Anda di halaman 1dari 49

A técnica da Eletroforese

para a análise de DNA e
proteínas
Prof. Dr. Francisco Prosdocimi

Histórico

1952, Markham and Smith

1955, Smithies

Géis de acrilamida com maior resolução e
permitem separar ainda moléculas
grandes de DNA

1980, Schwartz and Cantor

Géis de amido funcionam bem para
separar proteínas do soro humano

1967, Loening

Ao estudarem hidrólise de RNA percebem
que moléculas de diferentes estruturas
têm sua mobilidade diferenciada quando
aplicadas num papel e submetidas a um
campo elétrico

Eletroforese em campo pulsado separa
fragmentos enormes

É hoje impossível imaginar um
laboratório de biomol sem eletroforese
acontecendo a todo instante...

Vou ali
correr um
gelzinho e
já volto

Tenho que ir
senão vou perder
meu gel

Eletroforese
• Movimento de partículas
dispersas num fluído sob
influência de um campo elétrico
uniforme
• DNA, carga negativa
– Tem tendência a se dirigir ao
polo positivo quando sujeito a
um campo elétrico

• Serve para separar moléculas
por tamanho/carga elétrica
– Proteína deve ser desnaturada
com detergente (SDS)

• Técnica utilizada à exaustão em
trabalhos de biologia molecular

Eletroforese, etapas
1.Preparação do gel
2.Aplicação das amostras
3.Eletroforese
4.Coloração
5. Análise dos resultados

Preparação do gel Horizontal X Vertical Agarose X Poliacrilamida .

Aplicação das amostras Definição do mapa das amostras por canaleta .

senão o DNA sai do gel .Corrida do gel • Aplicação do campo elétrico • Fonte elétrica gera fluxo de íons através da solução tampão • Terminais positivo e negativo • Tempo adequado.

etc .Coloração das moléculas • Brometo de etídio – Agente intercalante do DNA • Cancerígeno! – Composto fluorescente à luz UV – Gel de agarose • Prata – Gel SDS-PAGE • PoliAcrilamide Gel Electrophoresis – Melhor resolução • Coomassie blue.

.

.

Eletroforese em campo pulsado Grandes fragmento s de DNA .

Dr.com/view/53 8a719f-927b-4192-8e95-18a 92a9e95a5 . Francisco Prosdocimi http://dotsub.PCR a reação em cadeia da polimerase Prof.

Reação em cadeia .

Amplificação do DNA .

dNTP . DNA polimerase. Tampão.Síntese de DNA in vitro • Polimerase Chain Reaction – Reação em cadeia da Polimerase • Amplificação in vitro de moléculas de DNA – In vivo X In vitro X In silico • Procedimento análogo à replicação do DNA – Amostra de DNA. 2 primers.

– Não permitia automação . a enzima polimerase era desnaturada e precisava ser acrescentada ciclo a ciclo..Etapas da PCR • Ciclos da PCR – Separação das fitas → 96°C – Anelamento dos primers → 60°C – Síntese do DNA → 37°C • Problema inicial da técnica – Durante a etapa de quebra das pontes de H e separação das fitas (DNA melting) a 96°C..

1972 2 anos de pós-doutorado numa industria farmacêutica • Deixou a academia para escrever ficção científica. é um dos que acredita que o HIV não causa a AIDS. demorou um ano para padronizar a técnica • Perdeu a namorada logo depois. foi dono de padaria por dois anos. 1966 – – Doutor em bioquímica.História da PCR • Químico. mas ganhou o Nobel de química (1993) • 1986 → utilização da enzima polimerase de Thermus aquaticus – • Permitiu finalmente a automação da técnica Controvérsias: Surfista. voltou à indústria • 1983 → Teve a idéia de utilizar um par de primers para amplificação enquanto voltava para a casa à noite ao lado da namorada • Avisou na empresa e deixou-se que ele ficasse trabalhando na PCR. e diz ter tomado bastante LSD na década de 60/70 e que isso o ajudou a descobrir a afamada técnica! Taq polimerase Kary Mullis. 1944 . já foi divorciado 3 vezes.

PCR Sistema de reação: DNA molde (100 ng) Iniciadores (5 M) dNTPs Tampão com MgCL2 Taq polimerase Protocolo de amplificação: Desnaturação: 95º C Anelamento: 45-60º C Extensão: 72º C .

Filmes como técnica didática • http://learn.com/genetics/PCR/PCR.utah.genetics.com/watch?v=_YgXcJ4n-kQ .youtube.htm • http://www.maxanim.edu/content/labs/pcr/ • http://www.

