Anda di halaman 1dari 15

BIOINFORMATIKA

Oleh : Nama NIM Rombongan Kelompok Asisten : Saefullah Habibi Z.A : B1J008010 : VI :3 : Zakiyyah

LAPORAN PRAKTIKUM BIOLOGI MOLEKULER

KEMENTERIAN PENDIDIKAN NASIONAL UNIVERSITAS JENDERAL SOEDIRMAN FAKULTAS BIOLOGI PURWOKERTO 2011

I. PENDAHULUAN A. Latar Belakang Perkembangan teknologi DNA rekombinan memainkan peranan penting dalam lahirnya bioinformatika. Teknologi DNA rekombinan memunculkan suatu pengetahuan baru dalam rekayasa genetika organisme yang dikenal dengan bioteknologi. Perkembangan bioteknologi dari bioteknologi tradisional ke bioteknologi modren salah satunya ditandainya dengan kemampuan manusia dalam melakukan analisis DNA organisme, sekuensing DNA dan manipulasi DNA. Kemampuan untuk memahami dan memanipulasi kode genetik DNA ini sangat didukung oleh teknologi informasi melalui perkembangan hardware dan software. Baik pihak pabrikan software dan hardware maupun pihak ketiga dalam produksi perangkat lunak. Salah satu contohnya dapat dilihat pada upaya Celera Genomics, perusahaan bioteknologi Amerika Serikat yang melakukan pembacaan sekuen genom manusia yang secara maksimal memanfaatkan teknologi informasi sehingga bisa melakukan pekerjaannya dalam waktu yang singkat. Kemajuan teknik biologi molekuler dalam mengungkap sekuens biologi protein (sejak awal 1950an) dan asam nukleat (sejak 1960an) mengawali perkembangan pangkalan data dan teknik analisis sekuens biologi. Pangkalan data sekuens protein mulai dikembangkan pada tahun 1960an di Amerika Serikat, sementara pangkalan data sekuens DNA dikembangkan pada akhir 1970an di Amerika Serikat dan Jerman pada Laboratorium Biologi Molekuler Eropa (European Molecular Biology Laboratory). Penemuan teknik sekuensing DNA yang lebih cepat pada pertengahan 1970an menjadi landasan terjadinya ledakan jumlah sekuens DNA yang dapat diungkapkan pada 1980an dan 1990an. Hal ini menjadi salah satu pembuka jalan bagi proyekproyek pengungkapan genom, yang meningkatkan kebutuhan akan pengelolaan dan analisis sekuens dan pada akhirnya menyebabkan lahirnya bioinformatika. Perkembangan jaringan internet juga mendukung berkembangnya bioinformatika. Pangkalan data bioinformatika yang terhubungkan melalui internet memudahkan ilmuwan dalam mengumpulkan hasil sekuensing ke dalam pangkalan data tersebut serta memperoleh sekuens biologi sebagai bahan analisis. Selain itu, penyebaran program-program aplikasi bioinformatika melalui internet memudahkan

ilmuwan dalam mengakses program-program tersebut dan kemudian memudahkan pengembangannya. Bioinformatika merupakan ilmu terapan yang lahir dari perkembangan teknologi informasi dibidang molekular. Pembahasan dibidang bioinformatik ini tidak terlepas dari perkembangan biologi molekular modern, salah satunya peningkatan pemahaman manusia dalam bidang genomic yang terdapat dalam molekul DNA. Mempelajari penerapan teknik komputasi untuk mengelola dan menganalisis informasi hayati. Bidang ini mencakup penerapan metode-metode matematika, statistika, dan informatika untuk memecahkan masalah-masalah biologi, terutama yang terkait dengan penggunaan sekuens DNAdan asam amino. B. Tujuan Praktikum kali ini bertujuan untuk melakukan alignment data hasil sekuensing, mencari situs restriksi dan melakukan perancangan primer.

