buku-5.indd

23

Penjelasan Hukum tentang Kebatalan Perjanjian 23

12/13/2010

11:00:03 PM

Demikian pula bila setelah paksaan atau kekhilafan atau penipuan itu berakhir pihak yang berada di bawah paksaan, kekhilafan atau penipuan tersebut kemudian membenarkan persetujuan yang telah diberikannya, baik secara tegas ataupun diam-diam maka penuntutan pembatalan perjanjian menjadi tidak berlaku lagi. Hal ini diatur dalam Pasal 1456 KUH Perdata yang menegaskan bahwa “Tuntutan untuk pernyataan batalnya suatu perikatan,

gugur jika perikatan itu dikuatkan secara tegas atau secara diam-diam, sebagai

oleh orang yang mengajukan alasan adanya paksaan, penyesatan atau

penipuan, setelah paksaan itu berhenti atau setelah penyesatan atau penipuan itu diketahuinya”. Hal yang sama juga berlaku untuk perjanjian yang dibuat oleh pihak yang tidak cakap melakukan perbuatan hukum. Apabila perjanjian seperti ini dikuatkan sendiri secara tegas ataupun diam-diam oleh mereka yang tidak cakap hukum itu, perjanjian tersebut menjadi tetap berlaku dan mengikat para pihak. Pihak yang tidak cakap hukum yang melakukan penegasan/penguatan/ penetapan perjanjian tersebut adalah (a) bila ketika membuat perjanjian dia adalah anak-anak maka penegasan tersebut dilakukan ketika dia dewasa; (b) bila ketika membuat perjanjian dia berada di bawah pengampuan maka penegasan dilakukan setelah pengampuannya dihapuskan. Penegasan atas perjanjian yang dapat dibatalkan ini dapat dilakukan secara tegas melalui pembuatan akta pengesahan ataupun akta penguatan sebagaimana diharuskan oleh KUH Perdata. Hal ini diatur dalam Pasal 1892 KUH Perdata yang berbunyi “(1) Suatu akta yang menetapkan atau menguatkan suatu perikatan yang terhadapnya dapat diajukan tuntutan untuk pembatalan atau penghapusan berdasarkan undang-undang, hanya mempunyai kekuatan hukum bilaaktaitumemuatisipokokperikatantersebut,alasan-alasanyangmenyebabkan dapat dituntut pembatalannya, dan maksud untuk memperbaiki cacat-cacat yang sedianya dapat menjadi dasar tuntutan tersebut; (2) Jika tidak ada akta penetapan atau penguatan, maka cukuplah perikatan itu dilaksanakan secara sukarela setelah saat perikatan itu sedianya dapat ditetapkan atau dikuatkan secara sah; (3) Pembenaran, penguatan atau pelaksanaan suatu perikatan secara sukarela dalam bentuk dan pada saat yang diharuskan oleh undang-undang, dianggap sebagai suatu pelepasan upaya pembuktian serta tangkisan-tangkisan (eksepsi) yang sedianya dapat diajukan terhadap akta itu; namun hal itu tidak mengurangi hak-hak pihak ketiga”. Jadi, menurut Pasal 1892, perbuatan hukum yang dapat dibatalkan karena adanya cacat yang tidak berakibat batal demi hukum, masih dapat

berikut

24 Dokumen Penjelas

buku-5.indd

24

12/13/2010

11:00:04 PM

disahkan melalui penetapan ataupun penguatan dengan akta yang bentuknya diharuskan oleh undang-undang. 43 Akta penetapan atau akta penguatan harus mencantumkan isi pokok perbuatan dan alasan yang menyebabkan dapat dituntutnya pembatalan serta maksud untuk memperbaiki cacat yang sedianya menjadi dasar tuntutan pembatalan. 44 Akta semacam itu mengakibatkan dilepaskannya hak untuk membatalkan perbuatan hukum yang sedianya dapat diajukan. Dengan demikian, perbuatan hukum yang sebenarnya dapat

dibatalkan tersebut menjadi sah sejak perbuatan hukum tersebut dilakukan. 45 Melalui akta penguatan atau akta penetapan itulah maka perjanjian yang sebenarnya terancam pembatalan itu menjadi sah terhitung sejak perjanjian tersebut dibuat. Hal ini tidak berlaku untuk perjanjian yang terancam batal demi hukum. Artinya, untuk perjanjian semacam ini tidak mungkin dapat dilakukan pengesahan, penguatan ataupun penetapan melalui akta tertentu. Jadi, simpulannya sebagai berikut.

(a)

Perjanjian yang dibuat oleh orang yang tidak cakap dan/atau perjanjian yang dibuat tanpa adanya kesepakatan atau kehendak bebas dari para pihaknya, masih dapat dikuatkan melalui akta penguatan atau akta penetapan.

(b)

Perjanjian formil yang tidak memenuhi syarat sah, perjanjian yang dibuat oleh orang yang tidak berwenang, perjanjian yang tidak mempunyai objek tertentu, perjanjian yang tidak memiliki kausa yang halal, tidak mungkin dapat disahkan atau dikuatkan dalam bentuk akta apa pun.

(c)

Demikian pula perjanjian yang batal akibat terpenuhinya syarat batal, atau batal akibat terjadinya wanprestasi, 46 ataupun batal akibat terjadinya keadaan memaksa, 47 tidak mungkin dapat disahkan atau dikuatkan kembali.

4. Perjanjian Batal Karena Wanprestasi atas Dasar Kelalaian Sebagai Syarat Batal

Pada bagian kelima dari Bab I dalam Buku III KUH Perdata yang mengatur tentang Perikatan Bersyarat, yang beberapa pasalnya telah dijelaskan dalam nomor 22– 24 di atas, masih terdapat ketentuan Pasal 1266 dan Pasal 1267. Kedua pasal ini

buku-5.indd

43 Herlien Budiono, Catatan No. 5 di atas, hlm., 211.

44 Ibid.

45 Ibid.

46 Lihat, No. 46–49 dari restatement.

47 Lihat, No. 50 dari restatement.

Penjelasan Hukum tentang Kebatalan Perjanjian 25

25

12/13/2010

11:00:04 PM

sebenarnya berisi tentang pembatalan perjanjian timbal balik akibat salah satu pihak wanprestasi karena kelalaiannya. Penempatan kedua pasal dengan topik tersebut dalam bagian tentang perikatan bersyarat menimbulkan kritik, 48 tetapi juga ditemukan alasan pembenarnya. 49 Tampaknya, pembuat KUH Perdata menganggap bahwa kelalaian debitur sehingga wanprestasi tergolong sebagai suatu syarat batal yang dicantumkan dalam setiap perjanjian timbal balik. Menurut Pasal 1267 KUH Perdata, dalam perikatan yang timbul dari perjanjian timbal balik apabila debitor tidak melaksanakan kewajibannya sebagaimana dijanjikan dalam perjanjian itu, kreditor atas dasar wanprestasi dari debitor berhak untuk memilih apakah (a) memaksa debitor untuk memenuhi perjanjian apabila hal itu masih dapat dilakukan, atau (b) menuntut pembatalan perjanjian disertai penggantian biaya, kerugian, dan bunga dari pihak debitor. Hal ini ditegaskan dalam pasal tersebut yang berbunyi “Pihak yang terhadapnya perikatan tidak dipenuhi, dapat memilih: memaksa pihak yang lain untuk memenuhi persetujuan, jika hal itu masih dapat dilakukan, atau menuntut pembatalan persetujuan, dengan penggantian biaya, kerugian dan bunga”. Pasal di atas jelas terkait dengan Pasal 1266 KUH Perdata yang menyebutkan bahwa “(1) Syarat batal dianggap selalu dicantumkan dalam persetujuan yang timbal balik, andaikata salah satu pihak tidak memenuhi kewajibannya. (2) Dalam hal demikian persetujuan tidak batal demi hukum, tetapi pembatalan harus dimintakan kepada pengadilan. (3) Permintaan ini juga harus dilakukan meskipun syarat batal mengenai tidak dipenuhinya kewajiban dinyatakan di dalam persetujuan. (4) Jika syarat batal tidak dinyatakan dalam persetujuan maka hakim dengan melihat keadaan, atas permintaan tergugat, leluasa memberikan suatu jangka waktu untuk memenuhi kewajiban, tetapi jangka waktu itu tidak boleh lebih dari satu bulan”. Dari ketentuan Pasal 1266 dan 1267 KUH Perdata dapat disimpulkan hal berikut. Kedua pasal tersebut hanya berlaku untuk perjanjian timbal balik, bukan perjanjian sepihak. 50 Wanprestasi merupakan syarat telah dipenuhinya syarat batal dalam perjanjian timbal balik, dan wanprestasi tersebut terjadi bukan karena keadaan memaksa atau

48 Herlien Budiono, Catatan No. 5 di atas, hlm. 196.

49 Subekti, Catatan No. 4 di atas, hlm. 48.

50 Perjanjian sepihak adalah perjanjian yang membebankan prestasi atau kewajiban hanya pada satu pihak. Contoh: perjanjian hibah, perjanjian penanggungan, perjanjian pemberian kuasa tanpa upah, perjanjian pinjam pakai, perjanjian penitipan barang tanpa biaya, perjanjian pinjam-meminjam tanpa bunga.

26 Dokumen Penjelas

buku-5.indd

26

12/13/2010

11:00:04 PM

keadaan di luar kekuasaan (force majeure atau overmacht), tetapi terjadi karena kelalaian pihak tergugat. Akibat wanprestasi tersebut penggugat dapat menuntut pembatalan perjanjian di depan hakim, dengan demikian perjanjian tersebut tidak batal demi hukum. Pasal 1266 dan 1267 KUH Perdata yang menempatkan wanprestasi sebagai syarat batal, sebagaimana pengertian syarat batal dalam Pasal 1253 KUH Perdata, dianggap tidak tepat. Alasannya adalah kepatutan dan logika, yakni tidak akan selalu adil menghukum debitor yang wanprestasi karena kelalaiannya dengan pembatalan perjanjian. Terhadap kritik ini, Subekti, justru menjelaskan bahwa ketentuan kedua pasal tersebut sebenarnya tidak salah. 51 Mengapa demikian? Sebab sekalipun wanprestasi dianggap sebagai syarat batal sehingga menyebabkan perjanjian berakhir, berakhirnya perjanjian itu bukan karena demi hukum, melainkan harus melalui pernyataan pembatalan oleh hakim. Hal ini jelas terlihat dari Pasal 1266 ayat (2) KUH Perdata: ”Dalam hal demikian persetujuan tidak batal demi hukum, tetapi pembatalan harus dimintakan kepada pengadilan”. Bahkan, ayat (3) pasal ini juga menegaskan bahwa perjanjian itu tetap bukan batal demi hukum, melainkan dapat dibatalkan, sekalipun di dalam perjanjian itu dicantumkan soal wanprestasi sebagai syarat batal. Kemudian, ayat (4) menambahkan bila wanprestasi sebagai syarat batal tidak dicantumkan dalam perjanjian, hakim memiliki kebijakan berdasarkan pertimbangan keadaan memberi jangka waktu maksimum 1 (satu) bulan bagi pihak yang wanprestasi untuk memenuhi kewajibannya. Dalam konteks terakhir ini, bahkan menurut Subekti, 52 hakim berhak pula untuk mempertimbangkan dan menilai besar kecilnya kelalaian debitur yang wanprestasi itu dibandingkan dengan akibat pembatalan perjanjian yang akan menimpa debitur itu. Dengan kata lain, ketika hakim harus memutuskan gugatan pembatalan perjanjian karena wanprestasi sebagai syarat batal, ia harus memperhatikan berbagai asas hukum perjanjian yang lazim, salah satunya adalah asas itikad baik. Namun demikian, pendapat Subekti di atas, tampaknya kini justru dikesampingkan. Menurut Herlien Budiono misalnya, Pasal 1266 dan 1267 KUH Perdata bukan ketentuan hukum yang bersifat memaksa sehingga dapat disimpangi oleh para pihak yang membuat perjanjian. 53 Namun, penyimpangan itu tampaknya hanya untuk soal ‘perantaraan putusan hakim’, bukan tentang soal wanprestasi sebagai syarat batalnya perjanjian. Artinya, para pihak dengan tegas

buku-5.indd

51 Subekti, Catatan No. 4 di atas, hlm. 48.

52 Ibid., hlm. 49.

53 Herlien Budiono, Catatan No. 4 di atas, hlm. 199–200.

27

Penjelasan Hukum tentang Kebatalan Perjanjian 27

12/13/2010

11:00:04 PM

dapat mengesampingkan Pasal 1266 ayat (2) hingga ayat (4) sehingga pembatalan perjanjian akibat terjadinya wanprestasi dari salah satu pihak tidak perlu dimintakan kepada hakim. Akibatnya, perjanjian seperti itu akan otomatis batal demi hukum. 54 Pengesampingan Pasal 1266 ayat (2) hingga ayat (4) yang berakibat pelepasan hak para pihak untuk menuntut pembatalan perjanjian di depan hakim, secara tegas harus dicantumkan di dalam akta perjanjian yang bersangkutan. 55

5. Perjanjian Batal Karena Wanprestasi Akibat dari Keadaan Memaksa

Apabila wanprestasi yang dilakukan salah satu pihak dalam perjanjian timbal balik terjadi akibat dari keadaan memaksa (force majeure atau overmacht), perjanjian menjadi batal. Namun demikian, menjadi kewenangan hakimlah untuk menilai apakah benar telah terjadi keadaan memaksa atau bukan. Untuk itu, hakim akan membuat putusan yang bersifat deklaratoir. Jadi, keadaan memaksa juga dapat menjadi syarat batal bagi sebuah perjanjian, tetapi syarat ini tidak perlu diperjanjikan oleh para pihak. 56 Ada beberapa contoh dalam KUH Perdata yang mengatur tentang keadaan memaksa yang membuat perjanjian menjadi batal, misalnya Pasal 1545 tentang musnahnya objek tukar-menukar, Pasal 1553 tentang musnahnya barang yang disewakan, Pasal 1607 tentang musnahnya pekerjaan di luar kelalaian pemborong, dan Pasal 462 tentang berakhirnya carter kapal karena kapal musnah. 57

6. Akibat Pembatalan Perjanjian

Secara praktis, perjanjian yang dapat dibatalkan ataupun yang batal demi hukum pada akhirnya akan berakibat sama, yakni perjanjian-perjanjian itu menurut hukum dinilai tidak memiliki efek hukum. Perjanjian yang batal demi hukum tidak lantas berarti perjanjiannya tidak ada atau dianggap tidak ada sebab bagaimanapun perjanjian itu telah ada atau telah terjadi, hanya menurut hukum perjanjian semacam itu tidak diberi akibat atau tidak berefek. Pada keadaan seperti itu, hukum menilai bahwa kondisi dikembalikan mundur ke kondisi semula seperti pada saat

54 Ibid.

55 Ibid.

56 Ibid., hlm. 197–198.

57 Ibid., hlm. 198.

28 Dokumen Penjelas

buku-5.indd

28

12/13/2010

11:00:04 PM

perikatan itu timbul atau pada saat perjanjian tersebut ditutup. Karena perjanjian tidak berakibat hukum maka para pihak tidak perlu melakukan prestasi, dan kepada pihak yang telah melakukan prestasi dianggap telah terjadi pembayaran yang tidak diwajibkan. Pembayaran yang tidak diwajibkan seperti ini, menurut Pasal 1359 harus dikembalikan. Pasal 1359 berbunyi “Tiap pembayaran mengandaikan adanya suatu utang; apa yang telah dibayar tanpa diwajibkan untuk itu, dapat dituntut kembali. Terhadap perikatan bebas yang secara sukarela telah dipenuhi, tak dapat dilakukan

penuntutan kembali”. Perjanjian yang dibuat oleh orang yang tidak cakap hukum yang kemudian dimintakan pembatalannya oleh orang yang bersangkutan di depan Hakim, mengakibatkan ‘kembalinya’ barang dan orang yang bersangkutan dalam keadaan seperti sebelum perjanjian dibuat. Dengan kata lain, batalnya perikatan membuat keadaan kembali seperti kondisi semula ketika perikatan belum terjadi. Hal ini ditegaskan dalam Pasal 1451 yang berbunyi “Pernyataan batalnya perikatan- perikatan berdasarkan ketidakcakapan orang-orang tersebut dalam Pasal 1330, mengakibatkan pulihnya barang-barang dan orang-orang yang bersangkutan dalam keadaan seperti sebelum perikatan dibuat, dengan pengertian bahwa segala sesuatu yang telah diberikan atau dibayar kepada orang yang tak berwenang, akibat perikatan itu, hanya dapat dituntut kembali, bila barang yang bersangkutan masih berada di tangan orang yang tidak berwenang itu, atau bila ternyata bahwa orang ini telah mendapat keuntungan dari apa yang telah diberikan atau dibayar itu, atau bila apa yang telah dinikmati telah dipakai bagi kepentingannya.” Kemudian, khusus untuk perjanjian yang dibuat oleh orang yang berada

di bawah paksaan, kekhilafan ataupun penipuan, hal yang sama seperti di atas

disebutkan dalam Pasal 1452, yakni “Pernyataan batal yang berdasarkan adanya paksaan, penyesatan atau penipuan, juga mengakibatkan barang dan orang yang bersangkutan pulih dalam keadaan seperti sebelum perikatan dibuat.” Apabila pihak-pihak yang tidak cakap hukum, dan/atau yang tidak memiliki

kehendak bebas, ketika membuat perjanjian mengajukan tuntutan pembatalan perjanjian yang telah dibuatnya itu, mereka juga wajib untuk mengganti biaya, kerugian, dan bunga kepada pihak lawan jika memang ada alasan untuk itu. Hal

ini ditegaskan dalam Pasal 1453 yang berbunyi “Dalam hal-hal tersebut dalam Pasal

1446 dan 1449, orang yang terhadapnya tuntutan untuk pernyataan batalnya suatu perikatan dikabulkan, wajib juga mengganti biaya, kerugian, dan bunga, jika ada

alasan untuk itu.”

buku-5.indd

29

Penjelasan Hukum tentang Kebatalan Perjanjian 29

12/13/2010

11:00:04 PM

7.

