Anda di halaman 1dari 148

Enseanza de la lengua y la literatura.

Artculos y reseas de 1983 a 2003


Xavier Laborda Gil

El aprovechamiento escolar, Cuadernos de Pedagoga [Cuadernos de Pedagoga], XI-1982, p. 27-9. Un excelente campo semitico para un buen anlisis, Cuadernos de Pedagoga, 1 (I-1983) 41-3. 1 de BUP: la lengua al servicio de la lengua, Cuadernos de Pedagoga, 106 (X1983) 29-31. George Orwell va la escuela, Cuadernos de Pedagoga, 109 (I-1984) 45-9. De la revolucin a la evolucin en los libros educativos, Cuadernos de Pedagoga, 112 (IV-1984) 513. Paisaje antes de la batalla, Cuadernos de Pedagoga, 113 (V-1984) 4-7. Semanas sensuales, Cuadernos de Pedagoga, 119 (XI-1984) 36-7. El aula ideal es real, Cuadernos de Pedagoga, 126 (VI-1985) 51-2. Analfabetismo tecnolgico, Quimera, 45 (1985) 12-5. Manuscrito policiaco hallado en un aula, Cuadernos de Literatura Infantil y Juvenil, 7 (VI-1989) 38-41. J. D. Salinger, el guardin entra en la escuela, Cuadernos de Literatura Infantil y Juvenil, 8 (VIII-1989) 81-2. Quin no gusta de Tournier?, Cuadernos de Literatura Infantil y Juvenil, 10 (X1989) 74-75. La enseanza del francs, Cuadernos de Pedagoga, 182 (VI-1990) 92-3. Sentidos del anlisis del habla en el aula, Cuadernos de Pedagoga, 187 (XII1990) 84-5. El proyecto cientfico del enseante: resea de M. Arc et al., Ensear ciencia, Cuadernos de Pedagoga, 188 (I-1991) 71. Viajes lingsticos, Cuadernos de Pedagoga, 193 (VI-1991) 66-8.

Hablar, convencer, seducir, Cuadernos de Pedagoga, 196 (X-1991) 84-5. Pensar y el deseo de saber: resea de Jess Alonso Tapia, Motivacin y aprendizaje en el aula, Cuadernos de Pedagoga, 198 (XII-1991) 76. Sensatez contra el dogma: resea de Daniel Pennac, Como una novela, Cuadernos de Literatura Infantil y Juvenil, 51 (VI-1993) 73. Literatura? El estado de la cuestin, Cuadernos de Pedagoga, 225 (V-1994) 745. Oratria i retrica, o la parla quotidiana, Butllet del Collegi de Doctors i Llicenciats en Filosofia i Lletres i en Cincies de Catalunya, 89 (VII-1994) 44-5. El habla, millares de respuestas: resea de David Crystal, Enciclopedia del lenguaje, Cuadernos de Pedagoga, 230 (XI-1994) 75. De lo invisible: resea de M. A. Santos Guerra, Cuadernos de Pedagoga, 234 (III1995) 103. Mediaciones instrumentales: resea de A. San Martn, Cuadernos de Pedagoga, 245 (III-1996) 104. Consum i producci a la comunicaci de masses, Perspectiva escolar, 207 (IX1996) 2-8. Como un diario: resea de F. Lzaro Carreter, Cuadernos de Literatura Infantil y Juvenil, 96 (VII-1997) 69. Encadenar conocimientos: resea de J. Cols, Cuadernos de Pedagoga, 261 (IX1997) 98. Relacin de un lector fascinado y desdeoso, Cuadernos de Pedagoga, 279 (IV1999) 101. Una sencilla forma de apreciar la lectura, Cuadernos de Pedagoga, 283 (IX-1999) 108. El canon Bloom, invariable. Resea a Harold Bloom, Cmo leer, Cuadernos de Pedagoga, 296 (XI-2000) 101. El maestro y el aprendiz: resea de J. Pozo y Y. Postigo, Los procedimientos como contenidos escolares, Cuadernos de Pedagoga, 301 (IV-2001) 103. Un paseo con mucha sustancia: resea de Raffaele Simone, La Tercera Fase, Cuadernos de Pedagoga, 305 (IX-2001) 101. La calidad, premisa previa: resea de E. Barber, La incgnita de la educacin a distancia, Cuadernos de Pedagoga, 305 (IX-2001) 102. El deseo y la capacidad de narrar: resea de Francisca Prez, Una propuesta didctica sobre la narracin, Cuadernos de Pedagoga, 323 (IV-2003) 97. Resea J. M. Cots y L. Nussbaum, Pensar lo dicho, Cuadernos de Pedagoga, 327 (IX-2003) 121.

REVISTA MENSUAL DE EDUCACION N,o 95

NOVIEMBRE 1982
AI\IO VIII 200 PTAS.