II. MATERI DAN METODE

A. Materi Alat-alat yang digunakan pada praktikum kali ini meliputi laptop, modem/ wifi (akses internet) dan flashdisk. Bahan-bahan yang digunakn pada praktikum kali ini meliputi urutan DNA hasil sekuensing, program-program offline (software) BIOEDIT dan RASTOP, program-program online NCBI blast, NEBcutter, Primer3 dan www.molbiol-tools.ca. B. Metode Bioedit 1. Download aplikasi BioEdit dalam bentuk WinRAR dengan filename BioEdit.rar 2. Extract file dengan cara klik kanan pada file dan pilih Extract to BioEdit 3. Setelah di ekstrak, aplikasi dapat langsung digunakan karena bersifat portable. Alignment 1. Aplikasi BioEdit dijalankan sebelum dimulai, di-download softcopy sekuensing DNA yang akan digunakan sebagai sampel pada praktikum. Setelah didapatkan sampel sekuensing, sampel tersebut dibuka menggunakan BioEdit dengan cara klik Open > cari file dgn format (*.ab1) atau (*.txt). File yg dibuka dengan format *.ab1 akan terlihat diagram Elektroforogram. 2. Kedua sampel sekuen yang diberikan dibuka. Sehingga akan terlihat dua urutan basa pada tab berbeda. 3. Kedua sampel disatukan dengan mengkopi salah satu urutan sekuens dengan cara klik salah satu nama sekuens > pilih Edit > Copy sequence(s) 4. Sekuens tersebut diPaste-kan di tab sekuens lainnya dengan cara pilih Edit > Paste sequence(s). Akan muncul tampilan: klik salah satu nama sekuens pilih Edit > Copy sequence(s). Akan terlihat dua sekuens pada satu Jendela TAB. 5. Setelah kedua sekuens sejajar, maka dilakukan alignment. Untuk melihat kesamaan dari kedua sekuens tersebut, klik shade identities and similarities in alignment window. Akan muncul warna pada posisi basa yang sama. Suatu urutan sekuens akan dikatakan baik atau dapat dibaca apabila semua urutan sama dan tidak terdapat basa yang kosong (-) atau N. Untuk itu perlu dilakukan Reverse Complement pada salah satu sampel yang berfungsi membalikan urutan basa yang komplemen.

6. Reverse Complement dilakukan dengan cara klik salah satu sekuens pilih menu Sequence > Nucleic Acid > Reverse Complement 7. Kemudian kedua sekuens diblok dan alignment mulai dilakukan dengan cara klik ClustalW Multiple Alignment pada menu Accessory Application dan klik Run ClustalW > OK. Setelah menjalankan ClustalW, dicek kembali alignment dengan klik shade identities and similarities in alignment window maka akan terlihat pasangan basa yang sama akan terwarnai. 8. Kemudian deretan sekuens (dilingkar merah) yg tidak di-reverse (sekuens yang atas) diblok dan tekan Ctrl-C (Copy). Sekuens tersebut diPaste-kan pada program Notepad. Kemudian file tersebut disave dengan nama sesuai keinginan. Contoh Koloni 1 sekuen. 9. Selesai sudah dalam tahapan alignment. Sekuens tersebut yang nantinya akan dipergunakan dlm NCBI Blast-N. File tersebut dibuka dalam BioEdit. Translasi Selanjutnya adalah melakukan translasi untuk memperoleh sekuens dalam menggunakan NCBI > Blast-P. Translasi dilakukan dari hasil sekuens tadi dengan cara sebagai berikut: 1. 2. Dibuka file Koloni 1 sekuen tadi pada BioEdit maka akan muncul tampilan. Klik sekuens tersebut kemudian dipilih menu Sequence > Nucleic Acid > Translate. Maka akan terdapat pilihan Frame 1-3. Melakukan translasi menggunakan BioEdit harus dicoba setiap Frame translasi hingga tidak ditemui gen yang menyandi gen End (*) atau berhenti pada pertengahan sekuens. Setelah di-copy dalam Notepad, ubah format tersebut dengan format FASTA. Dengan cara mengetik >(nama file). Contoh: Salah satu contoh bentuk hasil translasi yang memiliki gen penyandi End atau berhenti di tengah sekuens. 3. Setelah mengecek semua hasil translasi pada setiap Frame dan telah memilih Frame tanpa penyandi End, maka dilakukan Toggle Translation dengan cara sebagi berikut: klik sekuens yg akan ditranslasi dan pilih menu Sequence > Toggle Translation. Maka akan terlihat bahwa kode sekuens akan berubah menjadi kodekode protein hasil translasi. Sekuen inilah yang akan digunakan dalam NCBI Blast-P.Copy sekuen tersebut dalam file Notepad tadi dan dibuat jarak 1 spasi saja serta dibuat format Fasta, kemudian save file tersebut.