Pembatalan Perjanjian Oleh Pihak Ketiga (Actio Pauliana)

Dalam uraian no. 35–39 telah disebutkan tentang siapa atau pihak mana yang berhak meminta pembatalan perjanjian karena tidak terpenuhinya syarat subjektif sahnya perjanjian dan tentang batas waktu untuk meminta pembatalan. Namun, masih ada satu hal lain yang relevan dengan persoalan siapa saja yang berhak meminta pembatalan atas suatu perjanjian atau perbuatan hukum tertentu, yaitu ketentuan Pasal 1341 KUH Perdata yang dalam hukum perjanjian disebut mengatur tentang actio pauliana. Pasal 1340 KUH Perdata berbunyi “Persetujuan hanya berlaku antara pihak-pihak yang membuatnya. Persetujuan tidak dapat merugikan pihak ketiga; persetujuan tidak dapat memberi keuntungan kepada pihak ketiga selain dalam hal yang ditentukan dalam Pasal 1317”. Kemudian, Pasal 1341 menyebutkan bahwa “(1) Meskipun demikian, tiap kreditur boleh mengajukan tidak berlakunya segala tindakan yang tidak diwajibkan yang dilakukan oleh debitur, dengan nama apa pun juga, yang merugikan kreditur, asal dibuktikan bahwa ketika tindakan tersebut dilakukan, debitur dan orang yang dengannya atau untuknya debitur itu bertindak, mengetahui bahwa tindakan itu mengakibatkan kerugian bagi para kreditur. (2) Hak-hak yang diperoleh pihak ketiga dengan itikad baik atas barang-barang yang menjadi objek dari tindakan yang tidak sah, harus dihormati. (3) Untuk mengajukan batalnya tindakan yang dengan cuma- cuma dilakukan debitur, cukuplah kreditur menunjukkan bahwa pada waktu melakukan tindakan itu debitur mengetahui, bahwa dengan cara demikian dia merugikan para kreditur tak peduli apakah orang yang diuntungkan juga mengetahui hal itu atau tidak”. Terhadap kedua pasal di atas, Herlien Budiono menegaskan bahwa 58 Pengertian kreditor dalam Pasal 1341 mencakup tidak hanya orang yang berhak atas pembayaran utang saja, tetapi juga orang yang berhak untuk memperoleh prestasi yang dijanjikan orang lain (yakni debitor) terhadapnya, seperti prestasi untuk melakukan sesuatu atau untuk tidak melakukan sesuatu. Pasal 1341 ditujukan untuk melindungi kepentingan kreditor dari tindakan debitor yang sebenarnya tidak diwajibkan oleh undang-undang dan merugikan kreditor. Dengan demikian, dapat terjadi bahwa seorang pihak ketiga (kreditor) yang sebenarnya bukan merupakan pihak yang membuat perjanjian dengan debitor, ternyata meminta pembatalan perjanjian yang dibuat oleh debitor tersebut dengan orang lain (yang merupakan pihak kedua dalam perjanjian dengan sang debitor itu),

58

Ibid., hlm. 161–165.

30

Dokumen Penjelas

buku-5.indd

30

12/13/2010

11:00:04 PM

dengan alasan perjanjian tersebut bukanlah sesuatu yang diwajibkan oleh undang- undang kepada debitor untuk melakukannya, dan juga perjanjian itu merugikan kepentingan kreditor. Hak menggugat yang dimiliki pihak ketiga untuk meminta pembatalan perjanjian yang dibuat oleh orang lain inilah yang dinamakan actio pauliana.

8. Pembatalan Perjanjian Oleh Pihak yang Berwenang Karena UU

Selain beberapa hal atau kondisi tertentu yang dapat mengakibatkan batalnya perjanjian seperti dijelaskan di atas, masih ada satu kondisi ‘khusus’ lagi, yaitu pembatalan perjanjian oleh pihak tertentu atas kuasa undang-undang yang secara eksplisit menyatakan hal tersebut. Maksudnya, terdapat norma hukum dalam sebuah UU yang menyatakan bahwa lembaga atau pejabat publik tertentu berdasarkan UU tersebut berwenang untuk membatalkan perjanjian tertentu. Hal ini ditemukan dalam peraturan berikut ini:

a. UU No. 24 tahun 2004 tentang Lembaga Penjamin Simpanan (LPS).

Pasal 6 ayat (2): “LPS dapat melakukan penyelesaian dan penanganan Bank Gagal dengan kewenangan:

c. meninjau ulang, membatalkan, mengakhiri, dan/atau mengubah setiap kontrak yang mengikat Bank Gagal yang diselamatkan dengan pihak ketiga yang merugikan bank”.

Pasal 26: Setelah RUPS menyerahkan hak dan wewenang sebagaimana dimaksud dalam Pasal 25, LPS dapat melakukan tindakan sebagai berikut:

g. meninjau

mengubah

kontrak bank yang mengikat bank dengan pihak ketiga, yang menurut LPS merugikan bank.

ulang,

membatalkan,

mengakhiri,

dan/atau

Pasal 52 ayat (1): ”Untuk kepentingan aset atau kewajiban bank dalam likuidasi, tim likuidasi dapat meminta pembatalan kepada pengadilan niaga atas segala perbuatan hukum bank yang mengakibatkan berkurangnya aset atau bertambahnya kewajiban bank, yang dilakukan dalam jangka waktu 1 (satu) tahun sebelum pencabutan izin usaha”. Pasal 52 ayat (2): ”Dikecualikan dari ketentuan sebagaimana dimaksud pada ayat (1) adalah perbuatan hukum bank yang bersangkutan yang

buku-5.indd

31

wajib dilakukan berdasarkan Undang-Undang”.

Penjelasan Hukum tentang Kebatalan Perjanjian 31

12/13/2010

11:00:04 PM

b. UU No. 10 tahun 1998 tentang Perubahan Atas UU No. 7 tahun 1992 tentang Perbankan

Pasal 37 A:

1. Apabila menurut penilaian Bank Indonesia terjadi kesulitan Perbankan yang membahayakan perekonomian nasional, atas permintaan Bank Indonesia, Pemerintah setelah berkonsultasi kepada Dewan Perwakilan Rakyat Republik Indonesia dapat membentuk badan khusus yang bersifat sementara dalam rangka penyehatan Perbankan. 2. Badan khusus sebagaimana dimaksud dalam ayat (1) melakukan program penyehatan terhadap bank-bank yang ditetapkan dan diserahkan kepada badan dimaksud. 3. Dalam melaksanakan program penyehatan terhadap bank-bank khusus sebagaimana dimaksud dalam ayat (1) mempunyai wewenang sebagaimana dimaksud dalam Pasal 37 ayat (1) serta wewenang lain, yaitu d. meninjau ulang, membatalkan, mengakhiri, dan atau mengubah kontrak yang mengikat bank dengan pihak ketiga, yang menurut pertimbangan badan khusus merugikan bank.

Dari dua contoh UU di atas tampak bahwa Lembaga Penjamin Simpanan (LPS), tim likuidasi bank gagal, dan ’badan khusus ad hoc penyehatan perbankan’ masing- masing memiliki kewenangan untuk membatalkan perjanjian yang dibuat oleh pihak lain, yaitu bank yang berada dalam masalah seperti bank gagal atau tidak sehat. Ketentuan dalam UU yang secara khusus memberi mandat atau kewenangan kepada lembaga khusus untuk membatalkan perjanjian yang dibuat oleh pihak lain seperti tercantum di atas mirip dengan norma hukum dalam KUH Perdata tentang actio pauliana. Namun demikian, tampak sedikit perbedaan, yaitu norma hukum actio pauliana mensyaratkan bahwa pembatalan perjanjian oleh pihak ketiga dapat dilakukan apabila pihak ketiga itu mengalami kerugian akibat dari perjanjian tersebut yang bukan merupakan perbuatan yang diwajibkan oleh hukum atau undang- undang. Dalam UU tentang LPS ataupun Perbankan di atas, kewenangan LPS dan badan khusus penyehatan perbankan untuk membatalkan perjanjian yang dibuat pihak lain, yaitu bank gagal, tidak didasarkan pada pertimbangan kepentingan LPS ataupun badan khusus tersebut, tetapi pertimbangan bahwa perjanjian itu merugikan pihak bank gagal. Perbedaan lain adalah tampaknya ketentuan dalam kedua UU di atas lebih didasarkan pada pertimbangan untuk melindungi kepentingan publik, dalam hal ini kepentingan keuangan negara karena kedua UU di atas mengatur tentang

32 Dokumen Penjelas

buku-5.indd

32

12/13/2010

11:00:04 PM

perbankan yang memperoleh fasilitas penjaminan oleh Pemerintah, dan tentang perlunya menyehatkan perbankan yang sedang mengalami kesulitan sehingga dapat membahayakan ekonomi nasional.

9. Putusan Hakim tentang Kebatalan Perjanjian yang Menjadi Yurisprudensi

Sejak tahun 1960-an hingga dekade pertama abad ke-21, ditemukan banyak putusan hakim tertinggi, yaitu Mahkamah Agung (MA) yang dinyatakan sebagai yurisprudensi oleh MA sendiri di bidang hukum perdata, khususnya hukum perjanjian. Namun

demikian, sangat sedikit di antara yurisprudensi itu yang relevan dengan persoalan kebatalan perjanjian. Lebih sedikit lagi, yurisprudensi yang memuat pertimbangan hakim (ratio decidendi) yang memperjelas, memperkuat, atau membantah sebuah norma hukum ataupun doktrin hukum tentang kebatalan perjanjian. Oleh sebab itu, untuk memperkuat penulisan restatement ini telah diteliti kurang lebih hampir 100 putusan hakim, termasuk di dalamnya sekitar 20 yurisprudensi, yang kemudian ternyata hanya berhasil menemukan 2 yurisprudensi yang relevan, yakni 59

a. Putusan MA No. 147K/SIP/1979 tanggal 25 September 1980 tentang perjanjian

jual beli tanah dan rumah yang ternyata tidak memenuhi syarat objektif sahnya perjanjian, yaitu unsur kausa yang halal. Dalam perjanjian yang menjadi pokok perkara, kausa atau objeknya dilarang oleh Pasal 5 juncto 21 UU No. 5 tahun

1960 tentang Pokok-Pokok Agraria.

b. Putusan MA No. 522K/Pdt/1990 tanggal 29 April 1992 tentang perjanjian jual beli tanah yang juga tidak memenuhi syarat objektif untuk sahnya perjanjian.

Dalam perjanjian yang menjadi pokok perkara, kausanya dilarang oleh Stb tahun

1875 No. 179 tentang Larangan Pengasingan Tanah, yang berlaku sebelum UU

No. 5 tahun 1960 diberlakukan.

Kedua yurisprudensi MA di atas memperkuat norma hukum dalam KUH Perdata tentang syarat sahnya perjanjian serta akibat hukumnya bila syarat tersebut tidak terpenuhi. Dengan kata lain, kedua yurisprudensi di atas merupakan contoh riil dan praktis bagaimana Hakim mengaplikasikan dan menafsirkan norma hukum perjanjian dalam suatu perkara hukum. Di sisi lain, sangat disayangkan bahwa hingga restatement ini ditulis, tidak ditemukan yurisprudensi ataupun putusan hakim (yang bukan berupa yurisprudensi) yang relevan dengan pembatalan perjanjian sebagai akibat dari tidak terpenuhinya syarat subjektif untuk sahnya perjanjian. Padahal apabila yurisprudensi semacam itu dapat ditemukan maka akan membantu

59 Lihat, putusan MA secara lengkap dalam Lampiran dari restatement ini.

buku-5.indd

33

Penjelasan Hukum tentang Kebatalan Perjanjian 33

12/13/2010

11:00:04 PM

memperkuat dan memperjelas norma hukum dalam KUH Perdata tentang perjanjian yang dapat dibatalkan. Pada lampiran dari restatement ini juga disertakan yurisprudensi, yaitu Putusan MA No. 1180K/SIP/1971 tanggal 12 April 1972 tentang perjanjian jual-beli mesin generator yang mengharuskan terjadinya impor barang dengan pembayaran uang yang meningkat jumlahnya akibat terjadinya perubahan kurs mata uang. Yurisprudensi ini memang tidak langsung relevan dengan topik restatement ini, tetapi cukup bernilai karena hakim dalam pendapatnya menegaskan bahwa kausa yang halal dalam sebuah perjanjian berbeda maknanya dengan norma hukum tentang keadaan memaksa. Kausa yang halal dinilai atau ditetapkan pada saat perjanjian dibuat, sementara persoalan keadaan memaksa dinilai atau ditetapkan pada saat perjanjian dilaksanakan. Pendapat hakim dalam yurisprudensi ini bermanfaat untuk memperjelas makna dari kausa yang halal yang merupakan syarat objektif untuk sahnya perjanjian.

34 Dokumen Penjelas

buku-5.indd

34

12/13/2010

11:00:04 PM

PERSPEKTIF INTERNASIONAL

NULLITY AND ANNULLABILITY ACCORDING TO THE CIVIL CODE OF THE NETHERLANDS

Indonesian Restatement Project/June 2010

Oleh: Prof. Dr. Jaap Hijma

Table of contents

Introduction The concepts of nullity and annullability Nullity Conflicts with mandatory law Conflicts with good morals or public order Consequences of a nullity Mitigation of (the consequences of) a nullity annullability Grounds for annullability Consequences of annullability and annulment Mitigation of (the consequences of) an annullability

A.

INTRODUCTION

1. The concepts of nullity and annullability

1.1. Dutch law principally distinguishes nullity (= voidity) from annullability (=

voidability). 1 Nullity (voidity) is chosen whenever, in short, public aims or public interests are at stake. Nullities operate automatically. An invocation by one of the parties is not necessary; the court can apply the nullity of its own accord (ex officio). Regarding the nullity as such, an eventual court decision has a declaratory character. Problems typically suitable for nullity are: non-compliance with a required form (art. 3:39 DCC 2 ,) the violation of a mandatory statutory provision (art. 3:40 par. 2 DCC), the violation of good morals (art. 3:40 par. 1 DCC), the violation of public order (art. 3:40 par. 1 DCC).

1 ‘Nullity’ and ‘voidity’ I consider interchangeable, as well as ‘annullability’ and ‘voidability’; I will use the former terms.

2 DCC refers to the (new) Dutch Civil Code.

buku-5.indd

35

Penjelasan Hukum tentang Kebatalan Perjanjian 35

12/13/2010

11:00:04 PM

1.2.

Annullability (voidability) is chosen when solely the interests of one of the parties need to be protected. An annullability does not operate automatically,

but only strikes if it is activated by the protected party. An annullable juridical act can be annulled in two ways: either by means of an extra-juridical declaration issued by the protected party, or by means of a court decision (art. 3:49 DCC). In the latter case too, an invocation by the protected party is essential; the court cannot annul of its own accord. After annulment the contract is considered null, with retroactive effect to the time it was concluded (art. 3:53 DCC). As long as the contract is not annulled however it is valid and binding. Underlying idea is that when only the interests of one of the parties are at stake, it can be left to the protected party to decide whether the contract shall stand or fall. Problems typically suitable for annullability are: incapacity (art. 3:32 DCC), fraud, duress, undue influence (art. 3:44 DCC), mistake (art. 6:228 DCC), unreasonably onerous general conditions (art. 6:233 sub a DCC).

1.3. The concepts of nullity and annullability not only refer to contracts, but also to other types of juridical acts, including unilateral acts. Therefore most of the relevant provisions are located in the General Part of Patrimonial Law (Book 3 DCC). 3 According to practice, this contribution will be primarily focused on contracts.

B.

NULLITY

2. Conflicts with mandatory law

2.1 Under the former Civil Code Dutch law, following French law, embraced the concept of a(n) ‘(un)lawful cause’ ((on)geoorloofde oorzaak). The new Dutch Civil Code (DCC) no longer mentions this requirement. Instead of posing such a general validity demand, the new Code simply specifies a number of– fundamental–borders which the contracting parties are not allowed not cross:

mandatory law, good morals, public order. A contract contrary to one of these three will, as a rule, be null (art. 3:40 DCC).

2.2 Art. 3:40 par. 2 DCC reads: A juridical act which violates a mandatory statutory provision becomes a nullity; if, however, the provision is intended solely for the

3 For nullity and annullability see: Asser/Hartkamp & Sieburgh 6-III* Asser series, Algemeen overeen- komstenrecht, Deventer: Kluwer 2010, Chapters 23―25; Hijma, Van Dam, Van Schendel & Valk, Re- chtshandeling en Overeenkomst, Deventer: Kluwer 2007, Chapter 5 (by Van Dam); Hijma, Nietigheid en vernietigbaarheid van rechtshandelingen, diss. Leiden, Deventer: Kluwer 1988.

36 Perspektif Internasional

buku-5.indd

36

12/13/2010

11:00:04 PM

protection of one of the parties to a multilateral juridical act, the act may only be annulled; in both cases this applies to the extent that the provision does not provide otherwise. 4

2.3 The documentary history of art. 3:40 par. 2 DCC demonstrates that the cited

provision has a rather limited scope. 5 In the first place, art. 3:40 par. 2 is written with a view to cases wherein the conclusion of the contract is forbidden. If the content or the necessary implication of the contract is forbidden art. 3:40 par. 2 is not applicable (but art. 3:40 par. 1 presumably is 6 .) In the second place, art. 3:40 par. 2 exclusively covers conflicts with provisions constructed at the highest national level (wetten in formele zin). Legislation made by a provincial or a municipality is not maintained by par. 2, but–indirectly–by par. 1 of art. 3:40 DCC.