'

~~~ -~~~;/

- - -./
/

/./--~ /'

//~

El aprovechamiento escolar y el lenguaje


,

-l. lA VIER LABORDA

Un reciente y muy amplio mente mayores problemas, estudio editado por el Servi- de tal suerte que el fracaso cio Psicopedaggico Munici- escolar es progresivo y acupal de Alcorcn (Madrid) ci- mulativo, Y he aqu lo revefra el fracaso escolar en los lador: las materias en que centros de EGB nacional en ms abundan los suspensos un 62 %. El rendimiento es- son el lenguaje, el idioma y colar se resiente a medida las matemticas. Curiosaque los alumnos avanzan en mente las dificultades se los cursos, y su cota ms centran en el dominio de los baja se alcanza en los lti- lenguajes, a saber, la lengua mos cursos. Las deficiencias propia. la lengua extranjera iniciales generan paulatina- y un lenguajeformal, tectencasos de alumnos de los ltimos cursos de EGB Como consecuencia lgi- que no saben leer ni escribir. ca, el alumno se ve incapa- Estos son analfabetos en el citado para asimilar los co- sentido ms estricto; pero el nocimientos programados. analfabetismo real es mucho Sin embargo, mal que bien, ms amplio, si por l entenel alumno puede sortear el demos todo uso balbuciente obstculo de la evaluacin; de la lectura y la escritura. y se accede a BUP. y se' eso s, con un dominio incierto y poco til de la asig- constatan las numerosas denatura. A ello se puede aa- ficiencias en el lenguaje, que dir alguna ligera ayuda del dificultan, y en algunos asprofesor, que a veces realiza pectos imposibilitan sin rela comprensible eleccin de medio, el aprovechamiento que el alumno no se estan- escolar. Su casustica es proque en los estudios repitien- lija. Valgan, pues, unas bredo curso. Y no es inslito ves notas. que, segn el mencionado El descuido ortogrfico es informe de Alcorcn, se de- lo ms aparente y escandaDeficiencias lingsticas

I
I ,

loso. Revela ya una actitud poco precisa y atenta respecto a lo formal. La causa bsica de este creciente me-

noscabode la escrituraes el desuso de la memoria, que


ha sido desprestigiada exacerbadamente con serias consecuencias. Pero las faltas ortogrficas y de puntuacin no son tan graves comparativamente, pues afectan a elementos aislados del discurso, y no a su totalidad, aunque lo desluzcan. La estructuracin del escrito s es preocupante, si bien este aspecto suele ser ignorado. La penosa o inexistente (es decir, catica) estructura de un escrito lo convierte en un distrado producto dadasta, surrealista o del absurdo, si no fuera que carece de intencin, que es un texto imposible. Y la disposicin del entramado formal se logra mediante la correcta utilizacin de los signos de puntuacin, conformando una sucesin de frases suficientemente separadas, y matizadas las caractersticas de su relacin gramatical y semntica. La tarea organizativa, diseadora de las lneas de tensin del edificio que soportan el peso de la mampostera ideolgica, se completa con la provisin de partculas y clusulas de transicin armnicas y de pargrafos hermticos y proporcionados. Una manifestacin ms de lo abstrusos que resultan los aspectos de estructura puede hallarse en la prctica de la toma de apuntes. Esta tarea, en la mayora de los casos, se realiza torpemente; el alumno suele atender a lo textual, afanndose por copiar todo lo que se dice. Su aferramiento a la literalidad del discurso le proporciona un deshilvanado rosario de frases. Tan nefasta actitud es debida, sin duda, a su sensacin de naufragio en lo que

le parece un hostil mar lingstico. .As resulta que el alumno suele contentarse con la mejor o peor repeticin de las palabras pronunciadas por el profesor, que es el ms nfimo grado de conocimiento, segn la escuela socrtica. Afirmaba el griego que el segundo o intermedio grado de saber consiste en la enunciacin de las ideas recibidas con palabras diferentes; es decir, que la capacidad creativa de expresin significa un conocimiento superior. Como sea que no se ha adquirido un dominio suficiente de la lengua (o, simplemente, una sensacin de seguridad), no cabe esperar que el alumno desarrolle la toma de apuntes como una actividad reflexiva, que requiere sus potencias para discernir la informacin y disponerIa en el papel diagramticamente: con jerarqua y esquematismo. La explicacin de este fenmeno es clara. Nos remite a la concepcin dualista de pensamiento y lenguaje. El lenguaje es utilizado como medio que expresa transparentemente la realidad. Se pretende que las cosas aparezcan detrs de las palabras. Las cosas se pueden ver y tocar. Son concretas. Por qu no haban de serIo tambin las palabras, al servicio de lo fisico? Pero no, son elementos conceptuales y mediatos. Tal es la funcin referencial o representativa del lenguaje, que no se asimila fcilmente. Es curioso observar que la resistencia a aceptar la entidad propia del lenguaje posee una larga tradicin en los afanes cabalsticos, que rastreaban -segn el mito- los vestigios de la lengua revelada por Dios a los primeros padres, lengua "sabia" y transparente. (1) Una ltima apreciacin

general es la referida al registro idiomtico vulgar. Se trata de la incapacidad de adaptabilidad expresiva a las diferentes situaciones del hablante. Se posee una sola manera de hablar, ya sea entre los amigos o en la exposicin de un tema en clase. Tan slo se posee un registro idiomtico y, sea culto o no, se le califica de vulgar. Pero, efectivamente, el lenguaje utilizado no es formal (contenidos elaborados y matizados), sino vulgar (coloquial, espontneo. y con contenidos generales); ello significa que el hablante posee un cdigo restringido, a saber, un sistema lingstico pobre, repetitivo, enftico y poco sutil. Es' el problema del trnsito del lenguaje natural al lenguaje cientfico (2).
Conclusin: razn interna y externa del aprovechamiento escolar

El comentario de las deficiencias puede prolongarse, pero es suficiente para justificar el diagnstico, no por conocido, ms respetado. La provisin del recetario y la indicacin del tratamiento abre otros captulos. Pero, esta tarea se inicia necesariamente con la atribucin al lenguaje de su relevancia en el rendimiento escolar. Francis Bacon nos propone un muy adecuado smil en el "Prefacio" de la Instauratia Magna. Escribe: "Supongamos que se trate de transportar un obelisco de imponente magnitud..., )j que los hombres emprenden la operacin del transporte sin instrumentos; un espectado'r de buen sentido, nQ lo

juzgar como un acto de locura?" De poco servir que se aumente el nmero de hombres, ni que se elijan los

tiradores ms fuertes, ni que se recurra a los atletas, si no concurre la ayuda de rodillos, por ejemplo, o de gra. y aade el precursor de la "nueva filosofia" que "ejecutar los trabajos sin instrumentos y sin mquinas es equiparable a la aplicacin de la inteligencia desnuda y sola a las obras del espritu ". Esta vvida comparacin hace hincapi en la esencialidad de los instrumentos y de lo intrnsecamente metodolgico. El instrumento del trabajo intelectual es el lenguaje; su olvido o su desatencin en la escuela condena, igual que a los forzados del obelisco, a particulares y pequeos avances, en el mejor de los casos, y al desaliento; por el contrario, su cuidado y su adecuacin a las tareas intelectivas permitir la consecucin de los objetivos y la rentabilidad del esfuerzo desarrollado. Afortunadamente, la preocupacin por estas cuestiones no es particular. Aun as, es corriente que los educadores hagan dejacin de sus enseanzas lingsticas, para la mal entendida y fatal exclusiva de los profesores de lengua. El lenguaje es susceptible de ser tratado en su dimensin didctica, abstractamente, como es nuestro objeto. Pero, su consideracin como instrumento para la apropiacin del conocimiento y, en consecuencia, como factor de xito o fracaso escolar, no puede deslindarse de la realidad social. Algunas concepciones semiticas y estudios sociolgicos convienen en afirmar la no neutralidad del lenguaje y su relacin causal con las clases sociales. As, el lenguaje no es un fenmeno neutro; intermedia entre la estructura econmica y social, o modos de produc-

28

El lenguaje es un bien no cin, y las ideologas; y se halla mediatizado por la sujeto a reparto equitativo, funcin comunicativa de las fundamentalmente por caudos dimensiones, estructura sas exgenas. Esta trasceny superestructura. Tambin, dencia afirmada por la soms all del apacible mbito ciologa, con tintes determide la competencia lingsti- nistas, sugiere dos caminos ca (es decir, de la interiori- concurrentes. El primero zacin de la gramtica de la est orientado a la resolulengua), comn a los ha- cin de los problemas del blantes, la actuacin lings- lenguaje desde l y en l tica manifiesta sensibles di- mismo; a saber, en la escueferencias, atribuibles a la la, con las tcnicas particucondicin cultural, que lares de la materia de lengua acostumbra a coincidir con y literatura, aplicadas a los la propiamente social; pues, problemas enumerados, en segn el socilogo Basil acuerdo con las dems asigBernstein, los "principios de naturas. El segundo camino, -comunicacin dominantes y ya externo, consiste en presdominados... se adquieren tar atencin a la configuraesencialmente en la familia cin sociolgica del lenguay se desarrollan y sintetizan je. De la inteligencia cabal con que se estudie los eslaen la escuela" (3).

bones que antecepen al lenguaje en la cadena causal depender el dinamismo de la escuela. La afirmacin de estas vas de trabajo no es un vano voluntarismo, sino la posibilidad que cristaliza paulatinamente. La escuela vieja en que nos encontramos, y que difcilmente puede servir a la sociedad nueva, est sufriendo la compulsin social hacia el cambio y la mejora, mientras los enseantes, con trabajos, realizamos el aprendizaje de una nueva manera de entender nuestra tarea y nuestras materias. Y para concluir con un ejemplo, merece destacarse en el mbito de la lengua y la litera-

tura un fenmeno: la generalizacin de las experiencias de taller, que parecen prometer una enseanza integradora, creativa y estimulante.

J.J.L.
NOTAS:
(1) SCHAFF, A. Lenguaje y conocimiento, Ed. Grijalbo, Barcelona, 1975. KATZ, J. La realidadsubyacente del lenguaje y su valor filosfico, Ed. Alianza, Madrid, 1975. ) (2) PLEYAN, C. y NOGALES, V. "Lenguaje y pensamiento en la transmisin del conocimiento cientfico", en Cuadernos de Pedagogia,julio-agosto 80. (3) BERNSTEIN, B. Langage et classes sociales, Minuit, 1975. Cit., entrevista en El Pas, 25-V-82.

campo sernlotlco
b uen anlisis!

Un excelente ., .

~
~

para un

J. JAVIER LABORDA
Para el estudio de la materia de lengua y literatura es primordial dedicar atencin a las actualizaciones del cdigo. Concretamente, se desarrolla la prctica del comentario de texto, que tiene la virtualidad de ejemplificar variadamente la realidad subyacente de lo abstracto y la necesariedad de sus reglas. Lo concreto conduce, pues, a la comprensin del sistema lingstico. Otra cuestin es que se haya podido incurrir en el abuso del texto para el cumplimiento de la clase. La frivolidad de la moda es capaz de provocar estos perniciosos excesos, claramente pendulares. La utilizacin no superficial del comentario de texto resulta sumamente til por su versatilidad. Ello se debe a que constituye una unidad total de comunicacin; se da cabida al contexto y la situacin, esto es, a lo puramente lingstico y a las circunstancias no verbales. As, se abandona el mbito de las gramticas oracionales para acceder al ms amplio y, por ende, menos formalizado de la gramtica del texto. Ello posee mayor validez en el caso de los textos con un desarrollo extenso del esquema argumental, puesto que nos ofrece todo un campo semitico, completo y hermtico. La lectura y estudio de un libro supone un trabajo dilatado e integrador de hbitos de estudio, y es susceptible de un tratamiento ajustado a su particular tcnica y temtica. Fuera de toda duda est que cada profesor tiene sus preferencias en cuanto a textos se refiere, y que su conocimiento y gusto por ciertas obras es esencial para estimular la receptividad del alumno. Tal diversidad es para felicitarse, pues rehye parmetros homogeneizadores y atiende a las caractersticas del curso y de sus integrantes. Por consiguiente, nuestra intencin no es suministrar un vademcum ni abundar en el elogio de la actividad, ni tan siquiera suministrar un arquetipo, sino presentar un ttulo concreto, con su tratamiento y resulta4

~ dos, dentro de la brevedad " que nos condiciona.

)
L

El guardin entre el centeno, de Salinger

De entre los libros que hemos propuest() en clase para '1 su comentario, el de Jerome ) Salinger, El guardin entre el centeno (Alianza Ed., 1978) ha despertado un inters inusitado. Sencillamente, esta obra entusiasma a los alumnos de BUP, para quienes es especialmente apropiada; es alentador, pues un buen nmero de ellos son indiferentes e inclusive "alrgicos" a la lectura. Satisface haber conseguido quebrantar esa actitud hostil hacia la letra impresa, aunque el alumno solicite a continuacin leer otro libro parecido, con lo que nos coloca en un

compromISO.

Se produce con este libro el curioso fenmeno de que los alumnos dan noticia de l a los compaeros de otras clases que no lo conocen, se lo prestan y lo comentan en ratos de ocio. Este es uno de - los momentos en que la escuela trasciende, sale a la vida; la razn estriba en que es un libro vitalista, un producto que procede de la vida, con el cual conectan fcilmente los adolescentes. Nuestro mtodo de trabajo es el siguiente. Proponemos la lectura de la obra en cuestin, proporcionamos las referencias bibliogrficas y exponemos brevemente las caracteristicas ms motivadoras. Adquiridos los ejemplares e iniciada su lectura, dedicamos algunas clases espordicas a la puesta en comn de las cuestiones e incidencias que aqulla plantea. La participacin es nutrida; cada cual hace hincapi en algn pasaje, y recurre con complacencia a la cita textual de fragmentos. Parece 41

como si ese personaje rebelde y tierno fuera una creacin de cada uno de los alumnos, que fuera cada uno de ellos. Y no es de extraar esta identificacin con Holden, a pesar de enormes diferencias: neoyorkino, cosmopolita, de clase acomodada, interno en colegios caros... Su cultura americana y clase social elevada no son obstculo para que existan poderosos elementos de afinidad. Es esencialmente la figura del adolescente, el antihroe frente a los parmetros de los adultos. Simboliza la lucha por la afirmacin propia -en medio de mltiples contradicciones- y el sentimiento de indefensin ante la violencia y falsedad exteriores. Pero este libro no atrae nicamente por el hecho de que presente magistralmente a un personaje en la tensin del que ya no es un nio pero tampoco un hombre, con la consiguiente inestabilidad emotiva, inmediatez de reaccin, sensibilidad y ternura agazapadas tras una imperfecta mscara de dureza y autosuficiencia. El encanto de El guardin entre el centeno reside en la conjuncin necesaria de contenido y forma. La forma es sumamente atractiva. La narracin est escrita en primera persona; el recurso de la autobiografia de ficcin cala muy hondo en los alumnos, que interiorizan un personaje "real". Sin embargo, la bondad de la forma narrativa no termina en lo enunciado, sino que se completa con dos elementos relevantes: el humor y lenguaje. Es un libro de humor, de cabeza a fin, con la peculiaridad de que dicho humor no se desgasta; se lee una, dos... cuatro veces el texto y produce el mismo efecto. La trascendente significacin de El guardin...

nos viene servida con la aparente facilidad de una historia ligera, desenfadada, en la cual el narrador y protagonista no se toma en serio' ni a s mismo. Y el lenguaje tiene la cualidad del registro coloquial y el estilo fresco, sin insustanciales eufemismos ni retrica. En realidad, el humor y el lenguaje realizan una misma labor. Pero si atendemos tan slo a nuestra visin, con nuestros trminos, la presentacin de El guardin... queda desvirtuada. He aqu algunos comentarios (fragmentarios) al respecto de alumnos de l. de BUP del Instituto de Mollet (Barcelona). Habamos solicitado un nuevo ttulo para el libro, ya que el original es metafrico. Este es uno de los propuestos, con gran perspicaCIa: Ana: El libro que voy a
o

comentar tiene su propio ttulo. Pero despus de leerlo, me ha parecido que uno como "Un adolescente y su sociedad" es tambin muy apropiado. La misma alumna nos resume la historia y la interpreta con rotundidad. Ana: El contenido del libro habla de un chico, Holden Caulfield, de unos 16 o 17 aos. Holden es expulsado del colegio por haber suspendido cuatro asignaturas. Una noche, despus de pelearse con su compaero de habitacin, decide irse unos das a New York antes de volver a su casa. En la ciudad se aloja en un hotel de mala reputacin, y all mismo comenzarn sus experiencias, pasando las mil y una. Conocer gente extraa y rara, como las tres chicas del "Saln malva", las monjas, y al horrible Maurice. Estas experiencias poco a poco le harn sentir asco de 42

su sociedad y la maldecir. Al resumen argumental sigue la descripcin del ambiente y, a continuacin, la caracterizacin de los personajes. Empezamos por Holden: Guadalupe: Es simptico, sincero; no le gusta la falsedad; amable, caritativo, como en el caso del restaurante, donde se encontr con dos monjas a las cuales dio una limosna para los nios necesitados. Otros alumnos recogen ms caractersticas: sensibilidad, ensueo, odio a la rutina, variabilidad de humor (a diferencia de la "inestabilidad" antes sealada), tendencia a la mentira (por diversin o por caridad). . y despus de Holden, una galera de personajes, retratados impresionistamente. Ana: Ackley es un chico alto, con dentadura horrenda y mohosa. Su cara est llena de granos. Su carcter 42

es horrible, bastante atravesado. Luca: Phoebe es la hermana pequea de Holden, pelirroja y con trenzas. Es astuta, simptica, y muy cariosa con su hermano; prueba de ello es que estaba dispuesta a marcharse con l, cuando se enter de que se iba al Oeste a emprender una nueva vida... y tambin algunas palabras sobre lenguaje: Joaqun: El lenguaje que usan estos personajes yel mismo intrprete (protagonista) es un lenguaje de calle, ni sofisticado ni complejo, sino sencillo y claro, lleno de palabras como "cabrn", "rollo", etc., aunque no con demasiada insistencia. Es un hablar que la juventud de hoy da suele utilizar con frecuencia. El esquema de trabajo realizado por los alumnos se completa con una conclusin, que resume lo dicho en

;.,

~ .:J ...;

e e; ..
los apartados anteriores y que recoge la aportacin personal, lo que sugiere el texto. Ana: Sobre mi comentario (el libro, mejor), he de decir que me ha gustado. No la historia, sino todo en s, su forma de expresarse, su forma de desenvolverse poco a poco, es muy interesante. Las descripciones son lo ms importante, y cuando describe a una persona no lo hace diciendo cmo es, sino poniendo ejemplos de cmo acta o cmo tiene sus objetos, para comprender mejor lo que quiere decir. "Tambin creo que el autor, a travs de Holden, ha dado sus opiniones y crticas sobre la sociedad americana: materialista, ilusa, poco realista y con un gran grado de falsedad". La visin de El guardin... resulta ms completa con la fragancia e imperfeccin de las palabras cndidas y sabias, a la vez, de los jvenes lectores. Recapitulacin metodolgica Lo ms destacable del comentario es su simplicidad, viveza y eficacia. Y el plan de trabajo que hemos seguido en clase no merece otro adjetivo ms ajustado que el de "clsico". En efecto, la calidad de los instrumentos educativos puede lograrse mediante el desarrollo de una prctica no rutinaria con un material singularmente adecuado. Tales son los dos factores que se han conjugado. Este amplio marco semi-

43

tico que es el de la novela (como podra serIo el de cualquier manifestacin teatral, de la vida cotidiana, de la ceremonia, etc.) posibilita y exige una serie de actividades para completar su anlisis; decamos que es integrador de hbitos de estudio. Distinguimos tres partes:

- Lectura: El alumno se sumerge en la lectura de manera inmediata. Antes se le presenta lo ms sugestivamente posible a ese desconocimiento que es el libro sealado. Luego viene la confrontacin y, tras algn captulo de tanteo, la declaracin de las hostilidades o bien de la conformidad natural. En este ltimo caso, el libro y el alumno congenian y la corriente de simpata que se establece rescata el carcter ldico de la lectura.
- Discusin: Y nada ms ldico que el "hablar en clase, todos juntos". Por la triste memoria que tiene el alumno del mediocre hacer en la escuela, la discusin significa detener el tiempo y la precipitacin del programa de curso. En principio se ha de luchar contra ese concepto del "dolce far niente" propia del escarmentado, que est ms arraigada cuanto menos le interesa el tema. Mas, si se implica al alumno en el debate, ste deja de ser gratuito y tramposo. La discusin no slo permite madurar la informacin, las sensaciones, emociones... transmitidas en la lectura; tambin desarrolla las capacidades expresivas y, esencialmente, educa el sentido del trabajo colectivo y convergente, en menoscabo de los hipertrficos individualismo y rivalidad. Tal es el principio, y las concreciones nos hablaran del costoso y rentable aprendizaje del orden en las palabras, del si43

lencio atento, del respeto de las opiniones, de la oposicin razonada y de la fluidez y precisin en el uso de la lengua. La discusin se escalona a medida que se avanza en la lectura o que se vuelve sobre ella (la mayora de los alumnos leyeron el libro de un tirn), y mediante preguntas, citas, contraste de pareceres, vamos madurando el contenido del esquema propuesto desde un principio. - Exposicin escrita. La redaccin se cie a estos puntos, a ttulo indicativo, que discurren de lo general a lo concreto, salvo la conclusin: 1) Proposicin de un nuevo ttulo. 2) Tema (sntesis en varias lneas del objetivo del libro). 3) Resumen de la historia o argumento y circunstancias ambientales. 4) Los personajes. 5) Ellenguaje. 6) Conclusin. Del concepto de cada uno de estos apartados se ha tratado en las clases-debate. As, por ejemplo, la conclusin no puede consistir en una frase tpica, puesto que todo el trabajo se ha elaborado para depurar y razonar un juicio matizado. As como el minarete se levanta para dominar un lugar desde lo alto, de igual manera la conclusin culmina el trabajo si lo resume perspicazmente; de otro modo lo sesga. La significacin de estas tres partes del comentario de texto se reduce a 1) la lectura como ocio, 2) el libro como problemtica y como reflexin colectiva, y 3) ellibro como maduracin psicolgica y lingstica. A estas partes da fin la evaluacin, mediante la correccin de los escritos y el comentario de sus resultados, tambin de la participacin oral en una clase de valoracin. J.J.L.

l~

'.

:] S '1

PRACTICA

1. o DE BUP:
LA LENG UA

AL SERVICIO DE LA LENGUA

J. Javier Laborda Gil/ Francisco Rincn/Juan Snchez-Enciso

Hace bastantes

aos Amrico Castro dej dicho que la gramtica "no sirve para ensear a hablar y escribir correctamente la lengua propia, lo mismo que el estudio de la fisiologa o la acstica no ensea a bailar, o que la mecnica no ensea a montar en bicicleta", Es sabido que los mejores principios no tienen aplicacin inmediata por motivos diversos, servidumbre de la tcnica, pereza humana... Tal es la razn por la que se ha insistido de una manera nefasta en una prctica pedaggica que confunde los conceptos de lengua y gramtica. Parece que los planteamientos ministeriales al respecto pretendan equilibrar estos dos mbitos y hacerlos convergentes en los cursos de EGB y BUP.

Acerca de la gramtica de la lengua Necesariamente la actitud ante la enseanza de la lengua ha cambiado mucho. Se admite ya que hasta los catorce aos no es conveniente ensear gramtica. Despus de esta edad... tampoco es primordial. Como sea que se ha trabajado en el sentido contrario, el profesor cae a menudo en el desaliento; su tarea es casi intil; la aridez, el aburrimiento, la pasividad o, peor an, la agresividad deterioran la clase. Yes frecuente constatar el rechazo de la asignatura de Lengua. Los resultados son realmente devastadores: la teora es mal asimilada -no pocas veces memorizada efmeramente- y la prctica fructifica menos que un desierto en poca de sequa. El esquema de un libro de texto al uso -intil buscar diferencias notables entre ellos- es siempre idntico. Un texto inicia la leccin, acompaado de ciertas tcnicas de comentario, para servir de aperitivo al plato fuerte, teora acerca de los fenmenos de la lengua, pa~a acabar con unos ejercicios ejemplificativos. Es frecuente que muchos textos sean adecuados para estudiosos, universitarios o -en palabras de Manuel Seco- "extraterrestres", y los ensayos para su comentario -a veces patticos- no suelen orientar con determinacin, con mtodo; as, la tcnica del comentario es un elemento al que se atribuyen capacidades milagrosas a la hora de desarrollar el aprendizaje lingstico, pero en el fondo puede resultar tan anodino como un placebo. La teora, por muy acertada que sea, desciende graciosamente a iluminar al alumno, quien comprende fcilmente la relacin que existe entre su aumento de la competencia lingstica y el sistema fonolgico espaol, las variedades dialectales peninsulares, el signo lingstico, etc. A ello contribuye la inapreciable provisin de ejercicios para la "comprobacin emprica de los fenmenos de la lengua". Pero las deficiencias radican, no slo en los elementos de la leccin, sino tambin en el tipo de relacin que entre las diferentes unidades o lecciones se establece. Estas se repiten indiferenciadamente, sin marcar progresin alguna (salvo en la exposicin terica que va de lo ms general a lo ms particular), sin pretenderse una progresin estructural. Fernando Lzaro Carreter, autorizado por su dilatada experiencia pedaggica, ha expresado con palabras renovadoras que se impone "una reforma radical de los planes de estudio, que permita a los profesores y a los alumnos una mayor holgura para trabajar en ese frente defensivo" que es "ensear y aprender a servirse de la lengua espaola". La renovacin pedaggica que plantea consiste en la disolucin de esa confusin inmemorial entre lengua y gramtica. Como si de la liberacin real de la filosofa frente a la teologa se tratara, la expansin del buen uso de la propia lengua no ha de estar regida por el aprendizaje gramatical. Ello.no obsta para reconocer que, si la gramtica no sirve para aprender l lengua, puede ser til de manera secundaria y asociada. El taller como alternativa Si bien es difcil desligarse de la tradicin didctica de la lengua, la irrupcin de los denominados talleres est intentando cambiar el panorama con la radicalidad que vindicaba el profesor Lzaro Carreter. "Taller" es un nombre modesto; connota cierta autosuficiencia del grupo, tambin indepen- 29

dencia y una unidad en su pequeez que hace recordar el eslgan de "lo pequeo es hermoso". Responde a la necesidad que sienten los alumnos de hacer ellos su propio libro; de ser emisores y receptores interrelacionados de sus producciones lingUlsticas; de inventar un programa que les permita la utilizacin inmediata de la lengua. Indudablemente, hemos de estar a favor del desarrollo preferencial de la lengua escrita, puesto que es la que ha de potenciar su enriquecimiento lxico y tambin de los recursos gramaticales, sin olvidar el fundamental dominio de los registros. De tal suerte., lo escrito contiene lo oral. Con ello se aleja la amenaza de que los alumnos sean elementos pasivos, meros receptores de escritos o de textos de lejanas resonancias, en los temas y el registro . Necesariamente el cuestionario oficial ha de sufrir algunas quiebras en beneficio de una metodologa diferente. Nuestra

c r

\ t ~

r 1

E t

experiencia en la asignatura de Lengua de 1. o de BUP


-avalada por los satisfactorios resultados obtenidos en aos

c t E r c E f 1

anteriores en la de Literaturade 2. o - ha sido guada por esta


crtica, que, ante todo, nos hemos hecho a nosotros mismos.

Este curso de 1. o de BUP es crucial, pues rene en s las


caractersticas de ser un inicio y un final. El inicio viene dado por el paso a la enseanza media; el cambio, aunque debera ser de brusquedad amortiguada, existe, mxime si afirmamos la capacidad perturbadora de la gramtica en los cursos inferiores. El final se debe a que posteriormente se pasa a estudiar literatura; no obstante, la disociacin entre la enseanza de la lengua y la literatura est siendo resuelta, ya ello intentamos modestamente contribuir. Despus de este primer cur-

so, ya lo sumo el 2. o de Literatura, la lengua desaparece de


los programas para surgir como Guadiana endeble en el peculiar COU. Si en el curso de Literatura se parta de la prctica de la novela, la poesa y el teatro!l) , en este precedente, la pedagoga de la escritura se centra en el cuento, reuniendo en torno a s muy diversas actividades para un solo fin, como son el cmic, la representacin teatral, el guin radiofnico, el peridico, la actividad publicitaria, etc. Las pautas son muy simples: el alumno trabajar con cuentos seleccionados y crear otros tantos propios, con la nica exigencia de que aprenda a provocar el humor, mantener el suspense, plantear el drama, suscitar el sentimiento. Como aprendiz del taller de la lengua, se valora en el alumno su capacidad para realizar esos pequeos objetos narrativas, construidos con palabras, a cuya finalidad coadyuva el dominio de determinadas herramientas tericas y la madurez que proporciona la gradual reflexin sobre los fenmenos lingsticos. Una programacin diferente del curso

30

La distribucin del trabajo atiende a los trimestres del curso, a saber: el primero se dedica al desarrollo del humor, el segundo, al suspense y la aventura, y, el tercero, al cuento potico. Estas tres unidades son temticas y metodolgicas. En cada una de ellas se desarrollan las mismas tcnicas, con la diferencia de la superacin de las deficiencias formales de la escritura de los alumnos y la superior exigencia que supone llegar a la expresin de situaciones poticas. A efectos ejemplificatorios, puede servir la descripcin de las actividades del primer trimestre. Se inicia con la provisin

de un informe sobre los recursos lingUsticosde todo tipo (fonticos, morfosintcticos y semnticos), que tienen el atractivo de especial orientacin a los efectos humorsticos. La lectura de este informe es el prtico al conocimiento integral del humor, y para cada uno de elJos se establece el siguiente

plan: 1.0- lectura de un cuento apropiado; 2. o ejercicios:a)


banco de recursos, b) "cuentamos" contigo, c) humor se escribe con "h". El distinto acercamiento al humor por los textos presentados, sean de humor negro, disparatado, irnico, de situacin, etc., da pie a reflexionar sobre sus elementos y esencialmente sobre los recursos lingUsticos que en elJos se despliegan. En el apartado del "banco de recursos" se realiza el despiece del texto propuesto y el ensayo de sus recursos, con la intencin de aplicarlos a creaciones propias. Se entiende que este apartado intenta la asimilacin de la teora facilitada en el informe primero y la adecuada preparacin para que pueda ser utilizada con cierta eficacia. El segundo apartado de los ejercicios, que con cierta libertad denominamos "cuentamos contigo", propone diversas formas de preparacin del relato que va a realizar el alumno segn el tipo de humor trabajado. Hemos de aadir que, como materia prima de los relatos, el alumno dispone de una serie de noticias periodsticas, susceptibles de tratamiento polivalente. Finalmente, en cada una de estas "lecciones" del trimestre se presta atencin a la ortografa. En el segundo trimestre se atiende ya a la puntuacin. Pero estas cuestiones formales exigirn un tratamiento personalizado, segn los casos, al margen de los ejercicios colectivos. El trabajo se realiza en grupos de cuatro a seis miembros. La resolucin de los ejercicios, la redaccin final, suscitan dudas y sugerencias, que por regla general pueden ser solventadas en el seno del grupo. La crtica de los cuentos creados es uno de los momentos de discucin ms interesante. En la ltima parte del trimestre, concluida la fase de creacin, viene la parte de comunicacin. Los grupos han permanecido relativamente aislados, y es el momento de que transmitan de manera especial alguno de sus trabajos al conjunto de la clase. Para elJo se les facilita un conjunto de informes. El primero y ms general, titulado festivamente "Vamos a contar cuentos", explica cules son los medios de comunicacin y cules sus elementos y funciones; junto con la teora, se incluyen ejercicios para afianzar el conocimiento de lo expuesto. A continuacin, un abanico de posibilidades comunicativas, de entre las cuales debern escoger una y adaptar un cuento (cada uno de los grupos) a las caractersticas del medio. Los informes que posibilitan esta actividad son los relativos al lenguaje teatral, del cmic, de la radio, del peridico y de la publicidad. Los medios directamente comunicativos son los tres primeros; el grupo de periodistas ha de realizar crnicas de la preparacin de estos trabajos y valoracin de los resultados; los publicistas han de conocer los cuentos elegidos y proveer elementos propagandsticos de todo tipo (canciones, eslganes, remitidos periodsticos, etc.) para "vender" los productos. La combinacin de todas estas tcnicas es realmente sugestiva. No slo anima poderosamente al trabajo (especialmente al trabajo grupa\) , sino que tambin permite equilibrar el trabajo de pupitre con la escena, el "espionaje" periodstico o la declamacin. De esta manera, la pedagoga de la escritura busca la utilizacin inmediata de la lengua por los alumnos segn un criterio creativo, desde el punto de vista del emisor,

y la proyeccin en la dimensin comunicativa al dar trascendencia a sus propios textos, pues sirven de materia de estudio de la lengua y de plataforma de aproximacin a un modelo de competencia lingstica. De tal suerte, el hablante-alumno recupera su importancia y el reconocimiento social de la clase (y tal vez ms, pues las representaciones y el peridico pueden salir del aula). En el primer trimestre se cuidan los aspectos fonticos, morfolgicos y semnticos, sin perjuicio de que se traten de nuevo posteriormente. En el segundo trimestre se hace hincapi en la sintaxis, a la vez que se trabaja el cuento de miedo, de ciencia ficcin y policaco, todo lo cual sirve para denominar al trimestre como "la sintaxis del suspense". El tercer trimestre se aplica al cuento potico, a la vez que se suministran los elementos tericos respecto a la poesa y mtrica y los usos del lenguaje; las tres modalidades que se conocen en este son el cuento en verso, el lrico y el de realismo mgico. Sin duda, la radicalidad de esta propuesta de enseanza creativa de la lengua no puede ser a la vez fiel a los principios que la animan y totalmente respetuosa con el temario clsico. Los resultados parecen ser mucho ms halageos que los

obtenidos con metodologas tradicionales; an as, resulta evidente que se han de operar reformas en un proceso de maduracin lgico para alcanzar una eficacia ptima. A disposicin de los enseantes est esta experiencia metodolgica, editada por el ICE de la Universidad Autnoma de Barcelona, para que sus crticas perspicaces sirvan de estmulo para una deseada mejora.

J.J.L.G. /F.R. / J.S.E.

Nota (1) Ver Cuadernos de Pedagoga. noviembre 81. abril, junio y septiembre 82.

REVISTA MENSUAL
f

'

I ENERO1984 At\iO X 250 PTAS.

DEEDUCACION N.o 109

HISTORIA DEL PENSAMIENTO EDUCATIVO

VA A LA ESCUELA
J. Javier Laborda

oRWELL

GEORGE

Ms all del tpico ~cil, aunque oportuno, entre el ao de gracia 1984 y el conocido escritor George Orwell, est artculo propone al lector enseante una aproximacin diferente al autor britnico. Desfilan en ella su vida, sus libros y sus angustias. Pero, sobre todo, sus reflexiones como nio-alumno y, ms tarde, como profesor. La actualidad de su rechazo de formas y normas escolares, acordes con un tiempo y un espritu que no era el suyo, es, tambin, la de muchos educadores sensibles de nuestros das a quienes tampoco les satisface la escuela actual, la de 1984...

Crnica fechada en 1984


Desde nuestra poca, que a menudo nos parece crepuscular -o al menos as nos la presentan los medios de comunicacin social- se dira que poco nos afecta o importa lo que ocurra all en el primer tercio de siglo, ni qu distinta atmsfera se respiraba. Entre la soberbia de pulsar el curso del tiempo y la confusin de no poder gobernarlo, generalmente se nos oculta la contingencia de nuestro protagonismo y, si se apura, su banalidad. Y aun contribuye a agudizar este curioso estado anmico, resultante de los sentimientos encontrados de desorientacin y envanecimiento, el sabemos en la transicin o, tal vez, en la consumacin de una nueva etapa, era o como quiera lIamrsele. Se trata del abandono del modelo renacentista por la asuncin de una posmodernidad, cuya complejidad an no ha asimilado nuestro andamiaje mental. Se trata"tambin, del fin del modelo industrial del siglo XVIII y la irrupcin de la segunda revolucin industrial, en la que la electrnica barre a la mecnica, el ahorro de materias y energa al despilfarro, el intercambio de informacin al de bienes. Y se trata, en fin, de la ruptura con toda la historia de las guerras de la humanidad -parciales, con vencedores y vencidos- al abrir la posibilidad de la guerra absoluta, sin salvacin para la especie, adornada por las simpticas cualidades de rapidez, pulcritud y sed ente comodidad. Orwell intuy esto. No fue un visionario ni un profeta, pero s un espritu sensible y comprometido que, a modo del explorador, supo aplicar el pabelln auditivo de su inteligencia a los ralles del tren de su tiempo, para anunciar el fragor de una locomotora negra en movimiento de aproximacin. En estos momentos sus palabras nos suenan con especial poder, pero, ms que por la anecdtica coincidencia de la fecha 145

y ttulo de 1984, por la comunidad que se establece entre su temor y nuestra inquietud. Y su figura se nos antoja como la
de sagaz rbitro entre el pasado que conoci y el futuro que vislumbr, esforzndose por encontrar un equilibrio en los tempestuosos aos treinta y cuarenta. De ah que tengan inters sus vivencias escolares como alumno y profesor que fue. Quizs la acre visin que nos proporciona Orwell de la monstruosa normalidad del sistema escolar que le toc en suerte sirva de revulsivo para imaginar con vvida sensibilidad la realidad de nuestra escuela, aligerada por un momento nuestra epidermis de los depsitos calcreos de la deformacin profesional y de la amnesia de nuestra niez. O quizs nos gratifique al posibilitar una comparacin mental a nuestro favor. No obstante, lo ms fcil es que se cumplan las dos posibilidades a la vez y ninguna por separado, por la sencilla razn de que -como aspecto negativo- el "curriculum" educativo es esencialmente el mismo, mientras que -en el lado esperanzador- los propsitos y usos contemporneos apuntan a su superacin.

En la escuela posvictoriana Cuando Orwell ingres en la escuela preparatoria a la edad de ocho aos, en la que permanecera hasta los trece, ya llevaba consigo el germen de la aficin literaria, a cuya eclosin seran ajenas las aulas. Quince aos consecutivos en ellas, entre las que se contaran las del prestigioso Eton, y apenas le sirvieron de refuerzo. Sirva de consuelo que, como nada se vive en vano, los aos escolares le proveyeron de sufrimiento y tema de reflexin suficientes para provocar en l una maduracin eficaz. Con la ms hiriente irona coment sus cursos de la preparatoria en un ensayo autobiogrfico que titulaba sarcsticamente "As fueron aquellas alegras". Lo cierto es que sus motivaciones literarias fueron extraescolares. Su madre, Ida Mabel, era una mujer con carcter y esmerada cultura, y le inici en la poesa con lecturas que, al parecer, dejaron huella en el pequeo Eric (tal era su nombre autntico, Eric A. Blair); al poco, entre los cuatro y cinco aos, dict a su madre su primer poema, relativo a un tigre cuyos dientes "eran como de carne". Por razones familiares, desde esta edad cobij un sentimiento de soledad y menosprecio que perdur durante su adolescencia. Algunas circunstancias le indujeron a ello, pero influy especialmente su singular manera de percibir las cosas. El testimonio de sus compaeros recabado aos despus corrobor su extremada sensibilidad y mayor grado de madurez que la mayora. A temprana edad se inici en el hbito de hablar a solas y fabular para s historias, personajes y sucesos de su vida. Durante tres lustros aliment un ejercicio teraputico y, a la vez, literario: "ir imaginando una 'historia' continua de m mismo, una especie de diario que slo exista en la mente", reconoca en su ensayo "Por qu escribo". Se senta a gusto con las palabras, en las que encontraba el refugia y las satisfacciones que no le deparaba el entorno. Su etapa escolar le hizo experimentar el fracaso (a pesar de no sufrir ni un slo tropiezo acadmico), sentimiento que reforzaba dialcticamente su mundo privado. Al cegarse la comunicacin autntica y sustituirse por una relacin de impostura, le ocurri a Orwell -como a otros condiscpulos- que su capacidad qued ignorada y su intimidad soterrada. No es infrecuente que, por algu-

46

na casualidad, pueda compararse al alumno con el fruto del granado, que parece inerte tras su dureza paquidrmica y, sin embargo, es una promesa de estallido nuclear de espontaneidad e inteligencia; la clave est en que tal promesa de color rub ha de saberse manejar exteriormente para que se cumpla, y que el propio fruto no posee conciencia cierta de s y aun puede que sus rudimentos reflexivos le hayan sido inducidos falsamente. El colegio en el que Orwell ingres en el ao 1911, era el internado de Sto Cyprian, en Eastbourne, centro privado muy prestigioso al que concurran hijos de la aristocracia y de la clase media alta. (El esfuerzo de los padres de Orwell fue notable, pues se hallaban fuera de este segmento social.) Sus bondades pedaggicas podran deducirse de algunos datos, aparte de su realidad contable: cien alumnos, diez profesores, el director y su esposa (tambin con actividades profesorales) un ama de llaves. Estas y otras lindezas no se presentaban como tales a un nio desplazado de su casa y entregado a la vida cuartelaria. La primera noche se despert sobresaltado repetidamente, y la dureza del colchn le comunicara la metfora intuitiva de lo que le esperaba. "Tu hogar poda distar mucho de la perfeccin -escribi- pero por 10 menos era un sitio donde reinaba el amor y no el miedo... A los ocho aos 10sacaban a uno sbitamente de este nido caliente y 10 arrojaban a un mundo de fraude, fuerza y secretos, como una carpa dorada a un depsito lleno de pinchos". Esta impresin no hizo sino acrecentarse con el tiempo, especialmente porque el sujeto se senta atrapado. La era victoriana acab supuestamente en el siglo anterior, pero no sus estigmas. Escribir a los padres pidiendo que le "rescataran" era algo moralmente imposible pues significaba que era desgraciado e impopular, y el fracaso resultaba deshonroso, infamante. As que interioriz el sentimiento de culpa y de fracaso, segn le fue inculcado con energa y recursos eficaces, y ejercit ante todos la amarga obligacin social del disimulo con perfeccin britnica. Al poco de llegar a S. Cyprian comenz a mojar las sbanas, contrariedad esta que tena dominada haca cuatro aos. Para tal caso el remedio consista en una buena tanda de azotes -verdadera panacea para cualquier enfermedad escolar-. Despus de varias reconvenciones por su "delicuencia" desenfrenada, fue enviado a presencia del director, Mr. Wilkes "Sambo". El ritual era comunicar a ste la falta, aunque la conoca sobradamente, y acto seguido llova un sermn aderezado con rtmicos golpes de la fusta, de manera que sus palabras sonaban as: "eres- un -su-cio-chi-qui-llo" A los pocos minutos de este primer y leve castigo se encontr de nuevo en direccin soportando otro de campeonato, por la ingenuidad de haber comentado a otros nios que no le haba dolido. La esposa del director -"Flip", entre los chicos- caz el gesto orgulloso de Eric y le hizo desandar sus pasos para que aprendiera que el castigo corporal no busca tanto el dolor como la humillacin, el sometimiento moral. Pero esta vez el castigo busc por igual los dos fines. Director y discpulo cumplieron con su papel perfectamente, el primero con energa y el segundo emitiendo el llanto adecuado en una posicin harto incmoda, hasta que el ltigo dej de colaborar por la rotura de su mango de hueso. No afect tanto al nio Orwellla violencia del castigo ni sus secuelas fsicas como la comprensin de una realidad an-

gustiosa. Haba rezado con fervor para no despertar en la delatadora humedad matutina; sin embargo las plegarias no le libraron de su maldad, que no era consciente, pero era porque ocurra. Y adems era el culpable de la fractura de la fusta, segn le dijo el director y extremo que crey. Indudablemente, la buena voluntad no operaba de manera adecuada, resultaba dbil para enfrentarse a una predestinacin insondable. Ello le produjo una insoportable "sensaci6n de soledad y abandono -confesara bastantes aos ms tarde-, de ha/larme encerrado, no s610 en un mundo hostil, sino en uno de bien y de mal con reglas tales que no me era posible cumplir/as". Sea como fuera, el problema de la incontinencia acab tan drsticamente como pretenda el mtodo curativo que se le aplic. Pero no era necesaria esta curacin para convencer de su clamorosa eficacia a la felizpareja de Sambo y Flip. La esposa era la que en realidad gobernaba el lugar, y provocaba en los alumnos confusos sentimientos de odio, amor retorcido y temor. Su trato oscilaba entre la severidad y la frivolidad, que alentaba a la adulacin y a una "lealtad teida de culpabilidad". La hipersensibilidad de Orwell fue un raro sentido detector de relaciones y situaciones morbosas que se entendan normales, lo cual le mortific pero, como contrapartida, le permiti racionalizar en la edad adulta aquellas angustias. No era necesario que la vida de la escuela se saliese de lo cotidiano para sufrir los efectos de la violencia fsica y especialmente moral. Esta violencia se generaba con la incuIcacin

de una' nocin culpable del comportamiento, oscurantista y terrorfica del sexo, clasista de la calidad humana, desconcertante de la caridad divina, demoledora de la integridad personal, aborrecible de la pedagoga... Dlgmoslo as, de manera sinttica, para obviar las agrias ancdotas. Orwell sufri todo ello con aparente indiferencia pero con intensa rebelda emocional. La tirana del dinero le result intolerable. Se le hizo notar que era un becario. Le acongojaban los recordatorios del director de su "desgracia" social y el desdichado destino que por esa causa le estaba reservado: atracarse de estudiar para ser una ruina, es decir, un oficinista o un empleado en las colonias. Las clases ocupaban una parte del Internado no mejor que el resto. Llevaban el sello de la casa y consistan en un atiborramiento de conocimientos slo tiles para los exmenes de ingreso en las escuelas privadas de segundo grado. Era una enseanza -cnica, calific Orwell- memorstica y discrimlnatoria de las materias que no eran objeto de prueba, como las matemticas, ciencias y geografa. Se atenda a una preparacin clsica para el "timo" en ciernes: latn, griego e historia. Se buscaba una erudicin hueca, superficial, sin lectura de obras ni conocimiento reflexivo alguno, slo atenta a los resabios aprendidos de anteriores exmenes. "La historia -anot el escrltor- era una serie de hechos sin relacl6n unos con otros... Recuerdo verdaderas orgas de fechas y a los chicos ms listos saltando de sus asientos, impacientes porque les preguntasen y poder gritar las respuestas exactas".

47

El profesor que ha hecho escuela


La banalidad de estos conocimientos se articulaba en una abrumadora exigencia de trabajo, punitiva, que pareca de imposible cumplimiento sin la convincente exhortacin .de la vara. Orwell se llev a Eton la aversin y el recuerdo de la sordidez de St. Cyprian y pudo subir a la superficie a respirar. Bastante tiempo despus, a punto de cumplir los veintinueve aos, despus de haber conocido la antpoda" geogrfica (la India) y social (la mendicidad) asumi el rol d profesor en un pequeo colegio privado de Uxbridge de muy modestas pretensiones. La inexperiencia no fue obstculo para qu saliera con xito del empeo ocasional, que se prolong dos aos. Lo cierto es que no aplic los patrones educativos que aprendi. No habra sido capaz de aterrorizar a un chaval dicindole que la masturbacin era un camino que conduca directamente al manicomio, ni tampoco de reproducir la nocin clasista de que la asequibilidad del xito dependiera de quin se era (en libras esterlinas) y no de qu se haca. Decididamente, ayud a morir a la escuela victoriana. Algunos alumnos le recuerdan agradablemente, con los rasgos de su personalidad madura. A ellos dedic espontneamente mucho de su tiempo libre. Como amante de la naturaleza, les ense sus curiosidades en excursiones. Como amante de la literatura, les escribi y produjo una obra de teatro titulada "El rey Carlos 11",encargndose incluso de confeccionar ropajes y armaduras. Como enemigo del avasallamiento, trat a los jvenes amistosamente, estimulando su inters por el estudio y facilitando una relacin autntica. Y consigui que albergaran hacia l sentimientos que le habran parecido impensables en otro momento. Al parecer slo pocos aos antes de morir tuvo fuerzas para rescatar sus recuerdos escolares y depositarios lcidamente en el manuscrito "Asfueron aqueI/as alegras", que se public pstumamente. Con ello super el abismo de incomprensin que separa el mundo psquico adulto del infantil para comunicar un testimonio inquietante. Si "el nio y el adulto viven en mundos diferentes", dej escrito, a pesar de los tranquilizadores cambios de usos, "no podemos estar seguros de que la escuela... no siga siendo para muchos una experiencia tan espantosa como sola serio". Espantosa, para algunos, la escuela de internos, y penosa, para otros, la escuela de da. Ni Orwell hizo escuela con sus nuevas maneras en su fugaz dedicacin profesoral ni sus escaramuzas escolares se han difundido. Nunca pretendi tal. S, en cambio, ha creado escuela con su escritura, vibrante, honesta, sencilla y comprometida con la mejora del futuro del hombre. Algunas de sus inquietantes novelas advierten enfticamente de los peligros polticos. Otras nos devuelven el recuerdo de una vida antigua con el que cotejar la nuestra y constatar la prdida de lo valioso del pasado. Precisamente, en la memoria del pasado -que suprimen los policas de Milnovecientos ochenta y cuatro- se encuentra el baluarte para afrontar la amenaza de un futuro sin concienCia de lo perdido, sin identidad histrica. La magistral prosa orwelliana es una excelente fuente de entretenimiento y maduracin para profesores y escolares, que sintoniza con las corrientes de humanismo y modernizacin de la escuela; humanismo, mediante la integracin de

....

Como profesor en "The Hawthorns" en 1933

los principios democrticos y el desarrollo de la afectividad personal; y modernizacin, para la preparacin del alumno para vivir y luchar por su tiempo con los instrumentos de su tiempo, en especial, mediante el conocimiento real de los medios de comunicacin social y sus recursos. Slo as no ser posible Mil novecientos ochenta y cuatro. J.J.L. "PARA SABER MS"
Breve nota bibliogrfica de George Orwell

Novel~ - Rebelin en la granja, Ed. Destino. Barcelona, 1983. Versin catalana en Argos Vergara. Versin vasca en Euskal Liburu. De muy adecuada lectura para alumnos de los ltimos cursos de EGB y de Bachillerato. El texto presenta una notable ductilidad pedaggica y permite mltiples ejercicios, desde la escritura reflexiva hasta el canto coral (de la cancin de los animales). - Mil novecientos ochenta y cuatro. Ed. Destino. Barcelona, 1983. Versin catalana en Argos Vergara. Describe cmo podra ser nuestro tiempo o uno venidero horrible. Los detalles no son esenciales, s la atmsfera. - Subir a por aire. Ed. Destino. Barcelona, 1981. . Texto muy agradable por su sentido del humor, interesante por la defensa de unos ideales humanos y ecolgicos y asequible para alumnos de los cursos superiores de Bachillerato por su claro tratamiento. Ensayo - A mi manera. Ed. Destino. Barcelona, 1976. Antologa de ensayos y artfculos capitales de la obra de Orwell. Amenos, penetrantes e impresionantes. Incluye "As fueron aquellas alegras", "Por qu escribo" y "Matar un elefante", entre otros. - Sin blanca en Pars y Londres. Ed. Destino. Barcelona, 1983. Primer libro del autor que narra sus experiencias como lavaplatos y mendigo. - Homenaje a Catalua. Ed. Ariel. Barcelona, 1970. Versin catalana en la misma editorial. Relato de los sucesos que presenci Orwell en el frente de Arag6n y la Barcelona de la guerra civil espaola. La presencia bibliogrfica de Orwell en castellano se extiende a estos otros ttulos: La marca, (Destino, 1982); La hija del reverendo, (Alianza, 1970); Venciste, Rosemary (Destino, 1981); El camino de Wigan Pier (Destino, 1976) y Mi guerra civil espaola (Destino, 1978).

49

REVISTA MENSUAL DE EDUCACION N.o 112 ABRIL 1984 AOX 250 PTAS.

Je

La enseanza en Galicia

~ ~

'"

,,'

~ 0

Q)

~
r5 ~ ./

;;:;

,)

:7iP

~,~

ESCUELA SOCIEDAD

DE LA REVOLUCION A LA EVOLUCION EN LOS LIBROS EDUCATIVOS


J. Javier Laborda

Cul es el porvenir del libro ante la avalancha audiovisual e informtica? El autor no aventura una respuesta; pero ofrece una informacin sobre las estrategias que los editores estn elaborando para abandonar el viejo manual y entrar en el nuevo siglo. La renovacin pedaggica no puede quedar al margen de las nuevas tecnologas; equivaldra a quedar a su merced. Hay lugar, segn el autor, para una satisfactoria valoracin.
.~

La metfora

del espejo electrnico

El alumno aprieta el interruptor que conecta con la red y, con este gesto, abre su libro, comenzando siempre con el ndice. Para llegar a la leccin que le interesa no se ve obligado a pasar pginas; basta con que diga cul es o, mejor dicho, que lo escriba, e inmediatamente aparece. El libro es a la vez libreta y pizarra, ya que permite realizar en l los ejercicios; los resultados quedan reflejados en cada intento y borrados posteriormente. El libro incluye texto, imagen en movimiento y sonidos, esto es, rene peculiarmente al audiovisual y al libro tradicionaL Y adems rescata para la modernidad al espejo mgico de los cuentos fantsticos con su capacidad de dialogar con su dueo, contestar o proponer acertijos, sealar el xito o error de las manipulaciones, sugerir repeticiones o formps de recuperacin y, fundamentalmente, reflejar en su pantalla las bondades intelectivas de su usuario. Este libro, que no est hecho de papel, sino de circuitos integrados, y que no est escrito en tinta, sino con impulsos elctricos en virtud de un alfabeto binario, constituye la ms actual metfora de su lector. Esta mquina se erige en metfora multiforme, dinmica y personal. Los editores del mundo se estn volcando a este nuevo sector de su actividad que es el libro electrnico, en forma de discos para microcomputadoras. El campo educativo -institucional o no- absorbe gran parte de esta incipiente produccin, y el fenmeno no puede calificarse de moda. El lder de esta produccin es el gigante norteamericano. Por fortuna, en el mosaico europeo la avalancha informtica ha propiciado la colaboracin de prestigiosas empresas edito-

51

La ilustracin como elemento determinante en la visualizacin de contenidos, Ilustracin tomada de Visual, la Enciclopedia General Bsica, de Ed, Oceno.

~de
lilqIlttllljJi

Animales

riales para la realizacin de un proyecto educativo internacional. Y ha surgido VIFI, sociedad que agrupa a Mondadori, Nathan, Longman y Anaya-Grupo GSR, entre otras. La presentacin de su catlogo est prevista para esta primavera, y contempla sistemas de tratamiento de textos, juegos lgicos, cursos de diversas materias y niveles, programas de verificacin ortogrfica, mtodos de enseanza de los lenguajes informticos, etc., etc. Parece innecesario resaltar el inters de esta produccin propia y su edicin en castellano. Cruce de caminos Entre el viejo manual, de diseo a veces pueril y contenido indigesto, y la prometedora novedad del libro, sin papel, que ya es realidad y, pronto, extendida cotidianeidad, se alinean otro tipo de textos educativos que tienen la particularidad de servir de puente hacia esta ltima forma de edicin. Sin embargo, ste no es un proceso unvoco ni simple. La edicin electrnica no es hito excluyente, es decir, no juega en detrimento de la edicin con soporte tradicional. Las nuevas tendencias internacionales de la edicin de textos educativos posee el atractivo de unos principios pedaggicos resueltos y refrescantes. Su diestra plasmacin en resultados de agradecida presentacin y superior estructuracin no dimana de intuicin en un panorama de deplorables condiciones materiales, sino de la labor de equipos editoriales expertos y profesionales, En nuestros lares, donde la situacin resulta inversa y el castigo de las geniales improvisaciones es insoslayable, verdadero "Deus ex maquina" de cada da, no puede 'extraar por consiguiente que los proyectos editoriales aplicados a la educacin sean importados, traducidos y satisfechas la-sregalas. Aparte de las consideraciones sobre los efectos de tal colonizacin, ante todo se debe constatar la generalizada atona nacional. Se ha de vencer la pereza mental, s, pero tambin acrisolar un amplio espritu de empresa para alcanzar una competitividad ajena a fraudes y milagreras pseudoculturales. Mientras el libro no deje de ser algo negativamente mgico para muchos nios -y adultos-, es decir, un objeto misterioso y temible por su poder potencial de significacin, existe un amplio campo, aunque no sea ms que para los "primeros auxilios" pedaggicos. Lamentablemente, el libro constituye una ventaja racional al mundo, frente a la cual no siempre se ha sabido inculcar una actitud positiva. Los catlogos para la enseanza primaria o secundaria de editoriales como Cambridge Educational, Oxford University Press, Aladdin Books, Prentice-Hall o Usborne Publishing, por citar algunas firmas destacadas, ofrecen un excelente ejemplo del hiato entre el buen hacer didctico de estos renovadores y el tedio de la repeticin de anquilosados patrones oficialistas y pseudoenciclopedistas. En todas las obras dignas de atencin, el diseo es la pieza de choque, el reclamo ms seguro y la amalgama ms 'firme de la informacin suministrada. El diseo de la ma-, queta, vistoso pero no superficial, es la parte aparente o visible de la idea pedaggica, de la que es vicario. No sirve ilustrar abundantemente un texto. La imagen por la imagen es un alarde intil. Sin duda, un libro que pretende los objetivos mencionados ha de estar libre de la tirana literaria, pero

n'

=~~!I~'!! &<3'1~~;*I*\"A.!1~!
!
1+ !
"...~, ,...... ..~~

-,1

iI
1

;
\
"'

: '.. ,, ,\;.
.

11 I

,...

--

. -"'_ --,: --.-.'........ , .a.-..M"


,

~
, m,;;"

, ::.::,:--' '(j ,.......-. . ;""""",,,,~,~,~, ""'~"'-""..

CJ

-'-.-.

=:':"" .=-

"...-~..--,

9g

tampoco debe imponer, por el efecto del pndulo, el dictado opuesto. Ni texto ni imagen separadamente, ni tampoco un aspecto con predominio sobre el otro. Consideremos que cualquiera de estas frmulas es visual. No es frecuente la consecucin de una idea tan simple y profunda como la de presentar imagen y texto interrelacionados, y organizados entre s. Al abrir el libro, el golpe de vista ya supone una adquisicin de informacin de forma eidtica (mediante grficos con simpticas ilustraciones, estructuras que presentan, de forma concreta y asequible, conocimientos generales y procesos complejos, cmics, etc.).
Los ttulos sobre la tecnologa, en vanguardia

52

Lo cierto es que la virtualidad de estos nuevos libros educativos se aprecia especialmente en los ttulos que tratan acerca de la tecnologa. Y ello por dos razones: - por la escasa atencin que a este campo se le haba prestado y - por la dificultad que en s presenta. Los libros realmente sugestivos sobre computadoras, vdeo, programacin, "chips", aplicaciones prcticas de los microordenadores, robots, electrnica general, exploracin cientfica, etc., facilitan una introduccin autodidacta a tcnicas cuya sola mencin bloquea mentalmente a los adultos. Los jvenes lectores comprenden, por ejemplo, cmo

'"

"'"

\',

\,'

"'

," "'-,"","

\.
":/'/. /. ' ,.1"<# ,i
......
~';;:

~.

~\'~ :~\;\ >:~?5% J '":"<


'

"-""

X~,

"

",:

"

'>" :~;~~~~.;'~>,,-sx ' ' , <" "" . ,:::C"'"""-;>" ~ >;.. . /""1'" ~;";' ~,.;<::Y '"' ~ O:~ '","'Xy~,,/'- :, \ 'O;,~",-, , . ,; . ~ o '. O~" ./
' "
,

",

,,

""

"

,,

'

'"

"

" "" " " OO ,

"",

"

,,

01

,\

'"

, :'0

'

....

"'.. ~Y'.+ /.:, ,'o " t?",,~'' ;'+,q;"'/, ,'" "':.'~'.l./~II'/


~ ," ~<# /

/~.<;-U#~;~/

r.;,

/.. , r<#/_,,<#/.

", ,,~<#:,,<,./ ,)' '//

"" ~. ~<iI'~

. <\~:~,.'-,-"../ . /~# '\'S cY:"" f' .// .,.' .~ " ,',


"...~i:f ,,~... ..,~ .1' ""~ J','f' ~.."~i:f i' i",.<P. "O / 'l" " $', , f / ," ' ~.f"." ,,/,
"p<f ,,:-.'" ~>'

..~~ / ,;.+o.;.I'

.f
,

...,,~

~/ .-J" ..;e?

'~

+ "

~++~

" '. ( ."


,<l'
Foto: Jo Gri

. . '.

~ '.~ .~,~," O

~O

opera una calculadora de bolsillo o una computadora, paso a paso, con explicaciones entreveradas de provechosos juegos, rompecabezas y sugerencias para aprender haciendo. Y con sobrada razn afirma el Times Educational Supplement que El libro de la calculadora de bolsillo de Usborne Ed. "es la introduccin menos dolorosa a un buen nmero de cuestiones matemticas" que se puede encontrar en la actualidad. Estos libros que persiguen la amena comprensin y el desarrollo de las habilidades manuales y de creacin no aportan slamente un inmejorable punto de arrangue para los nios, sino tambin para los padres y profesores, tan abrumados por la revolucin tecnolgica. Sin duda, la oferta no termina en la tecnologa, pues abarca todos los rudimentos de lo que luego sern asignaturas y otras temticas menos acadmicas, como guas para buenos detectives y espas, iniciacin a la cocina, vampiros y casasencantadas, entre otras curiosidades. Ademsde la mayor calidad de manuales y libritos, tambin puedce comprobarse una evolucin en el concepto de enciclopedia. Apenas haba sufrido variacin la disposicin de los contenidos de las obras enciclopdicas desde su aparicin, hace ms de dos siglos. El socorrido esquema de la informaci6n literaria, con estilo engolado y trminos polvorientos, carece casi por completo, de capacidad auxiliar para el alumno, pues ignora que el destinatario actual de este conocimiento encuadernado es un sujeto que tiene a su disposicin otros medios de informacin ms giles. La canCin es la misma, el oyente, otro muy distinto. Los italianos han roto alguna lanza -especialmente Mondadori y Fabbri- por trastocar tal estado de cosas, pero la idea ms moderna en este campo es la de las lexiuisiones,

plasmada en la obra denominada Media. El xito de su difusin en toda Europa (versin castellana: Enciclopedia General Bsica Visual, Ediciones Ocano) estriba tanto en la sencillez de la idea como en su laboriosa ejecucin. Cuando, como en este caso, lo grfico no es pura sucesin de atropelladas imgenes, sino que lo icnico dispone de la superficie orgnicamente, abarcando la trama abstracta y la imagen ejemplificatoria, en el libro se cumple el principio segn el cual el medio determina el mensaje, esto es; su bondad pedaggica. Entendemos aqu por "medio" la forma, ms que el soporte, lo cual no obsta para que la creciente tendencia a editar las enciclopedias (como la Encyclopaedia Britannica) en soporte electrnico haya de alterar necesariamente los hbitos de consulta. Por el momento, slo estn disponibles en bibliotecas con pupitres electrnicos. Mas en las aulas alemanas ya se encuentra un hermano menor: se trata de un diccionario electrnico, Alpha 8, instalado en una calculadora

de bolsillo que ha editado Langenscheidt. Su memoria


capacidad para

posee

registrar4.000 vocablos alemanes y la corres-

pondiente traduccin a un idioma extranjero. No es posible hacer una mencin suficiente de los hallazgos dldcticos publicados recientemente. Ni tan 5610 hemos mencionado algunos magnfflcos mtodos para el aprendizaje infantil de lenguajes -naturales e informticos-. Sin embargo, nuestro propsito no era tanto detenemos en el detalle, so pena de dejar inacabado el dibujo, como transmitir la satisfactoria impresin que suscitan las nuevas tendencias en la edicin de textos para la enseanza. J.J.L. 53

Entrevista: Gonzalo Torrente Ballester


--"~

'_0

.,._~._~~~~

~._._.

TEMA DEL MES

PAISAJE ANTES DE
LA HATALLA

Javier Labarda

Por los sntomas, se dira que los alumnos de ahora mantienen una guerra no declarada con la lengua y la literatura. Suelen tropezar con la teora, violentar las pautas de puntuacin, descuidar la ortografa, tiranizar la sintaxis, laminar el lxico, solucionar mecnicamente el anlisis de la frase, no ubicar a Juan de Mena ni recordar ms de un ttulo de Galds, distinguir a tientas diferentes corrientes literarias, ignorar la conjugacin..., y as hasta agotar la tinta.

No pocos profesores aoran ese alumnado de dos dcadas atrs. O, mejor an, al de principios de siglo. La gramtica era su fuerte y las lenguas clsicas su ocupacin. Apenas lean textos, pero conocan los resmenes argumentales de todas las obras (pregunte, pregunte, por ejemplo, por El abencerraje o la Historia de los amores de Clareo o Florisea). Su conocimiento de gramtica les permita reconocer el influjo latino en la inexistente fIexin del caso en castellano. Sabrosas frases latinas o griegas recitadas en su momento expresaban la seguridad de su saber. Y, para qu hablar de la ortografa? Parece que la comparacin entre el pasado reciente y el presente no resiste un anlisis serio. Se dira que la ignorancia lingstica y literaria se ha adueado de las modernas promociones estudiantiles. Y, en buena lgica, se concluye que, para nuestro mal, hemos sobrevivido al ocaso educativo: somos los profesores una casta aislada, en medio de un cuerpo social aquejado de una tosca competencia lingstica. Si esto es as, el compromiso sobreviene cuando se plantea cmo encarar lo que an nos queda de vida profesional, qu