Nucleotide BLAST Blast-n digunakan untuk mengetahui jenis organisme yang digunakan sebagai sampel. Hal tersebut dilakukan dengan mencocokan hasil sekuens yang ada dengan yang ada di BankGen. Pencocokan sekuens dilakukan dalam keadaan Online. Lakukan langkahlangkah sebagai berikut: 1. 2. 3. 4. 5. Internet Explorer (program untuk browsing) dibuka kemudian masuk Google. Pencarian Google dimulai dengan mengetik ncbi blast. Kemudian mulai search. Akan ditemukan hasil pencarian ncbi blast, lalu pilih pada bagian yang paling atas yaitu BLAST: Basic Local Alignment Search Tool NCBI dan klik. Ketika masuk halaman web BLAST- NCBI, pada bagian Basic BLAST pilih program nucleotide blast. Setelah masuk pada halaman nucleotide blast terdapat kolom tempat meletakkan sekuens yang akan di-blast. Sekuens diCopy yang terdapat pada Notepad hasil alignment. 6. Kemudian dilakukan pengaturan beberapa hal, seperti pada set Database pilih Others (or etc.) setelah itu pastikan setting-an Other Databases pada Nucleotide collection (nr/nt). BLAST diklik pada bagian bawah untuk mulai melakukan blast. Selanjutnya akan terlihat halaman hasil blast berupa Graphic Summary yang menjelaskan nilai dari hasil alignment sekuens, Descriptions yang menunjukan produk-produk yang terdapat pada GenBank dari hasil sekuens dan Alignments yang menampilkan urutan dari setiap pasangan basa pada sekuens. Bagian Descriptions terdapat banyak pilihan yang memiliki urutan sekuens yang hampir sama. Salah satu yang memiliki nilai persentasi kesamaan yang tinggi (biasanya paling atas 90% - 100%) dipilih, maka akan terlihat urutan sekuens yang dimasukan dengan sekuens dari gen bank. Protein Blast 1. 2. Protein blast dilakukan dengan terlebih dahulu kembali ke-home BLAST-NCBI dan pada Basic BLAST pilih protein blast. Setelah masuk pada halaman protein blast akan terlihat kolom tempat meletakkan sekuens yang akan di-blast. Copy-kan sekuens yang terdapat pada Notepad tadi hasil translate. Akan terlihat halaman hasil blast seperti hasil blastn sebelumnya. 3. Hasil tersebut untuk Hasli dan Pembahasan pada laporan.

Perancangan Primer 1. Program Browser dibuka dan masuk ke Google. Ketik primer 3 dan dimulai pencarian. Klik Primer3 Input (version 0.4.0) pada hasil pencarian Google yang paling atas. 2. Masuk kedalam home Primer 3. 3. Sekuens yang akan dicari primernya dimasukan pada kotak sekuens. Kemudian lakukan pengaturan pada General Primer Picking Conditions. 4. Setelah dilakukan pengaturan dan sekuens dimasukan yang akan dicari primernya, klik Pick Primer. 5. Copy primer yang diperoleh dibahas didalam Laporan Praktikum. Pemotongan Sekuens Pemotongan sekuens DNA dilakukan dengan menggunakan enzim-enzim yang berbeda pada setiap daerah pemotongannya. Untuk mengetahui nama enzim yang digunakan untuk memotong suatu sekuens DNA dapat menggunakan aplikasi online yaitu NEBcutter. 1. Program Browser bibuka dan masuk ke Google. Diketik nebcutter dan mulai pencarian. Klik NEBcutter V2.0 pada hasil pencarian Google yang paling atas, maka akan masuk kedalam home NEBcutter dan terlihat kotak tempat meletakkan sekuens. 2. Copy sekuens yang akan dicari nama enzim pemotongnya. Kemudian pada bagian Enzymes to use pilih All commercially available specificaties. Setelah itu pilih Submit, maka akan muncul gambar. 3. Gambar menunjukan bahwa enzim yang dapat digunakan untuk memotong Mengetahui Bentuk 3D Protein Bentuk 3D Protein dapat dilihat prediksinya menggunakan aplikasi offline yaitu RasTop. Namun file yang digunakan harus di-download terlebih dahulu di molbioltools.ca menggunakan web online. Ikuti langkah sebagai berikut: 1. 2. Program Browser dibuka dan masuk ke molbiol-tools.ca. Kemudian cari bagian/sub Protein Sequence Analysis dan klik TERTIERY STRUCTURE PREDICTIONS. Setelah masuk dalam TERTIERY STRUCTURE PREDICTIONS/PROTEIN TERTIERY STRUCTURE, pilih sublinks PHYRE. 3. Kemudian akan masuk dalam halaman PHYRE. Terlihat kotak sekuens dan pilihan Email Address serta Optional Job description, diisi sesuai data diri anda