Interlúdio explicativo Prof. Dr. Francisco Prosdocimi .

São formadas por sequências de aminoácidos 2. Derivam de informações dispostas por genes no DNA. portanto: 1. que deve ser transcrito e.Bioquímica + Biomol • Enzimas são proteínas. tanto de aminoácidos quanto de nucleotídeos . posteriormente. traduzido 3. Podemos saber a sequência delas.

.

transcript variant 1. mRNA GAGGAGGAGCCGCCGAGCAGCCGCCGGAGGACCACGGCTCGCCAGGGCTGCGGAGGACCGACCGTCCCCA CGCCTGCCGCCCCGCGACCCCGACCGCCAGCATGATCGCCGCGCAGCTCCTGGCCTATTACTTCACGGAG CTGAAGGATGACCAGGTCAAAAAGATTGACAAGTATCTCTATGCCATGCGGCTCTCCGATGAAACTCTCA TAGATATCATGACTCGCTTCAGGAAGGAGATGAAGAATGGCCTCTCCCGGGATTTTAATCCAACAGCCAC AGTCAAGATGTTGCCAACATTCGTAAGGTCCATTCCTGATGGCTCTGAAAAGGGAGATTTCATTGCCCTG GATCTTGGTGGGTCTTCCTTTCGAATTCTGCGGGTGCAAGTGAATCATGAGAAAAACCAGAATGTTCACA TGGAGTCCGAGGTTTATGACACCCCAGAGAACATCGTGCACGGCAGTGGAAGCCAGCTTTTTGATCATGT TGCTGAGTGCCTGGGAGATTTCATGGAGAAAAGGAAGATCAAGGACAAGAAGTTACCTGTGGGATTCACG TTTTCTTTTCCTTGCCAACAATCCAAAATAGATGAGGCCATCCTGATCACCTGGACAAAGCGATTTAAAG CGAGCGGAGTGGAAGGAGCAGATGTGGTCAAACTGCTTAACAAAGCCATCAAAAAGCGAGGGGACTATGA TGCCAACATCGTAGCTGTGGTGAATGACACAGTGGGCACCATGATGACCTGTGGCTATGACGACCAGCAC TGTGAAGTCGGCCTGATCATCGGCACTGGCACCAATGCTTGCTACATGGAGGAACTGAGGCACATTGATC TGGTGGAAGGAGACGAGGGGAGGATGTGTATCAATACAGAATGGGGAGCCTTTGGAGACGATGGATCATT AGAAGACATCCGGACAGAGTTTGACAGGGAGATAGACCGGGGATCCCTCAACCCTGGAAAACAGCTGTTT GAGAAGATGGTCAGTGGCATGTACTTGGGAGAGCTGGTTCGACTGATCCTAGTCAAGATGGCCAAGGAGG GCCTCTTATTTGAAGGGCGGATCACCCCGGAGCTGCTCACCCGAGGGAAGTTTAACACCAGTGATGTGTC AGCCATCGAAAAGAATAAGGAAGGCCTCCACAATGCCAAAGAAATCCTGACCCGCCTGGGAGTGGAGCCG TCCGATGATGACTGTGTCTCAGTCCAGCACGTTTGCACCATTGTCTCATTTCGCTCAGCCAACTTGGTGG CTGCCACACTGGGCGCCATCTTGAACCGCCTGCGTGATAACAAGGGCACACCCAGGCTGCGGACCACGGT TGGTGTCGACGGATCTCTTTACAAGACGCACCCACAGTATTCCCGGCGTTTCCACAAGACTCTAAGGCGC TTGGTGCCAGACTCCGATGTGCGCTTCCTCCTCTCGGAGAGTGGCAGCGGCAAGGGGGCTGCCATGGTGA CGGCGGTGGCCTACCGCTTGGCCGAGCAGCACCGGCAGATAGAGGAGACCCTGGCTCATTTCCACCTCAC CAAGGACATGCTGCTGGAGGTGAAGAAGAGGATGCGGGCCGAGATGGAGCTGGGGCTGAGGAAGCAGACG CACAACAATGCCGTGGTTAAGATGCTGCCCTCCTTCGTCCGGAGAACTCCCGACGGGACCGAGAATGGTG ACTTCTTGGCCCTGGATCTTGGAGGAACCAATTTCCGTGTGCTGCTGGTGAAAATCCGTAGTGGGAAAAA GAGAACGGTGGAAATGCACAACAAGATCTACGCCATTCCTATTGAAATCATGCAGGGCACTGGGGAAGAG CTGTTTGATCACATTGTCTCCTGCATCTCTGACTTCTTGGACTACATGGGGATCAAAGGCCCCAGGATGC CTCTGGGCTTCACGTTCTCATTTCCCTGCCAGCAGACGAGTCTGGACGCGGGAATCTTGATCACGTGGAC AAAGGGTTTTAAGGCAACAGACTGCGTGGGCCACGATGTAGTCACCTTACTAAGGGATGCGATAAAAAGG