estrategia desplegar para seguir inclumes hasta el retiro. Este razonamiento irreprochable suscita, no obstante, alguna sospecha. Qu cabe pensar de uno mismo, si el entorno cambia y uno permanece tal cual, inalterable?' Pues podemos inferir dos conclusiones extremas: ya se posee una pureza resistente a todo deterioro, ya se ha "perdido el tren" de lo contemporneo. Y lo ms seguro es que ninguna de estas posibilidades se d. La explicacin puede hallarse en una disociacin: personalmente se es ms flexible, y profesionalmente se porfa en unas formas aprendidas (como individuo, uno no puede sustraerse al flujo social; como actor gremial, s). Algo se nos escapa. Com es posible, si no, que concibamos un panorama tan colmado de incultura, de ignorancia? Quiz estemos repitiendo el viejo error de juzgar algo segn patrones aejos. Invirtamos por un momento los trminos. Qu pensaramos de los alumnos decimonnicos si los situamos frente a los que conocemos en nuestras aulas? Porque stos poseen un conocimiento tan amplio, diverso y til, que acostumbramos a tomarlo como valor entendido y, por consiguiente, a no computar. Les censuramos el insuficiente desarrollo de la memoria, pero conocen centenares y centenares de eslganes publicitarios: frases y canciones, marcas y escenografa, que repentizarn perfectamente al primer estmulo. Estas voraces races publicitarias que homogeneizan el tejido social son, tal vez, las que condensan el saber til de ahora; los publicistas han asumido la funcin -diferida y no menos mendaz- de los clsicos y escolsticos, con la diferencia de prescindir del lustre y la oscuridad de lenguas muertas. Los estudiantes conocen la literatura de los trovadores y juglares modernos, que ya no cantan en la plaza y cuya presencia es casi omnipresencia por la ubicuidad de discos y vdeogramas. Los hitparades no son una tontera, y no son ajenos a las motivaciones de romances, poemas de clrigos, leyendas piadosas y similares. No poca literatura se sirve y, tambin, se hace en pantallas. Y no es menor el conocimiento en este campo; lopes de rueda y shakespeares de nombres actualizados se confunden entre los autores-actores-realizadores que acaparan los crditos de las obras, los programas de difusin, las revistas del corazn y del hgado... Y estos j-

~~ "~ ~~~ ~ ,~~:~~\ <::::,--7 /'


~~:.-~~

~~ ,

~~
,

-~

,_o'

"-

~--_/~,

r;;:;."'"

"

-~----

venes que suponemos en blanco asimilan rostros, voces, nombres, argumentos, gneros, localizaciones, tcnicas narrativas. Y de ello, qu es banal y qu no lo es? El medio homogeneiza productos tan dispares como "La ciudadela", "La comunidad", "Fama", "Retorno a Brideshead", "Fortunata y Jacinta" o "Flamingo Road" . Estos jvenes han palpado la cara bombardeada del Lbano o la maquillada de Reagan, las focas de la Patagonia, los fondos marinos..., la vida y la muerte en directo y en diferido. Informativos y documentales les surten de datos que, reunidos, formaran enciclopedia. Concursos y retransmisiones deportivas sumergen al receptor en el aprendizaje del ser social que se manifiesta discriminadamente mediante comportamientos especialmente pautados. Que mucha informacin es trivial y embrutecedora? Ms trivial puede resultar una enciclopedia por indigesta y obsoleta, y ms embrutecedor puede ser el aislamiento. Con estos medios audloic6nicos (pronto interactlvos), aunque supuestamente de escaso valor cultural (porque se asimilan con poco esfuerzo?), estos jvenes tienen conocimientos de muchas materias, y no slo

Los programas de las enseanzas medias. han entrado en un perodo de interinidad, desde el momento en que se ha iniciado la tarea de perfilar las lneas de una reforma necesitada con urgencia. Con esta reforma es de esperar la ms feliz homologacin de las experiencias que grupos de educadores llevan adelante, desde hace tiempo, en muchos lugares de la geografa hispana. Cmo conciben estos profesores la enseanza de la lengua y la literatura? Dicho escuetamente, su pretensin es la de favorecer los patrones de conducta verbal (escrita y oral), atendiendo a tres criterios: correccin, creacin, comunicacin plena. Se trata, por consiguiente, de poSobre la necesaria relaci6n de las tenciar comportamientos, nunca de cosas Inhlblrlos. Ello significa que el conoel., miento que se ha de adquirir se equipaPero, a todo esto, tiene alguna re- ra a la accin, esto es, conocimiento colacin esta consideracin de la ignoran- mo accin, no como verbalismo cia y del conocimiento social con la len- pseudoterico. Qu duda cabe de que

conocimientos tericos. La habilidad para el manejo, mantenimiento y aprovechamiento creativo de toda clase de aparatos mecnicos y electrnicos es un bien comn en ellos. La comodidad con que se mueven en sistemas y subsistemas semiticos es envidiable. La enumeracin tipolgica no se agota rpidamente. Pero, dejando a un lado este empeo secundario, cabe sealar varios elementos definitorios de este amplio conjunto. En primer lugar, la informacin que estos alumnos reciben es ingente. En segundo lugar, las fuentes de informacin no son nicamente escolares, ni tampoco literarias y/ o librescas. Y en tercer lugar, su organizacin es muy propia: se comienza a recibir desde muy temprana edad (irrespetuosa con la pausada cronologa del curriculum escolar) y consiste en un consumo considerable y efmero, que responde a una visin del mundo tan inacabada como cambiante.

gua y la literatura? Porque, si no estamos equivocados, el verdadero proble-' ma de la enseanza de la lengua y la literatura radica en el escandaloso desaprovechamiento escolar, es decir, la mala escritura y peor comprensin de las teoras lingsticas (lstimade alarde cientfico!), la amnesia literaria y una desalentadora ausencia de motivacin. Por ello surge esa aoranza del alumno de corte decimonnico que escriba con correccin, asista reverencialmente y memorizaba con mayor paciencia. Un ' puro mito, que aoramos porque en esencia los usos educativos de entonces no han desaparecido. Soamos con el nio idealizado que se fue, y nos empeamos en vestir a los recin incorporados con sus ropas. Eso s, con toques modernos, como unas coderas de cuero y una chalina escocesa bien prieta al cuello para que se entere el interesado. Las coderas representan a los benditos anlisis generativos (de amplio repertorio) y la chalina, al comentario de texto (estructural, estilstico). Volviendo a la pregunta anterior, s nos afecta (y palmariamente) la realidad social en que vivimos. No explica acaso este preocupante fracaso escolar el divorcio entre la didctica de la lengua y el vivaz mundo exterior de la COe municacin? La estrategia de la lengua

sobremanera, de los medios de comunicacin social, para una didctica feliz de la lengua. Porque la lengua -como cdigo- y la literatura -como aplicacin excelente del cdigo- son ms que una asignatura. Todos los medios, para tantos vectores La insercin de su prctica en un marco global, vivo, supraescolar, constituye la mejor garanta de su calidad. Este principio permite mltiples traducciones prcticas, y convierte al alumno, que accede as a la vida real, en un ciudadano cuando se desenvuelve como periodista, fotgrafo, radiofonista, publicista, economista, artesano, impresor, actor, animador... Con estas actividades, simultneas o estratificadas, transita el alumno los dominios multidisciplinares de la informacin, investigacin, creatividad y afectividad. Todo le exige, por activa y por pasiva, una continua reflexin sobre el lenguaje y la lengua. La forma de aplicacin de estas propuestas no guarda ninguna relacin con una empresa improvisada. A las experiencias que componen el "informe del mes" de este nmero de Cuadernos de Pedagoga se han de sumar aquellas que han aparecido anteriormente en estas pginas. En ellas es comn la metodologa del aprendizaje inductivo. De la prctica se extrae la teora. De lo propio y particular se progresa hacia lo general y social. Se parte del habla para arribar a la lengua y el lenguaje. Se inicia la aventura de la escritura en la forja de unas habilidades personales de expresin y narracin, para fomentar, con mayores posibilidades de xito, amor y admiracin por la literatura. Esta es la descripcin de un mtodo inverso al usual. Lo mismo ocurre con los logros. As, los alumnos ensayan por la va del cuento o de la poesa los recursos lingsticos: analizan modelos breves segn temtica y estructura, se ejercitan para la imitacin y la invencin y, tras un ciclo, adaptan correctamente los cuentos y los poemas a los formatos teatral, radiofnico, periodstico o del cmic. En otro curso se interioriza la riqueza literaria a travs de los gneros, en un ejercicio sucesivo de anlisis y composicin, que proporciona interesantes piezas de creacin y unos meses de trabajo genuinamente vividos. Y, fi-

han de hablar y escribir con una madusubyace en esta divisa el pensamiento de Austin respecto a cualquier reduc- racin progresiva, est dicho, y a ello cin a la dicotoma verdadero/falso, confluyen todas las actividades. No obstante, es indudable que ello no sigpuesto que son pura accin. La expresin de los alumnos debe nifica hablar, sin ms, en el aula o escrialcanzar una digna correccin, pero es- bir en un papel. El objetivo nunca es el ta labor correctiva y ampliadora no medio. Nadie desconoce la necesidad que puede desligarse de una estrategia generosamente amplia. A la vez, ha de origina el lenguaje, esto es, la comuniservir de vehculo a la creatividad, don- cacin, la puesta en comn. Sin embarde confluyen los otros "lenguajes", los go, en ocasiones, los profesionales olvidel sentimiento, la afectividad, el in- damos en el aula esta verdad y pretendemos simulacros de comunicacin, consciente -en palabras del pedagogo Malaguzzi-. Esta manifestacin de la ejercicios de laboratorio, que los alumcreatividad personal ha de estar presen- nos saben destinados a la nada y a cuyo te sin discontinuidades a lo largo del falseamiento se suman. Dnde est el curso y debe ser encauzada por una receptor?, dnde la sugestiva retroalimentacin?, dnde la sinceridad cometodologa que impulse la produccin y la reflexin. Pero -he aqu otra con- municativa? Se ha de considerar, pues, que, en dicin imprescindible- si no conquista una expresin correcta (ortografa, sin- primer lugar, la lengua ha de utilizarse taxis, lxico) y una canalizacin comu- para cumplir sus funciones, segn las nicativa trascendente, pierde sentido y enunci Jakobson, informar, atraer la eficacia. La consecuencia es clara: no atencin acerca de la forma lingstica, puede haber partes, distracciones ni ex- alterar las conductas y mover los coracepciones. El trabajo es un todo, una zones. En segundo lugar, la corriente actividad integral amalgamada por un comunicativa ha de servirse de canales y tcnicas apropiadas a la realidad soobjetivo central. Acabamos de mencionar un adjeti- cial e indefectiblemente a los intereses vo de moda, integral. No creemos que . de los comunicantes... En este contexto su vindicacin sea un tpico. El len- toma consistencia plena la pretensin guaje debe entenderse como una forma de una nueva antropologa, un mejor de educacin integral. Los alumnos conocimiento de nuestra cultura y,

nalmente, los alumnos del ltimo curso fundamentan y coordinan los medios de comunicacin de que dispone el centro, por ejemplo, la revista, hojas volanderas, pizarra-revista, etc. No es fcil virar tan rpidamente la metafrica nave que es esta materia porque ello supone conseguir un programa flexible, prescindir de contenidos itinerantes y exhaustivos, apreciar el valor formativo del trabajo manual y su relacin con la tcnica, conectar con el resto de las asignaturas, inculcar tcnicas de estudio y aprendizaje para que se adquieran los hbitos de hacer y, por ende, el saber. A qu conduce estudiar prcticamente toda la historia de la literatura en cada uno de los cursos, sino a su.repudio y olvido? Se mata la literatura, la curiosidad y la capacidad de afrontar cualquier trabajo cientfico. Se la convierte en una botnica de flores muertas. Como antdoto, se dispone de la concepcin instrumental, y no nuclear, de la gramtica y de la historia literaria, y tambin su magisterio indiferenciado. Separar, por norma, la lengua de la literatura es un error. Se parte de unas prcticas pedaggicas viciadas. Superar el gramaticalismo y el historicismo, tan enquistados en el sistema, significa la difcil victoria sobre unas pautas-prtesis realmente nocivas. El otro extremo que se ha de evitar es la siembra de un variopinto mosaico de prcticas y actividades, de endeble tramado, atractivas pero inconexas. Si carecen de una columna vertebradora resultarn inanes. De la misma forma que el alumno distingue los ejercicios falsamente comunicativos, tambin reconoce la gavilla de ejercicios faltos de slida orientacin final. Por razones cientficas y sociolgicas es recomendable que en la enseanza de la lengua y la literatura se potencie el protagonismo til del alumno y la gnesis de criterios algortmicos en la adquisicin y tratamiento de los conocimientos. A la bondad del mtodo se sumar la adecuacin a la realidad social del sujeto, que se caracteriza por poseer una memoria fuerte a corto plazo y un conocimiento funcional: sabe lo que le es til. Cuando los comerciantes descubran la madera de best-seller de Dante y el espaol sefard sea la lengua del rock, los nios recitarn la Divina Comedia y "vacilarn" en ladino. J.L.

1"1 I : r : l\ " : t 1 \ -" . --. "'" ~ --. .' 1fi,d, 1 _t.-.~,1U1,

j . 1::
,

''."<
'

~1

j":, ,
,

'

"

1:
".
,,

'

,,
,

'

-~Q- ,~, :M~


"

1: A~

REVISTA M SUAL DE EDUCACIOI\!r; ,1 9


~,,,,

..
"
~

I
I J

((J""

P1o.,.,'"

!.I ~ I \""'."""

'

r
I

1'"
J

1\ '""

Ir
,
,'~

'

"

..

11

I:~"' ..
I

~,
-

6 i~rp\
, ,.)j
, ,

~,~~,~ , 1
,

~
,

( ';' tit, (' ,-,,~ \J''l D l 1, ('."~~\


. "~li!I

(""

,'

'\,

~.~"\"..,;,

.I' ",P'"\'\'..","! .. ~ 1 J " ,


,

'I

'"\.J .\

'1

t,.
.

rI
.

,,~
.
..

ti
-

i.rt.l --...
:
.

;NT
.

..

..

. ~...

1 t~."l1 r~~'..

((~1 11 n.1(n)l -' . -(! ut \ - ~--~-.L I ~- ~.~(~ ;"'i:"~:1


.

. ..

..

...
-

~I(W

1:,'~

I
I

L
'

""'IJ'I'.'"

,. n" f
,
.

.'...".j-P'\~'...,..t.rF'."
~ :1
:.~

_"""""

~.,...

f ~;/, \.\

,
..."

I P'"

,
'. r ~

."-""""""""""" .".'

,""'/"'..'-'"

-.~

J.'"

~\r~ '1 ,lit,


11

.'t

J ] ro " 91 ' 1" l.

~~'\:1"f1
""
.

.:

- "'... --

"1r..[I'",,',

j,

.,I . .: ~""""""'" CI"~""""""L".L".""..


""'

}
,

r.~\;~.:~=.-:- )':\:'/~. ~~I; ' -'~;- ; ~. i 'i ; :: /1,171


.

'

.'.."""':'

, ...:,.

I
'..

'

.;

,,
:
,

" ,,

: ; : [1,
'

, ,

.:;'
..'; . ,

"' ,
.

: ...<;;11 i
. .:. , , , , ,

,,. :: , ," " , ,

jl

""."""," ~
"

"

.. :"

'~,'

U
",,

:.

"",,

",;"".',",,
..;. , "

.. ,

""" ,,"":L.. ,

)
"

:' ,:(@ " .'


"

"

( "
,

~.

~;""

'

[
" ,

"

i::;...'.':.

""

"

","""'.~

1'. .~l

,j"dllll.
,,

Ti'"
- . l.
11
I

... r.

'-J~~~:fi~Pl}.
"' '

~-i"""A',9,

}""
,)

"

r,

, ,

, ""

,., ~ ""re

i' J- l
",,

25Olibros
~ ; ..cfi
"" "''
""" "''
. , , '

.. -,.. ~
I
~ I I "'~,

""'.."1 II I.
~

1,.,

.;

~I

'"
'
.'

" '

';""']

~'
'.
..'. '.'

"

...~'
.
.

..

"

""Ir,) ,
,

'
'. ,

"-

''

''
'

"
.

'"' ~
,.

"'""
'
,,

,"'"

\
"1

'

'
"

I,('} ,
", ,

..., .,1"
.,

,.,. ", ".""",t

,1

.
,

, ,

'

., "..,

,."I1.

l'", ""
,

'," , , ,,.

\ t./'~/;'
"""""" ,
",,,. ,
,

,',

.. ,,," ",
,
', , ',

,,,.,.., ,

"1..-1:
'

':.1
'

\J

'"""""'-;.

'-'

''

,"
.
,

"
,,

'=',,""":IJ'.."

, J..J,."lrt.. ..,"", , '~j"


,

'',

"' 1 ".
'
.

.,~"~'
"
"

.'.' ,

"'."
"

- -::r, ,-.A.., , tI~, ,


.", .

" ",

",

"".,,.,h

, ' ~"
... ." I -r"""
"'" p
"

1'"

'/'"">.""'

! .i .
~

~, I ;, C '..' [' y J :~
,
"
,

, f'fr'.'
".'

" '

p "'-~
"

",

'
, ",

"'
'

"')
,

't;

1
'

'
"

ayq u"e leer


'

qUe
...

"

'
'

1".',1"\1 " (
"
"

""'""",, " '


. "

"eJ'"

"'

"
. "

""'.'

" " ''''l """'\ " ''' fr ~.",J " 1 ' "
. ,,.

'

'

"'. ""

""

"" ' ,,1. "


",.""."..

"

"

.,

,
.,,

""

ti. 'l.
,

"

~
~.

' .I:'

-,1
r
,,'
,

.
"

." .

1 ,1

"'

1 ".
"

' _ "'"1
,,,

"
~I.
,

,,,. .., " ,,,, ,,, .,


."

", ",, (..

"'.\\.111 , "",
, ,,, ,."

1:1 "
."."

,1 \'
'." .

", ,

.
.

J 1-'
",',..",,,

.."

,.

",

,
~ '"'
'~

"""""~

~... \- ," -

'..-

'

!
}
.

'
,

I~,

1 \ "'"'- J', " -

'~

'"

~"
.'..
,

""
..' ,

.,

,,

'"

; -"; .'

,,

,, ~
.'

"' '~ 1 \""'.1I" ",,, :.d ) .,'"-"' "','


4.
, ,,

~ 1,1'J ' '


,
,

,,

l'~~.
'

"

t
"
..,."

'.. ,"';;:'\

f,
"
"

,.,

~.

'.
J"

::: !'~ "~' ; ,"1 -"')


... lo .. ,"'" te'
"'
, ",

,. " 1'.",~_.
""1

Pl

,1
, ,

1""

,,

,'
,

"~.

' r J ,L ~J'( 'J 1;''~ N\ ' \)' ~ t.! "( ~J i' \: ~ 1,' f1 W(J _ ..I """~ J L'} J; Ul
"

"

:
",

'. ..

''

' ' ' "' '

'

'

"..

,>1

.
,

, , ,, "

, ,",

,,
.

",

.'

.,

'~

~'

"

'

'

'

""~

'

"'
I

4-

-,

." " "

, ,.

'

,,

,,

,~."~,

'~ "'.'"

l .J "",.t':
""

.'

, ,,

,"",

,.

'"

," ",,,,,' " ~ "' " ' "


.
, , ''

"

",

"

"",

"'-"'"

Lo.'\,..; ",1"*' ',""


,, ,,

'

"

~ ,,,

"

l~

;' " . t ! t\,( ~ ; I t L: .'~ f "-~ ~ \1 " \ 'J .. t" .("1 ;: : "'\',. ,
,

\.

~-

.-- "'1... "'\

-.

l
.'

" r~
, , , , ,
" . . , ,

;)~
.'. .
" ,

"".
,

'
.

'

'

..""

..,

' ",

"

'.'

...""",,-

c"
,

'"

"" '

,,

",

'

'

."

'

"

,,

"

,,,

""'I ', ,r' '


, ,

,,

i
,

(
"
'."

"'

"

"

,,'

,,

'""

.I""'\,
", , ,

1 , ""' "".X'"
1,.

j
' ' . ,

"

'. ,.

( } ~~1 r '"'.'"
" .,.:t>.'"',r

'f

,
"

\..E
,

",

"
~"
, ,

, ,

..
,

"'

'"

",:
."

'1
~

,1

~ r'" p

--

-I

"",

.."

""..:

1..
..

"

~""""'l

~
j

\ j

,J

t,

..
,

J .' ,

;.

. '
I

11

_,1

I~ J '"., . """-~~

JI"

1'1l l' '1Ifll", ',IYr ,"111' .'1 1'-' I '1 \. ' ~ ~ , '.' I '. ,,1 '., ' '1 , I ( ...;') ,'\ 1, I 1.',11 1\ \ .1""" ,1 '""./~ '" \ ,1 ~ t ,.. f!!'"
~ 1
I

...

, I I ,."t./I"""'~11 ,

."

I - - , ', ~~ ~"!.~"..\ , . ",

1
," ~ ~

PRACTICA

SEMANAS
SENSUALES

Xavier Labarda

Unos das al ao, generalmente primaverales, los alumnos viven intensamente unas actividades distintas que tienen ms que ver con sus intereses cotidianos que con los contenidos del curriculum. He aqu lo que dan de si esas semanas sensuales.

La educacin de los sentidos, asumida sin reticencias en preescolar y ciclo inicial, se presenta despus como una traba absurda al conocimiento abstracto. Es el resultado de la insostenible distincin entre cuerpo y espritu, entre sentidos y pensamiento, entre manualidad e intelectualidad..., en la que se reconoce ellastrante resabio de la educacin clerical, libresca, disgregadora, torpemente intelectualista y de un puritanismo mortificante y punitivo. Cuando la enseanza se concibe como un proceso que no encuentra satisfaccin en s, sino en el ms all de una proyeccin profesional, slo merece la calificacin de equivocada. Entre otras razones, porque ni los jvenes se muestran dispuestos a posponer su razonable gozoso aprendizaje, ni tampoco este desierto de conceptos prepara para el trabajo. Es cierto que exponer las ideas que anteceden equivale a suscitar un ciclo conocido. Pero la insistencia se explica fcilmente por la pervivencia, cuando menos larvada, si no activa, del espritu clerical en la prctica educativa. La enseanza media, que cubre los ltimos aos de la es~

colarizacinobligatoriay que acoge a alumnos inquietospor


su incipiente madurez y por su indecisin ante las opciones que se les presentan, padece ms agudamente esta pedagoga desquiciadamente ignorante del cuerpo y los sentidos y del aprendizaje integral. Flor de una semana de primavera Ello explica un fenmeno espontneo y poderosamente regenerativo que se est dando con cierta extensin desde hace varios aos en los centros de enseanza media. Se trata de la "Semana Cultural", que, mientras se est a la espera de una reforma sin complejos an no atisbada, constituye un grato antdoto e inmejorable experiencia viva. La Semana Cultural constituye una irregularidad el1 el curso. Interrumpe el montono discurrir del curso durante varios das, generalmente una semana completa. La irregula~ ridad se encuentra, por consiguiente, en esta ruptura liberadora y en la no contemplacin de su prctica en la normativa. Ello slo aporta efectos beneficiosos. En primer lugar, la realizacin de la Semana o Jornadas Culturales es una decisin del centro, que viste de contenidos y elije un momento sin acudir a ningn patrn. En segundo lugar, esta opcin creativa significa una superacin -a menos temporal- de la aborrecible enseanza por programas monocordes; es comn el rechazo del cors del temario de curso pero igualmente corriente resulta el miedo a ser tanto alumnos como profesores responsables de su tiempo, "el miedo a la libertad". De ,ah que decidir un alto en el camino de esta frentica carrera para completar el temario proporciona al enseante una vivencia en que disolver o acrecentar su zozobra de burcrata. Qu logro mejor que aliviar o violentar el conflicto del edpico funcionario en que a veces nos convertimos con nuestro apego/rechazo de la madre institucional que nos reglamenta! Tambin para el alumno significa algo nuevo. Por una vez encuentra en la Escuela lo que le ofrece la vida, la calle. Sus intereses se funden y el centro -no slo el aula- se convierte en un lugar de animacin. Se dan cita cultura y ocupacin, formacin humana y cvica, aprendizaje de conocimientos y conductas... No olvidemos tampoco la expresin

de la afectividad y los sentidos, de la palabra y del contacto (que etimolgicamente significa "llegar hasta tocar algo"). Este cambio de actividad posibilita al alumno descubrir no slo sus intereses sino tambin los del profesor, con lo cual resulta favorecido el papel de ste por un reconocimiento que antes se le escamoteaba parcialmente. Ms de cinco sentidos tenemos

Cul es el contenido de una Semana Cultural? Por supuesto, en cada caso responde a un esquema "ad hoc". No I obstante, si comparamos diversos programas se aprecian I unas coincidencias notables. Se rehuye la pasividad, la posicin sedente y la tirana de la magistralidad. La institucin central es el taller. Se priman las actividades que no se asienten fundamentalmente en la palabra, de la cual se ha escarmentado por el cotidiano espectculo de su uso gratuito. El trabajo con las manos, el placer de la meloda o de la imagen, la explosin de los sabores..., desemboca inmediatamente en el jbilo de los sentidos. El cuerpo, tambin, como instrumento, se desinhibe y expresa. Resultara atractiva la elaboracin de una taxonoma de actividades segn sentidos, que clasificara una diversidad tan aparentemente ajena a la finalidad de la Escuela como son yoga, cocina, mimo, marionetas, aerobic, bailes "carroza"; cermica, esgrima, expresin corporal, jazz, judo, magia, mscaras, peluquera, socorrismo, astrologa, acuario, bailes folklricos, juegos matemticos, jardinera, etc., etc. Los talleres se complementan con sesion.s de cine, v-

deo, teatro, conferencias, recitales, competiciones deportivas, actos poticos y como fin de fiesta, por ejemplo, la reunin en torno a una paella monumental y un baile de tar,de amenizado por un grupo rock eclctico. La Semana Cultural constituye una ocasin irrepetible para conectar con las actividades ordinarias del curso b1 su faceta ms espectacular. Es el momento para exponer trabajos realizados en los meses precdentes y suscitar un inters genuino, beneficiado de la atmsfera ldica con que se atacan entusisticamente aprendizajes mltiples. As, el alumno es libre de acercarse, sin lmite de tiempo, a la exposicin de las muestras botnicas y zoolgicas elaboradas en la clase de ciencias o la de trabajos plsticos de la case de diseo, fotografas, creaciones literarias, maquetas y cuadros de reconstruccin histrica. .. Todo aquello que se elabora separadamente, por asignaturas y por cursos, y que alcanzara una rentabilidad mezquina por lo callado de su pasar, se manifiesta pblicamente en un momento en que se consigue una sensibilidad ptima en el centro educativo. Y trascience el esfuerzo antes annimo, que por una vez aparece a los ojos de la colectividad como sorprendente, espectacular, redimido de su penosidad

por la dignidadsocialganada. "Parece mentira que los de 1. o


sean capaces de hacer esto", comenta alguien y otro replica que "los del Insti somos ms hbiles de lo que la gente cree". El efecto de estas actividades y exposiciones, poderosamente comunicativas, no es aritmtico sino geomtrico. Su valor' se acrecienta exponencialmente, y sus efectos se muestran evidentes; y ello sin intervenir calificaciones, controles de asistencia, compartimentaciones por cursoS en aulas, horarios normalizados... o tal vez tambin porque no intervienen estos factores?

Entre la Semana Cultural y la primavera existen notables puntos en comn. Coinciden temporalmente (la Semana suele florecer a finales de marzo). Su aparicin es tan inesperada como inexplicable ("... ha venido y nadie sabe cmo ha sido"). Y, por su significado, generan una floracin. En el panorama escolar, el arraigamiento de esta floracin de ao en ao se extiende cada vez ms y la eclosin se supera en calidad cromtica y aromtica. Este fenmeno, que no es nico, ya que el Carnaval tambin se enseorea por un da de la Escuela, nos habla del' poder de lo sensorial y afectivo cuando logra la unidad con el otro mbito asimtrico de la personalidad que es lo lgico y lo intelectual. Frente al rigorismo tradicional -que escinde -, la liberacin que propone la sensualidad se encuentra en la I asuncin del cuerpo en su globalidad -y no slo el cerebro, entendido poticamente como habitculo del pensamiento-,. para evitar formas pedaggicas necesariamente neurotizantes. Cuando en un futuro no lejano la ciberntica haya progresado sensiblemente, tendremos la oportunidad de aplicar sus patrones al estudio de los "mecanismos" de la materia animada y slo entonces se podr conocer justamente, y no slo de forma intuitiva, hasta qu punto son desastrosos los efectos de una inadecuada "programacin-educacin". X.L.

3';

REVISTA MENSUAL DE EDV~>ACION . 126


.

~~
:'\ >.

NIO-1985 OXI

~~

3lfi Ptas.

. \" " r" "

>~,

I
..

~
"
.
~

, ~.
.

,. ',!, '""

-............

..t~,

1
"

,\~
'1

EL MATERIAL ESCO LAR


/.

,/

"

I
I

\.

..J

\.
~ '>iof1

.....

)
~
'II,

? .

ESCUELA/SOCIEDAD

ELAULAIDEALES REAL
Xavier Laborda

La arquitectura de poder que exudan las construcciones escolares es agobiante. Recientemente lo han recordado Enzensbergerll) y Toffler,(2), por sealar dos plumas de diferente caligrafa, pero coincidente gracejo. No es una arquitectura de poder impresionante ni expansiva, como la de los templos financieros de Manhattan o los tanatorios nucleares y militares de diversa tipologa. Esta es una arquitectura de poder que acta hacia adentro, comprimiendo a aquellos sujetos a quienes debe cobijar, en un proceso de vampirizaci6n intelectual increble.

Est demostrado cientficamente. Los edificios escolares imprimen carcter a sus pupilos ahuecando la personalidad, sustituyendo sus pies por dos pegotes de arcilla; el rostro, por una mscara pintada de purpurina; las manos, por pinzas, destornilladores, teclados, cajas registradoras... Son una fbrica opresora. En la composicin de sus materiales y la disposicin de sus formas tiene su guarida el principio activo del maleficio. A alumnos y maestros no les ataca una enfermedad misteriosa, que queremos olvidar con eso del sndrome del fracaso escolar. A alumnos y maestros les afecta el diseo; les corroe la metonimia de los muros; les estigmatiza la metfora del claustro. El plan secreto de las piedras Juguemos a las asociaciones: hangar fabril, residencia de tropa, nosocomio, asilo, vagn de metro. Los parecidos responden a una causalidad funcional, poderosamente sinttica en el caso del aula. All se rene produccin, obediencia, tratamiento del vitalismo de los pupilos, profilaxis social que limpia las calles de golfos y de gozos, viaje barato de masas casi a ninguna parte, respectivamente.

Podremos arrumbar la tarina, reciclar la mesa y butaca del profesor y homogenizar as el mobiliario. Podremos liberar los pupitres de sus anclajes y desbordar la absurda simetra en hileras de incomunicados. Podremos resituar la pizarra que nunca conoci otra ubicacin y tapar las mirillas que permiten ver con impunidad qu ocurre dentro. Podremos intentar todo ello e incluso actuar con mayor imaginacin. Pero, qu poco cambiar nada! El recinto es el laberinto de Creta dispuesto por los dioses, la trampa de los arquitectos de los faraones. Generalmente, nuestra familiar construccin confunde al que la penetra, e impide cualquier fuga del sistema. Valiente invencin sta de depositar en una fuerza frrea y muda, annima, prcticamente secreta, el papel de guardin de los sagrados principios. Mientras permanezca inclume este guardin, entraremos y saldremos todos a la vez de las aulas, realizaremos idnticas operaciones repetitivas, permaneceremos aislados de lo exterior... Sencillamente, no somos dueos de nuestro tiempo ni de nuestro espacio. Mientras estn de pie esos muros obstinados estarn salvaguardados los principios de la uniformizacin, sincronizacin y concentracin. Todos lo mismo, al mismo tiempo, en el mismo lugar. Hasta ahora, stos eran los principios motrices del sistema. Pero stos y ste hacen crisis. Empiezan a ser otros porque han dejado de ser rentables. No obstante, la escuela fidelsima no se ha enterado (oficialmente) y los muros centinelas no han recibido contraorden. Pero los ojos de los estudiantes ya han empezado a saltar el muro, como se proclama en italiano.
Frescos ojos que suean

Para qu encerramos en el sueo de la razn de estos caducos arquitectos, visionarios de la tecnocracia, constructores de la fbrica, defensores del hormign armado (y bien armado) con rejas para cohartar la

pizarra

'-

librera

I
mar

montaa

"-l
taquillas

lm".
bllfle (Sanyo) (sic)

pizarra

ventanal montafta

ventanal mar

bafIe (Sanyo) (sic)

taquillas

inteligencia y el sentimiento? Para qu? No valen lamentos, El aula ideal es real. Est en los sueos de los jvenes. As se ha demostrado en los Encuentros de Juventud de Cabuees 84. Este verano, en la ciudad de Gijn, se han congregado varios millares de jvenes para conocerse y reconocerse. Entre ellos se encontraba un centenar de estudiantes de 1. de BUP del curso experimental para la reforma de las enseanzas medias. Estos jvenes Oovencitos) han vuelto la mirada sobre s mismos y se han preguntado: -Cmo podra ser nuestra clase? y se han puesto manos a la obra, con resultados excelentes, Con los titubeos del que rescata de entre la bruma del olvido el trasunto de un arquetipo sepultado. Han materializado su ensoacin en unas paredes ciegas de papel, sostenidas -en su parte posterlorpor un abigarrado andamiaje de pupitres y trastos desechados. (A esto se lama reciclaje de los materiales de derribo). La planta de esta aula de nueva planta es octagonal: ocho lados regulares que esbozan una aproximacin al crculo. Tan slo uno queda difano, Indeterminado, por razones prcticas de tramoya y para que sirva de espita de la Imaginacin particular. Los lienzos se abren a la luz con el color de los pinceles. En dos paredes opuestas, se expanden dos amplsimos ventanales, casi desde el suelo al techo. Uno mira a la montaa y otro al mar (un barco de vela, un faro sobre una punta rocosa, nubes, pjaros y olas rizadas). Otras tres paredes ms albergan tres ventanales sensoriales e intelectuales. En una, la pizarra. no muy grande, discretita. En' otra, un equipo estereofnico,

m1

.
D
,
'1!lil~lil~l! ., . I '1 .1 ,1. "

[W

radio, discos, fotos y posters. En la tercera pared, una librera, pero no algo impersonal con estanteras regulares, no; es ms hogarea, con baldas desiguales y armarios para cosas personales, decorativas, etc. Quedan dos paredes. Una, con armarios roperos individuales o taquillas (porque el alumno es persona y, como persona, se proyecta en sus objetos, que lleva a la clase, adems de las herramientas reglamentarias). En la ltima pared est colgado un bafle y se practica una puerta, con un poster que cubre su parte de cristal. Esta es la ajustada descripciqn de la planta y las paredes de un aula liberada. El espacio interior est vaco, mejor dicho, libre. Pero es muy elocuente. Para cuntos alumnos? Unos diez; eso s, a sus anchas, como en casa. La disposicin de los pupitres? Tal vez en forma de uve, para verse unos a otros. El lugar del profesor? No se adivina; no hay ningn signo de privilegio. Hasta aqu la descripcin. La interpretacin de su semitica, de los mensajes cifrados en su arquitectura, en el particular uso del espacio y de los instrumentos, es responsabilidad de cada cual. Y esta interpretacin no ser arcana para quienes dominen el cdigo de los jvenes. Pero no digamos que el aula ideal no es real, que est en el evanescente tejido de los sueos. Es una airosa nube de ocho facetas, una colorista flor de ocho ptalos, una soleada plaza de ocho esquinas.

NOTAS
(1) H.M. Enzensberger, La defensa del profesor particular, en Migajas polticas, Barcelona, Anagrama, 1984. (2) Alvin Toffler, La tercera ola, Madrid, Plaza & Jans, 1980, pp. 44-45.

AO 2 NMERO8 JULIO/ AGOSTO1989 425 PTAS.

Se buscan lectores
Informe:losPremios 88, del J.A. Goytisolo: ganasde leer
-00008
8 "480002"035132

J. D. Salinger, el guardin

entra en la escuela
por Javier Laborda*

eer a Jerome David Salinger es leer unas obras que dan la impresin de estar recin escritas (a pesar de que pertenecen a los aos cincuenta). Leerle es fascinarse como slo sucede con los grandes genios ya desaparecidos, y este sentimiento es mucho ms intenso si quien lee es un adolescente o una persona vitalmente joven. Leerle significa tener entre las manos la obra de un afamadsimo autor en el mundo anglosajn, de cuya pluma ha salido un ttulo que se considera uno de los diez capitales del siglo.

El hombre y el escritor No se trata de un hijo del comercio publicitario ni de la facilidad de una escritura dulzona como los refrescos de cola. Tampoco tratamos de un escritor ininteligible ni atormentadamente intelectual y retrico. Y sin embargo, es uno de los ms ledos (despus de la palabra de Dios, por boca de los profetas y apstoles, y las pginas amarillas). Y, al tiempo, respetado y admirado por los crticos. Su libro ms conocido, y principal, es El guardin entre el centeno (en original, The Catcher in the Rye, y L'ingenu seductor en cataln). Salinger naci en Nueva York en 1919. A los quince aos ingres en la academia militar Valley Forge, donde empez a escribir sus primeras narraciones breves. En 1937 viaj a Viena con una hermana y, a los pocos aos,

en 1942, vuelve a Europa como soldado a merced de la segunda guerra mundial. No se libr del desembarco de Lombarda, pero sin consecuencias visibles. Y su mquina de escribir y l mismo pudieron volver a Nueva York en 1946. Le acompaan el desagrado por la vida militar (por no tratar ya el horror de la guerra) y la amarga decepcin de un matrimonio truncado con una mujer europea. Entre esta fecha y el conocimiento, en 1953, de quien sera su segunda esposa, Claire Douglas, publica la mayor parte de su obra. A partir de ah, poco ms se sabe de su vida. Tiene dos hijos y vive completamente retirado de la vida social y del medio urbano. No concede entrevistas ni recibe visitas. Est dedicado a su mundo particular con una firmeza sorprendente, la misma con que atiende y supervisa las ediciones de sus obras. (11 La obra de Salinger est traducida al espaol. Muy pocos ttulos la componen. Ciertamente es muy escueta. Y sobresaliente. Aqu ha habido un notable retraso en sus ediciones, como sucedi con Nueve cuentos (cuyo ttulo es escrupulosamente descriptivo), aparecido en 1986, cuando la edicin americana data de 1953,u1 No har mencin al resto de la obra aqu, que se completa con cuatro velas cortas ms, y dejo la indicacin de Nueve cuentos y El guardin entre el centeno como seal de una preferencia personal clara, si tuviera que escoger.

81

CLlJa

La aventura de vivir en un escenario urbano La nica novela de Salinger es El guardin entre el centeno, publicada por primera vez en 1951 (edicin castellana en Alianza Editorial). Narra una historia muy simple, las andanzas de Holden, un muchacho que acaba de ser expulsado de un internado caro y que durante tres das deambula por Nueva York, enfrentado a su confusin y soledad. Ello da pie a presentar costumbres y escenas urbanas, a modo de acuarela social. Pero, esencialmente, la novela compone un viaje a la azorada condicin del adolescente, del crudo desamparo que la tamiza y de los bruscos movimientos -mentales y exteriores- en la bsqueda del sentido del vivir. Se ha escrito sobre la agudeza sociolgica del autor y la presentacin que realiza de una atmsfera que anunciar la poca beatnik y, despus, la hippie. Mas el centro de gravedad no debe buscarse ms all de la narracin de una realidad esencial y universal, la del adolescente. Ya que es preciso sintetizar, cabe decir que en esta obra queda plasmada, con una

vivacidad y frescura de lenguaje inigualables, la aventura del vivir y la herida que ello produce, el duelo de la inocencia frente a la condicin adulta y el dolor que sta trae aparejada de tener que saber y tener que olvidar. Ello, en el escenario de un mundo urbano, que comienza a ser nico y exclusivo en el orbe. El guardin entre el centeno, en su ttulo y en su totalidad, encierra una metfora y un anhelo, el de preservar a los nios de caer en el precipicio de los adultos, de donde no se regresa. Este libro emotivo y estimulante, de argumento con adolescente, es una obra de cabecera tambin para los adolescentes. Y un hallazgo afortunadsimo para cualquier lector. Quien est en la enseanza, habr vivido la experiencia de buscar donde sea listas de ttulos vitaminados, para combatir la natural resistencia de los alumnos y la rutina de unas lecturas poco afortunadas. No nos engaemos. El xito de la lectura no se debe a la excelencia del libro, y depende de aspectos ms exigentes y dinmicos que la mera suposicin de que toda obra literaria es un depsito auto suficiente de valores. Con ello quiero insinuar que las listas de xitos para consumo acadmico no existen, y s, por el contrario, una buena combinacin de saber hacer (lectura y lectores) y obras de calidad. Estas consideraciones se me imponen en este momento en que releo a Salinger. El protagonista, otro adolescente ms Trabajamos algunas de sus obras en el instituto, en los cursos de primefaccin de ser lectores de la que hacan gala los alumnos. Este gozo trajo alguna dificultad, como fue la de recomendar luego libros -en palabras de los propios jvenes- que fueran como El guardin entre el centeno. Cierto es que su lectura result fcil,

ro.(3) Y recuerdocon claridad la satis-

LIBROS/ENSAYO

fluida, esencialmente porque lectores, texto y referencia (realidad circundante), se pusieron de acuerdo. La novela de Salinger es un trabajo humorstico notable, y se revela fresco y sorprende a cada relectura. A la vez, el humor queda conjugado con un sentimiento dramtico del vivir. Esta combinacin fascinante emerge del protagonista: Holden Caulfield encarna al hroe adolescente. Y su figura sirve a una visin irnica, reticente, tierna, dolorida y desengaada, de una realidad confusa, desordenada y violenta. No importa que entendamos que esa realidad es la general (visin sociolgica) o la del adolescente que anhela un orden perdido y una existencia menos atribulada. Cualquiera de las dos y ambas a la vez son posibles. Cules son las circunstancias del protagonista? Holden no se presenta precisamente como un dechado de virtudes ni como una personalidad de una pieza, sin contradicciones. Bastante tiene con la lucha que mantiene consigo mismo, como para ser capaz de tener un acertado control de lo inmediato y de sus interlocutores. Es un adolescente que aparentemente no se diferencia de cualquier otro. Es el tpico jovencito, salvo por ciertas notas socialmente negativas: fracaso escolar, emotividad inestable y una desorientacin vital grande. Pero ello no es tal como aparece. Encierra en su intimidad -descifrada narrativamente- una naturaleza heroica. Y sus hazaas exudan de actos cotidianos y poco apreciados. Holden es un rebelde que narra sus pasos durante unas navidades, desde una casa de reposo. Es un rebelde astillado, pero irrenunciable. Soy el mentiroso -escribems fantstico que pueda imaginarse. Es terrible. Si voy camino del quiosco a comprar una revista y alguien me pregunta que adnde voy, soy capaz de decide que voy a la pera. He aqu un rasgo insignificante de algo fundamental.

En este mentiroso empedernido hallamos a un defensor de la honestidad y a un ser alrgico a la hipocresa. Esta dureza crtica tiene que convivir con una emotividad a flor de piel. Cuando Holden se va para siempre del -amargointernado, se debate entre sentimientos opuestos: cuando me iba, ya con maletas y todo, me par un momento junto a las escaleras y mir hacia el pasillo. Estaba a punto de llorar. No saba por qu. Me cal la gorra de caza roja con la visera echada hacia atrs, y grit a pleno pulmn: Que durmis bien, tarados! Apuesto a que despert hasta al ltimo cabrn del piso. Luego me fui. La peregrinacin de Holden es un viaje de exploracin del mundo y de formas de amar. Y esta conmovedora necesidad de amar y tal anhelo por dibujar su identidad, se enfrentan a las speras experiencias con la escuela y sus pobladores, las perplejidades amatorias y los escarceos sexuales, los unos sociales y los patrones familiares. De este contraste, violento y desigual, emerge la silueta del protagonista, espontneo seductor, por su ingenuidad y su soledad radical.

* Javier Laborda es profesor de Lingstica de la Universidad de Barcelona.

vida y obra de Salinger, conviene Juan Jos Coy, 1. D. Salinger, 1968, Barcelona. Nueve cuentos, 1986, Edhasa, Barcelona. Y la versin en cataln: Just abans de la guerra amb els esquimals, 1986, Empries, Barcelona. 3. Vase J. Laborda, Un excelente campo semitico..., en Cuadernos de Pedagog[a, n 97 (1983), pp. 41-43.

Notas 1. Sobre la consultar a Fontanella, 2. Salinger,

82
CLlJa

AO 2 NMERO 10 OCTUBRE 1989 425 PTAS.

El libro de conocimientos
.Colegas: rnold Lobel A Quinno gustade Tournier?
.""""""""","'"".
8 "480002"035132
00010

LIBROS/ENSAYO

Quin no gusta de Tournier?


por Javier Laborda*
o.nTo.urnierno.shallamo.s ante un fenmeno. so.rprendente y felicsimo. en la narrativa reciente. Po.r. que se trata de un auto.r que se vale de la literatura para escribir so.bre filo.so.fa,esencialmente, y tambin So.bre antropo.lo.ga y semitica. Co.n una intencin as, po.dra pensarse que no. hay literatura que emerja en lo.s trabajo.s del pensado.r y del divulgado.r. Bien, quiz esta presentacin no. propo.rcio.na una caracterizacin y s una caricaturizacin. Lo incuestio.nable es que Michel To.urnierha lo.grado.la atencin de lo.s lecto.res desde el principio.. Ha lo.grado. la atencin, el xito., y no. slo. en Francia, que es su pas, sino.tambin en Europa y en el mbito. anglo.sajn. y es tan apreciado. po.r el mino.ritario. secto.r de intelectuales co.mo. po.r el gran pblico.. La explicacin de una co.bertura tan amplia no. puede explicarse en una frase, pero. alguna luz arro.ja la o.pinin, en la que abundan no.po.Co.Src tico.s, respecto. a su co.ndicin de narrado.r de una capacidad y o.riginalidad sin igual, en lengua francesa, de lo.s ltimo.s decenio.s. No.cabe duda de que la escritura de To.urnieres muy firme y madura. Pues bien, po.r raro que parezca, esta escritura es leda co.nmucho. gusto. po.rj-

,1

venes y nio.s. Su co.ntinua bsqueda en el teso.ro de lo.s mito.s de nuevas y espectaculares facetas, le co.nvierten en un auto.r que puede o.frecer a to.do. tipo. de lecto.r to.do.aquello. que desea hallar. Cualquiera dira que se trata de un a(gumento. digno. de la fantasa de algn cuento. de To.urnier, cuando. slo. se trata de una descripcin: To.urnier es un autor de fo.rmacin y preo.cupacin filo.sfica, que co.nsigue el xito. desde el principio. y en l se mantiene. Es un escrito.r ledo. en su casa y en muchas o.tras casas ms. Es un narrado.r selecto. y tambin po.pular, y para un pblico. adulto. y no. adulto.. Es co.mo.para preguntarse quin no. gusta de To.urnier?, siempre que se pueda dispo.ner de las edicio.nesde sus o.bras. Pero esto. ya es o.tra cuestin, que apunta a las dificultades de edicin de To.urnier en castellano.. Viernes o el hermano gemelo de Robinsn La primera y ms famo.sa o.bra de To.urnier es Viernes o los limbos del Pacfico, de 1967 (en castellano., Alfaguara, 1986). En esta no.velareco.nstruye la histo.ria de Ro.binsn Cruso.e, po.dero.ssimo.mito. tantas veces reto.mado. en la histo.ria de la literatura, pero nunca seguido. co.n tanta fideli-

74
CLlJ1.0

dad ni revisado con tamaa perspicacia como lo hace el francs. La habilidad de Tournier consiste en abrir una nueva dimensin, vibrante y desencantada, en el mito de Robinsn. Para ello adopta el punto de vista de Viernes, el indgena salvado de la muerte y tambin de la oscuridad de la ignorancia y de la horrorosa condicin de salvaje por Robinsn. Esa es la perspectiva del escrito de Defoe y de sus imitadores. Mas la horrorosa condicin de salvaje no es tal, ni su vida es un vaco completo. En la narracin de Tournier, Viernes viene a cumplir la funcin de hermano gemelo de Robinsn, puesto que aporta una nueva faceta del propio Robinsn, insospechada y luminosa. Viernes es quien salva a Robinsn de la estril y voraz empresa de levantar en la isla desierta una nueva Inglaterra. Consigue que las creencias ms civilizadas del que asume la funcin de amo se tambaleen, para que asuma el papel de hermano, de igual, y que se impregne de un sentido del vivir gozoso y... revolucionario. Eso le ensea Viernes. Eso aprende Robinsn, hasta el punto de renunciar a embarcarse para su patria cuando se da' la oportunidad y decidir fundirse definitivamente con el destino de la isla perdida en la inmensidad del desierto marino del Pacfico.

Los limbos del Pacfico ya no son el territorio de Robinsn, pues los bautiza y los configura Viernes. El espritu del Tercer Mundo se revela a Europa, la colonizadora a golpe de Biblia y sable, como una cultura fascinante, henchida por un designio de paz y de saber. As, puede leerse la novela, de la que Tournier ha elaborado una versin juvenil, Viernes o la vida salvaje (Noguer). Cualquiera de los dos textos resulta magnfico y su calidad slo se ve aumentada por el peso de la intencin del autor. Recomiendo otra lnea de lectura: la historia de la lucha de un nufrago -en los avatares corrientes del vivir- por sobrevivir psicolgicamente; la lucha del individuo en crisis por merecer la dignidad humana y por aprender a quererse en su soledad -la de toda persona que se conozca- y a saber querer luego. No quiero dar con ello una idea de dramatismo. Quien conozca el mito de Robinsn no podr evitar una carcajada al empezar a leer ya las primeras lneas.
La imagen adorable de Can, el ogro y otros mitos

Tournier aade a la pasin literaria la de la fotografa. Y ello como fotgrafo, como autor de textos para lbumes de fotos y como sujeto que se interroga sobre los poderes y los peligros de la imagen hoy da en su ltima novela La gota de oro (Alfaguara). En ella cuenta la historia de un pastor berebere de quince aos, cuya vida se tuerce cuando una joven francesa le toma una fotografa en su oasis, al noroeste del Shara. Este muchacho peregrinar hasta el barrio rabe de la gota de oro, en Pars, y sufrir penalidades que hablan amargamente de la tirana opicea de Occidente: el culto a las imgenes. Este autor se manifiesta en todas sus obras como un admirador de los mitos y como un iconoclasta que goza con invertirlos o deformarlos hasta

que consiguen otra apariencia. As sucede en Gaspar, Melchor y Baltasar (Noguer), Los meteoros (Alfaguara) -el mito de los gemelos- o El urogallo (Alfaguara), entre otros. Hay una obra en la que se renen de manera brillante los dos intereses de Tournier, los mitos y su tratamiento desde una perspectiva asequible a los ms jvenes. Se trata de la ya citada El urogallo. Contiene catorce cuentos que responden a esta caracterizacin y su temtica es diversa. El cuento La familia Adn se acoge a una fuente muy apreciada por Tournier: la historia sagrada y su rutilante faceta mtica, y recupera la figura de Can como modelo positivo; tambin especula acerca de la condicin de lo masculino y lo femenino. En Mam Noel logra que una corriente y anodina pugna en un pueblecito entre creyentes y ateos desemboque en una imagen paralizadora: Mam Noel amamanta en el pesebre al nio Jess. Amandine o los dos jardines narra la iniciacin sentimental de una nia, merced a la confrontacin que sta hace del jardn de orden y domstico de la casa de sus padres con el jardn silvestre y solitario de la casa vecina. La nifia sangra a la vuelta de su paseo de exploracin, y el mundo ya no ser el mismo para ella. Otros cuentos dan vida a la figura

de un ogro bondadoso y ecologista, que se asemeja a la de un marginado al que se le persigue implacablemente. O a la figura de un enano que llega a descubrir en s la personalidad de un superhombre, con la determinante intervencin de los nios. Tambin, la naturaleza necrfila de una joven y su particular relacin con la realidad y, en otro cuento, la ptica con que un nio ve las cosas y su experiencia turbadora del reconocimiento de los modelos sexuales, que le conduce a una sangrienta renuncia a su condicin de nio para optar por la de nia. La ternura no rehuye la crueldad y la perversidad. As, la recreacin de estos mitos despierta un inters renovado. En sus pginas, Tournier ha sembrado un magnetismo oscuro, mtico. Tournier es un autor que vive en las estanteras de las escuelas y los cuartos infantiles y juveniles, y cuenta con ediciones dedicadas a stos. Qu opina l de la literatura infantil y por qu escribe para los nios? Tiene una opinin muy clara: No. No escribo para los nios. Nunca. Me avergonzara de hacerlo. No me gustan los libros escritos para los nios. Es subliteratura. Pero tengo un ideal literario, unos maestros, y estos maestros se llaman Perrault, La Fontaine, Kipling, Selma Lagerlof, Jack London, Saint Exupry y, por qu no?, Victor Hugo. Son autores que no escriben nunca para los nios. Slo que escriben tan bien que los nios pueden leerlos. Michel Tournier, parisino nacido en 1924, obtuvo el gran premio de novela de la Academia francesa por Viernes o los limbos del Pacifico, y el premio Goncourt por El rey de los alisos. y debe estos reconocimientos oficiales y otros ms a un trabajo modestsimo: ofrecer a los lectores sus prendas de imgenes para que abriguen su desnudez.

* Javier Laborda es profesor de lingstica de la Universidad de Barcelona.

75
CLlJ10

AO 3 NMERO 15 MARZO 1990 425 PTAS.

"
~

Cuentosde pelcula
rase una vez Walt Disney Francia:Livres poor enfants
-""--"""'"1111'"111"1111'" 00015

8 "480002"035132

LI RaS/ENSAYO S

Novela indita de Verne


por Xavier Laborda*

a noticia del hallazgo y la reciente publicacin de una novela indita de Julio VerL ne ha sido recibida como un acontecimiento por los lectores de los Viajes extraordinarios del escritor de Nantes. Podemos ahora conocer una temprana novela que qued apartada en un cajn por consejo del editor de Verne. Se trata de Viaje maldito por Inglaterra y Escocia. (1) La obra tiene su origen en el viaje que realiz Verne a las Islas Britnicas en 1959. Dio forma a sus impresiones, ancdotas y notas de viaje en el manuscrito Voyage a reculons en Anglaterre et en Escosse. Como no pareci en su momento de inters, ha salido a la luz cuando el Ayuntamiento de Nantes se hizo con la documentacin del archivo familiar del escritor. Resulta curiosa esa falsa fama de sedentario impenitente que se le ha atribuido a Verne, segn la cual nunca haba salido de su ciudad natal. Como es sabido cambi de residencia varias veces, visit el Reino Unido en varias ocasiones, estuvo en Estados Unidos y recorri las costas europeas en un yate que arm para satisfacer su temprana vocacin marinera. Dos jvenes entusiastas, Jacques Lavaret y Jonathan Savournon -que son el trasunto literario del propio Verne y su compaero- parten desde Nantes por va martima para Burdeos, donde toman pasaje en un buque mixto que les conduce a Liverpool. Conocern Glasgow, Edimburgo, las tierras altas escocesas y Lon-

VIAJE

MALDIID

POR

INGLATERRA

Y ESCOCIA.

DEBATE,

1989.

dres. Tal es el itinerario que siguen durante cuatro semanas estivales. Lo que hallan se resume en tres escenarios, todos ellos fascinantes a los ojos del protagonista, Jacques Lavaret: la travesa en el mar, la Escocia romntica de Walter Scott y la Inglaterra industrial.

Verne describe este panorama nocturno desde el buque de hlice Hamburg: El cielo estaba cubierto de nubarrones negros; la oscuridad apenas permita distinguir la proa o la popa del barco; la punta de los mstiles se perda en la niebla, y las velas desple-

72
CLlJ15

JUliO

VERNE

VIAl E MALD ITO


POR INGLATERRA Y ESCOCIA

gadas aleteaban sobre las vergas; la luz del habitculo, invisible para cualquier otro que no fuese el hombre del timn, iluminaba directamente la incrustacin de cobre de la rueda; ese crculo resplandeciente en la profunda oscuridad produca un efecto fantstico; el navo pareca guiado por una mano sobrenatural, bajo la accin de esa rueda luminosa... En este fragmento se expresa la doble fascinacin por la naturaleza del mar y por el progreso tcnico. En muchos otros pasajes el autor plasma las estimulantes impresiones que le produce la velocidad de los trenes, la ingeniera vial, la pujante industria y el afanoso trajn en el laberinto de los muelles comerciales. Mar y mquina o, dicho de otro modo, aventura y orden tcnico. He aqu dos focos de admiracin de Verne. El tercero es decididamente romntico y literario: la Escocia tradicional, con sus paisajes y los lugares donde resuena el eco de Walter Scott. El tercero y el principal, a la hora de realizar el viaje y de constituir el eje tem-

t )

e 1 r e t I

e r e e e r

..

- - - - --- ----

----

---

=:::=

~:=-

--

--=-;~--~ ~-:;~i~~~~:~';~:-"'

-:::~2t~~7:~-

-~~,----

~~--- ,~~--,-o~= ===-~~=

----------

------------ ----- =--~--

-_0_= ='--=-_H______-----

---

VIAJE

MALDITO

POR

INGLATERRA

Y ESCOCIA-

DEBATE,

1981-

tic o de Viaje maldito por Inglaterra y Escocia. Llegados a este punto, conviene hacer una aclaracin sobre el ttulo de la novela. La calificacin de viaje maldito ha de tomarse en su sentido irnico, esto es, como viaje a contratiempo, con obstculos, retrasos, prisas e inquietudes menores. El libro es una sutil broma acerca de las dificultades de dos viajeros curiosos que se enfrentan a pequeas contrariedades; la mayor es la escasez de tiempo y su desajustada distribucin: tres semanas para llegar al Reino Unido y una para recorrerlo. En definitiva, la obra no es una novela exactamente, si bien incluye lige-

ros elementos de suspense y accin, y no pocos golpes de humor. Se trata de una gua de viaje, un carnet de notas, una crnica (descarnada, en ocasiones, por mor de la miseria de la industrializacin) y, sobre todo, una peregrinacin literaria y romntica. Y muy vital.

* Xavier Laborda es profesor de lingstica la Universidad de Barcelona.

en

Notas 1. Julio Verne, Viaje maldito por Inglaterra y Escocia, Debate, Madrid, 1989.

73

CLlJ15

"~.

~Oj ,,~

I
,

~
"
",' "',

,
_-111
~I

.-M473M471C4S
'

ftJj
,, ,

',

ti
...

'

""

MA73M4T1C4S , - MAT3M471C4S , MATEM471C4S , =~' MATEMA71C4S "


.

MATEMAT1C4S ,
.,

MATEMAIC4S , T MATEMAICAS T
Nios visibles niasinvisibles y La reformade las palabras
o 0182
8 "480002"035224
.... _J

Bibliotema

Laenseanza delfrancs
y noc::ttuloc::m:\c:: con un contenido muv

A pesar de la regresin que experimenta la enseanza de este idioma, la oferta bibliogrfica y recursos es amplia y diversificada. Aqu se seleccionan algunos libros, materiales y direcciones tiles, y se destacan las novedades ms recientes.
n los ltimosveinteaosse ha producidoun descenso alarmante Esen paaen lo que ataea los estudios de francscomolenguaextranjera (FLE).La linguafranca contempornea, ingls,se el ha instalado convenientemente el pas,en en detrimento lastradicionales de aficionespor el francs,el alemny el italiano.Languidez y atonaasediana los profesores e francs, d quienesse sientenlaboral enteamenazam dosy que,entrebromasy veras,hanformado el Comitpourla dfense desespeces rares.As se hanpresentado las recientes en XIVes Journespdagogiques I'enseigsur nementdu fran9aisen Espagne (Barcelona, 7-9de marzo,ICEUniversidad Autnoma de Barcelona). De puroconocido,estepanoramaaburre. Porello,sin duda,convienemirarlas cosas de otra maneray, sobretodo,atendera los signosy presagios. Cabepreguntarse, prien merlugar,si laprdidade influencia delfrancses tan nefasta(parasu futurocomolengua extranjera)y si resultairreversible. n E segundolugar,hayqueindagarquestsucediendoahoramismoconsuenseanza,o l cualayudara contestar a parcialmente inel terroganteprecedente. Aunquecuesteaceptarlas siguientesrazonesa los directamente afectados,podra considerarse benficoestebruscoajustea la relacininternacional e las lenguasy su d demanda.Por otra parte, no significagran cosa unaclientelaque nazcadel proteccionismoadministrativoe planesde estudio d oficiales.Y la prdidaestacional estudiande tes -tal como ha sucedido- no tiene por qu ser una prdidasin contrapartidas. Losenseantes temenqueel abandono de las autoridadesacadmicastransformesu desazn precariedad en y,posteriormente, la precariedad desahucio. oraquhayque en P insistiry cooperarparahallarusosprometedores del francs. Otroaspectopositivose aadea lo anterior.Noes meraespeculacin. lgrandesaE rrollode las relacionesinternacionales est cambiando,a mejor,la consideracin la de enseanza las lenguas.Losplanesde la de CE son un aspectode ello,el msreciente de los cualeses el programaLingua, para la decididapromocinde las lenguasde la Comunidad. Algunasconsecuenciasrevisibles e este p d movimiento generalpuedenser:la mejora de la calidadde la enseanzade las lenguas, y el aprendizajede ms de una lenguaextranjera.Noarrojaestoalgunaluz sobreel francs?lIusionapensaren unareforma que mejorela calidadde la enseanza y,tambin en la disolucinde la viejadisyuncin:estudiar ingls o francs?,por ejemplo.Para conseguirlo enunciadose precisade mejoresprogramas, uenametodologa msreb y . cursos. Comolos programasy la metodologa pidendiscurriry tenerespacio, continuacin a vamosa ocuparnos losrecursos. osvalde N dremosdel expediente unalistaparcialde de materialdidcticoy direcciones tiles,conla esperanza que las piezasdesordenadas de de este puzzle sean de alguna utilidad al lector. Novedadeseditoriales Le nouveauSansFrontil!Jres1. l Inter1 C national. Espaces, Hachette (mtodo para debutantes). Libre changes,HatierlDidier. Quatrea quatre,ClInternational (mtodo intensivo). Le franyais de I'entreprise,Cl International. Pour un enseignement u franyaiscomd mercial, ICE, UB. Losseistitulos precedentes novedad son en laseccinde manuales francs.Otras de novedadesms especficasson: Aprochede texteset encyclopdie MEMO, Larousse-Nathan. Littratureparascholaire,Gallimard. only En CO ROM (CompactDisc (Cread memory) e han presentado s cuatro obras: Zyzomys: ictionaire franyais.EncycloO de pdie et Atlas. Hachette.Mthodesde langues, Hachette. Anthologiede littraturefranyaise,Hatier. Texteset Contextes,Magnard.

I
I

y dos ttulos ms, con un contenido muy estimulante:

,1

L'critureretrouveou quelques techniquesd'critureet leurproduction,ICE,Univ.


de Barcelona. Les idiomatics, ditions du Seuil (visin humorstica de los idioma-tics y las correspondencias entre las expresiones hechas, en francs y castellano; libro ilustrado). Buen panorama editorial
El panorama editorial es bueno. Basta con ver la lista parcial de novedades, su calidad, nmero y la notable mejora que demuestra. y los recursos didcticos para el francs constituyen una seria oferta: manuales, gramticas, lecturas, material especfico para la escritura y la lengua oral, obras de temas especficos y material informtico y telemtico. Sera intil y aburridsimo intentar dar aqu ni tan siquiera una seleccin de estos apartados. A ttulo de ejemplo, el catlogo de material didctico de SGEL, distribuidora en Espaa, recoge ms de catorce gramticas y un nmero similar de guas parciales. Entre todo ello, bien se puede encontrar material

Centros de recursos, revistas y cursos de verano Otro catlogo fundamental e~ el que edita el CIEP (Centre International d'Etudes Pedagogiques, 9, rue Lhomond, 7S00S-Pars. Tel. 47 07 42 73). Este organismo pertenece al Ministerio de Educacin nacional y tiene una antigedad de cuarenta y cinco aos. Realiza investigaciones pedaggicas y se ocupa de la formacin en la didctica del FLE (Franc;aisLangue trangere). Su nutrido catlogo recoge no s610textos sino tambin recursos audiovisuales e informticos, aspectos en los que sobresale la pedagoga francesa. El CIEP edita tres revistas.La Gazette RVC,
revista pedaggica del Rssau Vido Correspondance que propqne actividades de vdeo

a medida.
Dos gramticas recientes y nuevas en la forma de aclarar, entretener y proponer ejercicios: BRARDEet LAvENNE. Grammaire De utiledu fran{:ais(Hatier), y SABATELLI, la maniere impertinente d'apprendre grammaire
(Retz). Esta ltima es ms un texto de humor ilustrado que una grmtica. Para ejercitar la escritura, he aqu algunos

y vdeo interactivo; Echos, revista de civilizacin francesa contempornea. Y ducation et Pdagogies, publicacin peridica sobre actualidad pedaggica, dirigida a un pblico internacional. El CIEP tambin participa en la revistaeditadapor Hachette,Le Fran{:aisdans le Monde, revista internacional de pedagoga (ocho nmeros anuales), y el suplemento trimestral Diagonales, dirigida a profesores de francs como segunda lengua

ttulos:Ecrivons-IeHatier-Didier); ( C'estfacile dire:exercices grammaireetd'actesde de parole (Hatier).


Para ejercitar la expresin y comprensin orales, las obras se acompaan de cintas magnetofnicas: coute, coute (Didier); Les fran{:ais des Fran{:ais: accents rgionaux (Sermap); Parler et convaincre (Hachette). Sobre obras de tema especfico, tan slo fijndonos en una editorial, Hachette, hallamos manuales tales como Le fran{:ais des relations internationales; ...de la banque; ...de I'htel/erie et du tourisme; ...du secrtariat commercial, entre otras. Y, en otro registro temtico, Parlez-Iuid'amour (Cl International) o bien Tours de France (Hachette).
Las colecciones de lecturas son servidas por Magnard, Cl International, Hachette y Gallimard. De estas ltimas editoriales la co-

~
CPt'!{J~S

'{ DE }J~O

leccinFolio, articularmentempliaentipos p a de literatura niveles dificultadlingstica. y de Dosdistribuidores Espaade material en de francsson /taca (Lpezde Hoyos141,
28002-Madrid. Tel. 416 66 00) Y SGEL (Marqus de Valdeiglesias S, 2800S-Madrid. Tel. S32 23 92). Disponen de catlogo.

CANOONES y JUE DE

.1,

(26, rue des Fosss-Saint-Jacques, 75005-Pars. Tel. 46 34 89 82). Otro ttulo a considerar es Le Trefle, revista trimestral de ANEFLE, Association Nationale des Enseignants cherchers et formateurs de Franc;:aisLangue trangare (8, place Saint Jean, 69005-Lyon. Tel. 78 38 16 73). Una organizacin ms, ASDIFLE: Association de didactique du Franc;:aisLangue trangare, con finalidades pedaggicas y profesionales (101, boulevard Raspail, 75006-Pars. Tel. (1) 45 44 38 28). De inters para las personas implicadas en las enseanzas medias y universitaria puede ser la recin fundada revista French Culo tural Studies, que atiende a aspectos de la cultura francesa, y se publica en ingls (AIpha Academic, Half Penny Furze, Mili Lane,

Chalfont S1. Giles, Bucks HP8 4NR, Inglaterra). La Embajada de Francia en Espaa ofrece muy eficazmente todo tipo de asesoramiento por medio del BAL:Bureau d'action linguistique (por ejemplo, BAL, Moia 8,
08006-Barcelona, Tel. 200 57 90). Absolutamente recomendable acudir a estos centros. Entre otras muchs cosas, proporcionan una informacin de mucho inters de cara al verano: los cursos de francs para estudiantes

extranjeros. Un folletorecoge las direcciones y condiciones de cursos de verano en ms de sesenta centros por toda Francia. Estos cursos constan de sesiones de tres a cuatro semanas de duracin, con un coste medio de treinta mil pesetas por semana. La relacin calidad-precio es buena. Adems de Francia, puede escogerse Suiza (por ejemplo, Universit de Lausanne, facult des lettres-BFSH2, CH-1015, ausana) o bien BlL gica (como Rsidence Univ.Neussart, Place de Paniers, 1, 1348-Louvain-la-Neuve). Mucha informacin ha tenido que quedar fuera de este resumen. S aparecen las referencias y direcciones bsicas. La produccin editorial tiene calidad y diversidad metodolgica. Las condiciones sociales y polticas respecto al idioma apuntan hacia una buena direccin. Y los centros de recursos (tambin privados) aumentan y mejoran. As mis-

mo, las oportunidadesde visitar pases


francfonos y aprender la lengua sobre el terreno no son insignificantes. (Atencin a las becas de estancia e intercambio, que las hay.) En consecuencia, qu augurios cabe adelantar sobre la enseanza del francs?

XavierLaborda.

LA ESCUELA EN LA

LITERATURA
"

00187

Eranguaposlosegipcios?

Matemticas campo enel


-~ -

Bibliotema

Sentidos del anlisis del habla en el aula

En los ltimos tiempos han proliferado las investigaciones y publicaciones en torno al anlisis de la interaccin verbal en el aula. Aunque una gran parte de la produccin bibliogrfica slo est editada en ingls, existen ya unos cuantos ttulos en castellano que comentamos en estas pginas.