kemudian copy-kan sekuens protein yang akan dilihat bentuk 3D-nya. Setelah itu klik Quick Phyre Search. Kemudian akan muncul halaman konfirmasi sukses dan akan dikirim melalui email anda. 4. 5. Untuk langsung men-download file protein 3D klik link yang ditunjukkan pada gambar. Kemudian pilih prediksi 3D protein yang paling atas karena nilai persentasinya paling tinggi dan cocok seperti yang dibaca pada sekuens protein tersebut. Save file tersebut dan buka pada RasTop dengan cara klik Open. File yang didownload memiliki ekstensi *.pdb

III. HASIL DAN PEMBAHASAN A. Hasil Tabel 1. Deskripsi Sekuens Hasil Alignment dan Translasi Accession DQ465452.1 ZP Description Streptomyces olivaceoviridis strain A1 xylanase TB gene, partial cds endo-1,4-beta-xylanase B [Streptomyces hygroscopicus ATCC 53653] >gb|EFL23815.1| endo-1,4-beta-xylanase B [Streptomyces

07295446.1 Max score 510 254 Total score 510 254

himastatinicus ATCC 53653] Query E Max ident 89% -

coverage value 79% 3e-141 81% 2e-66

Keterangan Hasil Alignment Hasil Translasi

Gambar 1. Grafik Hasil Alignment

Gambar 2. Grafik Hasil Translasi

Gambar 3. Sekuens Hasil Alignment (Blast)

Gambar 4. Sekuens Hasil Translasi (Blast)

Gambar 5. Enzim Restriksi

Gambar 6. Struktur 3D Protein

B. Pembahasan Berdasarkan hasil yang diperoleh yaitu untuk hasil alignment dan translasi pada Notepad dengan format Fasta (dengan mengetik >(nama file)) yaitu: >Hasil Alignment1 CCAACGCGTTGGGAGCTCTCCCATATGGTCGACCTGCAGGCGGCCGCGAAT TCACTAGTGATTTGGAGCAACACCGGCAACTTCGTGGCCGGCAAGGGCTG GAGCAACGGCGGGCGCCGCAGCGTGACCTACTCCGGCACCTTCAACCCGC CCGGCAACGCGTATCTGTCGCTGTACGGCTGGACCTCGAACCCGCTGGTCG AGTACTACATCGTCGACAACTGGGGCAGCTACCGGCCCACCGGCACCTTCA AGGGCACGGTCACCAGTGACGGCGGGACGTACGACATCTACGAGACGACC CGGACCAACGCCCCGTCGGTGGAGGGCACCAAGACCTTCAACCAGTACTG GAGCGTGCGGCAGTTCAAGCGGACCGGCGGCACCATCACCACCGGCAACC ACTTCGACGCCTGGGCCGGCCACGGGATGAACCTGGGCAGCTTCAACTACT