2.4 It is self-evident that art. 3:40 par. 2 only refers to mandatory law. In practice it is not always perfectly clear whether a violated provision has a mandatory character or not. 7 As a general rule, the law of obligations and the law of contracts are considered non-mandatory (so: merely supplementary). Two groups of exceptions to this rule are recognized. Firstly, provisions will be mandatory if the interests of third persons are at

stake (see e.g. art. 6:250 DCC). In connection herewith, property law provisions are considered mandatory. Secondly, provisions will be mandatory if they specifically aim the protection

of a weak type of party against a strong type of party. Examples of the latter are: the protection of consumer/buyers against professional sellers (art. 7:5 ff DCC, consumer sale), the protection of lessees against lessors (title 7.4 DCC, contract of lease and hire), the protection of employees against employers (title 7.10 DCC, contract of employment).

2.5 The violation of a mandatory statutory provision covered by art. 3:40 par. 2 DCC will generally result in a nullity. The article recognizes two kinds of exceptions to this rule. The first exception concerns provisions which are intended solely for the

4 In this contribution I mainly follow the English translation by Haanappel: Haanappel c.s., New Neth- erlands Civil Code, Deventer/Boston: Kluwer Law & Taxation 1990.

5 Parlementaire Geschiedenis van het Nieuwe BW (Parl. Gesch. Nieuw BW), Boek 3, Deventer: Kluwer 1981, p. 189―192.

6 See infra, no. 3.

7 On this subject: Loth, Dwingend en aanvullend recht, Deventer: Kluwer 2009.

buku-5.indd

37

Penjelasan Hukum tentang Kebatalan Perjanjian 37

12/13/2010

11:00:04 PM

protection of one of the parties. An example is art. 7:6 DCC regarding consumer sales. Art. 7:6 par. 1 DCC ordains that in a consumer sale there may be no limitations on or exclusions of the legal rights and remedies of the buyer. Evidently this prohibition is written with the singular aim of protecting the buyer’s interests. Therefore, annullability is the suitable remedy; 8 a nullity would overreach itself. The second exception is found in art. 3:40 par. 3 DCC, which establishes the possibility that a violated provision does not purport to invalidate juridical acts in conflict therewith. In such cases, the remedies mentioned in art. 3:40 par. 2 DCC do

not apply. Art. 3:40 lid 3 is written with a view to so-called leges imperfectae, which e.g. do not carry any civil law remedy but only a public law one (like a fine for one or both of the parties).

2.6 Non-compliance with form prescriptions is especially regulated by art. 39 DCC, reading: ‘Save as otherwise provided by the law, juridical acts which have not been performed in the required form are a nullity’. The phrase‘save as otherwise provided’ holds no limitation to explicit statutory provisions; the law can also provide otherwise in an implicit way. 9

3. Conflicts with good morals or public order

3.1 Art. 3:40 par. 1 DCC reads: A juridical act which by its content or necessary implication is contrary to good morals or public order, is a nullity.

3.2 Good morals and public order are, necessarily, rather vague concepts. ‘Good morals’ refers primarily to ethical issues; ‘public order’ refers primarily to the way public life is organized. In practice the criterion of public order is especially relevant regarding contracts concluded by a government body, e.g. by a municipality. The concepts of good morals and public order do not exclude one another; quite often they show an overlap. Together they embody the– unwritten–fundamental requirements of human conduct, which are current in a certain society at a certain period in time.

3.3 Art. 3:40 (1) DCC distinguishes the content of a contract from the necessary implication of a contract.‘Content’means: the mutual obligations of the parties, upon which they have agreed (e.g. the delivery of goods, the rendering of a service). Whenever the fulfillment of one of these obligations infringes upon good morals or public order, the contract will be a nullity, regardless whether the parties were aware of the infringement.

8

See infra, no. 3.

9

For an example: HR 5-10-2001, NJ 2002, 410 (Van der Vijver/Stoll), in the matter of a testament not mentioning the year it was drawn up.

38 Perspektif Internasional

buku-5.indd

38

12/13/2010

11:00:05 PM

3.4

‘Necessary implication’ (strekking) is a complex, two-headed, concept. In the

first place, it comprises the necessary consequences of the contract, foreseeable for both parties. 10 The second component of the concept of ‘necessary implication’ is concerned with the aims of the parties. This component is more visible in the Dutch word ‘strekking’ than in its English translation (necessary implication). If the parties conclude the contract with a common motive which is against public order or good morals, the contract will be a nullity. The same applies when only one of the parties had such a wrong motive, provided this one-sided motive was recognizable to the other party. An example of the latter: a knife is sold; the buyer plans to use it to kill his neighbor. If the seller recognizes this intolerable aim the contract will be null (void). If the seller does not recognize the buyer’s reprehensible aim however, the contract will be valid and binding.

4. Consequences of a nullity

4.1 A null contract does not give rise to the obligations the parties aimed at. Neither party can be held to perform. When one of them performs nevertheless, this performance lacks a legal basis. The performing party can demand restitution because of undue performance (art. 6:203 ff DCC). If property is transferred on the basis of a null contract, the seller retains ownership; the property never reaches the buyer (art. 3:84 par. 1 DCC).

4.2 Sometimes a null contract is performed by both parties. If afterwards the issue

of nullity is raised, both parties can file a claim for restitution. Where one of the prestations cannot, by its nature, be reversed, and where this prestation should not be valued in monetary terms at law, an action to reverse a counter- prestation or to be imbursed the value thereof is also excluded, to the extent that it would, for that reason, be contrary to reasonableness and fairness (redelijkheid en billijkheid; ‘goede trouw’) (art. 6:211 par. 1 DCC). An illustration: A and B agree that A will pay B money for threatening C. Afterwards A demands the restitution of his money, arguing the underlying contract A-B is null. This claim of A’s could be met, whereas B’s counter-claim to restitution (regarding his activities c.q. the financial value thereof) cannot. Ultimately A could get what he wanted without paying at all, which is an unreasonable result. The cited article prevents such an outcome.

10 Famous is HR 11-5-1951, NJ 1952, 128 (Burgman/Aviolanda), in the matter of the sale of combs by an airplane-constructor (who altered his factory without the required government permit).

buku-5.indd

39

Penjelasan Hukum tentang Kebatalan Perjanjian 39

12/13/2010

11:00:05 PM

5.

Mitigation of (the consequences of) a nullity

5.1 Formerly a void contract was considered non-existent; it had no juridical consequences whatsoever. Nowadays the concept of nullity (voidity) has become increasingly complex. The Dutch Supreme Court (Hoge Raad der Nederlanden) has expressed that one

of the general principles underlying the new Civil Code is, that–as a rule–nullities will not intervene beyond their purport. 11 This underlying principle notably comes to light through partial nullity (art. 3:41 DCC), conversion (art. 3:42 DCC) and convalescence (art. 3:58 DCC).

5.2 Partial nullity. The nullity of part of a juridical act does not affect the rest of the act, to the extent that, taking into consideration the content and necessary implication of the act, the parts are so inextricably related so as not to be severable (art. 3:41 DCC). If the parts are not inextricably related, the null part can and will be separated from the remainder; the remainder of the contract stays valid and binding. Before art. 3:41 DCC was enacted, the Supreme Court (Hoge Raad) already applied the same formula. 12 In practice, the concept of partial nullity is especially important regarding

general contract conditions. If one of a company’s set of conditions is null, the company often argues that it would never have concluded the contract without this

specific condition, claiming it shall be ‘all or nothing’. Art. 3:41 DCC however is not dependant of the hypothetic consent of the parties. ‘Inextricably linked’ allows for the use of more objective points of view. As a rule, almost every general condition will be considered to be severable: when one condition is null, the remainder of the contract stays untouched. 13

5.3 Conversion. When the necessary implication of a juridical act which is a nullity corresponds to such a degree to that of another juridical act, considered as valid, so as to imply that the latter juridical act would have been performed had the former been abandoned because of its invalidity, then the former shall be given the effect of the latter juridical act, unless this would be unreasonable to an interested person not party to the juridical act (art. 3:42 DCC). 14

11 HR 17-02-2006, NJ 2006, 379 (Royal & Sun/Universal Pictures).

12 HR 16-11-1984, NJ 1985, 624 (Buena Vista).

13 Cf. art. 3.16 of the Unidroit Principles of International Commercial Contracts, Roma 2004.

14 Likewise, before the new Code was enacted: HR 23-1-1981, NJ 1981, 284 (Neon-Brabant/Mulders).

40 Perspektif Internasional

buku-5.indd

40

12/13/2010

11:00:05 PM

Whereas the concept of partial nullity tackles a problem of quantity, the doctrine of conversion tackles a problem of quality. Conversion supposes that the parties

could have pursued their goal(s) successfully by means of contract type X, while they actually chose contract type Y, which is unsuitable and therefore encumbers nullity. In such a case, the null contract of type Y will–automatically–be ‘converted’ into a valid contract of type X. Examples of such a conversion under Dutch law are rather scarce. 15

5.4 Convalescence. When a legal condition for the validity of a juridical act is fulfilled

only after its performance and, during the period between the act and the fulfilment of the legal condition, all directly interested parties who could have invoked such defect have treated the act as valid, the juridical act is thereby ratified (art. 3:58 DCC). In the legislator’s view, such a convalescence has retro-active effect. 16 From a theoretical point of view the possibility of a convalescence is important; in practice the phenomenon is scarce. 17

C.

ANNULLABILITY

6.

Grounds for annullability

6.1

The main grounds for annullability under Dutch law are:

--

incapacity of one of the parties (art. 3:32 DCC);

--

duress (art. 3:44 par. 2 DCC);

--

fraud (art. 3:44 par. 3 DCC);

--

abuse of circumstances (undue influence) (art. 3:44 par. 4 DCC);

--

‘actio Pauliana’ (art. 3:45 ff DCC);

--

error (mistake) (art. 6:228 DCC);

--

unreasonably onerous general conditions (art. 6:233 sub a DCC).

6.2

Regarding the (in)capacity of the parties, art. 3:32 par. 1 DCC reads: Every

natural person has the capacity to perform juridical acts, to the extent that the law does not provide otherwise. The law does provide otherwise for minors (unmarried persons under 18; art. 1:234 DCC) and for persons under legal restraint (art. 1:381 DCC). Such incapable persons

15 A famous judgment is HR 21-1-1944, NJ 1944, 120 (Van de Water/Van Hemme), in a matter of mar- riage articles.

16 Parlementaire Geschiedenis van het Nieuwe BW, Boek 3, p. 247-251.

17 On convalescence: Potjewijd, Bekrachtiging en convalescentie, Deventer: Kluwer 2002.

buku-5.indd

41

Penjelasan Hukum tentang Kebatalan Perjanjian 41

12/13/2010

11:00:05 PM

have a legal representative (parent, guardian, curator) to serve their interests. A contract concluded by the incapable person himself is annullable (art. 3:32 par. 2 DCC). This structural incapacity has to be distinguished from a specific disqualification. Certain persons are disqualified to be a party to certain juridical acts; for instance a judge cannot acquire property in respect of which a procedure is pending before his court (art. 3:43 par. 1 sub a DCC). Such disqualifications serve public interests (e.g. integrity). Therefore the appropriate remedy is not annullability, but a nullity (art. 3:43

par. 1 in fine DCC reads: ‘

are a nullity and oblige the acquirer to pay damages’).

7. Consequences of annullability and annulment

7.1 As long as the ground for annulment is not invoked by the protected party, the contract is perfectly valid and binding.

7.2 Its annullability puts the fate of the contract into the hands of the protected party; the contract’s future is insecure. This insecurity comes to an end in case of prescription. According to art. 3:52

par. 1 DCC, the prescription period for actions to annul a juridical act–including extra- juridical declarations (art. 3:52 par. 2 DCC)–is three years. Afterwards, the annulment ground may still be invoked at law as a defense against a claim by the other party (art. 3:51 par. 2 DCC). Every power to invoke a ground for annulment lapses when the protected person confirms the contract (art. 3:55 par. 1 DCC). This power also lapses when the other party has given notice to the protected person, requiring him within a reasonable period to choose between confirmation and annulment, and that person has made no choice within that period (art. 3:55 par. 2 DCC). By giving such a notice, the other party forces the protected person to make up his mind.

7.3 When an annullable contract is annulled, the annulment has retroactive effect to the time the contract was concluded (art. 3:53 par. 1 DCC). Therefore the consequences of an annulment are identical to the consequences of an initial nullity. 18 When a performance was delivered, in retrospect this performance lacked a legal basis: the performing party is entitled to demand restitution because of undue performance (art. 6:203 ff DCC).When property was transferred, in retrospect the property never left the seller (art. 3:84 par. 1 DCC).

7.4 An annulment, like a nullity, can give rise to restitution. The Civil Code knows other phenomena giving rise to restitution, like the fulfillment of a resolutory condition (art. 6:24 DCC) and the setting aside of a contract because of non-

18

See supra, no. 4.

42

Perspektif Internasional

buku-5.indd

42

12/13/2010

11:00:05 PM

performance (art. 6:265 DCC). These phenomena are kept apart from nullity and annullability however, because they relate to (the performance of) a valid contract. Non-performance does not carry invalidity.

8. Mitigation of (the consequences of) annullability

8.1 The concepts of partial nullity, conversion and convalescence are applicable not only when a contract is null and void, but also after the annulment of an annullable contract. 19

8.2 Specifically concerning annullabilities, the Dutch Civil Code introduces a few

more in-between-solutions. According to art. 3:53 par. 2 DCC, the court may, upon request, refuse to give effect to an annulment in whole or in part, if the juridical act has already produced consequences which can only be undone with great difficulty. By means of this article e.g. the retroactive effect of the annulment can be limited by the court. According to art. 6:230 par. 2 DCC, instead of pronouncing the annulment because of mistake the court may, upon the demand of one of the parties, modify the effects of the contract to remove the detriment. Dutch law thus embraces the possibility that a contract is neither upheld nor annulled, but lives on with an adapted content, established by the court according to reasonableness and fairness (redelijkheid en billijkheid, ‘goede trouw’). This possibility exists with error or mistake (dwaling, art. 6:230 DCC) and with undue influence (misbruik van omstandigheden, art. 3:54 par. 2 DCC).

19 See e.g. Hijma & Olthof, Compendium van het Nederlands vermogensrecht, Deventer: Kluwer 2008, no. 59.

buku-5.indd

43

Penjelasan Hukum tentang Kebatalan Perjanjian 43

12/13/2010

11:00:05 PM

buku-5.indd

44

12/13/2010

11:00:05 PM

LAPORAN PENELITIAN

A. ANALISIS PERATURAN PERUNDANG- UNDANGAN TENTANG TOPIK KEBATALAN PERJANJIAN

Terdapat beberapa istilah dalam sistem hukum perdata Indonesia, yaitu ‘batal’, ‘batal demi hukum’, ‘dapat dibatalkan’, ‘membatalkan’, ‘pembatalan’, dan ‘kebatalan’. Terdapat beberapa dasar atas kebatalan suatu perjanjian, yaitu sebagai berikut.

1. Tidak terpenuhinya persyaratan yang ditetapkan oleh undang-undang untuk jenis perjanjian formil, yang berakibat perjanjian batal demi hukum.

2. Tidak terpenuhinya syarat sahnya perjanjian, yang berakibat:

a. perjanjian batal demi hukum, atau

b. perjanjian dapat dibatalkan.

3. Terpenuhinya syarat batal pada jenis perjanjian yang bersyarat.

4. Pembatalan oleh pihak ketiga atas dasar actio pauliana.

5. Pembatalan oleh pihak yang diberi wewenang khusus berdasarkan undang-

undang.

Frasa‘batal demi hukum’merupakan frasa khas bidang hukum yang bermakna‘tidak berlaku, tidak sah menurut hukum’. Dalam pengertian umum, kata batal (saja) sudah berarti tidak berlaku, tidak sah. Jadi, walaupun kata ‘batal’ sesungguhnya sudah cukup menjelaskan bahwa sesuatu menjadi tidak berlaku atau tidak sah, rupanya frasa ‘batal demi hukum’ lebih memberikan kekuatan sebab tidak berlaku atau tidak sahnya sesuatu tersebut dibenarkan atau dikuatkan menurut hukum, bukan hanya tidak berlaku menurut pertimbangan subjektif seseorang atau menurut kesusilaan/ kepatutan. Batal demi hukum berarti bahwa sesuatu menjadi tidak berlaku atau tidak sah karena berdasarkan hukum (atau dalam arti sempit, berdasarkan peraturan perundang-undangan) memang begitulah adanya. Dengan demikian, ‘batal demi hukum’ menunjukkan bahwa tidak berlaku atau tidak sahnya sesuatu tersebut terjadi seketika, spontan, otomatis, atau dengan sendirinya, sepanjang persyaratan atau keadaan yang membuat batal demi hukum itu terpenuhi.

buku-5.indd

45

Penjelasan Hukum tentang Kebatalan Perjanjian 45

12/13/2010

11:00:05 PM

Tidak Terpenuhinya Persyaratan yang Ditetapkan oleh Undang-Undang untukJenisPerjanjianFormil,yangBerakibat Perjanjian Batal Demi Hukum

Pada perjanjian yang tergolong sebagai perjanjian formil, tidak dipenuhinya ketentuan hukum tentang misalnya bentuk atau format perjanjian, cara pembuatan perjanjian, ataupun cara pengesahan perjanjian, sebagaimana diwajibkan melalui peraturan perundang-undangan, berakibat perjanjian formil batal demi hukum.

Ahli hukum memberikan pengertian perjanjian formil sebagai perjanjian yang tidak hanya didasarkan pada adanya kesepakatan para pihak, tetapi oleh undang-undang juga disyaratkan adanya formalitas tertentu yang harus dipenuhi agar perjanjian tersebut sah demi hukum. Formalitas tertentu itu, misalnya tentang bentuk atau format perjanjian yang harus dibuat dalam bentuk tertentu, yakni dengan akta otentik ataupun akta di bawah tangan. Akta otentik yang dimaksud adalah akta yang dibuat oleh Notaris atau pejabat hukum lain yang memiliki kewenangan untuk membuat akta otentik menurut undang-undang. Berikut beberapa contoh perjanjian di bidang Hukum Kekayaan yang harus dilakukan dengan Akta Notaris.