OS estudiossobrela naturaleza rey giasdel hablaenel aulatienensu inicio en losaostreintay lasinvestigacionesquese hansucedido estnmereciendo el reconocimiento unconjuntode perde sonasmovidaspor muydiversosintereses. La interaccinverbalen el aulaes un fenmenoque,por el momento, e sustraea s un anlisisglobal.Laexistenciade diversos enfoquesde estudioes unaconstatacin de su complejidad (ysu humildey obligatorio homenaje). El enfoquelingsticoes unode los ms avanzados, i biensu progreso s formalno ha logradoresolver mocooperar atisfactoriac s mentecon otrosenfoquesinsoslayables: l e sociolgicoy etnogrfico, l psicolgicoy el e educacional. Porotraparte,estaetiquetacinnoagotatodaslaslneas detrabajo,oda t vezque cabenempresasintegrado que, ras comoladel conocimientoompartido, c perfilan propuestasmuy estimulantes. La pragmtica Unafuncinfundamental s su condicin e instrumental arala comunicacin. a pragp L mticaes unadisciplinade la lingstica que atiendea estevalor. eocupade losusosdel S lenguaje,aquellosque sirvenpara hacer cosas. Cules sonesascosasquepodemos hacer con el lenguaje?Podemos prometer,ni formar,preguntar, amenazar, pedir...Heaqu algunosde losactos habla. oqueplande L teala pragmtica eslacapacidad hablandel te paraejecutary reconocerun conjuntode fenmenosfundamentales todo acto de en comunicacin:las intenciones,os propsil tos, las creenciasy los deseosde los agentes del acto comunicativo. Dosson las obrasfundacionales, bsolua tamenterecomendables estudiososy cua riosos: 84

AUSTIN,J. (1962): Palabras y cosas, Pai-

ds, Barcelona,1982. SEARLE,J.R. (1969): ctosde habla,CA tedra,Madrid, 980. 1 Estostextosponenlas basesdel anlisis pragmticocontal claridady capacidadexplicativaqueyasonclsicos.Sise deseateneracceso unextracto a didctico compreny sivo de una etapamayorde la pragmtica, puedeacudirseal manualde lingsticasiguiente: AKMAJIAN (yotros)(1979): Lingstica: una introduccin al lenguaje y la comunicacin, Alianza,Madrid,1984(cap.12,pp.313-346). La condicinactivade los hablantes queda particularmente xpresada el ttuloorie en ginal de la obra de Austin: Cmohacercosas con palabras (How to do things with words).A partirde esteestudiose entiende que los actosde hablase clasificanen cuatro categorasprincipales:actos locutivos (meraaccinde pronunciarlossonidosverbales),actos inlocutivos (encierranla intencindelemisor), ctos perlocutivos(actos a que y producenun efectoen el oyente) actosproposicionales(queataena la referencia a y la predicacin).
El discurso en el aula

Lapragmtica el anlisis y deldiscurso son dos desarrollosindependientes, i bien se s acogena una mismaperspectiva cientfica, la lingstica. acaracterstica anlisisdel L del discurso esqueseocupade la comunicacin comoun procesoquetiene unciclo mslargo que el intercambio unasfrases,el cide clo del discurso. Curiosamente, l anlisisdel discursoha e centradoen el aula uno de los principales camposde estudiode la naturaleza las rey giasdel habla,puestoqueofreceunascondiciones de investigacininmejorables.La obraque marcala entradaen un periodode

Enfoque sociolgico y etnogrfico

ilisisdel Iula
madurez aparece 1975y vienefirmadapor en dos britnicos: SINCLAIR, MCH y COULTHARD, J. R.M. (1975): TowardsnAnalysis a o(Discourse: he T Englishusedby Teachers ndPupils,Oxford a UniversityPress,Londres. Enellase ofreceunataxonoma deestructurasdel discurso,a partirdel anlisisrealizadoen el aula.Lacategorizacin habla del disponeunidades quesesuceden unajeen rarqua creciente. acategora L ..acto (recurdesela aportacinpragmtica) e sumeen s lacategora ..movimiento; estaltimarevierte y constituye ..movimiento, el latransaccin y la leccin, ucesivamente. virtud de s En esteprograma terminolgico, todohechocomunicativo quese produceen el procesode aprendizaje el aulaes adscritoa unacaen tegora,y recibeun significadofuncional. Laaportacin Sinclairy Coulthard, ue de q hatenidounanotabilsima repercusin, uep de conocerse encastellano travs laedia de cindeobrasdeotrosinvestigadores quedan continuidada sus investigaciones. Tales el caso de Stubbs: STUBBS, . (1976):Lenguajey escuela, M Cincel,Madrid, 1984. Otrode losaspectos queponede manifiesto elanlisis deldiscurso losautores de apuntadoses laorganizacin losturnosde pade labray su estructura.Sucedeque hayuna comprensingrandeentreel maestroy los alumnosen lo que respectaa las expectativas que aqul tiene de que stosintervengan, callen o pasenla palabraa algnotro de sus compaeros, egnsea el caso.Lo s fundamentalde ello es que el profesorno haceexplcitas (ode unmododirecto) usins dicaciones. El anlisisdel discursodestacala comprensin partede la clasede unasreglas por especficasy muy elaboradas hablaen del la enseanza. En lo que respecta accesode las fuenal tesbibliogrficas, hayquereconocer uehay q algunasdificultades.En primer lugar,algunasobrasfundamentales tienenedicin no en castellano. Tambin, pocos no trabajos tienenuncarctermuyconcretoy especializado, y no sugerirangrancosaa un colectivo ampliode lectores,especialmente aadisi mosque,aun realizandomuchasinvestigaciones,el progresotericoes pausado. Dichoesto,hayque aadirque s se disponede ediciones encastellano dettulosexcelentesy sumamente tiles.

...

, t'

En lavertiente sociolgica hallamos enun foqueque se apartadel criteriode anlisis formalde la lingstica, quese interesapor y el discursoeducativo comofenmeno determinadopor otrosfactores:el marcosocial, lascomunidades, culturay prcticasociales, coherencia conflicto o denormas,ransmisin t social... Un aspectodel quese haocupadoestalneade investigacin el del fracasoescoes lar en comunidades condificultades culturales frente al estndar imperante(comunidades escolaresde negros,en los Estados Unidos,por ejemplo). Unaguaactualy renovadora uedehallarp se en la siguienteobra: COOK-GUMPERZ,(1986):La construcJ. cinsocialde la alfabetizacin, aids,BarP celona, 1988. Recoge trabajos de la compiladora, Cook-Gumperz, reconocido del JohnJ. Gumperz o del propioGordonWells.y delimita -mediante teoray experiencias- laalfabe-

tizacincomoprocesono slocognitivosino social.Elloimplicaque las interacciones en el aulaestnorientadasa promover capacidadesdiscursivas que merezcan refrendo el social. La investigacin educativa Elenfoque lingstico cieestrictamente se a su objeto, l lenguaje, a su mtododefore y malizacin;y el enfoquesociolgicoaporta explicaciones que precisanunacontextualizacinde lo escolarmsampliade lo que dan a entenderlas prcticasdentrode sus muros.Otrafuenteinterpretativa madu-y ra- es la psicolgica.El lenguajede los niosy de la escuelaha merecidolos esfuerzosde Piaget,Brunero Vygotski, ntreotros. e Cadacualhabalizado caminosde comprensinde la dimensincognitivadel lenguaje. y constituyenun referenteterico muy influyente. Unade lasconsecuenciasel progreso d de la psicologaen los procesoscognitivosha sidofacilitarel estudiodel lenguaje comoactividad,como realidaddinmica,conjuntay social. En estesentidoavanzala investigacin educativa.

CUADERNOS DE PEDAGOGA 187

CUADERNOS DE PEDAGOGA187

Si lapsicologa Piaget,Brunery Vygotsde ki haprovisto modelos de interpretativos, tambinha suministrado ayudasde interslafilosofay la lingstica.Unade ellasprocede de la obrade PaulGrice(Logicand conversation, 1975). riceformulael principiode G cooperacin, queencierraun mandamiento al que los interlocutores acogen.Reza se as:"Haztu contribucinsegnseanecesario, en el momentoen que quepaestacontribucin,siguiendo elfin o ladireccin aceptadosdel intercambio verbalen el queests tomandoparte. El principiode Gricedescribeuno de los aspectos lenguaje, u funcincooperatidel s va. Evidentemente, estafuncin puede ser traicionada,masentoncesel discursopuedefracasarpor:faltade calidado verdad,inadecuacin delacantidad informacin, de irrelevanciao ininteligibilidad. Unapropuestamsestrictamente educativa -y que nos remite a Sinclair y Coulthard- es la de Flanders: Anlisisdela inFLANDERS, (1970): N.A. ter accindidctica, naya,Salamanca, 977. A 1

comprensin elaula,Paids-MEC, en Barcelona, 1988. Latesisdefendida porestosautores que es la interaccinen el aula es significativaen tantoquecreacin conocimiento de compartido.Ellosignificaqueel aprendizaje queall se realizaesten realidadenfocado la cona secucin unacomprensinompartida de c entre maestrosy alumnos. Edwards Mercerordenany pasanrevisy ta a lasaportaciones recedentes p (entre ellas, los conceptosde informacindada e informacinnueva),paratratar luegode puntos de su inters,comoel conocimiento prinde cipiosy de ritual,el controldel conocimiento por partede los maestros bienel traspaso o de la competenciaa los nios.
Relacin complementaria de bibliografa accesible

Su instrumento anlisisdel discurso de escolar(FlAG) basaendiezcategoras, ue se q codificanla actividadde habladel profesor -segn formulepreguntas, xplique, inse d trucciones,critique o alabe,entreotros hechos-, el habladel alumnoy los silencios. Lacodificacin la interaccin erbalperde v miteclasificar cuantificaros hechos. eah y l D derivala induccin laregla losdosterde de cios:durantedosterciosdeltiempoalguien habla;el maestroocupadosterciosde este tiempode conversacin; dosterciosde la intervencinde steestndedicadosa la lectura y a formularpreguntas.Un ejemplode aplicacindel FIACes el de MaRosaBuxarrais(vasebibliografa complementaria). La investigacin Orculo,quese propona desvelarlavariedad riquezade loshechosvery balesqueseproducen enel aula(Galton,Simon y Croll). Laobjecinquepuedehacerseal anlisis sistemticode Flandersy otros'similaresy aun mssutiles,se resumeen la rigidezde susinstrumentos la ignoranciade factores y fundamentales. n estalneacrticaavanza E la propuestade Edwardsy Mercer: EDWARDS, MERCER, (1987): l coD.y N. E nocimientocompartido.El desarrollode la

La mayorpartede la produccin bibliogrfica sobreel anlisisdel discursoen el aula debe buscarseen edicionesen ingls.Por otrolado,es comnque una mayorade estos ttulos sean especializados por tanto, y, de escasointers,mientras nose integren en modelosmadurosy de irreprochablecapacidad interpretativa. nacaracterstica U ms es quesedansuficientesenfoquesmetodolgicoscomoparaatestiguarla riquezay dificultadde la realidadque hemosapuntado. A los ttulos y autoresreseados, abra c aadirunaprolijarelacinbibliogrfica, i no s fueraque la prudenciay la mesurala desaconsejan. eaadea continuacin,anslo, S t unarelacincomplementaria bibliografa de disponibleen edicionescastellanas. BASSOLSPUIG, .: Notas i M sobrela interaccinlingstica el aula,en Tecnologa en Educativa 1983,pp. 31-33. ,1, BENNETT, N.:Estilosde enseanza proy gresode losalumnos,Morata,Madrid,1979. BERNSTEIN, (1988):Clases,cdigosy B. control111, Akal, Madrid, 1988. BRUNER, J.S.:El habla del nio, Paids, Barcelona,1986. BRUNER, J.B.:La importanciade la educacin, Paids,Barcelona,1987. BUXARRAIS, MaR.: Anlisis la interacde cin profesor-alumno comocatalizadora del procesode aprendizaje, Revistade Eduen cacin, 288, 1989,pp. 419-428. DELAMONT, La interaccindidctica, S.: Cincel-Kapelusz, Madrid, 1984. DAZAGUADO, M.J.:Lasexpectativas en la interaccinprofesor-alumno, Revista en Espaolade Pedagoga, 1, 1983,p. 162. 4 GARCA LVAREZ, Interaccin J.: didctica, Incie, Madrid, 1980. STUBBS, M.:Lasrelaciones profesor-alumno, Oikos-TauBarcelona,1978. , VVGOTSKI, loS.:El desarrollo losprocede sospsicolgicossuperiores,Crtica,Barcelona, 1979. WERTSCH, Vygotski la formacinsoJ.: y cial de la mente,Paids,Barcelona,1988. XavierLaborda. PGINA 85

..

Existe readeCiencias? el Bibliotema: u Bernstein B

LIBROS
LIBRODELMES

El proyectoientfico c delenseante
Arca, Guidoni y Mazzoli Ensear ciencia. Cmo empezar:reflexiones para una educacin cientfica de base Barcelona: Paids, 1990, 207 pp. uando se lee sobre ciencia, por lo generallo que halla el lector son obras de una condicin un tanto extrema. O bien se ocupan de cuestiones especializadas (sean las materias en curso de investigacin, sean las elaboraciones tericas sobre mtodo cientfico y epistemologa), o bien se interesan por problemas sumamente limitados. Estos ltimos son los que sirven a un objeto de estudio, y desconocen los dems (y no ya para integrados sino al menos para sealar la complejidad), o se atienen a una fundamentacin rgida y endeble o, por ltimo, consisten en una tarea de divulgacin trivial, confusa, engaosa. Ciertamente, en esta enumeracin deberan aparecer separadamente las obras de calidad de las inanes. Sin embargo, el lector entender esta omisin puesto que lo que se trata aqu de destacar es otra cosa: la rareza de ttulos que convengan de manera sobresaliente a los mbitos de ciencia y escuela. El libro de la biloga Arca y los fsicos Guidoni y Mazzoli es uno de estos inhabituales casos. La obra Ensear ciencia... no es un texto de Ciencias, ni est pensado para los profesores de Ciencias (al menos no slo para ellos). No es un libro terico ni tampoco prctico, si por terico entendemos un conjunto de principios abstractos que difcilmente podrn ser aplicados, y si por prctico suponemos que se trata de un recetario de trucos para solucionar algunas lecciones de ciencia. Se trata, por el contrario, de un libro que aglutina teora y prctica, en el sentido de principios explicitadores y explicativos (teora) y aplicaciones que integran la experiencia, el lenguaje y el conocimiento (prctica). El libro se compone de tres partes. La primera dispone, en dos captulos, las consideraciones preliminares de un programa de educacin cientfica y propone los elementos tericos de una enseanza integradora y constructivista, cuya aspiracin se cifra en atender al desarrollo del joven y en favorecer la constitucin de la clase como legtimo sujeto social.

La segundaparte forma la parte mayor del conjunto. En ella se analiza el proceso abstracto de formacin de las disciplinas.La perspectiva con que se contempla el nacimiento de los saberes disciplinarios es la interaccin entre la observacin y la formulacin lingstica, entre los modos de mirar y los modos de hablar. Los captulos de esta parte sintetizan el trabajo realizado por los autores en cursos de la Enseanza Primaria con el objetivo de construir redes de ideasen torno a los nmeros (captulo1),a los seresvivos y la biologa (captulo 2) y al conceptofsicoy lingsticodefuerza (captulo 3). Concluye esta parte con una interpretacin de las experiencias expuestas, para establecer unas condiciones y dificultades de la renovacin de la educacin cognitiva. La obra se cierra con una ltima parte que contempla de una manera ms amplia la cuestin fundamental de cmo organizar una enseanza cientfica relevante. Los autores deEnsear ciencia... insisten en que los recorridos didcticos que acaban de sugerir son tan slo una ejemplificacin de los mltiples caminos posibles. Sin duda, y sta es una de las innega-

bles virtudes, su escritura obra -que no slo


dice- sobre el solar de los procesos de conocimiento. Y la construccin de ste depende de la adecuada relacin del joven y del adulto con el mundo, con el experimentar, el hablar y el integrar dicha explicitacin en un modelo explicativamente superior. El trabajo de Arca, Guidoni y Mazzoli merece del lector un reconocimiento sin reservas. Rene cualidades poco comunes. A unas experiencias sumamente interesantes en la Primaria antepone unos principios mucho ms poderosos, que son los que guan el concepto de ciencia y su papel en la educacin. Este planteamiento -que incluye lo epistemolgico, psicolgico y didctico- no'hace otra cosa que promover una reflexin filosfica sobre nuestro saber. Si a ello se aade el cuidado estilo expositivo y el talante cercano y acogedor con que los autores arropan al lector, se entiende que se trate de una obra que puede estimular la tarea de todo enseante y dar luz a su proyecto. Xavier Laborda.

CUADERNOS PEDAGOGA DE 188

PGINA71

NUEVAS

ECOI.

e:

00193
. "'""".,.""." "...,..." "'

El patlOde mi escue la
8 8

8 "480002"035224"

j- - ~

, ,

111

Mapasurbanos , -

ESCUELA SOCIEDAD Y

Viajeslingsticos

Viajar al extranjero paraaprenderenguas l seha convertido enunhbitocultu. ral bastante extendido. autoranalizadiversas El modalidades -cursos, viajes, estancias- y sugierealgunasdirecciones tilespara alumnos profesores. y

XAVIER LABORDA
ntorno a la creciente demanda de cursos lingsticos allende las fronteras se est consolidando un sector dedicado al turismo de lenguas. A su vez, se hacen corrientes expresiones con cierta pretensin, como viajes lingsticos o estancias lingsticas. La primera constatacin que puede hacerse es que estas expresiones designan prcticas diferentes y que, tras dichas prcticas, se aprecian diferentes fmalidades. Por otro lado, se echa de menos una informacin crtica sobre la calidad y los costes de este tipo de cursos, sobre todo si el colectivo de usuarios resulta tan abultado. Msde 300.000 espaoles, de ellos el 90 % asisti a cursos veraniegos de ingls.

senta un ao de trmite. Por consiguiente, la desparejada preparacin, segn se realice fuera o aqu, no favorece a los que siguen el COU fuera. As que quiz las calificaciones de estos ltimos en la Selectividad se resientan, y tambin sus opciones de acceso a las facultades. Una alternativa es estudiar en el extranjero un curso de BUP, que no compromete la prueba de selectividad. Por otra parte, parece que los niveles aqu y all son similares. Y, dentro del ciclo de BUP, se puede sugerir el segundo curso por su condicin intermedia. Algunos profesores con responsabilidad de tutor aaden, en favor de esta propuesta, que, si bien la ado-

El curso escolar en el extranjero


Varias dcadas atrs, Suiza era un destino que frecuentaban los jvenes de familias bienestantes, mientras que ahora es comn asistir durante un curso escolar a opciones especficas en Estados Unidos, Irlanda, Gran Bretaa o Canad. Ms all de consideraciones sociales -que en buena parte son el motor de las migraciones-, este tipo de estancia est muy bien considerado entre los educadores que tienen la oportunidad de valorar sus resultados. La duracin del curso permite la maduracin lingstica del alumno y la asimilacin de ciertas regIas interculturales. En definitiva, los objetivos buscados son dos: hablar la lengua y entender la cultura inmediata que vehicula dicha lengua. Por aadidura se implican elementos nuevos de socializacin y convivencia para el joven. Si se enva al joven para un ao, tiene mucha importancia la eleccin del momento. Es corriente que cursen COu. Se entiende que, como sea que se acerca la entrada en la Universidad, conviene una inmersin lingstica, lo cual ha de redundar en el mejor dominio de la bibliografa universitaria, entre otras ventajas. Algunos especialistas critican esta eleccin porque, a diferencia de lo que ocurre en los centros escolares americanos -destino mayoritario-, el curso de COU en Espaa mantiene un nivel acadmico notable, y en absoluto repre-

66

Los viajes de verano

;ticos
lescencia es una etapa activa y difcil para el sujeto, la edad de quince aos no acostumbra a presentar los conflictos de bsqueda amorosa inherentes al joven. Hay razones a favor y en contra de cualquier tramo escolar que se elija para estudiar fuera. Sin embargo es incuestionable la recomendacin de que un nivel suficiente del idioma representa una condicin necesaria. Una estada del tipo que consideramos se prepara aos antes mediante la asistencia regular a clases ordinarias de idioma. Actuar de otro modo puede comportar una experiencia decepcionante; no slo es doloroso enfrentarse con escasos conocimientos a una inmersin lingstica sino que tambin puede frustrar el sentir de quien la sufre y las expectativas de los progenitores que albergan la ilusin de multiplicar el capital escolar del joven con esta inversin, inversin que alcanza o supera una cantidad de seis cifras.

EGB.

Hay opciones menos onerosas a la asistencia durante uno o varios aos a cursos en el extranjero. El inters de los pases de la Comunidad Europea por favorecer el conocimiento de idiomas entre sus ciudadanos se aprecia en algunas medidas y recursos econmicos que van en esta direccin. Dentro del mbito universitario, los alumnos de ciclo superior pueden optar a las ayudas del programa Erasmus, que promueve el intercambio universitario de alumnos durante varios trimestres. Otro programa, Lingua, busca la movilidad y el conocimiento de lenguas extranjeras de alumnos y profesores de Enseanzas Medias, principalmente. No es infrecuente que pequeos grupos de Primaria realicen algunos viajes de intercambio con colectivos de otras nacionalidades. Parece que la activacin y mejora del aprendizaje de idiomas sigue un camino decidido. Los intereses comunitarios pesan. Y, entre otras acciones, cabe apuntar la implantacin experimental de un segundo idioma en centros de

Con estos fenmenos como teln de fondo durante el curso, llega el verano, que se ofrece como buena oportunidad a muchos, escolares y adultos, para progresar lingsticamente o
para lavar un tanto la conciencia y el sentimien-

to de analfabeto funcional en idiomas. El veranoes un acontecimiento ordenmade

curso de, al menos, veinte horas semanales. La garanta de que los grupos son reducidos (con indicacin numrica del mximo) es una buena razn. La disposicin real (y no tan slo aparente) de servicios, como biblioteca, mediateca, prensa, restauracin o una seccin de autoaprendizaje, aporta unos elementos muy convenientes.

Cursos charter
Lo que se puede esperar de un curso de verano es la consolidacin de los conocimientos que se tienen del idioma y un buen estmulo para seguir adelante, una vez de vuelta a casa. Salvo que se pueda permanecer un trimestre en el extranjero, es muy recomendable formar la base lingstica en casa. Las clases de idiomas resultan mucho ms baratas aqu y por horas que en un paquete de curso de verano fuera. Aqu se puede invertir tiempo y recurso en idio-

yor. La mitologa contempornea halla en el verano un mbito de fascinacin y de segregacin de mitos sumamente complejo. En l se enredan y apoyan otras mitologas, como la del automvil, la del consumo -pinsese en los artculos estacionales y las campaas de los grandes almacenes- y la del culto al paraso perdido. El equipaje del veraneante incluye un afn de bsqueda del paraso y la transitoria instalacin en este espejismo de mundo ocioso e inocente. Los cursos de verano son un departamento de la gran oficina turstica estival, as como una seccin ligera del edificio escolar europeo. No parece absurdo considerar que los cursos de verano responden a tres componentes, el culturalmitolgico, el de esparcimiento y finalmente, pero no el menos importante, el componente lingstico. Por ello la valoracin de un cursillo no depende tan slo de su calidad acadmica, como perfectamente se puede apreciar en la eleccin y comportamiento de los usuarios. Un curso de verano responde a unas caractersticas precisas. Su duracin es corta; de dos a cuatro semanas. Acoge a un alumnado de diversas nacionalidades. Los grupos se distribuyen en una rejilla de niveles que no acostumbra a superar el nmero de cuatro: debutantes, falsos debutantes, intermedios y avanzados. En algunos centros se ofertan cursos especiales de perfeccionamiento lingstico y didctico a profesores. El objetivo principal se orienta a la fluidez oral. El alojamiento puede ser en familias, lo cual da ocasin a situaciones comunicativas que refuerzan lo ejercitado en la escuela y permite trabar conocimiento con un aspecto de civilizacin como es la vida cotidiana en el hogar. Las actividades culturalesy excursiones ue q organiza el centro o que surgen espontneamente, aportan otra dimensin a la escolar y de acogida familiar. A pesar de este marco comn, la calidad de los cursillos puede variar muchsimo. Ante todo, importa elegir un lugar (pas, localidad, zona urbana o rural) que responda a las expectativas del cliente. El centro escolar es fundamental, y para ello no estara de ms tener informacin de amigos que lo recomienden. La opcin lectiva y su precio tambin cuentan. Si se desea aplicarse al estudio, conviene elegir un

mas, al ritmo que se desee.Por otra parte, el


verano es la estacin alta, con todas sus consecuencias: caresta, aglomeraciones y descenso de la calidad. Por el precio de un curso de verano se puede pagar la mayor parte de una estancia de un trimestre, con la ventaja de que la calidad ser ms alta. Sin duda, la calidad del curso depende de la condicin del centro y del ambiente que aglutina, pues las dos cosas suelen ir juntas. Con todo, la limitacin temporal del cursillo no favorece la profundizacin de la tarea acadmica ni la cohesin del grupo. El aliciente de la variedad lingstica y cultural de los alumnos, se convierte fcilmente en un retardador del ritmo de estudio. Acuden alumnos de diversos continentes y, curiosamente, los colectivos nacionales o culturales atienden a intereses muy diversos. Es bueno conocer la diversidad, pero no se valora suficientemente la ventaja de estudiar en grupo homogneo junto a un profesor que conoce la mentalidad cultural del alumnado y su lengua o sus lenguas. El ideal del profesor nativo ha sido sustituida por la del profesor nativo que acredita una preparacin pedaggica y un buen conocimiento de la lengua de los alumnos. Quien haya conocido los cursos de verano puede explicar suculentas ancdotas acerca de dificultades y malentendidos con otros compaeros o con el profesor que no deberan suceder. Hay una razn ms para el desequilibrio de las clases. Los alumnos pueden presentar una disparidad de nivel apreciable, aun despus de ser clasificados como homogneos. Y ello no puede superarse en unas semanas, con lo cual el ritmo es desigual, as como los resultados. Por ltimo, hay que considerar que los resultados tienen que ver con los objetivos del curso: consolidacin y ligera mejora de la competencia lingstica, y contacto cultural. La mayor parte de las actividades escolares estn encaminadas a la produccin o mejora de la fluidez oral, que adems es una de las lneas de la vigente metodologa comunicativa. Es una opcin interesante y realista. Su prctica permite un uso inmediato en el medio social que rodea al estudiante y da instrumentos que afian-

PGINA 67

zan la seguridad del sujeto y la utilidad cierta en la comunicacin. Por otro lado, no es sensato intentar realizar tareas de aprendizaje demasiado densas y continuadas. La fluidez oral es excelente, si bien queda postergado el trabajo de correccin o propiedad en lo que se refiere a la escritura. Los viajes lingsticos manifiestan un inters creciente y muy positivo entre los jvenes por la adquisicin de idiomas. Este comportamiento, que habla tambin de modas culturales, enriquece el bagaje del estudiante. Lo fundamental, sin embargo es que estas actividades

supongan una mejora de su competencia idiomtica y no la consolidacin de una prctica que suple las carencias de una formacin escolar insuficiente y descuidada. Con todo, la apre-

ciacin del valor de los viajes lingsticos no ha de dejarseconfundirpor las apariencias. Estos cursos permiten acelerar el aprendizaje y, tambin, conferirprofundidady durabilidad a sus efectos.Ms importante que todo ello es la relacin de familiaridad que el estudiante puede adquirir con la lengua y la cultura. Esta nueva relacin convierte al aprendiz en
maestro.

Parasaberms
Organismos oficiales Es aconsejable solicitar informacin de cursos a la Embajada o Consulado del pas al que se desee acudir. Editan guas muy completas, con las que se puede comparar las ofertas. Citamos dos ejemplos:
-Cursos en Gran Bretaa. Folleto de la Oficina Nacional de Turismo Britnico. Te!. (91) 541 13 96. - Universidad Stendhal, Grenoble III. Cursos de francs general, francs cientfico (ciencias, derecho, economa o gestin) y estadas pedaggicas para profesores. Tres sesiones: julio, agosto y septiembre. Precio por sesin: francs general (20 h/s), 2.780 francos. Francs especializado (22 h/s), 3.200 f. Deportes organizados (tenis, gimnasia, excursionismo). Universidad Stendhal-Grenoble III. B.p. 25 X-38040 Grenoble Cedex. - Universidad de Reading (CALS). Centro especializado en cursos de ingls para estudiantes universitarios y profesores. Cursos de posgraduado para profesores. CALS, University of Reading. Whiteknights. PO Box 218. Reading RG6 2AA (GB). -Universidad de York. Slo ingls avanzado y cursos para el ttulo Proficiency. Sesiones de julio, agosto y septiembre. 480 f: por sesin; 22 a la semana, por alojamiento. Language Thaching Center, University of York. York YOI 5DD (GB).

- Cursos en Francia. Ministerio de Asuntos Exteriores. Te!. (93) 414 54 63.

Agentes

y organizadores

de cursos

En Espaa hay una Asociacin de Empresas de Promocin de Cursos en el Extranjero (Aseproce). Unas cuarenta empresas estn adheridas a dicha asociacin. La mayora organiza cursos en el Reino Unido, Irlanda, Francia, Estados Unidos y Canad, y los tipos de programas son el estndar, el intensivo, el deportivo, los campamentos, las convivencias familiares en el campo, y el profesional. En muchas capitales de provincia tienen sede algunas de estas empresas o bien cuentan con agentes de contacto. A continuacin sigue una breve lista tomada al azar: - Ace Advisor Services. Te!. (91) 622 18 84. - Intercambio Cultural. Te!. (91) 574 68 64. - Escuela Castellana de Lingstica Aplicada. Te!. (947) 50 76 82. -Sas Internacional. Te!. (93) 253 31 71. -The English Montessori School.
Te!. (91) - Wolse 357 Te!. 26 67. (945) 23 18 21. Te!. (91) 435 04 lO. profesional). - Vele.

Otros datos
- Alemn en Berln: GLS-Sprachenzentrum. Cursos en verano y resto del ao. Curso estndar (20 clases semanales de 45 m.; mximo de 12 alumnos/grupo): 2 semanas, 610 DM. Curso individual: 2 semanas, 2.100 DM. Alojamiento en familia, 395 DM por semana. GLS. Pestalozzistrape 88 b. D-lOOO Berlin 12. -Centro de Estudios para Extranjeros. Organiza cursos en Francia, Italia y tambin en Espaa (castellano Profesorado. y vasco). Escuela de Formacin del Universidad del Pas Vasco. Avda.

(ingls

Del Instituto

de la Juventud

depende

TIVE,

que gestiona cursos y viajes. Te!. (91) 347 77 OO. La organizacin Intercultura ofrece programas de intercambio. Te!. (91) 248 63 31.

de Tolosa, 20009 San Sebastin. - Estudio Viajes. Programa, de ingls para estudiantes universitarios, en Inglaterra, Escocia o Irlanda. Dos semanas, 109.100 ptas. Cuatro semanas, 163.100 ptas. El precio incluye viaje de ida y vuelta en avin desde Madrid o Barcelona, alojamiento (pensin completa en familia), 6 horas diarias de clase y actividades de ocio. Estudio Viajes. Josep Tarradellas, 124. 08029 Barcelona. Te!. (93) 439 84 22. -Cursillo de francs en l'Alliance Francaise

Estudios encentrosuniversitarios
Numerosas universidades imparten cursos durante el ao escolar y el verano. Ofrecen un ambiente muy perfilado. No admiten adolescentes. Puede hallarse informacin en los prospectos editados por los organismos oficiales. Estos son algunos ejemplos recomendables: -Universidad de Lausana (Suiza). Cursos de lengua y civilizacin francesas. Curso de tres semanas (50 horas lectivas en total), 400 francos suizos. Cours de Vacances de l'Universit. BFSH 2-Dorigny. CH-I015 Lausanne.

de

Paris. Especial para adolescentes y jvenes. Visitas culturales y 2 horas de clase diarias. Cursos de dos semanas, incluido alojamiento (pensin completa), 59.500 ptas. La Alianza Francesa de Thrrasa. Te!. (93) 203 71 64 y (91) 446 22 99. -Intercambios docentes ofrece un catlogo de profesores que desean hacer intercambio gratuito de casa, entre otras modalidades. changes Enseignants. 6 Avenue des Lilas. 64000 Pau

(Francia).

CUADERNOS PEDAGOGA DE 193

LIBROS

l.BIBJmIiBI

Hablar,convence y seducir
a palabrao, lo queesmsexacto, l e discurso despiertanloshumanos n e u inters inagotable, diverso. Setratade la curiosidad delhombre sums por sorprendente capacidad, laverbal. al T comoapuntaron Bhler,lakobsono Austin, ablartienemuchas tilidades. h u Unade las apreciadas ms consiste nint1uirenlosdee ms. araello secuentacondoscaminos, l P e dela argumentacin el de la seduccin. y La argumentacin, quesevaledemodelos eperd suasin busca y convencer, puede serestudiadaenlostratados deretrica.Porsuparte,la seduccin, queextrae sufuerzadelapuesta en escenaconla queaspirano yaa convencer y sino avencer, puede serapreciadanla afanoe saaccin delosdenominados mass media. Losmediosdeintervencin socialaportan unaforma de hablarquedifcilmente puede equipararsedilogointerpersonal. al Supropio nombre esunacajachina,unnombre largocon sorpresas inocentes. no AgustnGarca Calvo noacepta de la seduccin el quesonreenel nombre oficialdemedios ecomunicacin d socia!>}argumenta enrealidad, y que, nosonotros que medios deformacinsocial.A suvez, Carlos urmndez G serefiere conjunto al deestosmedios comounaindustriamercantil e d laconciencia. filsofoGurmndez El desarrollasutesisen la resea Pais,17-11-91) (El del interesante deBlancaMuoz,Cllltllray libro comllnicacin. Introdllccinalasteorfas contemporneas (Barcelona, Barcanova, 1990). Esunafortunaquecontemos condecenas deobras excelentes queinsisten enel estudio delosrecursos losefectos y demedios tanpoderosos. esla intencin No deeste escrito ocuparseeese d campo sinodeldelosmodelos e d persuasindel papelquepuede y tenerla retrica.

Losdocentes asansutrabajoprofesional, granmedida, obrela palabra. b en s A menudo esun usoinocente, intuitivoe inconscienteel poderquecontiene d eldiscurso comotcnica comoarte.Aquseofrecen, omentados, y c algunos Ii. brossobrecomunicacin, retrica,argumentacin, memoriay accin.

anacrnica?, tiene algnotrovalorqueelacadmico?, tiene alguna oportunidadfrente la a realidadcomunicativa actual?,y ofrece elementos dedefensa frenteal asedio dela televisiny los satlites? odemos ntender uesP e q tassonsloalgunas elaspreguntas d quesugiere elgigantismoomunicativosuconnatural c y alienacin. y aun si pensamos n algo msespecficoi e comoesla escuela, puede suceder uelaspoq sibilidades eactualidad d dela retricaresulten insignificantes. Sinembargo,odasestas t consideraciones carecen ecalado.Basta d sealar la pauprrima capacidad oratoriadelosbachilleres suimaginable alacompetencia y m deanlisisde lo quetransmiten medios? los Un trabajoquepuede servirdepuente entre lasinquietudes sinmediatas la retricaesm y tricta esel textodeKathleenK. Reardon, a L persllasin enla comunicacin. eorfa conT y texto(Barcelona, Paids, 983). 1 Estaobra,que relaciona ideasdela preceptiva la activicon dadsocial omunicativa, c haintroducido ungiro notableenel estudio dela persuasin. Vams all delconcepto depersuasin comoresultado o actividadinterpersonal parailuminarsu funcinconstitutiva reafirmad o oradelsujeto y delcolectivo quecontrolael proceso. uien Q modificaconductas jenas a persuade. el senY tido desuaccinapuntaa suautoestima. or P consiguiente, quetieneimportancia lo noesel mensajeinola interaccin ntreelyo y elcons e texto.Elquiddelapersuasinoestenlo que n sedicesinoenla situacinenla quesedicey enla finalidadquesepersigue. finalidadcoLa mndeeste proceso -que todosdesplegamos a diario muchas veces- puede serel afianzamiento de la credibilidadpersonalo de la autoestima. Reardonratatantodelasactividadesepert d suasin entrepersonasomodelasqueparten c demedios comunicacin ocial.En lo que de s La lgica de la persuasin afectaa los medios sociales, onsidera c aspectostan fundamentales comola audiencia maestructural queplantean, elcaso Antetodo,nadaparece ssensato m quepre- siva,eldesafo y guntarsesto:noesla retricaunadisciplina particulardela televisin la publicidad.Soe

QA

brela publicidad enconcreto, o eludeeljusn tificadotpicodesucondicin escandalosa, su influenciaen]0 niosy la funcinquedesempeacomorepresentacin las minoras. de

Viejasy nuevasetricas r
Esinnegable queel trminoretricasabe a rancio.Suscita imagen la deun tomo depreceptivaoratoriay estilstica. esuna lstima Y quesetenga esaimpresin porqueno seajusta a la realidad.Quienquieraremontarse las a obrasdeMarcoTulioCicern(De oratore) y MarcoFabio Quintiliano(Deinstitutioneoratoria), podrreconocer dimensinoriginal la dela retrica.Contodo,quizno seanecesaria unalabortan eruditaparasaberquela retricaesunadisciplina queseocupadelosfundamentos el discurso. istinguelos recursos d D quetraban danfuerza palabra.Tambin, y a]a enalgunosasos, c seocupa dela produccin discursiva.Estateoray produccinno entraen el terreno literario,lo cualesel punto diferenciadordela retricay la potica. Sisenospermite detenemos unmomento por enelcaminohistricoquearrancaenla Antigedad clsica,mencionaremos aportacin la derenacentistas espaoles. MiguelSalinas, on c suRetricaen lengua castellana.Gonzalo de sobrelapoeArgotedeMolinay suDiscurso sacastellana. bienElocuencia O espaola en arte,deBartolom Jimnez atn.EstosescriP tosmerecieron unaedicin acargo deElenaCasas, nelvolumen retrica enEspaa(Mae La drid, EditoraNacional,1980). El maestro RolandBarthes ofreceun visin dela historiadela retrica enLa retricaantigua,queformapartedesulibro La aventura semiolgica (Barcelona, Paids, 1990). La piezafundamental dela retricaclsica esla diseccin eldiscurso d encincopartes:invencin, isposicin, d elocucin, emoria m yaccin.Dichas partes sesucedennesteordende e maneranatural. La invencinconsisteen la creacin elosargumentos. d Ladisposicin feca del La taalaestructuracin discurso. elocucin semanifiesta enelestilo.A suvez,la memoria permite retenerasoperaciones l anteriores y,en su momento, pronunciar ldiscurso. inalmene F te,la accinestodoaquelloqueacompaa a ]adiccin,comoesla mnimay los dems elementosdepuestaen escena. a Paradar un repaso las nocionessomeras el de retricay suspartes, uedeconsultarse p manualdeTomsAlbaladejo,Retrica(Madrid, Sntesis,1989).Esun textodedivulgacin s recomendable introduccin como simple, i bien suestiloseresiente deun gris academicismo.

Invencin y disposicin Un tono ms decidido y


un contenido ms

especficoepuede s apreciar nel imprescindie bletrabajodeCh.Perelman L. Olbrechts-Tyy teca,Tratado laArgumentacin. nueva de La retrica (Madrid,Gredos, 1989). Estos autores, ~enespecial Perelman -polaco afincadodesie tempranadaden Blgica-,sonlos respone

:UADERNOS DE PEDAGOGA lQ& -

LIBROS

l1IDIIDDmI
arehabilitacin retrica. aobra dela L I enEspaa con 31aosde retraso. dodela argumentacineocupa s de elementos quepermitenconstruirel Mas supropiottulo dala indicacin principal bjetivoestratardelasdos o mera, inventio la dispositio. la y Ibra noesun simple manualviene exneltrminoTratado. Hacehonor l.Define lmitesdela argumentalos 10 sonel acuerdo inicial, la presenta'sdatos la formadeldiscurso. diy Y las diversascnicas t argumentativas. metodologastructuralista, e seocupa deforma- nor importancia, unclsico delquehuelgan tolizarunateora delasfiguras,paralo cualtam- daslaspresentaciones, Aristteles suRetriy bininfluyenprincipios desemitica potica. ca (Madrid, Instituto de EstudiosPolticos, y 1971). Laedicinbilinge correacargodeAntonio Tovar,paradeleitede eruditos.

Memoria y accin
Finalmente seaccede lasdosltimaspara tes,la memoria la accin.Sobrela primera y no soncorrientes trabajosquerespondan los a unaperspectiva retrica.Slo sonlosmeramente mnemotcnicos. Unaverdadera rareza de erudicin eslaobradeFrances . Yates, arte A El dela memoria (Madrid,Taurus, 976). 1 Laautora britnica recoge enestamonografa lasfuentes del arte de la memoriaen la Greciay la Roma clsica, lostratados medievales, ascomo lostrabajosrenacentistas, quedesembocan en el desarrollo mtodocientifico. del Un fenmeno curiosoesAprendera hablar enpblico,ttulo deun cuaderno deconsejos paraoradores ocasionalesscritopor el desae parecido JuanAntonio Vallejo-Ngera (Barcelona, Planeta,1990). stetexto,desenfadado E y pretendidamente pocoambicioso ensucontenido,aspiraa ensear, onla oratoriaefic caz,cmocautivary convencer mediode por la palabra. a buenaaceptacin loslecL por toresdeestetipo delibrosponedemanifiesto la escasareparacin uetieneel hombremep q dio parahablaren pblico.Y su publicacin cubreunanecesidad clara. Paraconcluireste comentario bibliogrfico, aadiremos recomendacin la devariosttulos ms.Dosmanuales deusouniversitario, l de e K. Spang, undamentos eretrica(PamploF d na,Eunsa,1979) el deJess onzlez y G Bedoya,Tratado histrico deretrica filosfica(Madrid, Njera,1988). orltimo,y noel demeP

XavierLaborda. Tttulos mencionados Retrica, lbaladejo, .: Madrid,Sntesis, A T 1989. Retrica, ristteles: adrid,Institutode A M EstudiosPolticos,1971. La aventura semiolgica, Barthes, .: BarR celona,Paids,1990. La retricaenEspaa, asas, Madrid, C E.: EditoraNacional,1980. Tratadohistrico de retricafilosfica, Gonzlez Bedoya, .:Madnd,Njera, 1 1988. Retrica general, rupo.t: arcelona, G B Paids, 1987. Cultura comunicacin. y Introduccin las a teorrascontemporneas, Muoz, R: Barcelona, arcanova, 990. B 1 Tratado dela argumentacin. Lanuevaretrica,Perelman, Ch.y Olbrechts-Tyteca, L.: Madrid, Gredos,1989. Lapersuasin enla comunicacin. eora T y contexto, eardon, .K.: Barcelona, R K Paids,1983. Fundamentos deretrica,Spang, .: PamK plona, Eunsa,1979. Aprendera hablarenpblico hoy, Vallejo-Ngera,lA.: Barcelona,Planeta, 1990. El artedelamemoria, ates, Y EA.: Madrid, Taurus,1974.

n
ucin dacarnalidad andamiaje ue al q :.Al igualqueel arquitectoconfiere asuobracuandoda formaconcreta Ida, trotantosucede o cuandoeloraequrecursosstilsticostilizarpara e u suargumentacin. :ucin senutredelenguaje figurado: tropos. a hiprbole, ueconsiste L q en :racinemntica incluso s o unatrans:sunafigura. Y un ejemplodetropo onimia, ueseresume la sustituq en 10 trminopor otro conel quemanrelacin contigidad de (decausa a : continente contenido,de la parte a Estos recursos sonel ornatus del lorigurosoquetrata dela elocucin topor el GrupoJl,Retricageneral la,Paids, 1987).El Grupo Jl,formaisprofesores franceses, tomasunomnicialdeunaoperacin retrica meo IDO lametonimia la metfora. on o C

ESCAP ARA TE

y el deseo de saber
Pensar
Alonso Tapia, 1.: Motivacin y
aprendizajeenel aula. Cmo ensearapensar,Madrid: Santillana, 1991. La tendencia a cuidar la reflexin en la escuela es creciente. Una lnea de este tipo de tarea se manifiesta en los trabajos sobre cmo aprender a pensar. Autores como Nisbet, Nickerson o Selmes, han dado a conocer interesantes obras aplicadas al aprendizaje, las habilidades de estudio y el ensear a pensar. El inters de los maestros lleva a una amplia divulgacin y discusin (Cuadernos de Pedagoga, 175, nov. 1989, Tema del mes Ensear a pensar). y an hay otro aspecto ms. A la investigacin de ciertos autores y al debate que proponen los medios educativos, hay que aadir los proyectos que se desarrollan en torno a las estrategias de aprendizaje. Uno de los ms conocidos es el Proyecto de inteligencia Harvard, fruto de esta universidad y de instituciones venezolanas. Tras cinco aos de su aplicacin en centros espaoles, los resultados obtenidos parecen satisfactorios (Comunidad escolar, 9, oct. de 1991). El atractivo y utilidad de esta lnea de trabajo da lugar a una

dernosdePedagoga, 164,nov. 1988). Alonso Tapiapropone en una obra densa, con abundante material argumentativoy de ejemplificacin,las cuestionesbsicas de la enseanza de procesos y
estrategias. El hecho de que considere, en su globalidad, los objetivos y contenidos del currculum, da a Motivacin y aprendizaje en el aula un valor cierto. Se apoya en una perspectiva integradora. Pero saber pensar no es slo una cuestin de saber operatorio. En ello se implica la voluntad y la motivacin del aprendiz. Y Alonso Tapia se ocupa, por consiguiente, no slo de procedimientos sino tambin de los recursos de motivacin, as como de la interrelacin entre los dos

abundante produccin de publicaciones, a la que caracteriza la diversidad. Un ejemplo de condicin diversa es el curioso texto escrito por De Bono (El pensamiento latera!), recientemente factores. traducido al castellano, que pone De entre las habilidades en las el nfasis en los recursos otros que se insiste en el libro, destadel pensamiento creativo, los de can como principales las de la procesamiento alternativo. Por otro lado, las Jornadas dedicadas profundizacin en la comprensin lectora, la comunicacin esal tema destacan por su aportacin social y cientfica. La publicrita, la solucin de problemas, el razonamiento y la relacin encacin de Ensear a pensara travs del currculum escolar, en tre recuerdo y aprendizaje. Las propuestas prcticas de Je1991,pone al alcancede los lectores las ponencias de las 11Jorss Alonso Thpia, con ser numenadas de Estudio sobre Estraterosas y diversas, tienen el valor gias de Aprendizaje realizadas de estar ligadas a unos principios en la Universidad Autnoma de unitarios que dan coherencia al Barcelona. libro. Estos principios son los de Jess Alonso Tapia, autor de . la explicitacin de los procesos de pensamiento, la proposicin Motivacin y aprendizaje en el de modelos especficos y contrasaula, participadetodos estosfactores. Ha investigado positivatables, y la aplicacin de la prctica como proceso progresivo, mente prcticas y principios de las estrategias del aprendizaje, ha paulatino, para que los alumnos puedan moldear sus conductas y participado en la divulgacin y habilidades. debate pblicos y en proyectos de

experimentacin <Ensear a
pensar? S, pero cmo?, Cua-

Xavier Laborda.

1I

AO6
NMERO 51 JUNIO 1993

650 PTAS.

Panoramade actualidad
Entrevista:
Ministro de Cultura Dossier:Editoresdel ao
8

480002035132

nr

LIBROS/ENSAYO

Sensatez contra el dogma


ay novelas que pasan de mano en mano y que los amigos se prestan con la ms encarecida recomendacin. sta es una de ellas. En realidad, la obra de Pennac no es una novela, como honestamente proclama su ttulo; pero funciona como si lo fuera. Y quien la ha ledo siente el deseo de participar de su intimidad con otros lectores. El francs Daniel Pennac (Casablanca, 1944) es profesor de literatura y novelista. De sus publicaciones, sta que reseamos ha tenido en su pas una acogida desbordante. Qu hay en Como una novela que merezca nuestra devocin y la fortuna comercial? Sencillamente, es un texto que se lee como se bebe un vaso de agua. Y que trata de la lectura. He aqu un ensayo en forma narrativa sobre cmo se llega a ser lector, en una alquimia infantil; cmo se tambalea el aprecio de tal tesoro en la adolescencia; y cmo la escuela y el instituto miman y lapidan lo textual y lo literario con revelaciones prodigiosas y con el dogma odioso que reza hay que leer. Pennac sigue estos avatares personales. Ms que referirlos, evoca sentimientos, recrea situaciones, contrasta prejuicios, opone la mayutica de un sentido del humor tierno y optimista y, lo que es ms importante, consigue presentar el fenmeno con la facilidad y naturalidad de una reflexin slida. El fenmeno, por supuesto, es el de la presencia de la lectura en el mundo, la lectura -y la

literatura- como mundo, el revuelto tpico de los enemigos de la lectura, las prcticas docentes del dar a leer y, tambin, el cmo se leer, articulado en un declogo de derechos del lector. Contra el dogma y la intolerancia elitista estn los derechos del lector. As, el primero es ser libre de leer o no leer, puesto que la condicin humana no va ligada necesariamente a la obligacin moral de leer. Por otra parte, si uno opta por leer, est en su derecho de saltarse pginas (segundo)

o de no terminar el libro (tercero). Y as los dems principios, en los que hallamos tanta sensatez como plvora para la polmica.

Como una novela Daniel Pennac. Traduccin de Joaqun Jord. Coleccin Argumentos. Editorial Anagrama. Barcelona, 1993. 1.400 ptas.

73 CLlJ51

Cultura escolar sociedad y postmoderna Cmo sobrevivir colegio enel Unaescuela ruralalternativa la extincin ela literatura d

,
~

UE

CO NTENIDOS?

ENTREVIST A

Juan Carlos Yedesco

---

----

EL DEBATE

LITERATURA?
No nos llamemos a engao. Lo que aqu se debate no es leer y escribir, sino la literatura y cmo se habr de ensear. Tambin entra en ello la lectura y la escritura, s, pero bajo una horma. Es de esperar que los contertulios de este debate se vean razonablemente acogidos en el presente sermn, una exhortacin a deconstruir tpicos y participar en un dilogo circular. La materia de controversia son los programas de literatura en la LOGSE. Puede tomarse el discurso de Jos Calero como una recusacin de la Reforma, de la que se lamenta. Argumenta con bro sobre el contraste entre el plan que ahora se extingue y el de futura aplicacin. Y seala dos novedades que perjudican la enseanza de la literatura: la desaparicin de la literatura como asignatura independiente; y el reducido espacio concedido a sta, en comparacin con el de la lengua. La amonestacin de Calero acaba con un llamamiento a los gobiernos a legislar con dosis de utopa. A saber, con el cultivo de las humanidades; la literatura entre ellas. A su vez, Garca Lpez dedica el grueso de su exposicin a los nuevos contenidos, para concluir que, con toda la importancia que tienen, le merecen an mayor aprecio los mtodos y las actitudes de los profesores. Para llegar a este sealamiento,ms all de lo debatido -por falta de espacio, pero tambin por razn del enfoque inicial-, realiza un vuelo histrico de dos siglos. Con ello queda ilustrada la idea de que la Reforma es hija de una tradicin. Por consiguiente, en la parte de los males, no es suficiente correccin la crtica de la nueva ley. Como doloroso ejemplo, el autor apunta el olvido actual de la literatura universal.

EL DEBATE

]
Si la literatura es historia, se ha de recordar el principio asentado hoy de que sta no presenta hechos materiales, sino que consiste en un discurso similar a la ficcin. La historia no es un gnero mimtico sino generativo.3 Y si se acepta que lo suyo no son objetos puramente materiales, conviene saber sobre qu entramado conceptual de historia y literatura operamos. Un segundo aspecto, en parte ligado a ste, es el de la posicin desde la que se imparte o recibe docencia. Ello afecta la situacionalidad, pues los agentes educativos no son abstractos ni neutros; disponen de sus teoras, valores y propsitos (como puede apreciarse en los turnos del debate); y quizs estemos dando vida a formas del tringulo cautivo,4 a jerarquas de tres elementos: ley y programaprofesor-alumno, o bien teora-investigacin-docencia. Paulo Freire se refera a ello como modelo bancario, eficientista, jerrquico. La posicin importa, sin duda, y otro tanto sucede con la representacin de nuestra pltica. Se puede hablar de perpetuar la tradicin literaria, de salvar a una sociedad para los valores estticos de la palabra. Se puede hablar de conducir hacia lo mejor a los alumnos. Pero, raramente se suele or la voz del interesado: el lector o, aqu, el alumno. Atencin, no se trata de hacer una encuesta entre el alumnado, sino de algo consistente, que las palabras de Barthes dan a entender con precisin. Es comn hablar, para atacar o defender lo que sea, en nombre de un humanismo que se erige, hipcritamente -escribe Barthes-, en campon de los derechos del lector. Y aade: La crtica clsica no se ha ocupado nunca del lector; para ella no hay otro hombre que el hombre que la escribe.5 De acuerdo, hablemos de todos, del hombre que escribe la obra -autory la horma legal -ministro-, y de quien las lee, esto es, el profesor y el alumno. Sobre todo de estos ltimos, porque en ellos es donde se desvela el sentido total de la

El estad o dela cuestin


XAVIER LABORDA * omencemos por observar la razn que asiste y rene a los dos participantes en este Debate, los profesores Calero y Garca Lpez. Por de pronto, son las voces de profesores, con una dignidad y un pthos o sentir, que no pueden hallarse en la voz de la ley. En segundo lugar, est el acuerdo en un inters, que es una prevencin ante los efectos de la ley, de esta ley. Y, en tercer lugar, con los matices de la vehemencia y del sobrio objetar, reconocemos en los dos discursos una impugnacin: la de la clausura que supone el plan nuevo. Se trata del acta de desplazamiento de un modelo de lo literario, al que quizs el mismo currculum oficial haya querido entonarle el ms exaltado epitafio, afirma Calero. Se trata de la clausura de la puerta de la palabra, en favor del monopolio de la imagen. Se trata de la evidencia, como reitera Calero, de acomodar la enseanza a los modelos sociales vigentes. De ah la irritacin de quienes se han sentido defraudados e incomprendidos en la defensa de determinados valores, aade Garca Lpez, desde el factor histrico, para una crtica de los esencialismos. Es una crtica afn a otra que verta Flix de Aza en Cuadernos de Pedagoga Uulio-agosto, 1993), al referirse a la lectura. Hablaba as de la prdida de importancia social de sta:
Renunciar a la lectura, en trminos cuantitativos, significa, tan slo renunciar a un derecho exclusivamente burgus: la extensin de la alfabetizacin. Un derecho que seguramente ya ha agotado su necesidad histrica, y al que se puede renunciar sin menoscabo alguno de la dignidad, como tantas culturas orales atestiguan.

Fingimientos de la enseanza No ocurre lo mismo con la nocin de literatura. Interrogando: cul es la naturaleza de la literatura por s misma? Ms: los planes docentes son el centro o la periferia de un debate comprensivo? Y, de ser periferia, cul es el foco? Una postura que merece buen crdito pone en duda el concepto de literatura. Por qu? Porque es una tautologa encubierta: la literatura no se define, o se define como aquello que es igual a s misma: conjunto de las producciones literarias de una poca.... Una manera parcial de ver la cuestin, se dir, pero no falaz. Esta va de debate contradice la concepcin monoltica y oficial de la doctrina acadmica al respecto. Si se quiere, se puede entrar en discusin con el principio que propone Roland Barthes:1 La literatura es eso que se ensea, y ya est. Y de ella predica que es un objeto de la enseanza por lo siguiente: La historia de la literatura es un objeto esencialmente escolar, que no existe justamente, sino en cuanto constituye una enseanza. De manera que para el semilogo la etiqueta de historia de la literatura es casi una tautologa. Y qu opcin se ofrece a la impugnacin de esa nocin de literatura? Barthes, entre otros, seala que, mejor que literatura, es preferible referirse a la escritura y la lectura. (Slo como ejemplo paralelo, recordamos otra impugnacin, la que los lingistas hacen del trmino palabra que carece de valor distintivo.) Para acabar, hemos de manifestar que no nos corresponde desarrollar el debate, sino presenciarlo y moderarlo, es decir, atizar su fuego y expandir su campo. De ah que, con una referencia a las palabras de Barthes, recomendemos sus viejas-nuevas ideas de la conferencia Reflexiones sobre un manual de literatura, pronunciada en 1969.2All abreva el lector entre reflexiones tan lcidas, que tienen la virtud de romper prejuicios. Pues, de aceptar el binomio implcito literatura-enseanza, podramos suponer que su futuro y su influjo social dependen de la legislacin. Nos parece til sumamos a las fuerzas de los ponentes del debate para introducir la duda: de qu hablamos cuando nombramos la literatura? Ydesde qu posicin lo hacemos? Y en nombre de quin?

escritura. .

celona, y autor del libro De retrica. La comunicaci persuasiva, Barcelona: Barcanova, 1993.

Xavier Laborda es profesor

de la Universidad

de Bar-

Como vemos, un acuerdo de raz enlaza a Calero, Garca y Aza: el duelo por una clausura, un desplazamiento. Ello tiene consecuencias colosales, advierte Aza, como es hacer callar la voz de los muertos, de lo inactual, aquella en la que se puede atisbar algn lejano eco de nuestro origen y de nuestro destino final. O una magia (Calero) y un slido refugio ntimo frente a los interrogantes y el desasogiego (Garca). Son stas algunas formas' de expresar el duelo por la misma fractura. Por algo indiscutible.

Notas
1. Barthes,
R. (ed. orig. 1976): Reflexiones sobre un

manual, en Barthes, R.: El susurro del lenguaje, celona: Paids, 1987. 2.lbdem nota 1.

Bar-

3. Chartier, R. (1992): El mundo como representacin, Barcelona: Gedisa. Spiegel, G. Huellas de significado. La literatura histrica en la era del posmodernismo}), El Pas, 29-VIl-1993. 4. Usher, R. y Bryant, 1. (ed. orig. 1989): La educacin de adultos como teora, prctica e investigacin. El tringulo cautivo, Madrid: Morata, 1992.

5. Barthes,

R. (ed.

orig.

1968):

La

muerte

del autor,

en Barthes, R.: El susurro Paids, 1987.

del lenguaje,

Barcelona:

CUADERNOS DE PEDAGOGA 225

PGINA 75

~D

\~

~~
111

'11

00mrIID ~ ~ . dtg .
l1li

~-

.-

111

LIBROS
LIBRO DEL MES

El habla:millares de respuesta
Enciclopedia Lenguaje del dela Universidad deCambridge Crystal,D. Taurus,Madrid,1994 (475pp.).

Enciclopedia Lenguaje la del de Universidad Cambridge de Crystal, D. Taurus, Madrid, 1994 (475 pp.). a Enciclopedia del Lenguaje es una obra que, desde su edicin inglesa (1987), ha suscitado elogios en los crticos y un enorme inters en sus lectores. La obra dispone, en 475 pginas bien aprovechadas, sesenta y cinco captulos que dan una respuesta precisa, actual, clara e incluso amena a esa realidad inagotable que es el lenguaje, desde una posicin de respeto a su amplitud, complejidad y mbito de poder. David Crystal, su autor, es un lingista conocido por su enorme capacidad de trabajo y sntesis, as como por su deseo de plantearse preguntas que interesan a un pblico amplio, para hallar respuestas satisfactorias y sugerentes. Este talante explica la fortuna de la Enciclopedia o, en palabras del autor, embrin de enciclopedia. La obra consiste en un curso de introduccin y profundizacin en los problemas principales sobre esta realidad. Su contenido, que no est dispuesto en un orden alfabtico, organiza un itinerario temtico sobre la comunicacin y las lenguas, los contextos, la historia y la estructura. Merece destacarse el excelente uso de los recursos grficos y expositivos propios de este tipo de obras de referencia. Las ilustraciones, los recuadro s y esquemas, y una articulacin de textos breves que exploran aspectos diversos y complementarios de las materias, bastan para asegurar al lector un provecho considerable. Los apndices del glosario, el cuadro de las lenguas del mundo, la bibliografa y el de trminos, permiten un uso gil y selectivo. Crystal agrupa los contenidos en torno a once secciones. Comienza comentando el fondo de algunas ideas populares sobre el lenguaje (1). Destaca los factores que crean identidad en los hablantes, sea psicolgica, tnica o contextual (11).Describe la estructura de la lengua, segn sus niveles gramatical, semntico y pragmtico CIII). Atiende luego al medio del lenguaje y las actividades de hablar y CUADERNOS DE PEDAGOGA 230

escuchar (IV), leer y escribir (V), signos y visin (VI). Una seccin fundamental cubre el campo de la adquisicin infantil del lenguaje (VII), y otra muy breve apunta cuestiones de cognicin y trastornos del lenguaje (VIII). Las tres ltimas partes estn dedicadas a las races y prcticas de las lenguas en el mundo. A saber, el nmero de lenguas existentes, con su censo de hablantes, las familias de lenguas y su evolucin, o el caso especial de las lenguas criollas (IX); los problemas sociolingsticos derivados del multilingismo y la planificacin institucional, el ejercicio de la traduccin e interpretacin o el aprendizaje de idiomas (X); por ltimo, se reservan unas pginas a sistemas de comunicacin humana y animal, y a una escueta crnica de la lingstica, desde la India remota y la Grecia clsica hasta hoy. Es conveniente aclarar que, si bien David Crystal es lingista, su trabajo no se encierra en un discurso ni en una seleccin de inters puramente lingstico. En realidad, el autor despliega una concepcin tan slida teortica-

mente, como asequible y significativa para muchos lectores. La aproximacin de Crystal es de tipo antropolgico, si se entiende esta etiqueta de modo amplio: el lenguaje como una faceta bsica del individuo y de sus comunidades. De ah que cualquier captulo de la obra intente responder a preguntas que se hacen educadores, especialistas y hablantes que sienten la curiosidad y la fascinacin por el habla, por el instrumento de exploracin y edificacin de identidad y realidad. La calidad original de esta obra de consulta no mengua con su traduccin al castellano. El lingista Juan Carlos Moreno, al frente de su equipo, ha realizado una brillante labor no ya de traduccin sino de adaptacin, de acuerdo con los intereses del lector de habla hispana. El resultado es una obra enriquecida con referencias y ejemplos del espaol peninsular y americano. Esto la convierte en una obra felizmente acordada al mundo cultural con que comercia la lengua. Xavier Laborda. PGINA 75

EDUCACION y MEDIOS DE
~

COMUNICACION

Absentismobajasporenfermedad y Evaluacineltrabajoengrupo d

N0== 0==
$a1VNOtS3dOOd ..

-4-1")=

Andrs Ollero, portavoz

del PP

ESCAPARATE

Entre bastidores.
El lado oculto de la organizacin escolar Santos Guerra, M.. Aljibe, Archidona (Mlaga), 1994 (354 pp.). Este libro de Santos Guerra es un recordatorio de la idea de que no hay discurso sin un contexto (lo dicho antes), una situacin (condiciones materiales) y una informacin pragmtica (visin del mundo). Esto viene a ser, aplicado a la escuela, la organizacin escolar. Y el autor se propone alumbrar un aspecto de tal organizacin: su lado oculto, con una interpretacin mayutica y la edificacin de otras prcticas comunicativas. Veinte captulos, en su mayor parte publicados en revistas especializadas, encaran los asuntos de las relaciones entre los agentes educativos, el espacio, el Proyecto de Centro, la direccin o la evaluacin e investigacin sobre organizacin. En esto ltimo se apreciar unas grandes posibilidades, en la lnea de indagacin y cooperacin de la investigacin-accin. Pero lo mismo puede decirse de todos los aspectos tratados, ya que el enfoque de Santos Guerra va ms all de la descripcin. Se trata de una obra de

consulta, porque atesora muchos y muy diversos materiales, al modo de una cantera a la cual acudir segn las necesidades. Por ello habra sido de ayuda al lector una edicin menos premiosa, con un ndice de trminos y autores, un glosario y una bibliografa selecta. Tambin se podra haber repasado en los captulos algunos detalles expresivos y de gnero, para conseguir una redaccin regular y una lectura an ms agradable. A pesar de la condicin heterognea de la escritura, la obra se mantiene en un registro inmediato y eficaz, que llama a escena esa parte oscura de la escuela, la

de la institucin de reclutamiento forzoso -escribe Santos-, articulacin dbil, fines ambiguos, intensa jerarquizacin. Como indicios del inters y calidad apuntados, el lector podr reconocer, en Entre bastidores, ecos y presencias de micropoltica (Ball), dialogismo (Habermas), semitica y sociolingstica (Bernstein) o hermenutica (Usher y Bryant). Y algo de igualo mayor envergadura: retazos de la biografa laboral e intelectual del autor, como los plasmados en el ltimo captulo, Quince aos despus.
Xavier Laborda.

I tamb:

. . .
.,

Estrah~gies de comunicaci oral Les revistes infantils i iuvenils catalanes, avui La doctrina sociolingstica de Prat de la Riba

..,

(.,1..1 ,~

ti 011"

-"..,v

-<-".

..,.............

Estrategies de comunicaci oral


XAVIER LABORDA ..

Devegades s'acosta al mestre algun parlant encuriosit i Ii demana: podria aprendre a uCom parlarmillor?. Justifica la sevapetici en el reconeixement que no t facilitat de paraula i, dibuixant rentorn en el qualvoldria excel.lir, assegura que no es veu capa~de parlar en pblic ambpulcritud. El mestre apreciaque l'interlocutor s'expressa prou b; no tan sois fa entendre, es sin quematisa el quadre d'aspiracions i judicis sobre laparla. El mestre no li lresponres en concret fcom ararecomanar uns exercicis ouns cursos de comunicaci per a executiusJ sin que Ii fa preguntes. A qui vol arlar?Sobre qu? Quin objectiuel mena? Li falla la inventiva, les paraules que had'emprar, la memoria, la icci...?Li fa preguntes, 'is dir, el fa parlar i a 'acompanya en la lonversa, amb la convicci lue aquest i no cap altre s instrument de recerca deis struments.
olacatalana

1"0

llorar i excel.lir en la parla. Ara t, aix com hi ha canals que reprodueixen la il.lusi d'un coneixement instrumental immediatament disponible, tamb hi ha una altra posici ms exigent, que coneix la tradici retorica i tamb les retlexions pragmatiques sobre el discurs, que proposa un cam Ilarg, divers i obert; un canal que, per a expressar-ho breument, s el de les estrategies comunicatives.

l
\ :o

a qesti que evoquem aqu s una petici molt freqent: la de-

manda d'unes tecniques per a mi-

Instrucci

o educaci?

Han ensenyat estrategies comunicatives els retors, aquells mestres en l' art de la persuasi que van apareixer a la Grecia cIassiea. Tamb ho fan ara els ensenyants, que ensinistren els seus pupils en estrategies i teeniques, consistenIs en procediments especfies d'aplieaei meeaniea; la seva ra esta aneorada en una coneepci terminal, limitada; inculquen esquemes o normes d'ortografia, o de com saludar, deseriure o persuadir d'una cosa concreta. Per contra, les estrategies no contemplen usos especfies, ja que ens ajuden a ser conscients de tot ali que interv en qualsevol situaei comunicativa: (a) els proposits que ens animen; (b) la planificaei del que es rara; (e) I'avaluaei eonstant de la qualital de la producei i deis efectes i (d) la capacitat de regular i reorientar la colllunicaci. En definitiva. les estrategics col1lunieatives sn sistemes de rcgulaci de les intcraccions. l busqucn

Ichru

1"')6.

"llr". 327

una aplicaci conscient i eficac; de la planificaci, l'elocuci i l'avaluaci, tot aixo dios d'una dimensi pragmatica, la del com, quan i per a que, Del coneixement historie, pod~m extreure'n algunes observacions. La retorica va ser un programa d'indagaci sobre el discurs; la seva aparici, en el segle v a. c., no s casual,ja que es produeix quan la paraula adquireix una preeminencia poltica mai no assolida fin~ aquelI moment, amb un factor de pubJicitat i de regulaci tecnica. La retorica aporta aquest cos de principis reguladors del que s veritable i be!!. 1, corrent els temps, la retorica esdev un programa d'ensenyament que forma els joves en l's poltic, judicial. espectacular i literari de la parla, No estem partant del passat ni tampoc d'una tradici que, malmesa i anacrnica, es va recluir al' estudi de figures i guamiments expressius. Estem parlant d'una presencia: aix com la retorica va ser el primer programa d'ensenyament tamb podem comprendre l'actual ensenyament com una modalitat de retorica. D'aquesta manera, entrecreuant els dos models pode m extreure algunes indicacions sobre els discursos.

Un programa

a quatre bandes

La didactica de la lIengua oral delimita un programa a quatre bandes, coro si forms la figura d'un ljuadrilater. La primera eonsisteix a escoltar, la segona a llegir i eseriure: la segent rau en el eoneixemcnt de prineipis diseursius i la

L
""""f""'T.,

E
T~"T""T..t'TT'

."'..

u
~~~-'~TTTTT7YTTY..