AGAGAGGAATTTGACCTGGACGTGGTGGCTGTGGTCAACGACACAGTGGGCACCATGATGACCTGTGCTT ATGAGGAGCCCACCTGTGAGGTTGGACTCATTGTTGGGACCGGCAGCAATGCCTGCTACATGGAGGAGAT GAAGAACGTGGAGATGGTGGAGGGGGACCAGGGGCAGATGTGCATCAACATGGAGTGGGGGGCCTTTGGG GACAACGGGTGTCTGGATGATATCAGGACACACTACGACAGACTGGTGGACGAATATTCCCTAAATGCTG GGAAACAAAGGTATGAGAAGATGATCAGTGGTATGTACCTGGGTGAAATCGTCCGCAACATCTTAATCGA CTTCACCAAGAAGGGATTCCTCTTCCGAGGGCAGATCTCTGAGACGCTGAAGACCCGGGGCATCTTTGAG ACCAAGTTTCTCTCTCAGATCGAGAGTGACCGATTAGCACTGCTCCAGGTCCGGGCTATCCTCCAGCAGC TAGGTCTGAATAGCACCTGCGATGACAGTATCCTCGTCAAGACAGTGTGCGGGGTGGTGTCCAGGAGGGC CGCACAGCTGTGTGGCGCAGGCATGGCTGCGGTTGTGGATAAGATCCGCGAGAACAGAGGACTGGACCGT CTGAATGTGACTGTGGGAGTGGACGGGACACTCTACAAGCTTCATCCACACTTCTCCAGAATCATGCACC AGACGGTGAAGGAACTGTCACCAAAATGTAACGTGTCCTTCCTCCTGTCTGAGGATGGCAGCGGCAAGGG GGCCGCCCTCATCACGGCCGTGGGCGTGCGGTTACGCACAGAGGCAAGCAGCTAAGAGTCCGGGATCCCC AGCCTACTGCCTCTCCAGCACTTCTCTCTTCAAGCGGCGACCCCCTACCCTCCCAGCGAGTTGCGCTGGG AGACGCTGGCGCCAGGGCCTGCCGGCGCGGGGAGGAAAGCAAAATCCAACTAATGGTATATATTGTAGGG TACAGAATAGAGCGTGTGCTGTTGATAATATCTCTCACCCGGATCCCTCCTCACTTGCCCTGCCACTTTG CATGGTTTGATTTTGACCTGGTCCCCCACGTGTGAAGTGTAGTGGCATCCATTTCTAATGTATGCATTCA TCCAACAGAGTTATTTATTGGCTGGAGATGGAAAATCACACCACCTGACAGGCCTTCTGGGCCTCCAAAG CCCATCCTTGGGGTTCCCCCTCCCTGTGTGAAATGTATTATCACCAGCAGACACTGCCGGGCCTCCCTCC CGGGGGCACTGCCTGAAGGCGAGTGTGGGCATAGCATTAGCTGCTTCCTCCCCTCCTGGCACCCACTGTG GCCTGGCATCGCATCGTGGTGTGTCAATGCCACAAAATCGTGTGTCCGTGGAACCAGTCCTAGCCGCGTG TGACAGTCTTGCATTCTGTTTGTCTCGTGGGGGGAGGTGGACAGTCCTGCGGAAATGTGTCTTGTCTCCA TTTGGATAAAAGGAACCAACCAACAAACAATGCCATCACTGGAATTTCCCACCGCTTTGTGAGCCGTGTC GTATGACCTAGTAAACTTTGTACCAATTCAAAAAAAAAAAAAAAAAA >gi|188497754|ref|NP_000179.>gi|188497753|ref|NM_000188. nuclear gene encoding mitochondrial protein.2| Homo sapiens hexokinase 1 (HK1).2| hexokinase 1 isoform HKI [Homo sapiens] MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRS IPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEK RKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDT VGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRE IDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLH NAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKR MRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVG HDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQ GQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRG QISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAA VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVR LRTEASS 917 aminoácid os 917 x 3 = 2751 3617-2751 = 866 3617 bp 3.6 kb .