Hibah, kecuali pemberian benda bergerak yang bertubuh atau surat penagihan utang atas tunjuk dari tangan ke tangan: Pasal 1682 dan 1687 KUH Perdata.

Pendirian perseroan terbatas: Pasal 7 butir 1 UU No 40 tahun 2007 tentang Perseroan Terbatas.

Jaminan fidusia: Pasal 5 butir 1 UU No. 42 tahun 1999 tentang Jaminan Fidusia.

Perjanjian penyelesaian sengketa melalui arbitrase setelah sengketa terjadi: Pasal

1.

9 UU No 30 tahun 1999 tentang Arbitrase dan Alternatif Penyelesaian Sengketa.

Surat kuasa membebankan hak tanggungan (SKMHT): Pasal 15 ayat (1) UU No.

4 tahun 1996 tentang Hak Tanggungan atas Tanah Beserta Benda-Benda yang

Berkaitan dengan Tanah. SKMHT dapat pula dibuat dengan Akta Pejabat Pembuat Akta Tanah (PPAT) menurut Pasal 15 ayat (1) UU tersebut.

Pengaturan oleh undang-undang tentang formalitas tertentu yang harus dipenuhi untuk perjanjian formil di atas, memang merupakan pengecualian dari asas konsensualisme dalam hukum perjanjian yang berlaku secara umum. Sebab, menurut asas konsensualisme, suatu perjanjian sudah terbentuk dengan adanya kesepakatan dari para pihak yang membuatnya. Kemudian, agar perjanjian itu sah maka harus memenuhi syarat-syarat dalam Pasal 1320 KUH Perdata. Namun, asas

46 Laporan Penelitian

buku-5.indd

46

12/13/2010

11:00:05 PM

tersebut tidak cukup untuk perjanjian formil karena masih ada formalitas lain yang diatur dalam undang-undang yang harus dipatuhi. Jadi, perjanjian formil memang tidak cukup bila hanya berdasarkan pada asas konsensualisme.

Apabila perbuatan hukum yang wajib dilakukan dalam bentuk formal tertentu yang diwajibkan oleh UU tidak dipatuhi, akan berakibat bahwa perbuatan hukum tersebut batal demi hukum. Hal ini ditegaskan, antara lain, dalam:

a. Pasal 617 ayat (1) KUH Perdata yang berbunyi Tiap-tiap akta dengan mana kebendaan tak bergerak dijual, dihibahkan, dibagi, dibebani, atau dipindahtangankan, harus dibuat dalam bentuk otentik, atas ancaman kebatalan”.

b. Pasal 1682 KUH Perdata yang berbunyi Tiada status hibah, kecuali yang disebutkan dalam Pasal 1687, dapat, atas ancaman batal, dilakukan selainnya dengan statu akta notaris yang aslinya disimpan oleh notaris itu”.

c. Pasal 22 KUH Dagang yang menyebut Tiap firma harus didirikan dengan akta otentik, tetapi ketiadaan akta tidak dapat dikemukakan untuk merugikan pihak ketiga”.

d. Pasal 15 ayat (6) UU No. 4 tahun 1996 tentang Hak Tanggungan atas Tanah Beserta Benda-Benda yang Berkaitan dengan Tanah, menyebutkan bahwa (6) Surat Kuasa Membebankan Hak Tanggungan yang tidak diikuti dengan pembuatan Akta Pemberian Hak Tanggungan dalam waktu yang ditentukan sebagaimana yang dimaksud pada ayat (3) atau ayat (4), atau waktu yang ditentukan menurut ketentuan sebagaimana yang dimaksud pada ayat (5) batal demi hukum.”

e. Pasal 9 UU No. 30 tahun 1999 tentang Arbitrase dan Alternatif Penyelesaian Sengketa: (1) Dalam hal para pihak memilih penyelesaian sengketa melalui arbitrase setelah sengketa terjadi, persetujuan mengenai hal tersebut harus dibuat dalam suatu perjanjian tertulis yang ditandatangani oleh para pihak. (2) Dalam hal para pihak tidak dapat menandatangani perjanjian tertulis sebagaimana dimaksud dalam ayat (1), perjanjian tertulis tersebut harus dibuat dalam bentuk akta notaris. (3) Perjanjian tertulis sebagaimana dimaksud dalam ayat (1) harus memuat: a. masalah yang dipersengketakan; b. nama lengkap dan tempat tinggal para pihak; c. nama lengkap dan tempat tinggal arbiter atau majelis arbitrase; d. tempat arbiter atau majelis arbitrase akan mengambil keputusan; e. nama lengkap

buku-5.indd

47

Penjelasan Hukum tentang Kebatalan Perjanjian 47

12/13/2010

11:00:05 PM

sekretaris; f. jangka waktu penyelesaian sengketa; g. pernyataan kesediaan dari

arbiter; h. pernyataan kesediaan dari pihak yang bersengketa untuk menanggung

segala biaya yang diperlukan untuk penyelesaian sengketa melalui arbitrase. (4) Perjanjian tertulis yang tidak memuat hal sebagaimana dimaksud dalam ayat (3) batal demi hukum”.

2. Tidak Terpenuhinya Syarat Sah Perjanjian

a. Syarat Objektif Perjanjian

Syarat sahnya perjanjian yang diatur dalam Pasal 1320 KUH Perdata adalah

1. kesepakatan mereka yang mengikatkan dirinya,

2. kecakapan untuk membuat suatu perikatan,

3. suatu pokok persoalan tertentu, dan

4. suatu sebab yang tidak terlarang.

Dalam diskursus ilmu hukum perdata, syarat 1dan 2 digolongkan sebagai syarat subjektif artinya bergantung pada subjek yang mengikat dirinya, sementara syarat 3 dan 4 digolongkan sebagai syarat objektif, yaitu kondisi atas terjadinya suatu perjanjian.

Syarat objektif pertama adalah perjanjian mengatur suatu pokok persoalan tertentu/terdapat suatu objek perjanjian. Berikut adalah beberapa pasal KUH Perdata tentang hal-hal yang merupakan suatu pokok persoalan/objek perjanjian.

Pasal 1332: “Hanya barang-barang yang dapat diperdagangkan saja dapat men- jadi pokok persetujuan”.

Pasal 1333:”Suatu persetujuan harus mempunyai pokok suatu barang yang paling sedikit ditentukan jenisnya. Tidaklah menjadi halangan bahwa jumlah barang tidak tentu, asal saja jumlah itu kemudian dapat ditentukan atau dihitung”.

Pasal 1334 ayat (1): Barang yang baru akan ada di kemudian hari dapat menjadi pokok suatu persetujuan”.

Objek perjanjian berupa barang, sebagaimana disebut dalam Pasal 1332, 1333, dan 1334 ayat (1).

48 Laporan Penelitian

buku-5.indd

48

12/13/2010

11:00:05 PM

Pasal 1332: “Hanya barang-barang yang dapat diperdagangkan saja dapat men- jadi pokok persetujuan”.

Pasal 1333: “Suatu persetujuan harus mempunyai pokok suatu barang yang paling sedikit ditentukan jenisnya. Tidaklah menjadi halangan bahwa jumlah barang tidak tentu, asal saja jumlah itu kemudian dapat ditentukan atau dihitung”.

Pasal 1334 ayat (1): “Barang yang baru akan ada di kemudian hari dapat menjadi pokok suatu persetujuan”.

Selanjutnya, berdasarkan Pasal 1332 dan 1333 KUH Perdata, jelaslah bahwa untuk

sahnya perjanjian maka objeknya haruslah tertentu, atau setidaknya cukup dapat ditentukan. Objek perjanjian tersebut dengan demikian haruslah: 20

- dapat diperdagangkan,

- dapat ditentukan jenisnya,

- dapat dinilai dengan uang, dan

- memungkinkan untuk dilakukan/dilaksanakan.

Syarat objektif kedua adalah perjanjian tidak memuat suatu sebab yang dilarang. Berikut adalah beberapa pasal KUH Perdata tentang sebab-sebab yang dilarang.

Pasal 1335: Suatu perjanjian tanpa sebab atau yang telah dibuat karena sesuatu sebab yang palsu atau terlarang, tidak mempunyai kekuatan.

Pasal 1337: Dilarang oleh undang-undang atau apabila berlawanan dengan kesusilaan baik atau ketertiban umum.

Beberapa pasal di luar KUH Perdata yang mengatur tentang suatu sebab yang dilarang dan sebab-sebab yang dilarang tersebut menyebabkan perjanjian tersebut batal demi/karena hukum.

buku-5.indd

20 Herlien Budiono, Catatan No. 5 di atas, halaman 107.

49

Penjelasan Hukum tentang Kebatalan Perjanjian 49

12/13/2010

11:00:05 PM

a. UU No. 5 tahun 1960 tentang Peraturan Dasar Pokok-Pokok Agraria

Pasal 26 ayat (2) yang menyatakan bahwa “Setiap jual-beli, penukaran, penghibahan, pemberian dengan wasiat dan perbuatan-perbuatan lain yang dimaksudkan untuk langsung atau tidak langsung memindahkan hak milik kepada orang asing, kepada seorang warganegara yang di samping kewarganegaraan Indonesianya mempunyai kewarganegaraan asing atau kepada suatu badan hukum kecuali yang ditetapkan oleh Pemerintah termaksud dalam Pasal 21 ayat (2), adalah batal karena hukum dan tanahnya jatuh kepada Negara, dengan ketentuan bahwa hak-hak pihak lain yang membebaninya tetap berlangsung serta semua pembayaran yang telah diterima oleh pemilik tidak dapat dituntut kembali”.

b. UU No. 13 tahun 2003 tentang Ketenagakerjaan

Pasal 124: “(3) Dalam hal isi perjanjian kerja bersama bertentangan dengan peraturan perundang-undangan yang berlaku sebagaimana dimaksud dalam ayat (2), maka ketentuan yang bertentangan tersebut batal demi hukum dan yang berlaku adalah ketentuan dalam peraturan perundang-undangan.”

Pasal 127: ”(1) Perjanjian kerja yang dibuat oleh pengusaha dan pekerja/ buruh tidak boleh bertentangan dengan perjanjian kerja bersama. (2). Dalam hal ketentuan dalam perjanjian kerja sebagaimana dimaksud dalam ayat (1) bertentangan dengan perjanjian kerja bersama, maka ketentuan dalam perjanjian kerja tersebut batal demi hukum dan yang berlaku adalah ketentuan dalam perjanjian kerja bersama”.

Pasal 153 ayat (2)

Pemutusan hubungan kerja yang dilakukan dengan alasan sebagaimana dimaksud dalam ayat (1) batal demi hukum dan pengusaha wajib mempekerjakan kembali pekerja/buruh yang bersangkutan.

c. UU No. 4 tahun 1996 tentang Hak Tanggungan atas Tanah Beserta Benda-Benda yang Berkaitan dengan Tanah

Pasal 12: “Janji yang memberikan kewenangan kepada pemegang Hak Tanggungan untuk memiliki objek Hak Tanggungan apabila debitor cidera janji, batal demi hukum”.

Pasal 20: “(4) Setiap janji untuk melaksanakan eksekusi Hak Tanggungan dengan cara yang bertentangan dengan ketentuan pada ayat (1), ayat (2), dan ayat (3) batal demi hukum”.

50 Laporan Penelitian

buku-5.indd

50

12/13/2010

11:00:05 PM

d. UU No. 42 tahun 1999 tentang Jaminan Fidusia

Pasal 32: “Setiap janji untuk melaksanakan eksekusi terhadap Benda yang menjadi objek Jaminan Fidusia dengan cara yang bertentangan dengan ketentuan sebagaimana dimaksud dalam Pasal 29 dan Pasal 31, batal demi hukum”.

Pasal 33: “Setiap janji yang memberikan kewenangan kepada Penerima Fidusia untuk memiliki Benda yang menjadi objek Jaminan Fidusia apabila debitor cidera janji, batal demi hukum”.

e. UU No. 8 tahun 1999 tentang Perlindungan Konsumen

Pasal 18: “(3) Setiap klausula baku yang telah ditetapkan oleh pelaku usaha pada dokumen atau perjanjian yang memenuhi ketentuan sebagaimana dimaksud pada ayat (1) dan ayat (2) dinyatakan batal demi hukum”.

f. UU No. 25 tahun 2007 tentang Penanaman Modal

Pasal 33: “(1) Penanam modal dalam negeri dan penanam modal asing yang melakukan penanaman modal dalam bentuk perseroan terbatas dilarang membuat perjanjian dan/atau pernyataan yang menegaskan bahwa kepemilikan saham dalam perseroan terbatas untuk dan atas nama orang lain. (2) Dalam hal penanam modal dalam negeri dan penanam modal asing membuat perjanjian dan/atau pernyataan sebagaimana dimaksud pada ayat (1), perjanjian dan/atau pernyataan itu dinyatakan batal demi hukum”.

g. UU No. 40 tahun 2007 tentang Perseroan Terbatas

Pasal 37: “(2) Pembelian kembali saham, baik secara langsung maupun tidak langsung, yang bertentangan dengan ayat (1) batal karena hukum. (3) Direksi secara tanggung renteng bertanggung jawab atas kerugian yang diderita pemegang saham yang beritikad baik, yang timbul akibat pembelian kembali yang batal karena hukum sebagaimana dimaksud pada ayat (2)”.

h. UU No. 25 tahun 2009 tentang Pelayanan Publik

Pasal 27: “(1) Saham penyelenggara yang berbentuk badan usaha milik negara dan badan usaha milik daerah yang berkaitan dengan pelayanan publik dilarang dipindahtangankan dalam keadaan apa pun, baik langsung maupun tidak langsung melalui penjualan, penjaminan atau hal-hal yang mengakibatkan beralihnya kekuasaan menjalankan korporasi atau hilangnya

buku-5.indd

51

Penjelasan Hukum tentang Kebatalan Perjanjian 51

12/13/2010

11:00:05 PM

hak-hak yang menjadi milik korporasi sebagaimana diatur dalam peraturan perundang-undangan. (2) Perbuatan sebagaimana dimaksud pada ayat (1) dinyatakan batal demi hukum.”

i. UU No. 14 tahun 2001 tentang Paten

Pasal 66: “(1) Paten dapat beralih atau dialihkan baik seluruhnya maupun sebagian karena: a. pewarisan, b. hibah, c. wasiat, d. perjanjian tertulis, atau e. sebab lain yang dibenarkan oleh peraturan perundang-undangan. (2) Pengalihan Paten sebagaimana dimaksud pada ayat (1) huruf a, huruf b, dan huruf c, harus disertai dokumen asli Paten berikut hak lain yang berkaitan dengan Paten itu. (3) Segala bentuk pengalihan Paten sebagaimana dimaksud pada ayat (1) wajib dicatat dan diumumkan dengan dikenai biaya. (4) Pengalihan Paten yang tidak sesuai dengan ketentuan Pasal ini tidak sah dan batal demi hukum”.

j. Perpu Nomor 7 Tahun 1962 tentang Penggunaan dan Pengawasan Atas Penggunaan Dana-Dana Investasi

Pasal 5

“Setiap perjanjian yang diadakan oleh perusahaan/badan termaksud yang bertentangan dengan ketentuan-ketentuan dalam atau berdasarkan Peraturan Pemerintah Pengganti Undang-undang ini adalah batal karena hukum”.

k. UU No. 26 tahun 1997 tentang Hukum Disiplin Prajurit Angkatan Bersenjata Republik Indonesia

Pasal 12 ayat 3

“Perjanjian kerja yang dibuat oleh para pihak, yang bertentangan dengan ketentuan sebagaimana dimaksud pada ayat (1) huruf c dan huruf d batal demi hukum”.

Pasal 18 ayat 2

“Dalam hal disyaratkan masa percobaan kerja dalam perjanjian kerja sebagaimana dimaksud pada ayat (1), masa percobaan yang disyaratkan batal demi hukum”.

52 Laporan Penelitian

buku-5.indd

52

12/13/2010

11:00:05 PM

l. UU No. 30 tahun 1999 tentang Arbitrase dan Alternatif Penyelesaian Sengketa

Pasal 9 pada dasarnya menyatakan bahwa perjanjian untuk mengadakan arbitrase setelah sengketa muncul yang tidak dibuat secara tertulis dinyatakan batal demi hukum.

b. Syarat Subjektif Perjanjian

Terdapat perbedaan antara perjanjian yang batal demi hukum dengan perjanjian yang dapat dibatalkan. Hal yang disebut terakhir ini terjadi apabila perjanjian tersebut tidak memenuhi unsur subjektif untuk sahnya perjanjian sebagaimana diatur dalam Pasal 1320 KUH Perdata, yaitu kesepakatan para pihak dan kecakapan para pihak untuk melakukan perbuatan hukum. Akibat hukumnya adalah perjanjian tersebut dapat dibatalkan (voidable atau vernietigbaar).

1)

Cacat pada Pihak yang Membuat Perjanjian Pada prinsipnya, setiap orang sepanjang tidak ditentukan lain oleh undang- undang, dianggap cakap atau mampu melakukan tindakan hukum yang dalam konteks ini adalah membuat perjanjian sehingga menimbulkan perikatan. Hal ini ditegaskan dalam Pasal 1329 KUH Perdata yang berbunyi“Setiap orang adalah cakap untuk membuat perikatan-perikatan, terkecuali ia oleh undang-undang dinyatakan tidak cakap”. Orang yang oleh undang-undang dinyatakan tidak cakap, dilarang melakukan tindakan hukum termasuk membuat perjanjian. 21 Pasal 1330 KUH Perdata menyebut bahwa “Tidak cakap untuk membuat persetujuan-persetujuan adalah:

1. orang-orang yang belum dewasa,

2. mereka yang ditaruh di bawah pengampuan”.