arrera i quarta banda se centra en variellS'entoms de parla. L'esquema s simd leitil per a extreure algunes conside!Clons. Aprendre a parlar demana: (a) escolar; bj Ilegir i escriure i (c) trasIladar ( 01 quest bagatge a situacions concrea es,l n aqucsl punt, lornem a recomene ~el circuil marcat; aixo s, amb una naduresa ue permet mili orar la recepq :i, lectoescriptura, la reflexi sobre la DI legar i l' aplicaci quan i on escaip ~l, Hi ha, doncs, sobre una natura elemental, una disposici recursiva que Orla un progressiu aprofundiment o, a pmsno, a un procs inacabable d'inlerpretaci i d'intercanvi social. A aquesta rimera remarca se n' afegeix p unaltra, d' aparenr;a paradoxal. La nea cessitat t la didactica de l' expresque ioral e remetre'ns a l'expressi esd trita,a sigui per a formar-nos en les j larietats registres, ja sigui per a inde ~nmar-nos ibliograficament. b Pera reunir les dues remarques en un comentari hem de reproduir la constatali dela natura circular,comunicati va, de ~scapacitats simboliques deis individus, 's quals passen ineluctablement per la institu~ alfabetitzadora. I Ditaixo, podem examinar el que hi ~darrerede les etiquetes que hem apunbt.Ha farem, pero, d'una manera des~roporcionada,en el sentit que destaquem alIo que