Sequenciamento de proteínas • Degradação de Edman – Quebra-se o aminoácido N-terminal – Identifica-se o aminoácido quebrado – Sequenciamento de 50 a 70 aa’s • Espectometria de massa – Quebra-se a proteína em diversos pontos e verifica-se a massa dos fragmentos – Comparações com massas conhecidas dos aa’s identifica a sequência dos mesmos • Técnicas com limite de automação – Não permitem produzir dados em larga-escala – Para saber-se a sequência de um proteína. muitas vezes sequenciase o DNA do organismo de interesse .

O Sequenciamento de moléculas de DNA Prof.) TGACAGGCCTTCTGGGCCTCCAAAGCCCATCCTTGGGGTTCCCCCTCCCTGTGTGAAATGTATTATCACC AGCAGACACTGCCGGGCCTCCCTCCCGGGGGCACTGCCTGAAGGCGAGTGTGGGCATAGCATTAGCTGCT TCCTCCCCTCCTGGCACCCACTGTGGCCTGGCATCGCATCGTGGTGTGTCAATGCCACAAAATCGTGTGT CCGTGGAACCAGTCCTAGCCGCGTGTGACAGTCTTGCATTCTGTTTGTCTCGTGGGGGGAGGTGGACAGT CCTGCGGAAATGTGTCTTGTCTCCATTTGGATAAAAGGAACCAACCAACAAACAATGCCATCACTGGAAT TTCCCACCGCTTTGTGAGCCGTGTCGTATGACCTAGTAAACTTTGTACCAATTCAAAAAAAAAAAAAAAAAA . Dr.. complete cds GGCTGCGGAGGACCGACCGTCCCCACGCCTGCCGCCCCGCGACCCCGACCGCCAGCATGATCGCCGCGCA GCTCCTGGCCTATTACTTCACGGAGCTGAAGGATGACCAGGTCAAAAAGATTGACAAGTATCTGTATGCC ATGCGGCTCTCCGATGAAACTCTCATAGATATCATGACTCGCTTCAGGAAGGAGATGAAGAATGGCCTCT CCCGGGATTTTAATCCAACAGCCACAGTCAAGATGTTGCCAACATTCGTAAGGTCCATTCCTGATGGCTC TGAAAAGGGAGATTTCATTGCCCTGGATCTTGGTGGGTCTTCCTTTCGAATTCTGCGGGTGCAAGTGAAT CATGAGAAAAACCAGAATGTTCACATGGAGTCCGAGGTTTATGACACCCCAGAGAACATCGTGCACGGCA GTGGAAGCCAGCTTTTTGATCATGTTGCTGAGTGCCTGGGAGATTTCATGGAGAAAAGGAAGATCAAGGA CAAGAAGTTACCTGTGGGATTCACGTTTTCTTTTCCTTGCCAACAATCCAAAATAGATGAGGCCATCCTG ATCACCTGGACAAAGCGATTTAAAGCGAGCGGAGTGGAAGGAGCAGATGTGGTCAAACTGCTTAACAAAG(. mRNA (cDNA clone MGC:1724 IMAGE:3163058). Francisco Prosdocimi >gi|33869444|gb|BC008730.2| Homo sapiens hexokinase 1..

o genoma inteiro de um organismo. o bacteriófago phi X 174 – 11 genes in 5386 bases sequenciadas “à mão“ – Ganha o segundo Nobel de química em 1980 . pela primeira vez.Frederick Sanger • Único vivo dentre os 4 indivíduos que já venceram dois prêmios Nobel • ~1955: publicou a primeira sequência de aminoácidos da insulina – Ganhou o Nobel de química em 1958 • 1964: descobriu que as proteínas de bactéria iniciavamse com o aminoácido formil-metionina • 1967: desvendou a sequência do RNA ribossomal 5S • 1975: inventou o método dideóxi para o sequenciamento do DNA • 1977: sequencia.

com/watch?v=M z-4LSfecM4&feature=related Como acontece a síntese de moléculas de DNA? .youtube. ao invés da extremidade 3’OH. 1975 Polimerização do DNA a ser sequenciado (molde) na presença de: DNA polimerase primer tampão dNTPs (desóxinucleotídeo) ddNTPs (didesóxinucleotídeo) O que faria um nucleotídeo que. tem uma extremidade 3’H? http://www.O método de Sanger.