Akibat hukum bagi perikatan yang ditimbulkan dari perjanjian yang dibuat oleh mereka yang tidak cakap hukum, diatur dalam Pasal 1446 yang menyatakan bahwa “(1) Semua perikatan yang dibuat oleh anak-anak yang belum dewasa atau

21 Istilah undang-undang di sini dipakai karena Pasal 1329 KUH Perdata menyebutnya demikian. Namun, sebaiknya perlu diingat bahwa undang-undang lebih sempit maknanya daripada perundang-undangan sebab yang terakhir ini mencakup peraturan hukum yang tidak hanya berupa undang-undang.

buku-5.indd

53

Penjelasan Hukum tentang Kebatalan Perjanjian 53

12/13/2010

11:00:06 PM

orang-orang yang berada di bawah pengampuan adalah batal demi hukum, dan atas tuntutan yang diajukan oleh atau dari pihak mereka, harus dinyatakan batal, semata-mata atas dasar kebelumdewasaan atau pengampuannya (2) Perikatan yang dibuat oleh perempuan yang bersuami dan oleh anak-anak yang belum dewasa yang telah disamakan dengan orang dewasa, tidak batal demi hukum, sejauh perikatan tersebut tidak melampaui batas kekuasaan mereka”.

Contoh pasal yang mengatur tentang kecakapan bertindak.

Pasal 1446 ayat (1) KUH Perdata Semua perikatan yang dibuat oleh anak-anak yang belum dewasa atau orang- orang yang berada di bawah pengampuan adalah batal demi hukum, dan atas tun- tutan yang diajukan oleh atau dari pihak mereka, harus dinyatakan batal, semata- mata atas dasar kebelumdewasaan atau pengampuannya (2) Perikatan yang dibuat oleh perempuan yang bersuami dan oleh anak-anak yang belum dewasa yang telah disamakan dengan orang dewasa, tidak batal demi hukum, sejauh perikatan terse- but tidak melampaui batas kekuasaan mereka”.

Pasal 1331 KUH Perdata Oleh karena itu, orang-orang yang dalam pasal yang lalu dinyatakan tidak cakap untuk membuat persetujuan, boleh menuntut pembatalan perikatan yang telah mer- eka buat dalam hal kuasa itu tidak dikecualikan oleh UU. Orang-orang yang cakap untuk mengikatkan diri, sama sekali tidak dapat mengemukakan sangkalan atas dasar ketidakcakapan anak-anak yang belum dewasa, orang-orang yang ditaruh di bawah pengampuan, dan perempuan-perempuan yang bersuami”.

Pasal 55 ayat (4) UU No. 23 tahun 1999 tentang Bank Indonesia Bank Indonesia dilarang membeli untuk diri sendiri surat-surat utang negara seba- gaimana dimaksud pada ayat (1), kecuali di pasar sekunder. (5) Perbuatan hukum Bank Indonesia membeli surat utang negara untuk diri sendiri tidak di pasar sekunder sebagaimana dimaksud pada ayat (4), dinyatakan batal demi hukum”.

Pasal 56 ayat (1) UU No. 23 tahun 1999 tentang Bank Indonesia Bank Indonesia dilarang memberikan kredit kepada Pemerintah. (2) Dalam hal Bank Indonesia melanggar ketentuan sebagaimana dimaksud pada ayat (1), perjanjian pemberian kredit kepada Pemerintah tersebut batal demi hukum”.

54 Laporan Penelitian

buku-5.indd

54

12/13/2010

11:00:06 PM

2)

Tidak Adanya Kata Sepakat

Unsur subjektif kedua untuk sahnya perjanjian adalah kesepakatan antarpihak yang membuatnya. KUH Perdata tidak menjelaskan tentang apa yang diartikan dengan sepakat, tetapi sebaliknya justru mengatur tentang kondisi yang menyebabkan tidak adanya kata sepakat dari para pihak yang membuatnya. Dengan kata lain, KUH Perdata menyebutkan beberapa jenis keadaan atau kondisi tertentu yang menjadikan perjanjian menjadi cacat sehingga terancam kebatalan. Pasal-pasal tersebut adalah 1321, 1322, 1323, 1324, 1325, 1328 sebagai berikut.

Pasal 1321: Tiada suatu persetujuan pun mempunyai kekuatan jika diberikan karena kekhilafan atau diperoleh dengan paksaan atau penipuan”.

Pasal 1322: Kekhilafan tidak mengakibatkan batalnya suatu persetujuan, kecuali jika kekhilafan itu terjadi mengenai hakikat barang yang menjadi pokok persetujuan. Kekhilafan tidak mengakibatkan kebatalan, jika kekhilafan itu hanya terjadi mengenai diri orang yang dengannya seseorang bermaksud untuk mengadakan persetujuan, kecuali jika persetujuan itu diberikan terutama karena diri orang yang bersangkutan”.

Pasal 1324: Paksaan telah terjadi apabila perbuatan itu sedemikian rupa hingga dapat menakutkan seorang yang berpikiran sehat, dan apabila perbuatan itu dapat menimbulkan ketakutan pada orang tersebut bahwa dirinya atau kekayaannya terancam dengan suatu kerugian yang terang dan nyata. Dalam mempertimbangkan hal itu, harus diperhatikan usia, kelamin, dan kedudukan orang-orang yang bersangkutan”.

Pasal 1323: Paksaan yang dilakukan terhadap orang yang mengadakan suatu persetujuan mengakibatkan batalnya persetujuan yang bersangkutan, juga bila paksaan itu dilakukan oleh pihak ketiga yang tidak berkepentingan dalam persetujuan yang dibuat itu”.

Pasal 1325: Paksaan menjadikan suatu persetujuan batal, bukan hanya bila dilakukan terhadap salah satu pihak yang membuat persetujuan, melainkan juga

buku-5.indd

55

Penjelasan Hukum tentang Kebatalan Perjanjian 55

12/13/2010

11:00:06 PM

bila dilakukan terhadap suami atau istri atau keluarganya dalam garis ke atas maupun ke bawah”.

Pasal 1328: Penipuan merupakan suatu alasan untuk membatalkan suatu persetujuan bila penipuan yang dipakai oleh salah satu pihak adalah sedemikian rupa sehingga nyata bahwa pihak yang lain tidak akan mengadakan perjanjian itu tanpa adanya tipu muslihat. Penipuan tidak dapat hanya dikira-kira melainkan harus dibuktikan”.

Tentang kekhilafan, kekhilafan terjadi bila salah satu pihak khilaf tentang hal-hal yang pokok dari apa yang diperjanjikan atau tentang sifat-sifat yang penting dari barang yang menjadi objek perjanjian, ataupun mengenai orang dengan siapa diadakan perjanjian itu. Perjanjian memang telah terbentuk, namun terjadinya perjanjian itu berada di bawah pengaruh kekeliruan atau kesesatan sehingga bila kekeliruan itu diketahui sebelumnya maka tidak akan terbentuk perjanjian. Kekeliruan itu harus sedemikian rupa sehingga seandainya orang itu tidak khilaf mengenai hal-hal tersebut, ia tidak akan memberikan persetujuannya.

Tentang paksaan dalam KUH Perdata adalah paksaan secara kejiwaan atau rohani, atau suatu situasi dan kondisi di mana seseorang secara melawan hukum mengancam orang lain dengan ancaman yang terlarang menurut hukum sehingga orang yang berada di bawah ancaman itu berada di bawah ketakutan dan akhirnya memberikan persetujuannya dengan tidak secara bebas. Ancaman itu menimbulkan ketakutan sedemikian rupa sehingga meskipun kehendak orang yang diancam itu betul telah dinyatakan, kehendak tersebut menjadi cacat hukum karena terjadi akibat adanya ancaman. Tanpa adanya ancaman, kehendak itu tidak akan pernah terwujud. Paksaan juga dapat dilakukan oleh pihak ketiga yang sebenarnya tidak berkepentingan dalam perjanjian tersebut. Apa yang diancamkan berupa kerugian pada orang atau kebendaan milik orang tersebut atau kerugian terhadap pihak ketiga atau kebendaan milik pihak ketiga (Pasal 1325 KUH Perdata). Namun, perlu diperhatikan bahwa pembuat undang- undang membedakan antara paksaan yang membuat perjanjian mengandung unsur cacat kehendak dari pihak yang membuatnya sehingga terancam pembatalan, dengan rasa takut karena hormat kepada anggota keluarga dalam

56 Laporan Penelitian

buku-5.indd

56

12/13/2010

11:00:06 PM

garis lurus ke atas. Hal ini tampak dari bunyi Pasal 1326, yaitu “Rasa takut karena hormat terhadap ayah, ibu atau keluarga lain dalam garis lurus ke atas, tanpa disertai kekerasan, tidak cukup untuk membatalkan persetujuan”.

Terkait penipuan, penipuan terjadi bila satu pihak dengan sengaja memberikan keterangan palsu atau tidak benar disertai akal cerdik atau tipu muslihat untuk membujuk pihak lawan agar memberikan persetujuannya. Pihak yang menipu bertindak aktif untuk menjerumuskan pihak lawan. Akibat hukum bagi perjanjian yang dibuat karena adanya cacat pada kehendak pihak yang membuatnya sehingga tidak ada kata sepakat, adalah dapat dibatalkan. Hal ini didasarkan pada ketentuan Pasal 1449 KUH Perdata yang menegaskan bahwa “Perikatan yang dibuat dengan paksaan, penyesatan atau penipuan, menimbulkan tuntutan untuk membatalkannya”.

3)

Batal Demi Hukum Karena Ada Syarat Batal yang Terpenuhi Syarat batal dalam sebuah perjanjian adalah suatu peristiwa atau fakta tertentu yang belum tentu akan terjadi di masa depan, namun para pihak dalam perjanjian itu sepakat bahwa bila peristiwa atau fakta tersebut benar terjadi maka perjanjian tersebut menjadi batal. Syarat batal ini merupakan kebalikan dari syarat tangguh, yang apabila peristiwa atau fakta yang belum tentu terjadi di masa depan itu benar terjadi adanya maka justru membuat lahirnya perjanjian yang bersangkutan. Ketentuan tentang kedua syarat ini diatur dalam Pasal 1253 KUH Perdata yang menyebut bahwa “Suatu perikatan adalah bersyarat jika digantungkan pada suatu peristiwa yang mungkin terjadi dan memang belum terjadi, baik dengan cara menangguhkan berlakunya perikatan itu sampai terjadinya peristiwa itu, maupun dengan cara membatalkan perikatan itu, tergantung pada terjadi tidaknya peristiwa itu”.

Perjanjian bersyarat yang pelaksanaannya semata-mata digantungkan pada kemauan orang yang membuat perjanjian itu menurut Pasal 1256 KUH Perdata adalah batal demi hukum. Pasal 1256 KUH Perdata menegaskan bahwa “Semua perikatan adalah batal, jika pelaksanaannya semata-mata tergantung pada kemauanorangyangterikat.Tetapijikaperikatantergantungpadasuatuperbuatan

buku-5.indd

57

Penjelasan Hukum tentang Kebatalan Perjanjian 57

12/13/2010

11:00:06 PM

yang pelaksanaannya berada dalam kekuasaan orang tersebut, dan perbuatan itu telah terjadi, maka perikatan itu adalah sah”. Alasan dari ketentuan ini masuk akal mengingat bahwa mengharapkan terjadinya suatu perjanjian semata-mata hanya pada kehendak atau kemauan seseorang merupakan hal aneh kalau tak dapat disebut sia-sia sebab perjanjian seperti itu tidak akan terjadi bila orang itu tidak menghendakinya.

Demikian pula bila perjanjian memuat syarat yang bertujuan melakukan sesuatu yang tak mungkin terlaksana, atau yang bertentangan dengan kesusilaan yang baik, atau bahkan yang dilarang oleh undang-undang, adalah batal demi hukum. Hal ini ditegaskan dalam Pasal 1254 KUH Perdata yang berbunyi “Semua syarat yang bertujuan melakukan sesuatu yang tak mungkin terlaksana, sesuatu yang bertentangan dengan kesusilaan yang baik, atau sesuatu yang dilarang oleh UU adalah batal dan mengakibatkan persetujuan yang digantungkan padanya tak berlaku”. Aturan ini mirip dengan syarat objektif untuk sahnya perjanjian, yaitu syarat kausa yang halal.

Perjanjian dengan syarat batal yang menjadi batal demi hukum karena syarat batal tersebut terpenuhi, menimbulkan akibat kembalinya keadaan pada

kondisi semula pada saat timbulnya perikatan itu atau dengan kata lain, perjanjian yang batal demi hukum seperti itu berlaku surut hingga ke titik awal perjanjian itu dibuat. Akibat selanjutnya adalah pihak yang telah menerima prestasi atau sesuatu dari pihak lain maka ia harus mengembalikannya. Pasal

1265 KUH Perdata mengatur hal ini dengan menyebut bahwa“Suatu syarat batal

adalah syarat yang bila dipenuhi akan menghapuskan perikatan dan membawa segala sesuatu kembali pada keadaan semula, seolah-olah tidak pernah ada suatu

perikatan. Syarat ini tidak menunda pemenuhan perikatan; ia hanya mewajibkan kreditur mengembalikan apa yang telah diterimanya, bila peristiwa yang dimaksudkan terjadi”.

4)

Pembatalan oleh Pihak Ketiga Atas Dasar Actio Pauliana

Pembatalan oleh pihak ketiga berdasarkan actio pauliana diatur dalam Pasal

1341 KUH Perdata.

Pasal 1340 KUH Perdata berbunyi “Persetujuan hanya berlaku antara pihak-pihak yang membuatnya. Persetujuan tidak dapat merugikan pihak ketiga; persetujuan

58 Laporan Penelitian

buku-5.indd

58

12/13/2010

11:00:06 PM

tidak dapat memberi keuntungan kepada pihak ketiga selain dalam hal yang ditentukan dalam Pasal 1317”.
tidak dapat memberi keuntungan kepada pihak ketiga selain dalam hal yang
ditentukan dalam Pasal 1317”. Kemudian, Pasal 1341 menyebutkan bahwa “(1)
Meskipun demikian, tiap kreditur boleh mengajukan tidak berlakunya segala
tindakan yang tidak diwajibkan yang dilakukan oleh debitur, dengan nama apa
pun juga, yang merugikan kreditur, asal dibuktikan bahwa ketika tindakan tersebut
dilakukan, debitur dan orang yang dengannya atau untuknya debitur itu bertindak,
mengetahui bahwa tindakan itu mengakibatkan kerugian bagi para kreditur. (2)
Hak-hak yang diperoleh pihak ketiga dengan itikad baik atas barang-barang yang
menjadi objek dari tindakan yang tidak sah, harus dihormati. (3) Untuk mengajukan
batalnya tindakan yang dengan cuma-cuma dilakukan debitur, cukuplah kreditur
menunjukkan bahwa pada waktu melakukan tindakan itu debitur mengetahui
bahwa dengan cara demikian dia merugikan para kreditur, tak peduli apakah
orang yang diuntungkan juga mengetahui hal itu atau tidak”.
5)
Pembatalan
oleh
Pihak
yang
Diberi
Wewenang
Khusus
Berdasarkan
Undang-Undang
Selain beberapa hal atau kondisi tertentu yang dapat mengakibatkan batalnya
perjanjian seperti dijelaskan di atas, masih ada satu kondisi ‘khusus’ lagi, yaitu
pembatalan perjanjian oleh pihak tertentu atas kuasa undang-undang yang
secara eksplisit menyatakan hal tersebut. Maksudnya, terdapat norma hukum
dalam sebuah UU yang menyatakan bahwa lembaga atau pejabat publik
tertentu berdasarkan UU tersebut berwenang untuk membatalkan perjanjian
tertentu. Hal ini ditemukan dalam peraturan berikut ini:
a. UU No. 24 tahun 2004 tentang Lembaga Penjamin Simpanan (LPS)
• Pasal 6 ayat (2): “LPS dapat melakukan penyelesaian dan penanganan Bank
Gagal dengan kewenangan:
meninjau ulang, membatalkan, mengakhiri, dan/atau mengubah setiap
kontrak yang mengikat Bank Gagal yang diselamatkan dengan pihak ketiga
yang merugikan bank”.
• Pasal
26:
Setelah
RUPS
menyerahkan
hak
dan
wewenang
sebagaimana
dimaksud dalam Pasal 25, LPS dapat melakukan tindakan sebagai berikut:
Penjelasan Hukum tentang Kebatalan Perjanjian 59
buku-5.indd
59
12/13/2010
11:00:06 PM

meninjau ulang, membatalkan, mengakhiri, dan/atau mengubah kontrak bank yang mengikat bank dengan pihak ketiga, yang menurut LPS merugikan bank.

Pasal 52 ayat (1): “Untuk kepentingan aset atau kewajiban bank dalam likuidasi, tim likuidasi dapat meminta pembatalan kepada pengadilan niaga atas segala perbuatan hukum bank yang mengakibatkan berkurangnya aset atau bertambahnya kewajiban bank, yang dilakukan dalam jangka waktu 1 (satu) tahun sebelum pencabutan izin usaha”.

Pasal 52 ayat (2): “Dikecualikan dari ketentuan sebagaimana dimaksud pada ayat (1) adalah perbuatan hukum bank yang bersangkutan yang wajib dilakukan berdasarkan Undang-Undang”.

b.

UU No. 10 tahun 1998 tentang Perubahan atas UU No. 7 tahun 1992 tentang Perbankan

Pasal 37 A:

1. Apabila menurut penilaian Bank Indonesia terjadi kesulitan Perbankan yang membahayakan perekonomian nasional, atas permintaan Bank Indonesia, Pemerintah setelah berkonsultasi kepada Dewan Perwakilan Rakyat Republik Indonesia dapat membentuk badan khusus yang bersifat sementara dalam rangka penyehatan Perbankan.

2. Badan khusus sebagaimana dimaksud dalam ayat (1) melakukan program penyehatan terhadap bank-bank yang ditetapkan dan diserahkan kepada badan dimaksud.