correspon al nostre ob-

~ctiu,es estrategies discursives. l (a) L'activitat d'escoltar ha de ser


entesa

no com l'acte de parar atenci al

que iualg, sin coro a un fenomen ms d generalprofund: la socialitzaci de l' ini lan!. extensi, tot parlant s acoIlit i Per humanitzat er la comunitat a que acaba p -el d'arribar cas de l' estudiant de !lenges I'estranger- o en la seva propia, a gracies les relacions quotidianesa La socialitzaci entesa en termes d'adquisicide la parla -coro ha invesligar psicolingisla 1. Bruner-. desel vellla capacita!> colllunicalives deis les

participants i, en un procs que passa rapidament de la recepci a la producci de missatges, endega jocs comunicatius molt poderosos, tot i que elementals. (b) L'alfabetitzaci s el segent estadi en el domini de la parla i del cad que insemina les habilitats de la lectura i l'escriptura. S'estableix una continui'tal entre parla i escriptura i, emprant una metafora del pedagog Freire, la lectura del text segueix a la lectura del mn, s a dir: la comprensi deis textos va Iligada a l'exercici crtic i solidari de comprensi de la realitat i d'un mateix, de manera contnua, circular. Comprenem l' alfabetitzaci com un aprofundiment deis processos de recepci o socialitzaci (aj, s a dir, com una construcci social de canals i de sentits. Res ms allunyat, dones, de la imatge de I'alumne que s'esforr;a per cal-ligrafiar les seves primeres Iletres. L'alfabetitzacis una instituci lingstica que acuIl formats, registres i programes d'ensinistrament. EIs formats poden ser narratius, descriptius o argumentatius. El registre formal constrasta amb el col,loquial, i entre eIls hi ha altres modalitats. Els programes escolars aporten un paradigma que familiaritza els parlants amb uns usos sobre el fans i la forma discursives, o contingut i registre, per recollir una curiosa distinci. L'ensenyament de la Ilengua va associal a la competencia en els eixos diafasics, s a dir, l's i la comprensi de la paraula en l'estil, registre i variaci apropiats. En bofia part, el programa escolar se centra en un model prestigis, il.luminat amb el registre elaborar. I'estil.literari i un esmdard que llega la complexitat de les \'ariacions dialectals i de la !lengua oral. Saber declarar procedr
(c) El saber fer coses amh les paraules requereix un coneixemenl de /es causes. s el quc s'anomcna sabcr dcclara-

"..cuL.
"oo."..,..,. " 9 ..
9'"

(dl,UId

"... 9" - .....

tiu en altres mots: d'aixo se'n Jiu tenir consciencia de coro i per que parlero. Tot plegar ens mella a la qesti de les estrategies. Les estrategies discursives es componen d'un dir sobre les paraules -saber declarati u- id' un fer amb les paraules. 1, definint-Ies de manera finalista, les estrategies sn una guia de les accions comunicatives que cal seguir per aconseguir un objectiu: ja sigui convencer, plaure o dissuadir. Una definici ms densa ens presenta aquestes estrategies coro a processos de parla conscients i intencionals, en els quals l' emissor tria i recupera de manera coordinada els coneixements que necessira per complimentar una demanda o finalitat, segons les caracterstiques de la situaci en que es produeix l'acci comunicativa. Les estrategies sn sistemes de regulaci, i vnen orientades pels segents principis: ordre, qualitat i situaci. El principi de l' ordre afirma que tata producci discursiva s un procs en que es disposen diverses operacions, segons un ordre prefixat. Aquest enunciar queda reflectit en la figura sobre les operacions retoriques, i consisteix a descobrir que cal dir (invenci), en quin ordre (disposici), amb quins trets expressius (elocuci), recordant-ho b (memoria) per a dir-ho en el moment adequat davant I'auditori (acci). El principi de qualitat acullles causes persuasives, s a dir es refereix ms a la recepci que no ras a la producci. Dit amb una pregunta. la qesti que plantegem s: coro es persuadeixen els altres? En retrica, la resposta s triple, car tres sn les causes de la persuasi: fer-se digne de credit (hhos), fer que l'auditori s'emocioni (prhos) i emprar arguments i narracions (/lgoS). tamb podem denominar aquestes tres causes les proves persuasives del jo (;rhos). tu

(prhos) i aixo (/lgo.I).


1el tercer principi anuncia!. el de la situaci, es rcfcreix a la relaci que cal observar entre el dlscur~ i Ic~ circu!l1sescola catalana

. lebrel'I'J'J(; rrwn327 .

estOla (:alalani1

""yyyyyyyyyyyy",y""""",y,..yy"..yyy"yy"y,,~,,~..yy.

Perspectiva retrica
:rincipi d'ordre:

Perspectiva pragmatica Maxima de manera (ser ciar) Maxima de quantitat (ser informatiu)
Maxima de qualitat (ser vera<;:)

a) Invenci
c) Elocuci e) Acci
o persuasi:

b)Disposici d)Memoria
incipide qualitat
a)Jo

b)Tu

c) Aix
o decorum

f-------------

~ncipide situaci

alGeneres b)Estil e)Proposit

1------------Maxima de rellevancia (ser selectiu i pertinent)

Principi de cooperaci a) No imposar-se b) Donar opcions c) Fer que !'ordor se senti b

La comunicaci i les perspectives reto rica i pragmatica

es(lloc

i pblic). La tradici dis-

:ix diversosgeneres discursius selesvariables implicades, la qual disposa n un eix la intenci del e nt,lasituacii l'estil emprat. O'ai'ndejael decorum, l' harmona
:ssiva coherencia. o

onsiderant conjunt aquests tres en ipis sobre la construcci i la reide!siscursos, pode m esbossar d Islligams mb la teora pragmiHia :1 rincipide l' ordre esta relaciop jmb lesmaximes pragmatiques de a((sigues reu, ordenat i no gens b
IU) de quantitat i

<fesuna con-

tltan informativa com et sigui ~Ie). la seva part, el principi De ,alitat, persuasiu, pOI ser como lamb maxima del mateix nom o la !afitat <sigues vera~). En darrer elprincipi de situaci es pOI lir, termes pragmatics, en el en Il~i decortesa, que aconsella no lar-se, donar opcions i fer que l' o"i,~sentib- Tamb s apropiat
ellar l principi e

de situaci amb

lima rellevancia: cal dieel que de jcas , el que s elmateix, cal ser
IIU

i pertinent.

nsespecfics
,~nncipis comunicatius, ac.uells que filaproduccii la recepci discur~lana'ld)"rl'}<}6'l1Ijm.:>2,

sives, troben un bon camp de comprensi i aplicaci en entoms especfics, siguin solemnes (discurs inaugural), formals (conferencia) o interpersonals (conversa), entre altres. Volem destacar l'entrevista social-una modalitat transversal- que recull trets de tipus i registres diversos. L'entrevista social designa un gran entom comunicatiu en que teneD cabuda les relacions entre agents de rols diferents. Ho sn les relacions professioDaIs i tamb les de consulta: client-venedor, pacient-metge, alumne-professor, penitent-confessor, elector-poltic.., EIs agents i les situacions sn, pero, mltiples. 1el que importa ara s destacar alguns principis que emplacen els intercanvis, coro ara l'assertivitat, I'empatia i l' autoestima. L' assertivitat consisteix en l' exercici pIe i amb seguretat, per part del parlant, deIs seus drets i deures, des de la posici d' un paree social o rol. La inseguretat i l'agressivitat sn desviacions extremes d' aquest exercici assertiu. L'empatia iel respecte de I'autoestima deIs altres posa de manifest que les relacions no tan sois han de cobrir necessitats tccnic.ues (venure. ensenyar, aconsellar) sin tamb necessitats personals. L'empatia atn aquest vessant psicolgic i ctic. s ell1rtic "interlocutor que sap escoltar i que es pren el temps nc-

"

(/

l'

\1

TTy-.Y~YY.YYYTYYTTTYYTYY

cessari per entendre el que diu r altre i per mostrar-li que compren el seu estat anmicoSi desglossem el principi obtenim dues maximes: 1) saber escoltar renunciat i observar els senyals no verbals; i 2) comprendre el sentit de la comunicaci i expressar aquesta comprensi. Aquesta actitud respectuosa i positiva s'estn a l'estimulaci de l'autoestima de l'altre, amb un tracte correcte, des de saludar, somriure i establir contacte visual fins a l'elogi i a la mostra d'agra'iment quan correspongui. En definitiva: amb la cortesa deguda, merces a una atenci especfica i honesta. Cos d'impugnacions La relaci de principis comunicatius, afiliats a dues perspectives complementaries, la retorica i la pragmatica, s elemental, aproximativa. Tan soIs aspira a reproduir un resso sobre com ensenyar i aprendre estrategies de parla, amb una renncia clara, pero, de la il,lusi del saber instrumental que pretn conrear practiques d'aplicaci irnrnediata, frmules miraculoses. Una il.lusi d'aquest tipus pOIser perversa, en tant que ignora les finalitats i privilegia els mitjans. Darrera hi ha topics fal.la~os o, si ms no, discutibles. Sn els que proclamen que la nostra s una cultura de la imatge i que hi ha minva de les capacitats orals i de la memoria entre

elsestudiants,
Referencies

- ARISTTIL: R~liriC({, Madrid: E.E.c.. 1990, - BRli'\ER, J,: Actos d~ sigllificado, Madrid: Alianza,I991. - Esc.~'\l>u.L. V, IlItroduccilI a la pragmtica. Barcclona. ..\nthropos, 1993, - FREIRI.. "vI \llid",ti:uciII, Barcelona: Paids, 1989. - G\RT"" & PR \IT A{'ITlldi:aj~ \' {'roceso d~ al/;{,~ti:,uciII. Barcelona: PaiJs, 1991 -L.\B'J/<I)\.X,:/Jc"~I{',.icu.l",colllulli<'u('"i 1'<'lsuu,\'I'lI.Harc'cloll.!: l!arcano\'a, 19<n. -M""IRI"I,'all r.\trat~giu,\dl'<'II\<'IulI:u ,'ul'n'lIdi:u;c, 8ar,."c1,'na: (ral, 1994,

AO 10
NMERO 96 jULIO/AGOSTO 1997 750 PTAS.

Literatura allglosaj Olla ~=N


Antaviana: nios creadores La funcin social de la literatura
~ N

1<')

I 00

LIBROS/DEENSAYO

Como un diario
por Xavier Laborda*

El dardo en la palabra
Fernando Lzaro Carretero Editorial Galaxia Gutenberg/ Crculo de Lectores. Barcelona, 1997. 3.450 ptas.
El libro recopila ms de doscientos de artculos que Fernando Lzaro Carreter, eminente fillogo y, desde 1991, presidente de la Real Academia, ha publicado a lo largo de veinte aos en diarios espaoles y americanos. Su ttulo, El dardo en la palabra, es el mismo que encabezaba la columna en la que aparecieron los artculos, que nacieron como un desahogo ante rasgos que deterioran nuestro sistema de comunicacin, manifiesta el autor en el prlogo. Comenzaron como modestos dardos lanzados contra los usos verbales descuidados, los estragos que provocan las dudas y la torpeza discursiva que en no pocas ocasiones exhiben los medios de comunicacin social. Luego, la escritura de Lzara ha incorporado a sus precisos razonamientos una irona iluminadora y un humor cordial, lo cual da pie a que su lectura suponga para el lector la reunin de leccin y distraccin. Es muy atinado el comentario de Eduardo Haro Tecglen en que afirmaba que, con el tiempo, Lzaro ha perdido el fastidio de los primeros artculos y ha sabido brindar unas crticas bien templadas. Por algunas afinidades, este libro me lleva a buscar en la biblioteca la soberbia y casi desconocida obra del desapercido Jos Mara Valverde, El arte del artculo (Universidad de Barcelona, 1994), para releer algunos textos de la produccin

periodstica del maestro (1949-1993). El orden cronolgico de las secciones de El dardo en la palabra invita a examinar la evolucin de los asuntos y su trato, con el aliciente de las refererencias incidentales a la actualidad. Tambin se puede curiosear, segn nos atraigan los ttulos. Aun hay otra forma de lectura -muy provechosa, por ciertoque es la consulta, tarea que facilita el extenso ndice de trminos que se incluye. Puestos a imaginar un curso informal de lengua para todo tipo de alum-

nos, el libro de Lzaro Carreter podria ser un material excelente de lectura y documentacin, porque muestra las fuentes de documentacin filolgica y los conceptos de la lingstica que encarrilan la tarea, los pasos que da al discurrir, como quien delibera sobre las opciones para concluir lo que convenga sin dictar doctrina ni olvidar que las palabras son del pueblo y viven en l. El lector curioso y el especialista encontrar de todo o casi todo lo que es interesante reflexin sobre la lengua: lxico (rutinario o habitual), fontica (Mxico con sonido ks o j), neominia (airbaig, cojn de seguridad, peto o escudo de aire), barbarismos (contactar), sintaxis (en relacin a, en relacin con), argumentacin (el discurso de Arias Navarro), metforas (chupar de rueda), metforas imposibles (a pie de cesped), latiguillos (bueno), pragmtica (tuteo a mansalva). Sin embargo, la mayor riqueza de la obra est en su aire vivencial y fragmentario, como si se tratara del diario menor del erudito, al que nos atreveramos a pedir que contine en sus comentarios sobre el problema de la lengua en los medios, pero no slo en lo que toca a la correccin y la precisin, sino tambin como un aspecto de la industria de la conciencia y del crdito ideolgico.
*Xavier Laborda es profesor de Lingstica la Universidad de Barcelona. en

69
CLlJ96

~~::(

Publicaci de Rosa Sensat

Setembre 1996

PERSPECTIVA
C O?L A R . 2 O7

1I

.-...

PERSPECTIVA ESCOLAR

207

Mass

media

a I'ensenyament

La comunicaci s una invenci, una construcci poltica i tecnica !ligada a ideals i tendencies de poder. La lingstica i l' anezlisicrtica del discurs s' apropen a aquestfenomen amb la intenci de desenvolupar en el receptor deis missatges de mi~jans de comunicaci una consciencia deis recursos pragmeltics d'aquesta invenci i construcci. En conseqencia, el tractament lingstic deis media s'interessa sobretot pels usos que es fa deis elements simbolics.

'"

Consum i producci de masses


Xavier Laborda L'encs

a la comunicaci

de I'oferta

Una publicaci comercial editada recentment per una llibreria de Barcelona informa els seu s clients sobre les novetats bibliografiques en cinema i comunicaci. Aquest cataleg, que compren seccions dedicades a vdeo i televisi, fotografia, premsa, radio i televisi, inclou unes nou-centes obres, disponibles en diversos idiomes.' Els ttols repertoriats parlen de productors, actors, directors, obres artstiques, pero tamb de tecniques de realitzaci en qualsevol d'aquests mitjans, de llenguatges expressius, de crtica o d'experiencies escolars. En conjunt, es pot dir que queden cobertes moltes de les perspectives que poden interessar el lector, perque trobem material historiografic, tecnic, assagstic o didactic, aplicat a un conjunt suficient de mitjans de comunciaci massiva, tot i que no hi sn tots.

,.

L Cinema i comunicaci. Novetats primavera 1996, Laie, lIibreria cafe, Pau Claris 85, 08010 Barcelona, butllet bibliografic nm. 12 (36 pp.), que recull una selecci deIs ttols apareguts el darrer any.

Si citem aquest cataleg s per dues raons. La primera s immediata, ja que consisteix en l'ajut que el lector de Perspectiva Escolar pot rebre per aprofundir en els seu s interessos o dispersar la seva recerca. Pero no s ras la ra principal, perque un instrument d' aquesta llena pot sser substitu'it per altres. La segaDa i ms urgent ra es resumeix en una visi crtica del conjunt mediiUic o, si ho preferim, una visi selectiva, interrogativa i negadora d' estereotips. Si citem, doncs, un excel.lent cataleg bibliografic no s simplement

per la seva utilitat de receTen sin per reflectir un aspecte difcil de la qesti: que es pOI fer davant la diversitat i la complexitat deis mitjans de comunicaci massiva? Perque, com s'ha apuntat, sn molts els punts de vista que es poden adoptar i, dintre d'aquests, podem escollir una opci de consumidors o b de productors i emissors de missatges d'aquesta mena. Alhora, pero, cal no oblidar la reflexi sobre el fenomen, s a dir, el coneixement que dna la distancia crtica i escrutadora. Entenem que s aquesta darrera posici la que ha escollit l'equip de redacci de Perspectiva Escolar per tractar la materia. En concret, des de I'angle deIs seu s llenguatges i les seves practiques a l'aula. El principi implcit que proclama la importancia que t per a l'escola el tractament deis mass media rau en la necessitat d'una plena alfabetitzaci. El concepte d'alfabetitzaci inclou diversos processos socials d'extensi de les capacitats expressives i comunicatives, i representa un segon estadi de socialitzaci lingstica de caracter instrumental i tumb ideologic. Hi ha, per tant, una alfabetitzaci primaria que capacita per emprar les lletres i el nmeros, en constextos de reluci interpersonal o impersonal. 1 tamb hi ha alfabetitzaci en la maduraci receptiva i productiva de missatges periodstics, iconografics, cinematografics o informatics.