ACATGATCCTCGCCACCGAAATCGAATTCCCGCGGCCGCCATGGCGGCCG G >Hasil translasi PTRWELSHMVDLQAAANSLVIWSNTGNFVAGKGWSNGGRRSVTYSGTFNPP GNAYLSLYGWTSNPLVEYYIVDNWGSYRPTGTFKGTVTSDGGTYDIYETTRT NAPSVEGTKTFNQYWSVRQFKRTGGTITTGNHFDAWAGHGMNLGSFNYYMI LATEIEFPRPPWRP Primer adalah molekul oligonukleotida untai tunggal yang terdiri atas sekitar 30 basa. Primer berfungsi sebagai penginisiasi reaksi polimerisasi DNA secara in vitro karena tanpa primer. reaksi polimerisasi DNA tidak akan terjadi meskipun enzim dan komponen lainnya sudah tersedia. Selain itu, primer juga berfungsi untuk membatasi daerah mana yang akan diamplifikasi pada reaksi PCR (Pramono, 2011). Primer spesifik untuk mengamplifikasi suatu fragmen DNA dirancang berdasarkan informasi urutan nukleotida dari gen yang sama yang dapat diakses menggunakan program Primer3 yang dapat diakses secara online (http://www.biotools.umassmed.edu/), dengan memperhatikan beberapa parameter seperti ukuran dan posisi fragmen DNA target, titik leleh (Tm), komplementasi pada ujung 3 dan lain sebaginya (Budiani dan Purba, 2010). Fungsi primer sebagai inisiator sekaligus pembatas daerah yang akan diamplifikasi, maka idealnya primer memiliki urutan basa nukleotida yang tepat berpasangan dengan urutan basa DNA target yang akan diamplifikasi dan tidak menempel di bagian lainnya. Oleh sebab itu, primer dirancang (perancangan primer) untuk menentukan keseimbangan antara spesifisitas dan efisiensi. Spesifisitas didefiniskan sebagai frekuensi terjadinya mispriming (kesalahan penempelan) primer pada tempat yang tidak seharusnya. Primer dengan spesifisitas buruk akan terlihat dari banyaknya pita-pita yang tidak diinginkan saat produk PCR divisualisasi dengan elektroforesis gel, sedangkan efisiensi adalah seberapa dekat perolehan jumlah produk PCR dengan nilai teoritis yang seharusnya dicapai (ingat bahwa setelah n siklus PCR maka akan dihasilkan 2n kopi produk). Menurut Prasetyo (2009), proses perancangan primer dapat dilakukan dengan cara manual maupun menggunakan software. Perancangan primer PCR secara manual berbekal beberapa aturan dasar. Kelebihan dari desain primer secara manual adalah kita dapat mendesain primer PCR yang efektif dengan karakteristik yang mungkin "tidak diijinkan" oleh program yang ada.

Aturan dasar tersebut adalah sebagai berikut: Panjang primer sebaiknya antara 18-30 nukleotida (kecuali untuk tujuan tertentu). Sekuens dalam primer sebaiknya tidak mengandung daerah komplementari internal. Sebaiknya dalam sepasang primer tidak ada daerah yang saling berkomplementari. Dalam primer tidak ada struktur sekunder. Memiliki kandungan GC (guanosine dan cytosine) 50%. Hindari ketidakseimbangan distribusi daerah kaya G/C dan A/T. Untuk PCR diagnostik pilih primer PCR yang mengamplifikasi daerah yang stabil secara genetik. Perbedaan suhu anealing dalam suatu pasangan primer jangan lebih dari 5 0C. Perancangan primer dengan menggunakan software yaitu MEDUSA, Primer3, PrimerQuest, dan lain-lain. Penggunaan program semacam ini sangat disarankan untuk mendesain protokol PCR baru. Hasil perancangan primer dengan menggunakan program online yaitu Primer3 diperoleh: ATTTGGAGCAACACC (Primer forward) >>>>>>>>>>>>> CTGGGCAGCTTCAACTACTA (Primer reverse) <<<<<<<<<<<<<<<<< Untuk memperoleh primer dengan spesifitas yang tinggi terhadap fragmen cDNA yang akan diamplifikasi, dalam merancang primer telah dipertimbangkan beberapa hal yang merupakan ketentuan dalam perancangan primer yang baik di antaranya adalah panjang primer antara 18-28 nukleotida, kandungan basa guanin dan sitosin (G+C) berkisar antara 50-60%, dan kedua primer memiliki titik leleh yang sebanding (Budiani dan Purba, 2010). Penggunaan analisis tool baik secara on line maupun off line yang berupa BIOEDIT dan RASTOP digunakan untuk menyusun dan penyiapan data fasta yang telah di copy-paste kedalam natepad yang selanjutnya akan dihasilkan sekuens alignment dan hasil translasi. BLASTn digunakan untuk penyejajaran DNA dengan data yang ada di GenBank, dan penyimpanannya dilakukan denagn aplikasi EBI-SRS. Pembuatan primer dilakukan dengan menggunakan program PRIMER3 dengan menentukan beberapa parameter yang ada. Untuk melihat struktur protein secara 3D dapat menggunakan program Phyre dan untuk pendeteksian situs-situs restriksi yang dibutuhkan dapat menggunakan program NEBcutter (Santoso, 2001).