3. Dalam melaksanakan program penyehatan terhadap bank-bank khusus sebagaimana dimaksud dalam ayat (1) mempunyai wewenang sebagaimana dimaksud dalam Pasal 37 ayat (1) serta wewenang lain, yaitu meninjau ulang, membatalkan, mengakhiri, dan atau mengubah kontrak yang mengikat bank dengan pihak ketiga, yang menurut pertimbangan badan khusus merugikan bank.

60 Laporan Penelitian

buku-5.indd

60

12/13/2010

11:00:06 PM

B. ANALISIS LITERATURTENTANGTOPIK KEBATALAN PERJANJIAN

Analisis literatur ini dilakukan dengan bersandar pada beberapa isu berikut ini:

1. tidak terpenuhinya persyaratan yang ditetapkan oleh undang-undang untuk jenis perjanjian formil, yang berakibat perjanjian batal demi hukum,

2. tidak terpenuhinya syarat sahnya perjanjian, yang berakibat:

a. perjanjian batal demi hukum, atau

b. perjanjian dapat dibatalkan.

3. terpenuhinya syarat batal pada jenis perjanjian yang bersyarat, dan

4. pembatalan oleh pihak ketiga atas dasar actio pauliana.

oleh

Undang-Undang untuk Jenis Perjanjian Formil, yang Berakibat Perjanjian Batal Demi Hukum

Walaupun terdapat konsensualisme/kesepakatan di antara para pihak, suatu perjanjian tidak serta merta sah di hadapan hukum, jika terdapat syarat formil yang tidak dipenuhi.

Persyaratan

1.

Tidak

Terpenuhinya

yang

Ditetapkan

a. Subekti 22

Terhadap Asas Konsensualisme yang dikandung oleh Pasal 1320 KUH Perdata, ada pengecualiannya, yaitu oleh undang–undang telah ditetapkan suatu formalitas untuk beberapa macam perjanjian. Misalnya, untuk perjanjian penghibahan benda tak bergerak, di mana harus dilakukan dengan akta notaris. Selanjutnya, perjanjian perdamaian, harus dibuat secara tertulis, dan sebagainya. Perjanjian-perjanjian tersebut dinamakan perjanjian “Formil”, dan apabila perjanjian yang itu tidak memenuhi formalitas yang ditetapkan oleh undang-undang maka perjanjian- perjanjian tersebut akan “batal demi hukum”.

b. Herlien Boediono 23

Perjanjian terbentuk karena adanya perjumpaan kehendak dari pihak-pihak. Perjanjian pada pokoknya dapat dibuat bebas tidak terikat bentuk dan tercapai tidak secara formil, tetapi cukup melalui konsensus belaka.

22 Subekti, Hukum Perjanjian, Cetakan ke-17, Jakarta: Intermasa, 1998.

23 Herlien Boediono, Ajaran Umum: Hukum Perjanjian dan Penerapannya di Bidang Kenotariatan, Cetakan I, Bandung: Citra Aditya Bakti, 2009.

buku-5.indd

61

Penjelasan Hukum tentang Kebatalan Perjanjian 61

12/13/2010

11:00:06 PM

Di dalam sistem hukum Romawi, perjanjian baru dianggap terbentuk jika kebendaan yang bersangkutan diserahkan. Hukum Romawi berpegang teguh pada aturan bahwa semua perjanjian, dengan memperhatikan beberapa pengecualian khusus, harus memenuhi sejumlah persyaratan sebelum dapat dikatakan telah terbukti. Sekalipun ada kecenderungan untuk memberikan pengakuan terhadap asas konsensualisme tersebut, aturan umum, nudus consensus obligat pada waktu itu dianggap tidak berlaku.

Perkembangan dari hukum pada umumnya ataupun hukum kontrak pada khususnya selain itu juga sangat dipengaruhi oleh hukum gereja (hukum kononik) yang berkembang pada Abad Pertengahan di Eropa. Gereja sebagai institusi politik, tidak saja menyediakan sakramen (upacara gereja), tetapi sekaligus juga menjaga ketertiban umum. Pada zaman itu, tuan-tuan tanah lokal tiada hentinya saling berperang. Akibat terlalu sibuk berebut kekuasaan, acapkali urusan menjalankan kekuasaan administrasi atau menjaga dan memelihara kepentingan hukum atau ketertiban masyarakat menjadi terabaikan. Gerejalah ysng kemudian menjadi satu- satunya otoritas yang berhasil menjaga kepentingan dan ketertiban umum. Bahkan karena pengaruhnya, berhasil mempersatukan dunia (peradaban) Barat.

Gereja sadar bahwa mereka memiliki kemampuan untuk membuat ketentuan- ketentuan yang didukung ancaman sanksi. Berkenaan dengan itu, gereja tidak saja dapat mengggunakan hukum yang bersifat duniawi, tetapi juga rohani. Alat paksa yang didayagunakan gereja ialah ex communication (pengecualian dari komunitas). Pada waktu itu, berkembang kebiasaan untuk menggunakan sumpah sebagai cara formil untuk menegaskan adanya perjanjian. Kira-kira pada abad ke-13, di bawah pengaruh para teolog moral, secara perlahan berkembang pandangan bahwa kesepakatan atau perjanjian yang tidak dikukuhkan dengan sumpah juga memiliki kekuatan mengikat. Dengan adanya asas nudus consensus obligat, hukum kontrek memasuki tahapan yang sama sekali baru.

Pada dasarnya, UU memberikan suatu pengecualian dengan menentukan selain adanya kata sepakat, juga dibutuhkan formalitas tertentu bagi pembentukan beberapa jenis perjanjian tertentu. Adakalanya untuk sahnya beberapa perjanjian, UU menghendaki agar perjanjian tersebut dibuat dalam bentuk tertentu. Dalam hal ini, wajib dibuat akta di bawah tangan atau akta otentik.

62 Laporan Penelitian

buku-5.indd

62

12/13/2010

11:00:06 PM

TujuanpembuatUUdenganmembuatpengecualiandiatasadalahuntukmemberikan perlindungan kepada pihak lemah, terhadap dirinya sendiri, atau terhadap pihak lawan, satu dan lain dengan mengingat sifat terbukanya perjanjian. Singkat kata, tujuannya ialah memberikan jaminan kepastian hukum dan keseimbangan dalam lalu lintas pergaulan hukum. Tujuan lain dari persyaratan demikian adalah untuk memberikan suatu kekhidmatan pada perjanjian atau semacam jaminan untuk akibatnya di kemudia hari.

Akta untuk perjanjian formil adalah syarat mutlak bagi keabsahan pembuatan hukum yang bersangkutan. Sementara untuk perjanjian yang tidak digolongkan pada perjanjian formil, fungsi akta adalah sekadar sebagai alat bukti. Dengan perkataan lain, untuk perbuatan hukum yang tidak digolongkan pada perjanjian formil, tetapi oleh para pihak dibuat dalam bentuk tertulis, fungsi akta dalam hal ini adalah sebagai alasan alat bukti.

Di dalam praktik kerap terjadi penafsiran keliru mengenai kewajiban memenuhi bentuk tertentu untuk perjanjian formil dan apa akibatnya jika kewajiban tersebut dilanggar. Sebagaimana disebutkan di dalam ketentuan Pasal 5 ayat (1) UU Fidusia, pembebanan benda dengan jaminan fidusia dibuat dengan akta notaris dalam bahasa Indonesia. Jaminan fidusia yang dibuat tidak dalam bentuk akta notaris dalam bahasa Indonesia secara yuridis dogmatis menjadi nonexistent dengan akibat hukumnya adalah batal. Namun, ada pihak-pihak yang menafsirkannya berbeda. Mereka dengan mendasarkan diri pada ketentuan Pasal 1338 ayat (1) KUH Perdata berpendapat bahwa perjanjian tersebut tetap sah dan berdalih bahwa semua perjanjian berlaku sebagai undang-undang bagi mereka yang membuatnya. Betul bahwa pada prinsipnya ketentuan perundang-undangan berkenaan dengan perjanjian dikategorikan sebagai hukum yang bersifat mengatur.

Kehendak bebas tersebut masih“dibatasi”, yaitu harus pula“dibuat secara sah”. Berarti bahwa kebebasan tersebut sepanjang menyangkut pembuatan fidusia sebagai perjanjian formil dibatasi oleh adanya keharusan yang bersifat memaksa. Jaminan fidusia baru dianggap absah apabila dibuat dalam bentuk akta notaris dalam bahasa Indonesia sesuai bunyi ketentuan Pasal 5 ayat (1) UU tentang Fidusia.

buku-5.indd

63

Penjelasan Hukum tentang Kebatalan Perjanjian 63

12/13/2010

11:00:06 PM

c.

Kartini Muljadi 24

Selain ketidakpemenuhannya syarat objektif dalam suatu perjanjian yang berakibat batal demi hukum, undang-undang juga merumuskan secara konkret untuk tiap- tiap perbuatan hukum (terutama pada perjanjian formil) yang mensyaratkan dibentuknya perjanjian dalam bentuk yang ditentukan oleh undang-undang, yang jika tidak dipenuhi maka perjanjian tersebut batal demi hukum (tidak memiliki kekuatan dalam pelaksanaannya) (hlm. 142).

2. Tidak Terpenuhinya Syarat Sahnya Perjanjian

a. Subekti 25

Empat syarat sahnya suatu perjanjian tersebut tercantum dalam Pasal 1320 KUH Perdata. Dua syarat pertama, dinamakan syarat-syarat subjektif karena mengenai orang-orangnya atau subjeknya yang mengadakan perjanjian, sedangkan dua syarat terakhir dinamakan syarat- syarat objektif karena mengenai perjajiannya sendiri atau objek dari perbuatan hukum yang dilakukan itu.

Dengan sepakat atau dengan nama lain dinamakan perizinan, dimaksudkan bahwa kedua subjek yang mengadakan perjanjian itu harus bersepakat atau setuju mengenai hal-hal yang pokok dari perjanjian yang diadakan itu. Untuk syarat yang kedua, yaitu setiap orang yang membuat perjanjian itu harus cakap, yang dimaksud

di sini pada asasnya adalah setiap orang yang sudah dewasa atau akil balik dan sehat pikirannya, adalah cakap menurut hukum. Dalam Pasal 1330 KUH Perdata disebut sebagai orang-orang yang tidak cakap untuk membuat suatu perjanjian, yaitu

1)

orang-orang yang belum dewasa,

2)

mereka yang ditaruh di bawah pengampuan, dan

3)

orang perempuan dalam hal-hal yang ditetapkan oleh undang-undang, dan semua orang kepada siapa UU telah melarang membuat perjanjian-perjanjian tertentu.

Orang yang tidak sehat pikirannya tidak mampu menginsyafi tanggung jawab yang dipikul oleh seseorang yang mengadakan suatu perjanjian, yaitu seperti orang

24 Kartini Muljadi dan Gunawan Widjaja, Seri Hukum Perikatan (Perikatan pada Umumnya), Cetakan II, Jakarta: Raja Grafindo Persada, 2003.

25 Subekti, Hukum Perjanjian, Cetakan ke-17, Jakarta: PT Intermasa, 1998.

64 Laporan Penelitian

buku-5.indd

64

12/13/2010

11:00:06 PM

yang ditaruh di bawah pengampuan menurut hukum, tidak dapat berbuat bebas dengan harta kekayaannya. Ia berada di bawah pengawasan pengampuan, dan kedudukannya sama dengan seorang anak yang belum dewasa. Sebagai syarat ketiga, disebutkan bahwa suatu perjanjian harus mengenai suatu hal tertentu, artinya apa yang diperjanjikan hak-hak dan kewajiban kedua belah pihak jika timbul suatu perselisihan. Barang yang dimaksudkan dalam perjanjian paling sedikit harus ditentukan jenisnya. Sementara itu, berpindahnya hak milik barang itu atau barang itu sudah berada di tangannya berutang pada waktu perjanjian dibuat, tidak diharuskan oleh undang-undang. Juga jumlahnya tidak perlu disebutkan, asal saja kemudian dapat dihitung atau ditetapkan. Sebagai syarat keempat, yaitu “suatu sebab yang halal” yang dimaksud dalam hal ini adalah yang dimaksudkan dengan sebab atau causa dari suatu perjanjian adalah isi perjanjian itu sendiri.

Apabila keempat syarat sahnya perjanjian tersebut tidak terpenuhi maka ada beberapa hal yang dapat terjadi, yaitu sebagai berikut.

Dalam hal ini harus dibedakan antara syarat subjektif dengan syarat objektif. Dalam hal syarat objektif tidak terpenuhi maka perjanjian itu batal demi hukum, artinya dari semula tidak pernah dilahirkan suatu perjanjian dan tidak pernah ada suatu perikatan, dan tujuan para pihak yang mengadakan perjanjian tersebut untuk melahirkan suatu perikatan hukum telah gagal. Dengan demikian, tidak ada dasar bagi para pihaknya untuk saling menuntut di depan hakim. Hal ini dalam bahasa Inggris dikatakan bahwa perjanjian yang demikian itu adalah“null and void”. Sementara dalam hal suatu syarat subjektif, jika syarat itu tidak dipenuhi maka perjanjiannya bukan batal demi hukum, tetapi salah satu pihaknya mempunyai hak untuk meminta supaya perjanjian itu dibatalkan. Dalam hal ini, pihak yang dapat meminta pembatalan itu adalah pihak yang tidak cakap atau pihak yang memberikan sepakatnya secara tidak bebas. Hal ini biasa dikatakan bahwa perjanjian yang telah dibuat tersebut tetap mengikat para pihaknya selama tidak dibatalkan oleh hakim atas permintaan pihak yang berhak meminta pembatalan tadi. Dengan demikian, keberlakuan perjanjian seperti itu tidaklah pasti dan bergantung pada kesediaan suatu pihak untuk menaatinya.

Semua perjanjian adalah batal jika pelaksanaannya semata-mata bergantung pada kemauan orang yang terikat. Suatu syarat yang berada dalam kekuasaan orang yang terikat (debitur), dinamakan syarat Potestatif. Begitu pula ada suatu ketentuan dalam Hukum Perjanjian bahwa semua syarat yang bertujuan melakukan sesuatu

buku-5.indd

65

Penjelasan Hukum tentang Kebatalan Perjanjian 65

12/13/2010

11:00:06 PM

yang tak mungkin terlaksana, sesuatu yang bertentangan dengan kesusilaan, atau sesuatu yang dilarang oleh undang-undang, adalah batal dan berakibat bahwa perjanjian yang digantungkan padanya tidak mempunyai sesuatu kekuatan hukum apa pun. Jika suatu perjanjian digantungkan pada syarat bahwa sesuatu peristiwa akan terjadi di dalam suatu waktu tertentu, syarat tersebut harus dianggap tidak terpenuhi apabila waktu tersebut telah lampau dengan tidak terjadinya peristiwa yang dimaksud.

Dalam Hukum Perjanjian, pada asasnya suatu syarat batal selalu berlaku surut hingga saat lahirnya perjanjian. Suatu syarat batal adalah suatu syarat yang apabila terpenuhi akan menghentikan perjanjiannya, dan membawa segala sesuatu kembali pada keadaan semula seolah-olah tidak pernah ada suatu perjanjian, seperti yang diatur di dalam Pasal 1265 KUH Perdata, yang menyatakan bahwa:

“Suatu syarat batal adalah syarat yang apabila dipenuhi, menghentikan perikatan, dan membawa segala sesuatu kembali, pada keadaan semula, seolah-olah tidak pernah ada suatu perikatan. Syarat ini tidak menangguhkan pemenuhan perikatan; hanyalah ia mewajibkan si berpiutang mengembalikan apa yang telah diterimanya, apabila peristiwa yang dimaksudkan terjadi”.

Dengan demikian, syarat batal itu mewajibkan si berpiutang untuk mengembalikan apa yang telah diterimanya, apabila peristiwa yang dimaksudkan itu terjadi.

b. Herlien Boediono 26

Herlien Boediono membagi penjelasan tentang syarat sah perjanjian dan

keterkaitannya dengan kebatalan hukum sebagai berikut.

1. Sepakat Mereka yang Mengingatkan Dirinya

a. Pengertian Sepakat Syarat pertama untuk terjadinya perjanjian ialah “sepakat mereka yang mengikatkan dirinya”. Sepakat tersebut mencakup pengertian tidak saja “sepakat”untuk mengikatkan diri, tetapi juga“sepakat”untuk mendapatkan prestasi. Dalam perjanjian timbal balik, masing-masing pihak tidak

26 Herlien Boediono, Ajaran Umum: Hukum Perjanjian dan Penerapannya di Bidang Kenotariatan, Cetakan ke- 1, Bandung: Citra Aditya Bakti, 2009.

66 Laporan Penelitian

buku-5.indd

66

12/13/2010

11:00:06 PM

saja mempunyai kewajiban, tetapi juga berhak atas prestasi yang telah diperjanjikan. Suatu perjanjian sepihak yang memuat hak atau kewajiban satu pihak untuk mendapatkan/memberikan prestasi, tetap mensyaratkan adanya kata sepakat dari kedua belah pihak. Lain halnya dengan tindakan hukum sepihak. UU tidak menjelaskan apa yang dimaksud dengan kata “sepakat”. Akan tetapi, ketentuan Pasal 1321 KUH Perdata justru menyebutkan hal-hak“sepakat”tidak terbentuk, yaitu jika sepakat diberikan karena “kekhawatiran atau diperolehnya dengan paksaan atau penipuan”.