Els usos de la lIengua Es diu, amb fonament teoric, que els mitjans de comunicaci massiva apliquen uns llenguatges especfics, el coneixement deis quals resulta imprescindible per ser un interlocutor competent. Aix, l'exercici del periodisme demana un domini del registre escrit i deis formats especfics en que es manifesta: editorial, cronica, noticia, reportatge, ressenya, anuncis... 1 el seu llenguate consta de paraules i altres recursos tipogrMics i grMics, cOJ'n ara la presentaci, la ubicaci relativa dios el diari o les il.lustracions. El mateix es poI dir del llenguatge de la radio, el cinema o la televisi, en el sentit que la comunicaci que estableixen aquests mitjans esta supeditada a unes formes expressives mol determinades i exigents, almenys quant a formaci tecnica. L'ensinistrament deis alumnes en aquesta realitat mediatica, igual que succeeix amb I'alfabetitzaci primaria, fa observar els requisits formal s deis

PERSPECTIVA ESCOLAR

207

Mass

media

a I'ensenyament

./"""

respectius conscient,

registres i incorpora un coneixement intencional i avaluatiu.2

estrategic:

planificat,

Per a acceptar el terme de llenguatge referit als esmentats mitjans cal afegir que aquest s un concepte figurat, que reuneix elements lingstics, instrumentals i economics. Sn elements lingstics i expressius la combinaci de text, imatge i so. Sn instrumental s i tecnologics els recursos de gravaci, impressi i difusi. 1,en darrer lloc, pero no pas amb menor importancia, hi ha el factor economic i sociologic, en el sentit que els mass media constitueixen uns sistemes industrials de comunicaci i de construcci o conformaci de consciencies. Doncs b, les practiques escolars en els llenguatges poden i han de copsar aquests tres vessants, tot i que difcilment podran recrear-los tots ni falta que fa. S que cal destacar, pero, que el vessant lingstic s prou ric com per mereixer els millors esforyos, ja que demana el domini deIs registres, el lexic i les frmules canoniques o els criteris d'argumentaci i demostraci. De tot aixo se'n diu l'estil. L'estudi i l'aplicaci deIs estils deIs mitjans de comunicaci conformen la part ms atractiva d'aquesta realitat, si deixem de banda un altre captol fonamental com s la formaci professional. Tanmateix, no ens podem sentir satisfets amb aquesta aproximaci lingstica als mass media perque no justifica plenament el seu estudi ni ens adreya vers una aplicaci significativa. Quines son les seves mancances? La principal consisteix a creure que les estructures i els procediments formals sn l' expressi ms alta del coneixement, quan la seva funci s purament instrumental. Dit d'una altra manera, a la vida quotidiana no ens importa elllenguatge sin el missatge, perque elllenguatge s abstracte i el missatge s la seva actualitzai en situacions comunicatives. Per tant, si posem l' emfasi en el sistema o en el llenguatge, podem quedar reclosos dins un espai insUficient, depauperat. Pero no sn aquestes les tendencies educatives endegades i presentades aqu, perque s'interessen pel que sn activitat i comunicaci: els discursos. EIs discursos publicitaris a televisi, els discursos informatius a la premsa o els programes de confidencies a la radio, per exempie. Aixo implica concebre els mitjans com a formats tecnologics destinats a comunicar. Aixo implica tamb, d'acord amb la pragmatica, que no hi ha enunciats correctes o erronis sin adequats o

....

"

2. MONEREO, CASTELL, CLARIANA, PALMA, PREZ. Estrategias de enseanza y aprendizaje. Barcelona: Gra, 1994.

inadequats a la situaci comunicativa de cada caso Aixo comporta, finalment, l'assumpci del fetque no hi ha practiques interpretatives o productives tara d'un context, unes pressuposicions i uns objectius deIs parlants. Enconseqencia, l'estudi deIs llenguatges comunicatius s la part sintactica de I'activitat, que resulta molt valuosa quan es connecta amb la dimensi pragmatica o d'usos de la llengua. Esbrinar les pressuposicions o els objectius que impulsen un discurs o els actes dialogics que s'hi realitzen permet centrar la nostra atenci en els recursos emprats i en els efectes. Un proposit, el de la consciencia persuasiva, connecta a ms els factors lingstics amb el de la indstria de la informaci. El proposit o principi la consciencia persuasiva posa de manifest la relaci etica entre els parlants, segons la seva consciencia o advertencia de l'abast persuasiu del missatge.3 Aquesta consciencia inclou, a ms de la comprensi de l' enunciat, el reconeixement de les estrategies i mobils desplegats pel parlant o pel mitja de comunicaci. Quan el destinatari no n's conscient es dna una relaci eticament blasmable, perque I'emissor t una condici industrial, amb uns avantatges tecnics inherents que els alarguen una gran autoritat i els tan ms poders i ms penetrants socialment.

de

3. REBOUL, livier. La rha torique, Pars: Presses Universitaires de France, 1984. L'autor distingeix quatre relacions etiques en el discurso A) Consciencia compartida entre els parlants respecte del missatge persuasiu, com passa en la instrucci escolar. B) Predomini de I'emissor, en els missatges publicitaris. C) Perspicacia o advertencia del receptor, pero no pas de l'emissor, en les relacions entre psicoleg i consultant o b en la lectura crtica que fa un investigador. C) Inadvertencia deis interlocutors, en les manifestacions ideologiques.

PERSPECTIVA ESCOLAR

207

Mass

media

a I'ensenyamenl

El cas de la consciencia

persuasiva

4. Sobre la independencia relativa del quar! poder, Rafael Snchez Ferlosio eseri u: Ese dedo que escribe anticipadamente en el aire a ocho columnas, ese dedo que puede permitirse escribir con su vuelo invisible en la primera plana del aire invisible del despacho oval el noticin que al amanecer del da siguiente aparecer a ocho columnas en la primera plana de todos los peridicos del mundo, ese dedo es de verdad el cuarto poder, no los diarios que registran su decisin o sus palabras. (Vendrn ms aos malos y nos harn ms ciegos, Ed. Destino). 5. El lugar que ocupa la mujer en la noticia es la del nmero eventual (im-

Si considerem com s'aplica el principi a la premsa escrita, observem que es donen situacions en que els interlocutors sn conscients del missatje persuasiu, s a dir, deIs seus efectes comunicatius. Aixo succeeix quan el diari o la revista desplega mecanismes de pedagogia de la informaci, de manera que identifica les seccions de notcies i les d' opini, estableix uns descriptors elementals i ordenats en totes les informacions (qui, que, on, quan, com, per que, amb que) i fomenta una alternan9a o,la il.lusi d'alternan9a en la possessi de la paraula (cartes al director, rectificacions, concursos). Una segona modalitat de relaci, des de l'assimetria, consisteix en el fet que noms l' emissor s conscient de la for9a del missatge, i que denominem de predomini de l'emissor. La propaganda i la publicitat extreuen baila part de la seva influencia d'aquesta relaci enganyosa, generalment disposada en dos plans, el del misssatge aparent i el del misssatge ulterior. A la premsa s'aprecia aquest tomb assimetric en les agendes temiHiques de l'empresa editorial, quan s'insisteix particularment en certes qestions, o en el tractament descurat, si no interessat, de certs afers. L'interes de les practiques de producci comunicativa radiquen a assolir una perspicacia de lector, a ser capa9 de discernir abusos deIs mitjans de comunicaci i a assenyalar de quins procediments es valen per fer abusos discursius. Val a dir que en nombrases ocasions la mateixa empresa de comunicaci no s conscient de la codificaci persuasiva deIs seus missatges perque actua com la majoria de les empreses.4 Aixo succeeix amb discursos racistes, xenOfobs, sexistes o tecnolatres. Resulta curis, per no dir lamentable, observar com es classifiquen determinades notcies i quines associacions els atribeixen una interpretaci subjacent. En els res diversos apareixen delictes comesos per immigranls, els quals sn identificats per la seva' nacionalitat, i queden relacionats amb narcotrafic, marginaci, il.legalitat, violencia i problemes d'ordre pblic, mies integristes o practiques culturals aberrants. En les mateixes pagines es donen notcies judicials d' agressions a dones, amb relats pretesament expositius, tot i que afalaguen !'olda maliciosa amb ressons pornografics.5 Aquests clitxs ideologics passen desapercebuts, ja que es tenen pel relat de la veritat mateixa, tan natural com sembla per la for9a del costum.

.....

Analisi

crtica del discurs

Una lnia de treball en mass media, la de l' analisi crtica del discurs,6 consisteix a fer una lectura atenta deis discursos, no tant per desenvolupar un paper poltic -que aixo s una opci personal i associativasin per esbrinar els procediments pragmatics i retorics que intervenen en mediacions de predomini de l'emissor industrial o d'inadvertencia ideologica. Per il.lustrar aquest marc de treball volem mencionar el cas d'un operador britanic de borsa, Nick Leeson, presentat a la premsa sota un formal de narraci serial i que constitueix un exemple d'infracci de la maxima pragmatica de veracitat o, dit sense tecnicismes, de manipulaci informativa. La fallida d'un gran banc, amb unes perdues fulminants de cent cinquanta mil milions de pessetes, s recollida a les pagines economiques -i no pus a les de societat i fets diversos- i alllarg de set mesas apareixen breus notcies sobre la culpabilitat, fugida, empresonament i condemna del broker Leeson. Aquests sn els titulars d' algunes de les notcies, recollides del diari El Pas: El Banc d' Anglaterra interv Barings davant la impossibilitat d'aturar la seva fallida (27.02.95). El Govem britanic ordena investigar la crisi del banc Barings. Un 'operador deshonest' provoca la fi d'una entitat centenaria (28.92.95). El yuppy que va enfonsar un banco Els 28 anys d'un operador han bastat per arruinar dos segles de banca (01.03.95). La premsa denuncia la desaparici de documents del Barings (10.03.95). El Govem britanic i el Banc d' Anglaterra culpen el Barings de la seva crisi (19.07.95). Leeson reconeix la seva culpabilitat en la- fallida del banc Barings (11.09.95). Aqu tenim una historia, que s' inicia amb un esclat descomunal -va afectar l'economia i les divises del mn-, aporta una explicaci entenedora d'una cosa tan complexa i fosca com un delicte continuat en el mercat de futurs i derivats -hi ha un sol culpable-, menysvalora indicis que apunten que l'explicaci s falsa o una simplificaci abusiva -documents robats i informes incriminatorisi que acaba amb un veredicte de culpabilitat que

ms por su posicin ordinal en la accin criminal de la que fue vctima que por el grave hecho de haber sido vctima): Hallada la vctima nmero]9 de un asesino de prostitutas (La Vanguardia. 25.12.91). (Natalia F~rlHl1d~/., Los ",edios bajo la lupa, a Fempress, gener de 1994.) 6. Treballen el tema de l'analisi crtica del discurs Teun A. Van Dijk, Teresa Velzquez. Luisa Martn, Natalia Fernndez, Rulh Wodak o Koenraad Geldof, entre molts altres.

PERSPECTIVA ESCOLAR

207

Ma..

media

a I'ensenyament

'"

restitueixi l' ordre infringit. Cal consultar el contingut de les informacions per comprovar l' exactitud de la tesi indicada, tot i que ja amb els titulars coneguts s'aprecien infraccions retoriques, com les de comparar l' edat de l' empleat amb la de l' entitat i atribuir als 28 anys de Leeson una capacitat destructora, perque en aquests enunciats destaca la irrellevimcia d'una associaci i d'una relaci de causa i efecte. Per acabar, volem recordar unes paraules de Neil Postman, que plante gen de nou la conveniencia d' entendre i treballar entom deIs mitjans de comunicaci massiva de manera crtica, activa, creativa: Entendre la paraula escrita vol dir seguir un pensament, la qual cosa requereix for<;:apoders de classificaci, de fer inferencies i de raonaments. Vol dir descobrir mentides, confusions i generalitzacions exagerades, detectar mals usos de la logica i del sentit com. Tamb vol dir pesar idees, comparar i contrastar afirmacions, connectar una generalitzaci a una altra. Per fer aixo, s'ha d'aconseguir un cert distanciament de les paraules en Si.,,7. Un distanciament de les paraules i de qualsevol missatge mediatic. L'excel.lencia del receptor, en darrer terme, no esta lIigada tant als seus encerts d'interpretaci com al fet de no ser indiferent, de no ser un consumidor o un emissor a qui tant se li'n dna. Per assolir aquesta pretensi pot fer molt i mol un altre mitja de comunicaci de masses, no esmentat fins ara, tot i que genera una socialitzaci qualificadssima i busca una formaci crtica o de consciencia retorica deIs interlocutors. Aquest mitja s l' escala.

7. POSTMAN, (1985), Divertim-nos fins a morir. Els discurs a l'poca del N. show-business, Barcelona: Llibres de I'ndex, 1990 (p. 69).

~f'r

It

'!'!

,.

"....

" ,-...

-, /~

./"

f ",.';: -..

- ~

\~\

'L

,.

Encadenar conocimientos
DICCIONARIO ENCICLOPDICOILUSTRADO VOX Cols Gil, J. (dir.) Bibliograf, Barcelona, 1995 (1.600 pp.).

ocas veces es tan cierto como en esta ocasin el tpico que afirma el poder de la informacin y la diversidad de sus usos. En un solo volumen, que contiene ms de ochenta mil entraI das, el Diccionario EnciclopdicolustradoVox pone a disposicin del estudiante un instrumento asequible y prctico de consulta lxica y de trminos de referencia usuales. Tambin cuenta con tres mil fotografias, unos quinientos cuadros, esquemas, ilustraciones y mapas, as como con un extenso apndice cartogrfico. Su composicin, clara y fluida, hace fcil y amena la bsqueda. La redaccin es sinttica y selectiva. Las entradas de lxico dan cuenta de acepciones y locuciones, categora gramatical, el registro de uso y, en algunos casos, la etimologia; es decir, ofrecen informacin suficiente. En su conjunto, el tono y el fondo de los contenidos enciclopdicos concuerdan bien con la funcin escolar delli-

]p

bro. Adems, la com ilacin es e9uilibrada, coherente, en consonancia con er carcter didactico del texto. Tambin se apreciael esfuerzo de actualizacin en algunasentradas y la carga deformante de cierta tradicin en otras. Con todo, una lectura parcial y provisional -como la ma, movida por lo lingstico- puede captar que el diccionario organiza un inventario apropiado de conocimientos universales bsicos. Los trminos locales y la restriccin de americanismos son dos referencias elocuentes del punto de vista adoptado y de suslimitaciones. Por ello cuesta entender la presencia de entradas innecesarias o discutibles, como mujercilla o mujerzuela (mujer de poca estima y porte) y hombrecillo (diminutivo de hombre), de cuya comparacin se extraen consecuencias obvias. No estara de ms revisar crticamente reminiscencias sexistas y racistas, como las que aparecen en lasentradas mujero gitano,por ejemplo. O, en otro campo, adaptar la cartografiacontinental a una escalareal (proyeccin Peters, 1974). Tambin se echa de menos un ndice de cuadros temticos y tablas gramaticales. Por ltimo, como se trata de una obra viva y perfectible, cabe sugerir que podran incluirse datos profesionales sobre redactores y asesores para afianzar la imagen de solvencia de la obra.
Xavier Laborda.

/ 98 Cuadernos ePedagogaN.o261/ Septiembre d

~B R o s

Contra la impunidad de los medios


PUBLICIDAD:MANIPULACiN o INFORMACiN Reyzbal, M. V. San Pablo, Madrid, 1996 (183 pp.). TELEVISiNY AUDIENCIAS Un enfoque cualitativo Orozco, G. Ediciones de la Torre, Madrid, 1996 (207 pp.).

uestro comentario est dedicado a dos obras muy provechosas que tratan de la comunicacin mel. diticadesde una ptica educativa. Una versa sore publicidad, un gnero ubicuo. La otra, sobre la tela :vision, medio con mayor repercusin pblica y, pael Idjicamente, menos permeable. el Apesar su ttulo esquemtico, PlIblicidad: de lIIalliplllainoinjormacil1,Mara V. Reyzbal, es un libro que de

\J

:hye unadisyuntivatan engaosa,pues propone un ercicio e documentacin y anlisis sobre los proced imlentos e produccin, recepcin e interpretacin de d

publicidad, para propiciar receptores competentes y jcidos. contenido nos conduce por los conceptos y El bsicos,los agentes, el mensaje, los medIos de 1odelos Ilusin, lacuestin central de las estrategias persuasiaslas y repercusiones ideolgicas, para acabar finalmete

con una propuesta de trabajo en el aula especfica y, a la vez, flexible. Reyz:bal ofrece una obra sinttica y rica en informacin, esquemas, anuncIos de prensa y sugerencias pedaggicas en cada captulo, si bien el conjunto se resiente de una redaccIn seca, de dosier, y de las limitaciones de un tratamiento gennco. Por su parte, en Tr/Cflisill ' alldicllcias,Cuillel1llO Oroz) co propone un lcido y brillante discurso de comprensin del fenmeno televisivo y de su interaccin con la audiencia. De las dos partes que componen el texto de Orozco. la primera desarrolla los conceptos y 1asobservaciones que describen a la audiencia como conjuntos socIales coherentes, activos y creativos, aunque limitados por mediaciones o instancias culturales. La clara exposicin de todo ello conduce a una segunda parte, centrada en la educacin televisiva de la audiencia, en la que destacan la idea de organizar asociaciones de audiencia y el acertado anlisis de programas infol1l1ativos a partir de epgrafes y aforismos como muchas noticias, poca nformacin, noticias vemos, nociones no sabemos y alLla guerra, aqu la paz. ' E] inters de estos libros radica en que conciben la educacin como una fol1l1ade accin cultural y poltica para responder al desafio de la homogc neizacin y la lmpu ni- . . dad con que pueden actuar !Ol1l1atos publicitnios y medios de difusion. Xa/lier Laborda.
.

PRJMERAS~CIAS
Nmero 152 I Precio 650Ptas. Enero I Febrero 1998

I
I I

LewisCarrollentresconceptos: fiesta,uegoy smbolo j


Cuadernos de Cine y Educacin Tema del mes:
I

Gua Didcticade

TEATRO INFANTILY JUVENIL


CENTRO DE COMUNICACIN

"La llave mgica"


y PEDAGOGA

LITERATURA

INFANTIL

JUVENIL

23

ENTRE LIBROS Aniversario

Lewis Carroll en tres conceptos: fiesta, juego y smbolo


Xavier Laborda*

a fiesta, ese tiempo de conmemoracin del que nos valemos los lectores

para reencontrarnos como comunidad, nos rene este ao de 1998 en torno a las obras de Lewis Carrol!. Recordamos el centenario de su desaparicin y, con este motivo tan circunstancial y quiz fetichista, nos damos cita en la lectura de sus pginas. Con ello se procura homenaje no tanto al autor como a los vivos, que somos todos aquellos que nos emplazamos a superar el gozo de la lectura individual para fundimos en el grupo que festeja su aficin.

Celebramosla memoria del dicono y profesor que muri en un 14 de enero de 1898,en la poblacin inglesa de Guilford (Surrey). Iba a cumplir los 66 aos y su autntico nombre era el de Charles LutwidgeDodgson. Fue el tercero de los once hijos del reverendo Charles Dodgson y de FrancesJane Lutwidge.Y su fama perdura como autor celebradsimode las aventuras maravillosasde Aliciao de Silvia y Bruno.
El xito de sus narraciones y adaptaciones teatrales le permitieron renunciar tempranamente, en 1881, a su plaza de profesor universitario de matemticas en el Christ Church College de Oxford. Para entonces ya haba publicado las dos Alicias, la del pas de las maravillas (1865) y la del espejo (1872), yel hermtico relato en verso La caza del Snark (1876). Despus dara a la imprenta un ensayo tcnico, Eljuego de la lgica (1886), as como dos Alicias ms. Una fue la edicin facsmil de la versin primera e indita de Alicia, Aventuras subterrneas de Alicia (1886), que reproduda el manuscrito -ilustrado por el propio autor- con que obsequi a la nia

AliciaLiddel!.A la publicacinde esta proto-Alicia le sigui una versin adaptada para lectores infantiles, Alicia para pequeos (1989).En dos entregas ms, Carroll cerr su produccin con una novela en que aparecen nuevos protagonistas, y cuyos nombres dan ttulo al texto, Si/via y Bruno (1889y 1893).Se trata de una novela de difcil clasificacin,en la que el autor quiso plasmarsu aguda capacidad creativay una slida formacin en filosofadel lenguaje.No logrdespertar el entusiasmo con que se aclam los textos precedentes, per s tuvo el mrito literariode dejar perplejos a los admiradores de su fantasa, presos quiz como estaban del fascinante mundo de la reina de corazones, HumptyDumpty-Tente Tieso o Zanco Panco, en dos versiones en castellano- o el caballero blanco.

SMBOLO PLENO,SMBOLO ESQUIVO


Solemos buscar en la vida del autor el sentido de su obra, las claves de su creacin y el secreto que vincula al autor con sus criaturas. Pero en vano nos afanamos por ese camino interpretativo, pues slo hallamos indicios preparados. Reconocemos la figura del autor o, al menos, ciertos rasgos suyos en algunos de sus personajes, como la timidez profe.. soral del pjaro tartamudo o la nobleza y fragilidad del caballero blanco (de "suaves ojos azules y cara bondadosa"). Y, en efecto, es razonable creer que estos seres son trasuntos del autor, cuya ambicin le llevara a confundirse con criaturas de ficcin y a tener la fortuna de superar en y con narraciones la terrible mortalidad nuestra. En las narraciones es personaje. Con las narraciones es voz, perspectiva de autor.

24

LITERATURA

INFANTIL

JUVENIL

Ahora bien, no slo Carroll se introduce en la ficcin sino que tambin la ficcin se cuela en el mundo de las vivencias y realidades materiales. Veamos una muestra de esa manufactura del tiempo vivido por el sujeto -Dodgson- como artificio memorialista de una tarde tan original que en ella tuvo su primera existencia Alicia:

"Largos aos han transcurrido desde aquella 'dorada tarde' que te hizo nacer, pero puedo recordarla casi tan claramente como si hubiese sido ayer; encima, el claro cielo azul, debajo, el acuoso espejo; la barca, derivando perezosamente en su camino; (u) y las tres anhelantes caritas, vidas de noticias del pas de lafantasa y a las que no podra contestar con un 'no;' 'cuntanos una historia, por favor; salido de sus labios tena toda la inflexible inmutabilidad del Destino."
En este pasaje recoge el autor las sensaciones de una remota tarde del 4 de julio de 1862, durante un paseo en barca por el Tmesis que baa Oxford. Que los recuerdos sean claros, como proclama Carroll, y que su bosquejo narrativo tenga intensidad, no ha de hacemos olvidar de qu estn hechos los textos historicos, sean ensayos cientficos o escritos auto biogrficos. Unos y otros son escritura narrativa que pretende presentar y valorar ciertos acontencimientos. Son, pues, construcciones ideolgicas que coinciden en todo con los cuentos o las novelas, salvo en que estos ltimos tienen por meta la ficcin. Nuestra observacin solo invoca el canon de la historiografa contempornea, segun el cual la historia nunca dice la realidad del pasado sino que la hace y la brinda a lo dems. Es obvio que Carroll no inventa esa "dorada tarde". Simplemente establece, en primer lugar, que aquella tarde fue y, depus, cmo fue. Su relato verdico comporta operaciones discursivas como la categorizacin -la dorada, la tarde primordial- y la seleccin y relacin causal de hechos, con una libertad narrativa evidente. No se menciona en la explicacin de Carroll, ni parece preciso, la presencia del reverendo Robinson Duckworth, como tampoco se menciona cmo surgi la idea de dar un paseo con las tres hermanas Liddell, las nias Lorina, Alice y Edith, las hijas del decano de Christ Church. Conocemos estos detalles por el propio Carroll, adems de por otras fuentes. Si insistimos, sin embargo, en este pasaje es porque en l se resume un malentendido. El malentendido de la biografa como medio capaz de desentraar una realidad que no aparece en la superficie del texto. El malentendido del relato autobiogrfico como un compromiso con los hechos y el azar. El malentendido de Carroll como Dodgson y viceversa. Por qu? Porque el solcito profesor de la dorada tarde, el amable acompaante de las nias, el narrador que no tiene otro remedio que concebir un cuento pa-

ra un pblico tan entusiasta, es un personaje ms de su produccin. Existi su referente, es cierto. Tena rostro, como atestiguan las fotografas en que aparece; algunas de ellas han pasado a ser su retrato oficial por la expresin de ensoacin y romntico abandono que exhibe. Era profesor competente, como se desprende de sus acadmicas publicaciones en lgica y geometra (Compendio de geometra algebraica plana, 1860). Y tena la aficin de entretener a las nias, adems de fotografiadas, a veces, segn su propia expresin eufemstica, "vestidas con nada" Cdressedo/ nothing). En suma, lo que cuenta es que las facetas de ese personaje combinan muy bien con la inventiva disparatada de las obras carrollianas y de su sugerente inversin de lo que significaba la sociedad victoriana. No obstante, un examen ms crtico de la personalidad de Dodgson revela apectos que no cumplen con las expectativas que nos habamos forjado.As sucede con la lectura de su diario del viaje que realiz a Rusia! en el verano de 1867, en compaa del reverendo Henry Liddon. En esas pginas personales plasma las impresiones de dos meses de visita a Europa central y Rusia. Son comentarios de un viajero atento y culto, pero tambin de alguien perfectamente victoria no y predecible, todo lo cual nos lleva a un nuevo sujeto, el del ingls conforme con su cultura y su experiencia.

Lewis Carron.

LITERATURA

INFANTIL

JUVENIL

25

(~Excelente lugar para el Snark!, y lo digo por tercera vez, Recordad, todo lo que os diga tres veces es siempre verdad. "
La temeridad de los marineros radica no slo en su penosa misin, sino tambin en que se han confiado a un capitn inepto en su oficio y de discurso necio pero eficaz: la repeticin de un concepto suele ser muy convincente, como muy bien demuestran las prcticas en propaganda y publicidad. La estulticia de! capitn es lanzarse a una tarea seductora y esquiva con la ayuda de una tripulacin desmaada, formada por un limpiabotas, un empleado de billares, un castor humanizado, un carnicero y otro sujeto ms que haba olvidado su nombre y sus pertenencias y vena de repostero, si bien slo saba preparar tarta nupcial. A la postre, e! repostero es quien halla al bcham y fatdicamente se desintegra, se desvanece para siempre. Y as Carrollpuede colocar e! ltimo verso del poema: "Fortbe Snark /Vas a Boojum, you see" ("pues el snark era un bcham, como bien suponis"), que es el primero que se le ocurri y, para darle algn provecho, tuvo que tomarse la molestia de componer ciento cuarenta estrofas ms. Todo un capricho, si, como afirma e! autor, tal verso no significanada de lo que l sea consciente. Y he aqu otra ocasin -iba a desaprovecharla?- en que Carrolldescribe un brillante paisaje estivalcomo escenario taumatrgico de su intuicin:

---,'lo (!]
El Conejo. IInstracin de John Tenniel

UN CANON LLAMADO CARROLL


Cuando descubrimos que nos hemos salido del personaje, dejamos con aprensin unos papeles que han sido pergeados por la misma mano pero con una funcin distinta, privada, y un valor muy inferior. Y nos sumergimos en algo propiamente literario, es decir, en el arrebato de una ficcin tan oscura, incluso tenebrosa, como La caza del SnarkZ o tan elaborada como Slva y Brun03. Abrimos los volmenes que tenemos sobre la mesa y copiamos algunos prrafos, sin tener que esforzamos por hallar ejemplos de su genuino modelo, del canon carrolliano, en el que sobresalen dos factores afines, el humor incongruente y la lgica del sinsentid04. Veamos una de estas muestras. Con los siguientes versos arranca el relato de La caza del Snark. Describen el desembarco de unos temerarios marineros en tierra de snarks y, quiz tambin de letales buchams:

(~Excelente lugar para el Snark!", exclam el capitn, a la vez que desembarcaba con sumo cuidado a su tripulacin: ensortijando los cabellos de cada marinero en su dedo, les pona fuera del alcance de las olas" (~Excelente lugar para el Snark!'~ repiti,como si esta sola frase debiera estimular a la tripulacin.

El sombrerero. Ilustracin de John Tenniel

26

LITERATURA

INFANTIL

JUVENIL

La Reina, Alicia y la Reina Roja. Ilustracin de John Tenniel.

"Caminaba por una ladera, solo, un luminoso da de verano, cuando se me ocurri un verso, un nico verso: Pues el snark era un bucham, como bien suponis. Entonces no saba lo que significaba, ni s ahora lo que signiflCa,'pero lo anot. Y, algn tiempo despus, se me ocurri el resto de la estrofa, de la cual el verso mencionado result ser el ltimo. y as~ paulatinamente, en momentos de ocio de los dos aos siguientes, el resto del poemafue encajando hasta completarse, y la estrofa en cuestin fue la ltima. " Con su relato del origen mundano de la obra -mundano, pero luminoso y evocador-, el autor acrecienta su aura y brinda un nuevo guin literario en que figura como protagonista, Se ofrece como un personaje ingenioso, ocioso, feliz", Quin podra reprochar a este personaje adorable que se relacionara con otros del mismo mrito? Por ejemplo, la pareja de nios Silvia y Bruno, que aparecen en este dilogo de la novela homnima: ... Y Si/via est... un tanto as de triste! - 'Cunto de triste?-pregunt con malicia. - Tres cuartos de yarda -repuso Bruno con perfecta solemnidad...

Pertenecen estos nios a un mundo plenamente empirista en que importa mucho tomar las medidas de las cosas, aunque sus instrumentos nos parezcan inapropiados: - Para qu quieres ese ratn? -dije-, Deberas enterrarlo, o bien tirarlo al arroyo. - Pero si espara medir con l! -exclam Bruno-, 'Cmo medira usted un jardn sin un ratn? Hacemos cada macizo de tres ratones y medio de largo por dos ratones de ancho.

y podramos seguir con muchos otros personajes. Forman una amplia galera, Asque, si hubiramos de centrar nuestra atencin en uno, en aquel que resumiera su mundo ms risueo y solar, esa sera Aliciaen una tarde de verano.Y esa podra ser la Aliciaque describe Carroll en A travsdel espejocon trazos delicados y melanclicos: "Alicia se olvid de todo (...)mientras se inclinaba, apoyada sobre la borda de la barca, las puntas de su pelo revuelto rozando apenas la supeificie del agua... y con los ojos brillantes del deseo iba recogiendo, manojo tras manojo, de aquellos deliciosos juncos':
La sensualidad de esta escena, que nos devuelve a aquella "dorada tarde" del paseo en barca con las hermanas Uddell, expresa los valores de smbolo, juego y fiesta que establece el ca-

LITERATURA

INFANTIL

JUVENIL

27

non caITolliano.Es juego por el exceso de lo arbitrarioy el placer de lo que no tiene otro objeto que su propio y gratificantemovimiento. Es smbolo por la posibilidad que concede al lector de reconocerse en lo ajeno de esos mundos del otro lado de la madriguera o del cristal, y de reconstruirse como identidad nueva, ms flexibley mejor humorada. Y es fiesta porque, como sucede ahora, en esta efemride de 1998, la obra de CaITol1 une y nos nos separa. Laseparacin opera con respecto del tiempo noITnal y del mundo ordinario, es decir, del trabajo y el penoso orden de las necesidades, Launin afecta a la comunidad de lectores, convocados en esta fecha como gozosos participantes en una celebracin simblica y lclica que proclama una presencia, la de las criaturasde Cacrol1, sus hazaasy sus.impecablesuegos16con j gicos5, Como exclamara el capitn que va en pos de la quimera del snark, saludemos nuestra suerte con un brindis formalmente verdadero, es decir, repetido tres veces: Excelentemotivo para una fiesta!Excelentemotivo! Excelente!(Algose est desvaneciendo, como bien suponis.)

Ma.,carll (Barcelona, 1982, a cargo de M. E. Fn/tos y X. Laborda) (Madrid, 1982, realizatla por Loopoido M. Panera). 3 Se dispone tk la excelel!te edicin crtica de Siloia y Bnmo

y ediciones de Santiago

I.ibertarias Santerbs

(Madrid, A/laya, 1989, 496 pginas). En ella advierie el traductor sobre ciertas asperezas tipogrficas del original: "He CO1lSertJatla, aull parecil/dome en muchos casos i1l1/Rcesarias, cferias peculiaritlades absolutamente Santerbs comn caligrficas: excesivoe palabm, y frases en letra cursiva, y signos tksgarbada mayusculas inicialEs Ymiade eIlun conoci/J1.lelvea ser gratuitas, entrecomi/lados de admiracin" que al parecer y mellguanlos

que ese nfasi."

que hoy se /lOS antoja medios

desmesurado,

era mO/1Rtla corriente

gran sector de la literatura ahora, miellto.., tk tipografa

de su tiempo '; una moda

l., que aumelltanlos y composicin

i/iformticos

de edicin

4 Sobre esto.., ra.'gos tkl estilo tk Carroll potkmos


10.., iguientes artculo..,: jatJier M. Lalando, s 'A ambos la obra de ficcin de Carrol/'; en c.f. ij., 22 (noviembre "Carroll versus Dalh: dos concepcio/les 5 Nuestro salwlo cipaks llimla, como lajiterza (refiesta de humor e-' tan esquemtico Tenniel- nla.'

leer U/laS conclusiO//Rs

muy claras eIl

latlas del espejo: ciencia y disparate en de 1990) 54-62. Lucia-Pilar CanceklS, de 1997) 19-26. menciona cosas tan j1nerl la obra carro-La Caza del S/Iark-

'; en c.f.ij., 97 (septiembre qt.IE ni siquiEra

{re las tlustracion!'-,

y la imjJrO/lta de los dibujallles dos Alicil.'-, HeIlty Holitlay

como es el caso de]ob/I

y Harty /'lml." -SUvta y IJnmo-. llevando este Ctlho grajlco hastq nuestros dl{.', prxtriamos Incluir tmlx1j1l\' que rom'{I11 el mI mdo do C(l11'{)I~como ell kl e.~/K"ICI611jtoBrt!fiCtI do (,rlrm('/a I.lobelsobre Alicia en ell'a(s {lE IllS Martloll/a, que exhiba (canlitw~ 1m montaje 1".'00 Fabra Il>ulg, 274, IJarcelona, de imager/Rs que recreaban alegrinoviembre 1997-f!1lera 1998), camellle ciertos personajes.

ObiEII, ladificilyeqrtimcaetiqt.ietatkli/Eratura cia la opacitlad ra allglo..mjona blico iIflmtil. de las bromas y satira., (re Carroll, ya sus prctica.' Un tercer{w)(!cto, educatioa., IIgadoalprecetknte,

i/1jemtil, ellelsentidodequemE<paia, ell muchos casos apegmk15 a una cultuel p-

erlla.,ediciolleserlcastellano, a/afn, VlISCO, allegoo a.,/urill1lOuesehan hecho,se aprec g q


y IIteraria.,. No son, pUES, U/laS obras para es la gran dijlcultad

{re su traducCUII,

lo cual reajl/1na la dislancia cultural e idiomtica que hay que soloenlary, a la vez, el mrito prodigioso de algunas tk elltt" a lo cual convendra dediCtlr tambil! nues/ra atellcin Por ltimo, deseamos bolo, tml superficialmente por el filsofo alemn Paids/ice-uab,1991. manijes/ar que los conceptos hermerluticos de fiesta, juegoy smexpuesto.., aqu~ estn magnfica y ditkcticamerle desam,lladm Gatlamer' (1977); La actualidad de lo bello, Barcelona,

Ha1lS-Goorg

Notas:
1 Diario (re un viaje a Rusia es un iexto de publicacin cluso entre los lectores en lengua data de 1935, y corri a caIgo CollinglVood baba reproducido ingresa resulta poco dejobn Franc/., algll1lOs parrajos relativamente recientey edicin que ininglesa edicO/lOcid". La primera Anteriormente, McDermott. el bigrtifo la primera (Barcekma,

(E<te comentario sobre Carroll ba surgido tk la iniciati1Ja de un gntpo de admiradores y estudioso.., tk su obra, entre los cuales est jordi Qtilltmla, Imma Ba, Alba CUli, Victor Lobo, Adria Lpez, alga Resines y la 'Associaci su contagio..<o ejemplo tk este artculo son tkjohn E:xperimelltem amb l'Ar!'; a quie//Rs agradezco mucbisimo Las ilustraciOlles A/laya. Tambill de aficin y entusiasmo). Termiel para '1,(/S aoellturas 1996). de Alicia " de lid.. (Emprie-"

tkl diario. Segn sabemos,

cin ca.,tellmla

tk Diario de 1m oiaje a Rusia apareci

ell el editorial Mascarn

en: 'Alicia al pas tk les meravelTes"

1983, COIl traducciolles y IlOta.' de M. E. Frutos y X. Labortla). 2 La caza tk Sllark ba tenitla diversas ediciolles el! castellano. rial mexicalla Era (1978, a cargo de la Ulalume GO/lZles),

't{lS SOIl klS tk la edif{j.. (Barcelona, 1970),

Kairs

Barcelona

Xavier Laborda es profesor de la seccin de Ling.,tica General de la Universidad de

r---

W"- -- W_U_"""

J"""', "'o"u".

~,c"c..

~'p"'v'.,

'jll<1'J,."'.'U,H'J,'.