Pemotongan molekul DNA dapat mengguakan enzim restriksi berupa Apo I dan Btsc yang merupakan salah satu dari enzim endonuklease, yaitu merupakan enzim yang memotong bagian intenal DNA tepat pada ikatan fosfodiester, sedang kan enzim Apo I sendiri merupakan enzim restriksi yang serupa dengan EcoR I yang sama-sama dapat memotong plasmid pada urutan basa ke 396 serta meiliki sifat sebagai star activity (Brown, 2002). Semua protein pada semua spesies mulai dari bakteri sampai manusia dibentuk dari 20 asam amino yang sama dan tidak berubah selama evolusi. Protein memiliki empat tingkat struktur yang berbeda yaitu : struktur primer, struktur skunder, struktur tersier dan struktur kuartener. Sifat umum semua protein mencakup hambatan pada konformasi atau susunan spesialnya oleh ikatan kovalen dan nonkovalen. Struktur primer suatu protein adalah urutan linear asam amino yang isatukan ole iktan peptida yang mencakup lokasi ikatan disulfida serta tidak terjadi percabangan rantai. Struktur skunder berupa daerah dalam rantai peptida dapat membentuk struktur reguler, berulang, dan lokal yang terjadi akibat adanya ikatan hidrogen antara atom-atom ikatan peptida. Struktur tersier protein menggambarkan pengaturan ruang residu asam amino yang berjauhan dalam urutan linier dan pola-pola ikatan sulfida (Sari, 2007). IV. KESIMPULAN DAN SARAN A. Kesimpulan Berdasarkan hasil dan pembahasan yang diperoleh maka dapat disimpulkan bahwa : 1. 2. 3. 4. Alignment data hasil sekuensing dapat dilakukan dengan menggunakan format fasta yang diaplikasikan pada sofware offline BIOEDIT dan RASTOP. Mencari situs-situs restriksi dengan memasuki website secara online NEBcutter (http://tools.neb.com/NEBcutter) Perancangan primer dilakukan dengan aplikasi online PRIMER3 (http://www.idtna.com/SciTools/) Analisis struktur protein dapat dilakukan dengan aplikasi online yaitu http://molbiol-tools.ca B. Saran Pelaksanaan praktikum acara bioinformatika cukup baik tapi untuk kedepannya agar lebih terkondisikan agar penyampaian praktikum dapat terlaksana baik.

DAFTAR REFERENSI Brown, T.A (2002) DNA in Genomes, 2nd ed. Budiani, A. dan A. R. Purba. 2010. Kloning Fragmen Gen Penyandi -Ketoacyl-ACP Synthase II dari Dua Tipe Kelapa Sawit dengan Kandungan Asam Oleat yang Berbeda. Menara Perkebunan, 78(1): 1-8. Prasetyo, A. A. 2009. Materi Asistensi Biomedik. UNS, Solo. Santoso, D. 2001. Pengembangan Pelacak DNA Spesifik Gen melalui Bioinformatika: Indentifikasi Gen Penyandi Protein Biji 21 Kda pada Kakao UAH Indonesia. Menara Perkebunan, 69(1):10-17. Sari, M. I. 2007. Struktur Protein. Universitas Sumatra Utara.