Jika salah satu pihak mengambil keputusan yang “cocok” dengan lawannya untuk melakukan jual-beli, misalnya, syarat utama untuk terbentuknya suatu perjanjian telah dipenuhi. Untuk adanya kesepakatan tidaklah cukup bahwa keputusan sudah diambil oleh para pihak. Keputusan atau kehendak tersebut bagaimanapun juga harus disampaikan oleh pihak yang satu kepada pihak yang lain secara timbal balik.

b. Teori Kehendak Kehendak (will) adalah dasar dari keseluruhan hukum keperdataan. Pengingkaran bahwa orang yang melakukan tindakan hukum memiliki otonomi, tidak akan memecahkan masalah apa pun. Justru hal tersebut hanya menafikkan hukum keperdataan. Kehendak sebagai batu penjuru dan seluruh hukum keperdataan masih diakui sebagai ajaran yang berlaku di dunia belahan Barat. Menurut teori ini, faktor yang menentukan adanya perjanjian adalah kehendak. Namun, suatu kehendak harus dinyatakan dan dengan demikian hubungan alamiah antara kehendak dan pernyataan terwujud. Konsekuensi dari ajaran ini adalah jika pernyataan dari seseorang tidak sesuai dengan keinginannya, tidak akan terbentuk perjanjian. Untuk terbentuknya perjanjian, kehendak harus dianyakan. Sebaliknya, tidaklah mungkin ada pernyataan tanpa didahului kehendak untuk membentuk perjanjian.

c. Teori Pernyataan Teori ini berpendapat bahwa pembentukan kehendak adanya peruses yang terjadi dalam ranah kejiwaan seseorang. Karenanya, pihak lawan tidak mungkin mengetahui apa yang sebenarnya berlangsung di dalam benak seseorang. Konsekuensi logis darinya ialah suatu kehendak yang tidak dapat dikenali oleh pihak luar tidak mungkin menjadi dasar terbentuknya

buku-5.indd

67

Penjelasan Hukum tentang Kebatalan Perjanjian 67

12/13/2010

11:00:07 PM

perjanjian. Kekuatan mengikat perjanjian dikaikan pada fakta bahwa pihak yang bersangkutan telah memilih melakukan tindakan tertentu dan tindakan tersebut mengarah atau memunculkan keterikatan. Tindakan menjadi dasar bagi keterikatan karena “kehendak yang tertuju pada suatu akibat hukum tertentu sebagaimana terejawantahkan dalam pernyataan”. Terikatnya individu dilandaskan pada pernyataan individu tersebut, tanpa perlu memperlihatkan bahwa dalam perjanjian selalu ada dua atau lebih orang yang masing-masing membuat pernyataan. “Bukan kata-kata yang menentukan, melainkan tujuan yang hendak dicapai melalui pilihan pernyataan”. Demikian menurut Hijman.

d. Teori Kepercayaan Teori ini beranjak dari teori pernyataan, tetapi yang diperlunak. Tidak semua pernyataan melahirkan perjanjian. Pernyataan yang melahirkan perjanjian hanyalah pernyataan kepada pihak lain yang menurut kebiasaan di dalam masyarakat menimbulkan kepercayaan bahwa hal yang dinyatakan memang benar dikehendaki.

Schoordijk berpendapat bahwa kekuatan mengikat perjanjian harus dicari dalam kepercayaan yang dimunculkan atau dibangkitkan pada pihak lawan. Kepercayaan tersebut tertuju pada suatu perilaku faktual tertentu, “Hidup saya kuarahkan pada tujuan itu,” ungkapan ini digunakan Schoordijk untuk menunjuk pada kekuatan mengikat dan akibat darinya berupa kepercayaan (pengharapan) yang dimunculkan pada pihak lawan. Suatu perjanjian terbentuk bukan sekadar dari pernyataan-pernyataan, baik yang mengungkapkan kehendak par apihak maupun melalui kehendak itu sendiri. Terbentuknya perjanjian justru bergantung pada kepercayaan yang muncul pada pihak lawan sebagai akibat pernyataan dari yang diungkapkan.

Ketiga teori tersebut mempunyai segi positif dan negative. Oleh karena itu, tidak dapat diterapkan secara konsekuen tanpa adanya koreksi. KUH Perdata disusun beranjak dari teori kehendak yang diikuti hingga pertengahan abad yang lalu. Teori-teori lainnya yang menolak teori kehendak sebenarnya sebagai pengecualian diterapkan untuk hal-hal tertentu, demikian Asser Rutten. Namun, ahli-ahli hukum berbeda pendapat tentang teori-teori di atas.

68 Laporan Penelitian

buku-5.indd

68

12/13/2010

11:00:07 PM

2. Pernyataan Tidak Diinginkan

a. Vis Absoluta Paksaan dapat terjadi karena paksaan secara fisik ataupun psikis. Paksaan secara fisik terjadi dalam hal, misalnya, tangan seseorang dipegang untuk memaksakannya menandatangani suatu akta. Sementara paksaan secara psikis dapat dilakukan dengan mengancam atau menakut-nakuti seseorang untuk melakukan sesuatu. Misalnya, orang lain (anggota keluarga) akan dicederai. Paksaan psikis diatur di dalam Pasal 1324 KUH Perdata. Dalam hal adanya paskaan, tidak terjadi kesepakatan. Satu dan lain hal disebabkan tidak adanya kehendak yang tertuju pada akibat hukum. Adanya paksaan demikian yang tanpanya tidak akan dibuat perjanjian harus dibuktikan.

b. Gangguan Kejiwaan Oleh UU, akibat hukum dari tindakan hukum yang dilakukan oleh orang yang sakit jiwa hanya diatur jika mereka itu ditaruh di bawah pengampunan atau curatele (Pasal 433 KUH Perdata dan seterusnya). Tindakan mereka akan tunduk pada aturan umum dan asas-asas hukum mereka yang digolongkan “terganggu kejiwaannya”, baik karena mabuk, di bawah pengaruh narcose atau hypnose, kepikunan, maupun dalam keadaan emosional tinggi– singkatnya semua peristiwa atau keadaan yang menyebabkan seseorang tidak dapat menyatakan kehendaknya dengan benar atau sadar akan akibat hukumnya–tidaklah dapat diminta pertanggungjawaban hukum atas apa yang dilakukannya.

c. Terlepas Bicara atau Salah Menulis Dalam perspektif kepercayaan berlaku ketentuan umum bahwa walaupun maksud dan ucapan tidak saling bersesuaian, perjanjian tetap terjadi, asalkan pernyataan yang diberikan memberi kesan bahwa memang demikianlah yang dimaksudkan oleh yang bersangkutan. Teori kepercayaan dianggap berhasil memberi solusi dan kepastian hukum.

d. Keliru dalam Menyampaikan Berita Pernyataan yang benar, tetapi keliru penyampaiannya mungkin terjadi jika perjanjian dilakukan melaui seorang wakil. Pada dasarnya, berlaku ketentuan yang sama dengan kekeliruan yang terjadi karena terlepas bicara atau salah menulis. Perjanjian tetap terjadi jika pernyataan yang

buku-5.indd

69

Penjelasan Hukum tentang Kebatalan Perjanjian 69

12/13/2010

11:00:07 PM

diberikan karena salahnya sendiri dan memberi kesan kepada pihak lawan bahwa memang itulah yang dimaksud. Jika kekeliruan terletak pada wakil yang menyampaikan, kesalahan tidak dapat dibebankan pada pihak yang menyuruh. Artinya, risiko dipikul oleh wakilnya tersebut.

e. Menandatangani Suatu Surat/Akta yang Tidak Dimengerti/Diketahui Isinya

Di dalam kehidupan sehari-hari, sering kali perjanjian dilakukan dengan

menggunakan modal baku/standar. Di dalam perjanjian baku, isi perjanjian telah disusun secara terperinci, misalnya, polis asuransi, syarat-syarat

angkutan, sewa beli, dan leasing. Perjanjian baku atau perjanjian standar sering kali ditandatangani tanpa dibaca atau diketahui keseluruhannya oleh penanda tangan. Ciri-ciri perjanjian baku menurut Mariam Darus Badrulzaman adalah

- isinya ditetapkan secara sepihak oleh kreditor yang posisinya relatif kuat dari debitor,

- debitor sama sekali tidak ikut menentukan isi perjanjian itu,

- terdorong oleh kebutuhannya, debitor terpaksa menerima perjanjian itu,

- bentuknya tertulis, dan

- dipersiapkan terlebih dahulu secara massal atau individual.

Menjadi pertanyaan, apakah dalam hal ini telah terjadi pernyataan yang tidak dikehendaki? Penjelasannya adalah sebagai berikut. Walaupun pihak menandatangani akta yang tidak dibaca atau diketahui isinya, baik sebagian maupun seluruhnya, ia telah berkehendak dan sadar telah “menundukkan

dirinya” atas isi akta tersebut berlaku bagi dirinya. Di sini dikatakan bahwa telah terjadi “penundukan atas kehendak sendiri secara umum”. Dalam hal

ini, dianggap tidak terjadi deskripsi antara kehendak dan pernyataan, orang

menghendakiapayangdinyatakannya.Hampirselaluperjanjianbaku/standar ditandatangani tanpa dibaca terlebih dahulu atau diketahui isinya. Namun, kenyataan telah ditandatanganinya akta perjanjian baku menimbulkan kepercayaan pada pihak lawan bahwa penanda tangan betul mengetahui serta menghendaki apa yang telah dinyatakannya dengan ditandatangani aktanya. Hal tersebut berlaku juga untuk formulir yang telah ditandatangani tanpa diisi secara lengkap. Yurisprudensi di Belanda (sejak 1926) telah mengakui sahnya akta-akta perjanjian baku/standar dan orang tidak dapat menyangkal akan hal tidak diketahui apa yang telah ditandatangani.

70 Laporan Penelitian

buku-5.indd

70

12/13/2010

11:00:07 PM

3.

Pernyataan

Dimaksudkan Pihak Lawan

Dikehendaki,

Tetapi

Tidak

Dalam

Arti

yang

a. Pernyataan Tidak Cukup Jelas Atau Disalahartikan Secara umum dapat dikatakan bahwa pernyataan yang tidak cukup jelas atau disalahartikan mengakibatkan tidak terbentuknya perjanjian. Satu dan lain hal karena tidak adanya kesepakatan. Hanya dalam hal pihak, kepada siapa pernyataan disampaikan, tidak memiliki alasan untuk tidak menerima atau adanya kesan bahwa demikianlah kehendak pihak lawan sebagaimana telah dinyatakan maka terbentuklah perjanjian. Singkatnya, perjanjian tetap dianggap terjadi jika kesalahmengertian tersebut seluruhnya karena kurang teliti atau teledor dalam memberikan penjelasan sewaktu menyatakan kehendak. Kita perlu membedakan penjelasan salah pengertian dalam arti ada pernyataan yang disalahartikan dengan salah mengerti motivasi para pihak berdasarkan apa perjanjian itu dibuat. Untuk yang disebut terakhir, diterapkan ajaran berkenaan dengan cacat pada kehendak, yaitu cacat yang terjadi karena kekeliruan. Salah pengertian dapat diselesaikan dengan mengacu pada penafsiran perjanjian (Pasal 1342–1351 KUH Perdata).

b. Pernyataan Diterima oleh Orang yang Berbeda dari yang Dituju Surat penawaran yang sedianya adalah untuk A ternyata disampaikan kepada B. Apakah dalam hal ini jika B menerima penawaran tersebut dapat terbentuk perjanjian? Apakah B seharusnya mengerti bahwa penawaran tersebut bukan untuknya? Dalam hal ini sebenarnya tidak ada kekeliruan dari pihak yang menyatakan, yakni jika yang bersangkutan yakin bahwa penawaran telah disampaikan kepada yang benar. Ajaran cacat pada kata sepakat karena kekeliruan harus diterapkan di sini.

Pernyataan Sesuai dengan yang Dimaksudkan, Tetapi Tidak Menginginkan Akibat Hukumnya

a. Maksud yang Ditahan Dalamhalinikitaberbicaratentangorangyangmenyatakansuatumaksud.Namun, ia sebenarnya tidak menginginkan akibatnya (dan hanya disimpan di dalam hatinya sendiri). Dalam kenyataan tidak dapat dipungkiri telah ada pernyataan. Artinya, orang terkait pada pernyataan yang telah diberikan, sedangkan pihak lawan berpegang pada kepercayaan yang ditimbulkan oleh pernyataan yang

4.

buku-5.indd

71

Penjelasan Hukum tentang Kebatalan Perjanjian 71

12/13/2010

11:00:07 PM

diberikan, termasuk pada maksud yang terkandung di dalamnya. Dalam hal demikian, berdasarkan teori kepercayaan telah terbentuk perjanjian.

b. Senda Gurau yang Tidak Diketahui Pihak Lawan Pernyataan yang diberikan sebagai senda gurau pada dasarnya akan diterima sebagaimanaadanya.Guyonandianggapmengenaapabilasendagurautersebut setelah beberapa waktu menyebabkan orang baru sadar dan mulai curiga, ragu- ragu apakah pernyataan tersebut benar atau main-main. Bergantung pada pihak lawan, apakah pernyataan tersebut diterima secara serius atau seyogianya ia harus lebih bijak di dalam menerima “penawaran” yang disampaikan sebagai senda gurau itu. Penilaian harus dilakukan, apakah kita berhadapan dengan senda gurau yang jelas atau senda gurau yang samar-samar dan tidak jelas. Senda gurau yang berada dalam kawasan yang meragukan harus dianggap sama dengan keadaan mengenai reservation mentalis.

c. Perbuatan Pura-Pura Perbuatan pura-pura yang terejahwantah ke dalam perjanjian pura-pura atau perjanjian simulasi sebenarnya merupakan penyimpangan dari maksud tujuan menimbulkan akibat hukum. Penyimpangan terhadap “kesepakatan yang tercapai” telah dilakukan antara para pihak untuk secara diam-diam dan secara sadar melakukan tindakan hukum tertentu yang menyimpang dari apa yang seharusnya terjadi. Dapat dikatakan di sini bahwa para pihak melakukan “persekongkolan”.

5. Terjadinya Kata Sepakat

Galibnya kata sepakat tercapai melalui atau dengan pernyataan kehendak dari orang-orang atau pihak yang bertindak. Pernyataan atau kehendak tersebut harus tertuju pada akibat hukum yang ingin ditimbulkan. Dengan kata lain, pihak yang bertindak memunculkan kepercayaan pada lainnya bahwa kehendaknya itu tertuju pada terbentuknya perjanjian.

Namun, bagaimanakah perjanjian secara nyata terbentuk di antara para pihak/ kapan serta bagaimana terjadi kata sepakat sehingga dikatakan telah terbentuk perjanjiandiantaraparapihak?Umumnya,dikatakanbahwaperjanjianterbentuk jika ada persesuaian pernyataan kehendak atau perjumpaan kehendak dari para

72 Laporan Penelitian

buku-5.indd

72

12/13/2010

11:00:07 PM

pihak. Namun, perlu diperhatikan di sini bahwa sistem hukum yang terwujud dalam KUH Perdata telah melepaskan diri dari dan karenanya berada dari sistem hukum Romawi yang merupakan akar dari sistem hukum Barat. Di dalam sistem hukum Germania dan sistem hukum Romawi, perjanjian baru dianggap terbentuk secara formal (dengan akta), tetapi juga dengan diserahkannya kebendaan objek perjanjian (perjanjian riil). Oleh karena itu, dari sudut pandang sistem hukum Germania dan hukum Romawi, pernyataan-pernyataan tersebut bukan pokok masalah. Perjanjian terbentuk tatkala para pihak bertemu muka dengan dibuat aktanya atau penyerahan objek perjanjian.

Satu momen penting dalam proses pembentukan atau penutupan perjanjian adalah perjumpaan kehendak, saling bertuatnya pernyataan kehendak para pihak sebagaimana disampaikan satu pihak pada pihak lainnya secara timbal balik. Dari pernyataan-pernyataan tersebut, masing-masing pihak menurut hukum mengikatkan diri pada pihak lainnya dan dengan tercapainya “kata sepakat” perjanjian terbentuk.

Berdasarkan apa yang tersebut di atas, perjanjian terjadi atau terbentuk melalui proses penawaran yang disampaikan oleh satu pihak yang kemudian diterima pihak lainnya. Proses penawaran dan penerimaan melandasi terbentuknya perjanjian.

a. Saat Tercapainya Kata Sepakat Seperti telah disebutkan sebelumnya, kata sepakat dianggap tercapai pada saat pihak yang menawarkan mengetahi bahwa pihak lainnya telah menerima penawarannya, setidaknya ia dianggap patut telah dapat mengetahui telah diterimanya penawaran. Terbentuknya perjanjian cukup dengan terjadinya perjumpaan atau persesuaian kehendak, yaitu satu pihak mengajukan penawaran dan penawaran tersebut diterima oleh pihak lainnya. Dalam hal para pihak bertemu muka dan melakukan komunikasi lisan secara langsung, tidak sulit untuk menentukan kapan kata sepakat tercapai. Di sini kata sepakat dianggap terbentuk pada saat pihak yang menawarkan mengetahui bahwa penawarannya telah diterima oleh pihak lawannya.

Namun demikian, persoalan munculnya ketika penawaran dan penerimaan dilakukan secara berbeda, misalnya, melalui komunikasi elektronik jarak

buku-5.indd

73

Penjelasan Hukum tentang Kebatalan Perjanjian 73

12/13/2010

11:00:07 PM

jauh. Ilustrasi dari itu ialah kontrak elektronik. Apakah kata sepakat terbentuk sejak pihak yang menawarkan menulis surat penawarannya? Pandangan ini diajukan oleh teori pernyataan. Ataukah kata sepakat terbentuk pada saat surat penawaran telah dikirimkan? Pandangan ini dilandaskan pada teori penyampaian/pengiriman. Kemungkinan lain adalah kata sepakat terbentuk pada saat pihak yang menawarkan mengetahui bahwa penawarannya telah diterima oleh pihak lainnya. Pandangan ini disebut dengan teori penerimaan.