La comunicacin y su crtica
LA COMUNICACiNVERBALY NO VERBAL Hervs Fernndez, G. Playor, Madrid, J998 (206 pp.). DICCIONARIODETERMINOS LlTERARIOS!1 y 11) Reyzbal, M'V. Acento, Madrid, J998 (94 pp. Y 93 pp.). COMPRENSiN Y REDACCiN DE TEXTOS Snchez Miguel, E. Edeb, 8arcelona, 1998 (278 pp.).

os tres trabajos versan sobre la lengua y sus facetas y poseen en comn una intencin didctica innegable. En pnmer lugar. el manual de la serie Cmo domll1ap" La wlnlmicaciI/,'l'riJa!"O o ,,<rba/, consta de cuatro secciones. a saber. la gcne-

100 CI/adcrllos deI'ed"x,!~ia Y 272!

Scpricl/[m'

..{<{q Q

rica ",b.-c qu e, la comunicacin y la, e'pccifica, dc lo verbal, de lo no verbal y, en ultimo tmno, dc lo, ,i>tema' meditico, (p.-cnsa, publicidad...). La expmicin terica es clara y efectiva, si bien la autora, Gloria Hervs, superpone conceptos de diferente origen, por ejemplo los de! estructuralismo y los de la pragmtica. En definitiva, conviene no confundir e! valor cierto de la obra con la pretensin editorial, expresada mediante e! eslogan de cmo dominar. Lo que puede ser un buen prontuario de conceptos sobre la comunicacin para alwnnos de Secundaria, no justifica, sin embargo, e! reclamo editorial de un CUrsO prctico. La autora sortea la desproporcin terica y generalista achacable a los programas administrativos con una carta de materiales diversa y til sobre los sistemas de comunicacin social. En e! camino ascendente de la reflexin, que comporta un claro dominio de! discurso, hallamos e! provechosoDiccionario dernn;,/Os lirerarios Maria de Victoria Reyzbal. La delicada tarea de seleccin llevada a cabo en la obra --<Jue cuenta con un nmero de pginas quizs excesivamente breve-- posee e! mrito de incluir entradas relacionadas con la historia de la literatura o la teora literaria y tambin tnninos propios de! mbito de la comunicacin y la retrica. Adems, su redaccin est en consonancia con e! propsito de sintesis y actualiz:cin de los conceptos escogidos, lo que convierte a este libro en una obra especfica e introductoria. Quiz se resienta mucho e! diccionario de sus propios lmites fisicos,ya que aunque se trata de poco ms que un opsculo, est dividido en dos volmenes, con e! engorro que ello supone para su uso. Por otra parte, la misma sumarsima brevedad impide a,b autora ilustrar con ejemplos los conceptos o ampliar e! nmero de stos. La comunicacin eficaz -sea sta espontnea o guiada por tcnicas y estrategias- no constituye slo una actividad, sino que tambin y especialmente comporta conocimiento, es decir, una concepcin explcita de qu significa hablar, escribir o leer, Este principio, que es bsico en los dos libros de Hervs y Reyzbal ya mencionados, se convierte en la razn ms poderosa de la obrade EmiloSnchezMiguel,Comp"'r"in y ",""ceindetextos. Desde laperspectiva de la psicologia de la educacin)' en un tono de divulgacin, e! autor expone cuestiones actuales de la investigacin sobre la comprensin lectora, entendida como una experiencia comunicativa y de aprendizaje. Tras desarrollar estas aproximaciones tericas, e! psiclogo brinda soluciones muy interesantes para la comprensin de discursos narrativas y expositivos, ascomo para la mejora de lasredacciones. En este ltimo apartado, Snchez Migue! desarrolla algunas pautas para la produccin y la correccin de las redacciones escolares en las

modalidadc, texmale> ""t" anali~,b, ~Ia na~acin y la cxpo,icin-, que cie=n un t",bajo de inve,tigacin tan sugerente como de reposada aplicacin. De la lectura de estos tres libros sobre la lengua y la comunicacin podemos extraer ideas e instrumentos que impulsen al lector, al estudiante yal docente a interesarse no slo por las estructUraS de! cdigo lingstico y sus tnninos descriptivos y categoriales -{) metalingsticos-, sino tambin por los usos discursivos ms prximos a su actividad, sean interpersonales o de la comunicacin social. Afirmar que vale la pena analz:r los usos comunicativos supone tambin decir que es importante examinar las ambigedades, las exageraciones,las contradicciones y los abusos de tales usos; ese tipo de prctica se denomina, concretamente, 'anlisis crtico de! discurso. Para concluir, pennitaseme transcribir una noticia de sucesos como muestra de un material abundantsimo, brutal y defonnante, cuyo examen convierte los conceptos relativos a la comunicacin en una caja de herramientas sobre lo real. Dice as la nota, cuyo contenido eludimos comentar aqu: La--Audiencia Provincial de Hue!va ha conde-

nado a cuatro aos de crcel, privacin de patria potestad y SOO.OOO pesetas de indemniz:cin a una mujer que arroj a su
hija de dos aos por una ventana. Los hechos ocurrieron e! 30 de noviembre de 1996 en Hue!va, cuando el padre de la nia pidi a la mujer que le tirase e! encendedor por la ventana, momento en que la madre tir a su hija a la calle, quien salv la vida porque un toldo amortigu e! golpe. (El Peridico, 26 de febrero de 1998, p. 22). Sucesos, anuncios, promesas electorales, declaraciones politicas, parlamentos de fiesta... Heaqui mltiples fomutos-<:n al>soluto anecdticos o simplesque, adems de ser motivo de espectculo, pueden convertirse en objeto de crtica y maduracin. Xavier Laborda, Proxilll",I",/"

AA, vv,: Onogr~ra"cacilI: p""dc leyendo, adrid: Playor. y a M Diez, A,: L'apr",clltatg< dcla """seriptuta 11,Barcelona Grao. Gas,ol, A, y Arnega, M,: De",..rirc/pla",dc/al"ra, Barcelona:Edeb.
Milla Lozano, F,: Actil'idad" "",il'" para Imo.""ri""', Vilassarde Mar (Barcdona): Oikos-Tau. Novak,J,: Le"guajcy """'"'/CIII', Madrid: Alianza. Ortega Ojeda,G"y Rochel, G,: "cmJ~;s",cti""",;""m"fid"'". pa,1,1,Madrid: Playor. Petruci, A,: A!faloet",o,serill/ra, ",,cd,d, Barcelona: Gedlsa. ' Rovira, E,: Le"guoy I",..ra. U"a ~rcxi" s.b~ taprctica,Madrid: Escuela Espaola. . Rueda, R.: Bi/./iolccasNola"s. Gllaparaelp"(e.""ad,'d,Ed"",,, Primaria, Madrid: Narcca. . dronog"fia paraEd..,ac.. rimaria,Madrid: EsP Villarroya, E,: Programa cuela Espaola.

~ltl[~"'..:1'HI"'"

Las didcticas especficas y su crtica


APRENDER A ENSEAR GEOGRAFIA Ca/af, R.I $urez, M.A., y Monndez, R, Oikas-Tau, Vi/aSlar d. Mar laare./ona), 1997 124app.). xiones y propuestas acerca de la geografia, la historia y otras cienms sociales en lasaulas. Tal situacin muestra un puntO de inflexin y de recuperacin: los profesionales de la docencia y la divulgacin estn avanzando; y, por otra parte. se est produciendo un aumento de las expectativas y demandas sociales con respectO a las humanidades. En cualquier caso. el entOrno didctico y divulgativo de las CienCIas soCIaleseSt:;creCIendo y esto, en si mismo, resulta ya positivo. p'lesto que el corpus de reflexIn y expenencia didctica comienza a ,,'r conSlderdolc.

a didctica de las ciencias sociales haoa sido, hasta ahora, un rea de COnOCID1Ientoon escasa produccIn de bc bliografia cientfica. En los ltimos aos estamos asistiendo, afortunadamente, a una proliferacin de las ms diveNs refle-

11~

,el,re",I",.

.\',"272

C"",len""del'ed"g"~,,IOI

B R O, S"
LIBRO DEL MES

Relacin de un lector fascinado y desdeoso


Antonio Marinaesla sexta entrega de sus lcelebmdas inquisiciones sobre dominio~te,que rene la. ; ~~16si~titUni~PI;9S.~' YOltad~ e'lenguaje;. Elilibro \tue ,
:sentamos,retoma este";111smo npo,desdela perspectiva especIIlellenguaje,yvieite en sus capun caudal considerable de lee-

lensayode Jos

estilstico, sino un rec1amo sober)1 ,biode la atencin y iun 'PI'Qc~~.. " ,;,~epJP",~~Clzp~tl:xP<?n~rJ11~'u.l 1: ;yq\1~~~Jg~~;cue,~sellxtcoycomo'q, '1 opera,J<;91~~eJ:lte ,en la coDi- . '.P1'e qsi~ij~~l ~'~ icmo' aprende-, mos a hab~.y;a pensar, qu capaci), ,dade~,lingstic#)se ven afectadas por lesiones cerebrales, cmo lirerpretamos o confundimosJo:queco,
,

y reflexiones con una desen13 le pennite ~ar que los


',~~'a.\~1ifiaSy"'.'::,ml.,

"

, realizain,Qsal~~k.:

t()s 'm~ca1nos, o,~9~,ac ,

sim1J 1icos

-"

, "

1Iatis&cci' "
t'J!Il.

" "'oso: '';.


.,rpsta, f
"".,
"

I"":i:on " y",

,.,

. t6 es i{ YJ :.;
t), o'.;!;

t
j '.'

'traponie~49;. ' "~ . ~ "

- de f "I#:apq
,
, ..
,

posicio-

'.~
1,

"d',." '. Esci,):llii~~$i~~~ :,~laei6i'd'.' ',': :.\asthitOs'no '~~~~iistiY3:,peio,:hs i pue4eiJus~S9,,~:d,~'de 1 !(.ade\"""'~'&.tO' .Mi.Tin" "~ "YF'i"';":'~ ",'t...,,'lMSl .)r,j~.7~' , ~ .cuyo, ~~no ua~D~. ,

' "~,'"..,'ipn

. es,cientfi,

"ao:16i~3ub}i#~}-;~~~~n
los 1tilii~safi6~; ~mo se ap~ en el aparato crtico que aconipaqa la obra. Por su aspecto instrumental, la parte dedicada a las notas y los comentarios bibliogrficos puede resultar, por esa razn de envergadura y actualidad, muy atractiva. No en vano la seccin cNotasy tango bibliogrfico ocupa un tercio de la obra y cumple su cometido orientador de manera original e irreverente. Es ms, para ,quien escribe esta resea, ha supuesto la principal fuente de enseanza y satisfaccin, pues si bien el propio ensayo puede parecer a un lingista un mosaico de materiales muy diversos, el apndice de notas cuenta como un segundo libro, al modo de los reportajes Asse hizo.. .. Este diario de fuentes, que incluye generosa informacin sobre las aficionesy lasinquinas intelectuales de Juan Antonio Marina, aporta algo an ms apreciable, cual es la viva representacin de las ciencias -aqu, las que se interesan por el lenguaje- como un proyecto histrico, sometido a confrontaciones de fondo y de forma, de fortaleza de modelos y de vaivenes segn lasmodas; o, asimismo, de determinados nombres propios y de las circunstancias que influyeron en sus respectivasbiografas.As, La selva dellenguajeeleecon mucho agrado, s como un trazo --discutible, pero vigoroso- de esa historicidad y sus porfas. Xavier Laborda.

Seinte~;\a~W.. las,funpar lb. la relacin entre

,:

sentinntosel lxico que los y ltifica,las diferencias culturales nidadesognitivas en sociedac diferentes" problema de la el bd,o el deja relacin entre la dadd lenguaje, cuestiones sy queelleVan examinar diferenl a 'aportaciones 1 lingstica y de
tRIS umero~,disciplinas,como n

LA.1"'" Int,&a~' "', "",

?$~V':{:
.'

~1W

,/';;'

ci~~ti', d. ~";":"-'~:";\"jc'

intaxis,'b.ip~tica, la psico'i.ltica ,oJa,sociolingstica; pero lDinrecala.en diversos trabajos .osen el mbito de Ja antropob psiquiatra,la neurologa, la
,

:~~:J!~~~:',;J)N~!" \::"(;;;-:,., Anagrama, Bcin:el~a, 1998 " C310pp.J. '


que sorpren4~n~tnente ,afirma el editor en la coht:!:aprtada <estelibro es!ln tratado de lingstica a escala humana), rindiendo un mal servicio a la obra, que carece de la condicin de tratado, ya que no plantea un modelo al uso de la lingstica o las distintas lingsticas; adems, por ms vueltas que se le d a la expresin, resulta poco convincente hablar de ella como una ciencia a escala humana. Se habr de entender que tras este sinsentido editorial se encuentra la intencin de recordar el estilo gil y entreverado de ciertas expresiones coloquiales utilizadas, la sugerente provisin de ejemplos y ancdotas, la decidida presencia, en fin, de las marcas de subjetividad, de modo que el ensayo alcanza una expresividad que disuelve la indiferencia de los lectores y promueve la complicidad en buena parte de ellos. Este mrito innegable ha de considerarse no ya un rasgo

o]ananatologa. El trayecto
inapor una selva de anotacio-

lingsticas -de tangos bicificost, como las denominale origen y est destinado a SU [sobrela comunicacin y su acinecesaria: nuestra intelin ~rica. Lalingstica, la cienieestudia sa maravillosa creae delainteligencia humana que lenguaje, tiene tacil acomodo amplioy generoso de ~marco !etigenciatica, cometido cuyo ipal, egnel autor, es regir el s ortanento para salir bien lidelasituacin en la que estateOla e la salvacin, una teod 1, partir de la psicologa coga ,yquelibrrimamente califica Irde1ingstica personal. He meollo la escritura de Made

ienodebeconfundirse con lo

~q
Abril/N. 0279/ Cuadernos ePeda.!!o.!!{a d 101

'1

Fermn Barcel Un observador participante

1
1

--

BROS
La filosofia como tertulia
LAS PREGUNTAS DE LA VIDA Savater, F. Ariel, Barcelona, 1999 (286 p.).

un autor celebrado e inspirado, Fernando Savater, y una perspectiva, la filosofia, que ha dado a luz a la cultura occidental. Conviene aclarar de entrada que el libro se lee como si de una tertulia se tratara, o como si uno tuviera ante s la transcripcin de una amable e ilustrada disertacin del erudito Savater ante un pblico vivaz y curioso, deseoso de conocer las respuestas de la filosofia. La obra est destinada a un lector no especializado, que desee relacionar la tradicin filosfica con los problemas actuales, sean stos los de la libertad, la democracia, el conocimiento de s mismo o la actitud ante la inquietud de la muerte y la responsabilidad de la vida. El ttulo que ha escogido Savater es inequvoco, pues quiere destacar esa aspiracin del filsofo de hablar de la vida, cosa que hace de una manera amena y con unos contenidos magistrales. La obra puede considerarse como un compendio de la filosofia, pues en sus numerosas pginas el autor expone, de manera sucesiva, qu es el conocimiento y cul es el objeto de la filosofia, cmo se puede encarar el problema de la muerte y tambin qu es la verdad, la

]L Rene

aspreguntas de la vidaes una obra sobresaliente.

identidad, la construccin del mundo simblico, el universo, la libertad, el desarrollo tcnico de nuestra natural artificialidad, la vida poltica, la experiencia de la belleza y, finalmente, el conocimiento de la perspectiva histrica. A propsito de estos asuntos, cabe sealar que Savater desarrollalos trminos y algunas posiciones doctrinales de diversas disciplinas de la filosofia,como la esttica, la poltica, la lgica, la metafisica o la historiografia. Y con ello brinda un magnfico resumen de los mltiples instrumentos con los que cuenta la filosofia, y que podemos aplicar a problemas e inquietudes vigentes en la actualidad. Las ilustraciones que se incluyen en la obra provienen de fuentes tan estimulantes como la poesa, el refranero, la historia o la experiencia personal. Adems, cada captulo se acompaa de una seccin de preguntas, titulada Da que pensar..., y que puede convertirse en una gua de debate entre los lectores, por ejemplo entre losjvenes estudiantes. Precisamente, esas preguntas constituyen un hbil recurso para dar la palabra al lector, de modo que, al responderlas, se abra la reflexin a un crculo ilustrado pero accesible de contertulios. Fernando Savater ha sabido, una vez ms, dar una leccin de la filosofiacomo una conversacin vital e iluminadora de la vida. Xavier Laborda.

iB

R o si Una sencilla forma de apreciar la lectura -=,"",o.," " ," " ,;,

cada grupo de alumnos; y tambin en la redaccin de un diario de clase, la confeccin de unos apuntes, y la relacin epistolar mantenida con corres1998 ponsales de otras escuelas. Rubio Rivera divide su libro en dos partes: en la primera de ellas describe somera pero claraLengua lectura steban Rubio brinda, en Lenguay lectura:una mente su experiencia, justifica sus principios e inUnareflexindesdela prctica ,..""".-,""-,, JE reflexin desde la prctica, una sencilla forma de dica algunos aspectos rebatibles. En concreto, ca~..~. be sealar que, sobre este ltimo punto, el autor se apreciar la lectura, Expone la intencin y el desainterroga acerca de los resultados docentes de la rrollo de una experiencia que el propio autor ha desarrollado durante varios aos en el tercer ciclo de Primaexperiencia, los intereses y reacciones del alumnado, o la evaluacin de stos y de la propia experiencia. En la segunda ria y en el nivel inicial de Secundaria. Su intencin es proparte, aporta una reflexin sobre el concepto de lectura a mover las capacidades comunicativas de los alumnos, en espartir de las aseveraciones de diversos estudiosos, recoge la pecial el dominio de registros y de gneros. Para ello, el aunormativa ministerial sobre la materia en las etapas en que se tor considera conveniente acercarse a la escritura y a la lectura de un modo instrumental, es decir, como capacidades que interviene, y presenta el test de anlisis de la lectoescritura. Como se apreciar, esta parte ofrece unos materiales interese ponen al servicio de objetivos que pueden ser de inters para los alumnos, sean stos de ndole documental (trabajo de santes a la hora de juzgar la experiencia didctica en la clase de Lengua que presenta el autor. El libro consta, pues, de esinvestigacin), publicstica (diario), escolar (toma de apuntes) o vivencial (elaboracin de correspondencia). De ah que se tas dos partes, que quedan algo desligadas, como si fueran dos cuerpos afines pero independientes. No obstante, en el libro proponga una metodologa prctica, que permita al alumnalate una propuesta realista y eficaz de trabajo en el aula. Y su do iniciar el curso sin advertir la carga lectiva y teortica que pretensin no podra ser ms razonable: que los alumnos le est reservada, pues el aprendizaje que realiza le puede suministrar estos contenidos de un modo gradual y satisfactorio. aprecien los instrumentos que tienen a su alcance para vivir en el mundo, y todo ello comienza por vivir mejor la clase de La razn del procedimiento es sencilla, y consiste en adscribir diferentes tareas de lectura y de redaccin sobre un trabaLengua. Xavier Laborda. jo de investigacin relacionado con un tema escogido por

LENGUA Y LECTURA Una reflexin desde la prctica Rubio Rivera, E. Editorial Escuela Espaola, Madrid, (167 pp.).

o-

Entrevista
Miguelngel Santos Profesor e investigador

Galera e d
sentimientos y enormidades
La gran distancia entre lo que la educacin es ylo que podra ser puede medirse por las carencias en educacin emocional, esto es, en aquellos aspectos que velan por el desarrollo de la personalidad. y nos referimos alconocimiento de las propias emociones, al cultivo de la afectividad, al control de los sentimientos negativoso a la estimulacin de laautoestima. La importancia de estos aspectos no es slopersonal, sino tambin colectiva,como es el caso de la educacin transversal en valoresyen fenmenos afectivos. Como est asumido, la personalidad del individuo se desarrolla de modo provechoso si contempla la cognicin y los sentimientos. Despus de la denuncia de los excesos cognitivistas, hecha por el psiclogo Jerome Bruner en Actos de significado (Alianza, I99I), por citar un autor lcido, se ha convertido en una aspiracin de la educacin el tratar de la afectividad; as como de la consciencia y del control emocionales. Lanarracin autobiogrfica, la psicologa popular o las historias familiares son algunas formas de estudio y expresin de tales fenmenos.

DICCIONARIO DELOS SENTIMIENTOS Marina,JA., y LpezPenas, . M Barcelona, nagrama, 999, 468 pp. A 1

Jos Antonio Marina haba ya anunciado su inters por los sentimientos en La selva de11enguaje (I998), obra que recoge las consideraciones teorticas que han orientado el reciente Diccionariode los sentimientos, del propio Marina y Marisa Lpez.Ante un ttulo tan sucinto conviene aclarar cules son el objeto y la forma de la obra. Respectode lo primero,

digamos que los autores se interesan por la relacin entre los sentimientos yeluniverso lxicoen diferentes lenguas. Yelresultado es una presentacin muy interesante de la complejidad semntica que manejan los cdigos de lenguas de diferentes culturas. La hiptesis del trabajo, desde una perspectiva inequvocamente cognitivista,es que por encima de las particularidades de la selvalxicaexisten notables afinidades cognitivas en todas las

lenguas.
y en cuanto a la forma del Diccionariode los sentimientos, el lector observar al instante que la obra no se trata de un diccionario como tal, sino de un ensayo que clasificayanaliza con instrumentos heterogneos --extrados de la filologa, la psicologa, la antropologa- una tipologa que los autores presentan como universales de la afectividad. Laclasificacin consta de 22 tribus de sentimientos, que a su vez contienen diversos clanes o representaciones especficas, junto con sus trminos afines. Esta obra ofrece la oportunidad de sumergirse en una documentacin considerable y en una investigacin incipiente. El resultado, si bien irregular y pretencioso, tiene la honestidad de enfrentar al lector con la maravilla de un mundo chocante y feraz en trminos sobre los sentimientos. Es ms, la misma escritura de los autores constituye un objeto digno de estudio por la expresin de los sentimientos, el aprecio de s mismos yladivulgacinde sus certezas. Xavier laborda

--1 --

-I

CUADERNOS
,

.,
.

:~
r

.
1

-..,

_.l

, ,

'1

\ I

' lo 1.. .
:r""a

Entrevista
Gervasio Snchez Fotografay concienciasocial

LIBRO DEL MES

Esta obra de Harold Bloom ha llegado a las libreras espaolas con una presteza inusual, ms propia de la novela de xito que del ensayo literario. La razn de ello reside en que su autor es una figura que interesa y deleita porque tiene el don de .resumir con maestra las opiniones ql1eha elaborado a lo largo de toda una vida, dedicada a la lectura y a la enseanza en las universidades deYaleyNueva York.Bloom no es solamente tmprofesOrT un erudito, sino tambin un polemista desenfadado y brillante que crea doctrina a contracorriente de las distintas modas y escuelas. Elautor de El canon occidental, con cuya obra mereci la atencin de crticos ylectoresyql1e recibi juicios con'tradictorios, ha escrito esta continuacin, titulada Cmo leer y por qu, en la que desgrana los mritos de cuarenta literatos a partir deLcomelltal'io de varias de sus mejores obras. En este ellsayo se ncluye eIcolllpendio de un canon ql1eaplica Bloom a estos dilectos autores, en su mayora anglosajones, en los apartados correspondientes a gneros literarios como eLcuento, la poesa, la novela y el teatro. Un breve preludio a cada gnero, generoso en lcidas reflexiones, resarce allector que no logre congeniar con las elecciones del profesor. Y le anima tambin a conocer los comentarios precisos e iluminadores de un crtico entusiasta, que presentalostrazos argumentales yestticos de varias de las obras creadas por estos literatos. En estas pgnas, de lectura muy ligera, se halla retratada la galera de los grandes de la lteratura y, por descon. tado, de aquellos que concentran el ideal de su autor, entre los que se cuentan Anton Chjov, Ernest Hemingway e Italo Calvino como cuentistas; Robert Browning, Walt Whitman y John

CMO LEER Y PORQU

Bloom,H. Anagrama (col."Argumentos"), Barcelona, 2000 307 pp.

Mlton en el captulo de poetas; Mguel de Cervantes, Henry James o To-

ni Morrison como novelistas; y, finalmente, Henrik Ibsen y scar Wilde entre los dramaturgos. Quiz se eche en falta en la lista precedente un nombre ilustre en el terreno literario. Uno en particular, que hemos reservado para dar ocasin al lector de cubrir mentalmente este hueco. Se trata de Shakespeare, que, en efecto, aparece tambin en la seleccin de Bloom, y que es adems el nico que lo hace en dos secciones, la de poemas y la dedicada al teatro. "Ninguna introduccin a cmo leer y por qu -declara con resolucin Bloom- debera omitir a William Shakespeare, dramaturgo supremo de todos los tiempos y, sin duda, el escritor ms eminente de todas las lenguas occidentales, por encima de Dante, Chaucer, Cervantes y Montaigne." Dificilmente podr rebatirse tan fundada opinin. Mas, por si ello fuera posible, Bloom no pierde ocasin para volver una y otra vez al isabelino, ya sea para comparado con los mejores de su canon, presentar sus sonetos, o

exponer la doctrina literaria del propio ensayista. Nada resulta comedido en este ensayo, que parte del pretexto sobre cmo leer y arremete contra las corrientes que no encajan con un modelo romntico de la crtica literaria. Tambin son de sobras conocidas las invectivas del autor -que renueva aqu- contra la teora de la recepcin o las perspectivas del feminismo o del psicoanlisis. Lo importante de este legado es que Bloom se muestra coherente con su potica y que sus estudios resultan concienzudos. No hay lugar para la superficialidad en esta posicin algo atrabiHariay candorosa, porque bebe de las fuentes clsicas de Samuel Johnson y Ralph Waldo Emerson, crticos literarios del XVIII y del XIX, respectivamente, y notables ad. miradores de Shakespeare. y porque sus conocimientos son fruto de su tesn como lector y extraordinario profesor. Es posible que Elmayor mrito de la obra resida precisamente en este ma~ gisterio afectuoso del autor y su elogio sin medida de la literatura y de sus autores' por encima de la erudicin y la calidad de sus juicios, aspectos stos tambin muy destacables. Los ensayos crticos de Henry Jarnes, por citar un nombre muy querido para Bloom, recientemente pblicados bajo e1ttu. lo La imaginacin literaria en una edi. cinimpecable de Alba Editorial, recuerdan esa atmsfera envolvente y embriagadora de la tradicin clsica de la crtica. Sinembargo, a diferencia de Jarnes, Bloom aade un desenfado chocante y una simplicidad muyeficaz. Quiz su mejor consejo sobre cmo leer, de entre los pocos que dispensa -a pesar de lo que pueda sugerir el ttulo-, sea ste, relaciona. do con la actitud que debe adoptar el lector: "Cuando leemos por primera vez una obra literaria-concluye el autor-, por formidable que sea, [oo.] la condescendencia o el miedo nos impedirn comprenderla y gozar de ella". Yan aade que "todo lo que necesitamos, cuando abrimos un libro, es reducir a su mnima expresin nuestras ansias de poder". Bloom.recomienda la lectura por placer, si bien reconoce que se trata de un placer ciertamente exigente. Xavier LabordaGil

N 296CUADERNOS E PEDAGOGA D 1101

=1"=~ =00
~

noo~

I\@

~~

=00

-1"o-.

ETItrevista
Jordi Garca
El color de la escuela

Elmaestro el y aprendiz
Los autores de Los procedimientos como contenidos escolares, Juan Ignacio Pozo y Yolanda Postigo, tienen una larga lista de obras sobre estrategias de aprendizaje, algunas de ellas escritas conjuntamente. Conociendo tal historial, no ha de sorprender que este reciente libro sea una obra madura yutilisima. Y ello por dos razones. En primer lugar, hay que anotar que expone con precisin un esquema teortico depurado y a la vez simple, que consta de cinco procedimientos de aprendizaje. Se distinguen los procedimientos segn sea su funcin: la adquisicin de informacin, la elaboracin de la misma, el anlisis, la comprensin y,finalmente, la comunicacin de dicha informacin. Y, en segundo lugar, destaca la extensa y rica aplicacin de este programa didctico a las diferentes reas de conocimiento. Pozo y Postigo sostienen que estas actividades forman unos ejes procedimentales que merecen ser aplicados en el currculo de manera sustantiva, esto es, como si de contenidos de tratara. As pues, la adquisicin de estos procedimientos, como indican los autores, ha de permitir engarzar mucho mejor las actitudes y los contenidos verbales de las reas de conocimiento. El primer procedi-

1< a

f(

c c: e:

p la d ve g

LOS PROCEDIMIENTOS CONTENIDOS

COMO

ESCOLARES

h ta n n gl t

Pozo, J.I./Postigo, Y. Barcelona, Edeb, 2000 (337 pp.)

a] di Iv Cl dI ti, la

miento, que es el de la adquisicin de la informacin, consiste en aprender a observar, seleccionar la informacin (toma de apuntes y subrayado), buscar en fuentes documentales y mediticas, y usa la memorizacin. A continuacin, la interpretacin de la informacin se realiza mediante ejercicios de descodificacin, la aplicacin de modelos y el uso de ana-

cc ql hl pr ve ca tej pr di

logas. El tercer procedimiento, el de anlisis, permite comparar, realizar inferencias y proyectar trabajos de investigacin. Elloconduce al procedimiento de lacomprensin y organizacin del conocimiento, que hace hincapi en las relaciones de conceptos yen la estructura yel estilo de los discursos. Elquinto y ltimo procedimiento se ocupa del aspecto de la comunicacin del conocimiento, es decir, la preparacin de guiones expositivos,la realizacin de la exposiciny su argumentacin. JuanIgnacioPozoy YolandaPostigo hacen una presentacin documentada y tambin ilustrada con ejemplos cotidianos en la escuela y el trabajo, que hacen ms amena y clara su teora. Sin embargo, la parte ms extensa del libro est dedicada a aplicar las estrategias de aprendizaje a las reas de conocimiento de Ciencias Naturales, Ciencias Sociales, Matemticas y Lengua y Literatura. Los cuatro captulos dedicados a desarrollar de modo prctico elmodelo en las respectivas reas son una agradable invitacin a la lectura para todo tipo de docentes. Este libro, Los procedimientos como contenidos escolares,no sloexpone,sino que persuade de un modo elocuente a adherirse a su tesis central, esto es, que los procedimientos son una forma de transversalidadcurricular,una manera muyeficaz de conectar los contenidos de las materias. Ms an, que los procedimientos promueven la transformacin del aprendiz en maestro de su aprendizaje. Xavier !.aborda Gil

DE PEDAGOGIA
I

N.O323 abril 2003 6'50

' ""

'" "' '' ~'"' ' ':1 ''ffi


'~" ,r:

..-

.
17--(...)

.,

,-

,r~'.,

. ,..... ..., , .,. . . ,..

1"
~"""

=====

N M

0o

r~IlTImfiJJl1tim m. ~~
r

kmb1ll~~
Entrevista
I

00

~ i:'\ f'(ifGr
\!{tt~l [rlli.Jll=lI ~

I Jaume Martnez
Bonaf Recuperar la pedagoga de la izquierda

I~ r!1.JlnIf1l;th~lJ(~

~J'~

GJ

mDt~

LIBRO DEL

MES
Una propuesta didctica sobre la narracin
Intercambiar vivencias y rel'onocerse en la esrritum

Francisca Prez

En ellibro Unapropuesta didcticasobre la narradn, de Francisca Prez, hallamos un programa detallerliterario. Se centra en la narracin autobiogrficade hechos de la vida cotidiana. Yest especialmente concebido para alumnos de cuarto de ESO, realizable en un crdito variableoenlaasignaturade LenguaCastellana y literatura. La propuesta, que planifica actividadesreflexivasyproductivas en treinta y cuatro sesiones de trabajo, destaca por la precisin del programa, el rigor de la teora utilizada y por la ambicin de sus objetivos."Laautora plantea la enseanza de la composicin escrita-manifiesta Artur Noguerol en el prlogo- intimamente vinculada a la de la lectura, como una construccin cultural en la que la literatura aparece especialmente relacionada con la reflexin instructiva sobre las vivencias personales." Hablar de uno mismo es un ricoresorte para perfeccionar el aprendizaje literario ylingstico del estudiante. La narracin nos gua en todas nuestras actividades del da, en las personales y en las de trabajo, en las institucionalesyenlasimpersonales. Ennopocos casos, el asunto del relato somos nosotros mismos y trata de lo que nos ha sucedido o de lo que esperamos que pase. Hay personas que destacan como narradoras de sucesos de su vida, que presentan ya sea con un tono trascendente y heroico, ya de un modo irnico y mundano. Este atractivo de los narradores tiene una facilidad aparente, tras la cual hay una notable capacidad de reflexiny un gran dominio de los procedimientos narrativos. El estudio de Francisca Prez, Una propuesta didcticasobre la narracin, llama la atencin sobre el poder comunicativo de los relatos. Ypropone cubrir o mejorar un campo recomendable en la enseanza de la Lenguayla Literatura. Se trata de la narracin autobiogrfica. En ella el narrador es tambin el personaje central o secundario de unos he-

UNA PROPUESTADIDCTICA SOBRE LA NARRACiN

Intercambiar vivencias reconocerse y enlaescritura Prez. Francisca ICE dela Universitatde Barcelona/Horsori (col.Cuadernos deEducacin), Barcelona, 2002, 202 pp.

chos vivenciales. Las modalidades de este tipo de narracin son la autobiografia, las memorias, la crnica periodstica, el diario personal, el libro de viajes y el epistolario. Se trata de producciones escritas, a diferencia de la historia de vida-tambin autobiogrfica-, que tienen un formato oral y suelen responder a las preguntas de un entrevistador. Como indica Francisca Prez en el subttulo del libro, propone que los alumnos "intercambien vivencias y se reconozcan en la escritura". La introduccin de la obra presenta con rigor y sntesis un panorama de teora de la narracin, en sus tendencias histricas, modelos de anlisis -como el de Van Dijk, Bronckart y Adam- y conceptos de la gramtica del texto y de la pragmtica. Esta parte es ms que un marco de justificacin acadmica. Es un compendio de instrucciones y referencias tericas que resulta fundamental para desarrollar provechosamente la propuesta didctica. La parte principal del libro expone con detalle la propuesta didctica del

N,OIDENTlFICADDR:323.021

"anlisis y elaboracin del texto narrativo autobiogrficd'. Describe las tareas de las tres fases de la propuesta, que son las de preparacin y realizacin, y enumera los contenidos de las treinta ycuatro sesiones del programa, con sus objetivos, actividades y temas especficos. Se acompaa esta explicacin de las fichas de informacin que recibe alumnado. Las composiciones que elaboran los alumnos sobre el primer da de clase del curso o sobre una jornada estival son ejemplos de la lnea de trabajo, con relatos de la vida cotidiana que recogen experiencias personales de los autores. Laredaccin de relatos se combina con actividades de estudio, planificacin y revisin de las producciones. y los objetivos que propone Francisca Prez para los alumnos incluyen tambin una rica variedad de trabajos: uso y elaboracin de fichas de recursos, valoracin en grupo de las producciones de los compaeros y compaeras, resolucin de cuestionarios sobre textos literarios y puesta en comn de sus respuestas, fomento del inters por la lectura y el comentario de las narraciones, participacin en la edicin de una antologa de textos. Esta obra es deudora de la tesis doctoral de la misma autora, La escritura autobiogrfica en el aula. Y est escrita al modo acadmico de la literatura gris, que es donde cabe incluir las tesis doctorales, es decir, con un estilo abstracto, objetivo y muy preciso referencialmente. Cabe objetar que estos rasgos no convienen tanto a un libro de divulgacin como ste, propio de la literatura de librera. Quiz agradecera el lector en esta escritura rasgos del ensayo como, por ejemplo, la presencia de la autora como una voz tenue pero cordial y narradora. Con todo, la propuesta didctica de Francisca Prez Romero destaca por tres magnficas razones. Una es la eleccin de la narracin autobiogrfica, pues es un gnero cercano y sugestivo. Otra de ellas consiste en la combinacin de muchas tareas alrededor de los ejes de la Literatura y la Lengua. Y,por ltimo, merece la pena sealar un objetivo educativo del taller, el de que los participantes aprendan a dialogar ya respetar las opiniones de los compaeros. Xavier Laborda Gil

ABRIL 2003 N.o323 CUADERNOS EPEDAGOGA97 D 1

..

,.

.....

DEPEDAGOGIA
'. . N.o septiembre 2003 -6'50 327 ""
,

'ii

'"
~,.
A

11

l.

~
~

;. ,
e
"1

'tL

",o o

~=
-

I
11

Entrevista
lee Redhead
Summerhill hoy

Reflexionar n e

elaula
PENSAR LODICHO Lareflexinsobrela lenguay la comunicacin enel aprendizaje de lenguas Cots,JosepMaria;Nussbaum, Luci(ed.) Milenio (col. Educacin),Lleida, 2002, 231pp.

Losveintin autores de Pensar sobre 10 dicho explican e ilustran con elocuentes ejemplos prcticos la importancia de pensar sobre lo aprendido en clases de Lengua. Lautilidad de esta actividad consiste en que esa reflexin permite avanzar al alumno y al profesor con un nuevo impulso en el aprendizaje. Este libro colectivo est compuesto por doce captulos en los que se exponen los principios de la reflexin metalingstica, as como ciertos materiales que se pueden aplicar en el aula. Los trabajos se centran en el aprendizaje lingstico en la ESO, y resultan especialmente recomendables para profesores y profesoras cuya actividad es la enseanza de Lengua (primera, segunda o extranjera). El libro se gest en un encuentro de docentes dedicados a la enseanza de lenguas rala formacin delprofesorado. Lospuntos fuertes del libro son la equilibrada combinacin de aportacionestericas yprcticas,la actua1izacindel estado de la cuestin, la experiencia de los autores, su participacin en programas de renovacinpedaggicayla cuidada edicin de JosepMariaCotsyLuciNussbaum.

Los planteamientos de esta obra estn explcitamente relacionados con la corriente terica de enseanza de lenguas denominada conciencia sobre el lenguaje (language awareness). Esta corriente sajona, aparecida en Australia en los aos setenta y desarrollada despus en el Reino Unido, se ha consolidado, e inspira un trabajo muy estimulante, inquisitivo y riguroso. La corriente de la conciencia sobre el lenguaje plantea la utilizacin de la diversidad lingstica para que los estudiantes reflexionen y comprendan cmo funciona la facultad lingstica. Elloles ayuda en el aprendizaje de la lengua y, por extensin, en cualquier otro aprendizaje. El lema pedaggico de pensar lo dicho revela una concepcin que proyecta la enseanza de lenguas a un horizonte prometedor: el horizonte de la ecologa humana, aquel en que participan lenguaje yconciencia,pero no como actividades cerebrales o cognitivas,ni tampoco como transmisores de conocimientos, sino como la actividadsocial que los alumnos y los profesores ayudan a construir. Xavier Laborda Gil