Dari ketiga teori di atas, dapat dikatakan bahwa teori pernyataan dan teori penyampaian/pengiriman mengandung banyak kelemahan. Kedua teori tersebut dianggap tidak memenuhi asas kepatutan dan kepantasan. Alhasil, tidak banyak yang menganut teori ini. Sebaliknya, teori penerimaan adalah teori yang dianggap paling memenuhi asas kepatutan dan kepantasan sekalipun tetap memiliki kelemahan.

b. Tempat Terbentuknya Perjanjian Jika para pihak pada saat terjadinya perjanjian tidak sedang “berhadapan dan berada pada satu tempat, dikatakan bahwa perjanjian tersebut terbentuk pada saat kedua pihak berada di dua tempat yang berbeda. Jika dua tempat berbeda tersebut masih berada di negara yang sama, tentunya tidak akan ada pengaruhnya. Persoalan baru akan muncul jika dua tempat tersebut ada di dua negara yang berbeda. Artinya, ada dua sistem hukum yang berlaku. Penentuan tempat terbentuknya perjanjian penting untuk menentukan hukum manakah yang berlaku terhadap perjanjian yang telah terbentuk.

Berkenaan dengan hak tersebut, ketentuan Pasal 1346 KUH Perdata membuat petunjuk umum. Ketentuan ini yang juga berkaitan dengan keterkaitan hukum perdata internasional, locus regit actu, menetapkan bahwa “Apa yang meragu- ragukan harus ditafsirkan menurut apa yang menjadi kebiasaan dalam negeri atau di tempat, di mana persetujuan telah dibuat”.

c. Cacat pada Kehendak Suatu cacat kehendak terjadi bilamana seseorang telah melakukan suatu perbuatan hukum, padahal kehendaknya terbentuk secara tidak sempurna. Perbuatan hukum mensyaratkan adanya kehendak yang tertuju pada suatu akibat hukum tertentu sebagaimana terwujud dalam suatu pernyataan. Sekalipun kehendak dan pernyataan berkesesuaian, suatu tindakan hukum dapat dibatalkan jika memenuhi syarat-syarat tertentu. KUH Perdata mengatur

74 Laporan Penelitian

buku-5.indd

74

12/13/2010

11:00:07 PM

ikhwalakibatdarikekeliruan/kesesatan,kekerasan/paksaan,danpenipuandalam ketentuan Pasal 1322–1328 KUH Perdata. Sementara ikhwal penyalahgunaan keadaan tidak kita temukan pengaturannya di dalam KUH Perdata.

6. Kecakapan untuk Melakukan Tindakan Hukum

a. Cakap Bertindak Pemangku atau pengemban hak dan kewajiban adalah subjek hukum dan sebab itu juga dari kacamata hukum memiliki kewenangan bertindak. Anak yang baru dilahirkan, bahkan juga anak dalam kandungan yang dari kacamata hukum dianggap sebagai telah dilahirkan, berkedudukan sebagai subjek hukum. Sepanjang oleh hukum positif, apabila seseorang diakui sebagai subjek hukum, ia akan memiliki kewenangan hukum. Di dalam lingkup batas yang ditetapkan hukum baginya, kewenangan hukum dari subjek hukum tidaklah terbatas.

Dengan kata lain, setiap subjek hukum yang memiliki kewenangan untuk melakukan tindakan hukum adalah pengemban hak dan kewajiban hukum. Untuk terbentuknya suatu hubungan hukum, disyaratkan ada atau dilakukannya suatu tindakan hukum yang “menghidupkan” kewenangan tersebut. Siapa yang dapat dan boleh bertindak serta mengikatkan diri adalah mereka yang cakap bertindak dan mampu untuk melakukan suatu tindakan hukum yang membawa akibat hukum.

Artinya, mereka yang tidak mempunyai kecakapan bertindak atau tidak cakap adalah orang yang secara umum tidak dapat melakukan tindakan hukum. Kecakapan adalah ketentuan umum, sedangkan ketidakcakapan merupakan pengecualian darinya. Terminologi yang digunakan UU, kecakapan dan ketidakcakapan harus dimaknai secara berbeda dari arti umum yang diberikan padanya dalam pergaulan sehari-hari dan juga tidak merujuk pada sifat alamiah seseorang.

Tidak cakap menurut hukum adalah mereka yang oleh UU dilarang melakukan tindakan hukum, terlepas dari apakah secara faktual ia mampu memahami konsekuensi tindakan-tindakannya. Mereka yang dianggap tidak cakap adalah orang belum dewasa atau anak-anak di bawah umur dan mereka yang ditempatkan di bawah pengampunan. Mereka ini, tanpa seizin wakil, yakni orang tua atau wali mereka menurut perundang-undangan, dinyatakan tidak dapat melakukan tindakan hukum, terkecuali melalui lembaga perwakilan.

buku-5.indd

75

Penjelasan Hukum tentang Kebatalan Perjanjian 75

12/13/2010

11:00:07 PM

b. Perwakilan

- Perwakilan menurut UU (Pasal 50 ayat (1) UUP Jo Pasal 345 KUH Perdata). Perwakilan orang tua yang hidup terlama: “Salah seorang dari orang tua yang hidup terlama demi hukum adalah wali atas anak-anaknya yang sah (sepanjang ia tidak dipecat atau dibebaskan), pemisahan meja dan tempat tidur tidak berpengaruh terhadap kedudukan sebagai wali”.

- Perwakilan orang tua atas anak yang diakui. “Anak di luar perkawinan berada di bawah perwakilan ibu (Pasal 43 UUP); anak di luar perkawinan yang diakui oleh ayahnya, demi undang-undang berada di bawah perwalian ayah yang mengakui, terkecuali ayah tersebut dipecat atau dibebaskan atau sudah ada wali orang lain; ayah yang mengakui anak luar kawin, jika sudah ada wali yang diangkat hakim, ayah yang mengakui anak luar kawin tidak menjadi wali. Namun, ia dapat mengajukan permohonan kepada pengadilan negeri untuk menjadi wali dan jika permohonan tersebut dikabulkan, wali hakim diberhentikan.

- Perwakilan berdasarkna penetapan hakim (wali datif)–(Pasal 331a KUH Perdata)

- Perwakilan menurut wasiat (Pasal 51 ayat (1) UUP Jo Pasal 335–357 KUH Perdata)

c. Ketidakcakapan dan Ketidakwenangan Ketidakcakapan melakukan tindakan hukum haruslah dibedakan dengan ketidakwenangan melakukan tindakan hukum. Namun, pembedaan ini tidak kita temukan dibuat oleh pembuat UU, tetapi di dalam ilmu hukum. Tidak berwenang adalah mereka yang oleh UU dilarang melakukan tindakan hukum tertentu. Di samping pembedaan tersebut, antara ketidakcakapan dan ketidakwenangan, keduanya juga harus dibedakan dari tujuan dan akibatnya. Tujuan (pembuat UU) dari pernyataan ketidakcakapan ialah perlindungan dari pihak yang tidak cakap, ketidakwenangan terutama ditujukan terhadap orang yang dinyatakan tidak wenang dan tujuannya ialah memberikan perlindungan kepada pihak lainnya atau juga untuk melindungi kepentingan umum.

d. Tidak Cakap dan Tidak Mampu secara Faktual Tidak cakap tidaklah sama dengan secara faktual tidak mampu untuk melakukan tindakan hukum. Misalnya, dalam hal sekalipun orang-orang tertentu tidak berada di bawah pengampunan, ternyata mereka menderita sakit jiwa, terhipnotis, atau berada di bawah pengaruh narcoticum. Dalam hal demikian, orang-orang itu secara faktual tidak mampu menentukan sendiri kehendak

76 Laporan Penelitian

buku-5.indd

76

12/13/2010

11:00:07 PM

mereka, sekalipun tidak dapat digolongkan pada tidak cakap. Mereka pada saat- saat tertentu dapat memutuskan dan menentukan sendiri kehendak mereka. Penentuan ketidakcakapan dan ketidakwenangan seseorang untuk melakukan tindakan hukum, demi kepastian hukum, dikaitkan pada fakta eksternal yang mudah dipastikan dan dikenal batas-batasnya secara jelas, misalnya, akta kelahiran atau pernyataan umum lainnya (putusan pengadilan), surat/akta bukti pemilikan. Dalam hal ketidakmampuan faktual, keadaan tersebut justru harus dibuktikan keberadaannya di muka hakim.

7. Suatu Hal Tertentu

a. Objek Perjanjian

Menurut tradisi, untuk sahnya suatu perjanjian, objek perjanjian haruslah:

- dapat ditentukan,

- dapat diperdagangkan (diperbolehkan),

- mungkin dilakukan, dan

- dapat dinilai dengan uang.

b. Barang yang Baru Akan Ada Barang-barang yang baru akan ada di kemudian hari dapat pula menjadi pokok perjanjian. Kemungkinan ini dibuka di dalam ketentuan Pasal 1334 ayat (1) KUH Perdata. Pengertian “barang-barang yang baru akan ada” mengacu pada pengertian bahwa barang tersebut belum ada. Ini terjadi dalam hal orang memesan pada perusahaan mebel untuk dibuatkan sebuah lemari dan dikenal dengan sebutan barang yang baru ada bersifat objektif. Sebaliknya, barang yang akan ada yang bersifat subjektif adalah barang yang belum menjadi miliknya.

8. Suatu Sebab yang Halal

Syarat keempat untuk sahnya perjanjian adalah suatu sebab yang halal atau kuasa yang halal. Ketentuan Pasal 1335 KUH Perdata menyatakan bahwa “Suatu perjanjian tanpa sebab atau yang telah dibuat karena sesuatu sebab yang palsu atau terlarang, tidak mempunyai kekuatan (hukum). Dengan kata lain, batal demi hukum”.

Kuasa yang palsu dapat terjadi jika suatu kuasa yang tidak sesuai dengan keadaan sebenarnya atau kuasa yang disimulasikan. Kemungkinan juga telah terjadi kekeliruan terhadap kuasanya. Dengan demikian, yang penting adalah

buku-5.indd

77

Penjelasan Hukum tentang Kebatalan Perjanjian 77

12/13/2010

11:00:07 PM

bukan apa yang dinyatakan sebagai kuasa, melainkan apa yang menjadi kuasa yang sebenarnya.

a. Ahmadi Miru 27 Isu selanjutnya adalah apa akibat hukum dari tidak terpenuhinya syarat sah perjanjian. Terkait akibat hukum tidak terpenuhinya syarat sah perjanjian, Ahmadi Miru berpendapat sebagai berikut. Istilah batal demi hukum yang disamakan dengan istilah kebatalan adalah kontrak yang perjanjiannya tidak memenuhi syarat objektif dari syarat sahnya kontrak. Yang merupakan syarat objektif dari syarat sahnya perjanjian adalah

“suatu hal tertentu” dan “sebab yang halal”, misalnya objek kontrak tidak jelas atau bertentangan dengan undang-undang, ketertiban umum atau kesusilaan. Sementara untuk perjanjian yang dapat dibatalkan, juga digunakan istilah pembatalan. Pembatalan kontrak sangat terkait dengan pihak yang melakukan kontrak, maksudnya apabila pihak yang melakukan kontrak tersebut tidak cakap menurut hukum, baik itu karena belum cukup umur 21 tahun atau karena di bawah pengampuan, kontrak tersebut dapat dimintakan pembatalan oleh pihak yang tidak cakap tersebut apakah diwakili oleh wali atau pengampunya atau setelah dia sudah berumur 21 tahun atau sudah tidak di bawah pengampuan. Pembatalan perjanjian dapat juga dilakukan karena salah satu pihak maupun kedua belah pihak:

- belum dewasa,

- di bawah pengampuan,

- kontrak tersebut dibuat karena adanya paksaan, atau

- kekhilafan/kesesatan atau penipuan.

Pembatalan kontrak berakibat dipulihkannya keadaan sebagaimana sebelum terjadinya kontrak. Pembatalan perjanjian dan pengembalian kepada keadaan semula bagi orang yang tidak cakap melakukan kontrak hanya dapat dilakukan selama barang tersebut masih ada pada pihak lawan atau pihak lawan tersebut telah memperoleh manfaat daripadanya atau berguna bagi kepentingannya.

27 Ahmadi Miru, Hukum Kontrak dan Perancangan Kontrak, Cetakan II, Yogyakarta: Raja Grafindo Persada, 2007).

78 Laporan Penelitian

buku-5.indd

78

12/13/2010

11:00:07 PM

b. Hendry P. Panggabean 28 Selanjutnya, terdapat syarat sah subjektif perjanjian, yaitu kesepakatan, yang terkait erat dengan ajaran penyalahgunaan keadaan. Jika syarat sah subjektif kesepakatan tidak terpenuhi, terhadap perjanjian tersebut dapat dimintakan pembatalan.

Mahkamah Agung di Indonesia ataupun Hoge Raad di Belanda yang mengakui adanya penyalahgunaan keadaan dalam kasus-kasus tersebut dan bahwa NBW telah menambahkan ajaran penyalahgunaan keadaan sebagai alasan hukum keempat untuk pembatalan perjanjian sehingga di dalam NBW dapat diperinci alasan pembatalan perjanjian itu, dapat diakibatkan karena ancaman (bedreiging), tipuan (bedrog), penyalahgunaan keadaan (misbruik van omstandigheden) berdasarkan Pasal 3: 44 lid 1 NBW dan bisa akibat adanya kesesatan (dwaling) berdasarkan Pasal 6 : 228 lid 1 NBW.

c. R.M. Suryodiningrat 29 R.M. Suryodiningrat lebih lanjut menjelaskan tentang pembedaan kebatalan dan pembatalan perjanjian. Pembahasan mengenai kebatalan (nietigheid) atau pembatalan (vernietigbaarheid) dari perjanjian, hanya diuraikan dalam bagian uraian tentang hapusnya perikatan. Penulis menguraikan bahwa penggunaan istilah mengenai kebatalan/pembatalan tidak ada keseragaman, bahkan tidak begitu tegas apa yang menjadi dasar pembedanya. Hal demikian juga kerap kali muncul dalam undang-undang yang menggunakan istilah “kebatalan~batal demi hukum”, sedangkan maksudnya adalah “pembatalan”. Contoh yang diberikan, misalnya Pasal 1446 ayat 1 KUH Perdata yang menyatakan bahwa perikatan yang dibuat oleh orang yang belum dewasa atau yang berada di bawah pengampuan adalah “batal demi hukum”, sedangkan yang dimaksudkan ialah “pembatalan” yang terbukti dari kalimat selanjutnya yang menyatakan bahwa harus ada tuntutan untuk dan atas nama mereka di muka pengadilan agar….(teks terpenggal)

Berdasarkan uraian tersebut, sebenarnya Penulis sudah ingin memberikan kesimpulan sementara bahwa salah satu pembeda antara “kebatalan~batal

28 Hendry Panggabean, Penyalahgunaan Keadaan (Misbruik Van Omstandigheden) SEBAGAI ALASAN (BARU) UNTUK PEMBATALAN PERJANJIAN (Berbagai Perkembangan Hukum di Belanda), Yogya- karta: Liberty, 2001.

29 R.M. Suryodiningrat, Azas-Azas Hukum Perikatan, Bandung: Tarsito, 1978.

buku-5.indd

79

Penjelasan Hukum tentang Kebatalan Perjanjian 79

12/13/2010

11:00:07 PM

demi hukum” dengan “pembatalan” dilihat dari ada/tidaknya tuntutan di muka pengadilan untuk membatalkan perikatan. “Pembatalan” perjanjian harus ada tuntutan, sedangkan “kebatalan” ditafsirkan negatif tidak harus ada tuntutan.

Pembedaan antara “kebatalan~batal demi hukum” dengan “pembatalan”,

diuraikan secara ringkas, yang dimulai dengan penjelasan mengenai “kebatalan (nietigheid)~batal demi hukum”. “Kebatalan~batal demi hukum” yang dengan kekuatan sendiri membuat perbuatan hukum tidak tercapai maksudnya, menyebabkan perikatan berakhir dan perbuatan hukum dari semula tidak menimbulkan akibat-akibat hukum yang dimaksudkan. Perbuatan hukum adalah “batal demi hukum” (perikatannya mengalami kebatalan) jika:

- terdapat pelanggaran formalitas, contohnya Pasal 1682 KUH Perdata: Hibah dianggap“batal demi hukum”apabila hibah tidak dibuat dengan akta notaris;

- melanggar ketertiban umum, contohnya Pasal 1468 KUH Perdata: Pemilikan hak-hak dan tuntutan-tuntutan hukum karena penyerahan kepada para hakim, jaksa, panitera dan juru sita pengadilan, pengacara dan notaris yang sedang menjadi sengketa pengadilan di dalam wilayahnya mereka melakukan pekerjaan mereka, adalah “batal demi hukum” atau contoh lain Pasal 1469 KUH Perdata: Pembelian di bawah tangan yang dilakukan oleh para pegawai yang memangku jabatan umum mengenai barang-barang yang dijual oleh atau di hadapan mereka untuk dirinya sendiri atau orang- orang perantara adalah “batal demi hukum”;

- melanggar kesusilaan, contoh: Persetujuan antara suami dan istri yang ditutup sebelum perceraian, di mana istri melepaskan haknya untuk memperoleh nafkah dari suami (HR. 11 April 1919, NJ. 1919, 574, W.10442).

d. Hardjan Rusli 30 Selanjutnya adalah isu tentang makna dari kata “hal tertentu” dan “sebab/kasus yang dilarang”. Hardjan Rusli menjelaskannya sebagai berikut. Kalau dihubungkan dengan Pasal 1320 KUH Perdata yang menyatakan salah satu syarat sahnya perjanjian adalah“hal”yang tertentu dan kata“hal”ini berasal dari bahasa Belanda onderwerp yang dapat diartikan pokok uraian atau pokok pembicaraan (atau pokok persoalan) maka Zaak lebih tepat bila diterjemahkan sebagai pokok persoalan (arti nomor 4 dalam kamus Prof. Drs. S. Wojowasito) (hlm. 86).

30 Hardjan Rusli, Hukum Perjanjian Indonesia dan Common Law, Cetakan I, Yogyakarta: Pustaka Sinar Harapan, 1993.

80 Laporan Penelitian