.) e. (.Amplificação interrompida com didesoxinucleotídeos Desoxinucleotídeos dNTP O didesóxinucleotídeo não tem a extremidade 3’OH livre (... portanto. não permite a incorporação de novas bases a 3’ quando é adicionado.) interrompendo a formação da nova cadeia definitivamente ddNTP Didesoxinucleotídeo ..

C T C T C T G T A G A G T T C A A C AC T T C A G G G T T A G C C A C A C G T 5’ 3’ G A ATGCTTC ||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA 3’ 5’ .

T T C T T G C A C A T A G T A AC T T C A G G G T G T C C AG A C C TC A G 5’ 3’ G A ATGCTTC ||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA 3’ C 5’ .

C T T G A A GA T T C C CA AC T T G G T A G T G C A G C A C A C G T 5’ 3’ G A ATGCTTCTG |||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA 3’ T C T C .

C AT G C A T TT T G T C A T C T T AC C T CA A GC G G T G AC A A G A C GC 5’ 3’ ATGCTTCTGGCAGATCT ||||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA 3’ G 5’ .

A T GAA G A T T G T T T GA G C C T A T T C A GT G C C A GC A T C G C AC CC 5’ 3’ ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA 3’ 5’ .

A CC A T T G A T T T G A G C T A C A T T A G T C G G GA T G T CA C G C C C AC 5’ 3’ ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA 3’ 5’ .

A G 5’ 3’ C A G T C AC T T GAA CC T A T G T T G C T T G AA T C T G C G GC A C CA ATGCTTCTGGCAGAT ||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA 3’ 5’ .

5’ ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT ATGCTTCTGGCAGATCTGAACAGTGTTACT ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT ATGCTTCT ATGCTTCTGGCAGATCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTT ATGCTTCTGGCAGAT |||||||||||||||||||||||||||||||||||||||| TACGAAGACCGTCTAGACTTGTCACAATGACTATAACGAA 3’ 3’ População de moléculas Incorporaçã o aleatória do didesóxi Quantidade precisa entre didesóxi e desóxi 5’ .

ATGCTTCT ATGCTTCTGGCAGAT ATGCTTCTGGCAGATCT ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTT ATGCTTCTGGCAGATCTGAACAGTGTTACT ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT .

• • • •ddGTPs G molde polimerase dNTPs •ddATPs •ddTTPs A T •ddCTPs C .

ATGCTTCT ATGCTTCTG ATGCTTCTGG ATGCTTCTGGC ATGCTTCTGGCA ATGCTTCTGGCAG ATGCTTCTGGCAGA ATGCTTCTGGCAGAT ATGCTTCTGGCAGATC ATGCTTCTGGCAGATCT ATGCTTCTGGCAGATCTG ATGCTTCTGGCAGATCTGA ATGCTTCTGGCAGATCTGAA ATGCTTCTGGCAGATCTGAAC ATGCTTCTGGCAGATCTGAACA ATGCTTCTGGCAGATCTGAACAG ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTG ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTT ATGCTTCTGGCAGATCTGAACAGTGTTA ATGCTTCTGGCAGATCTGAACAGTGTTAC ATGCTTCTGGCAGATCTGAACAGTGTTACT ATGCTTCTGGCAGATCTGAACAGTGTTACTG ATGCTTCTGGCAGATCTGAACAGTGTTACTGA ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATA ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTG ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGC ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT G A T C .

ATGCTTCT ATGCTTCTG ATGCTTCTGG ATGCTTCTGGC ATGCTTCTGGCA ATGCTTCTGGCAG ATGCTTCTGGCAGA ATGCTTCTGGCAGAT ATGCTTCTGGCAGATC ATGCTTCTGGCAGATCT ATGCTTCTGGCAGATCTG ATGCTTCTGGCAGATCTGA ATGCTTCTGGCAGATCTGAA ATGCTTCTGGCAGATCTGAAC ATGCTTCTGGCAGATCTGAACA ATGCTTCTGGCAGATCTGAACAG ATGCTTCTGGCAGATCTGAACAGT ATGCTTCTGGCAGATCTGAACAGTG ATGCTTCTGGCAGATCTGAACAGTGT ATGCTTCTGGCAGATCTGAACAGTGTT ATGCTTCTGGCAGATCTGAACAGTGTTA ATGCTTCTGGCAGATCTGAACAGTGTTAC ATGCTTCTGGCAGATCTGAACAGTGTTACT ATGCTTCTGGCAGATCTGAACAGTGTTACTG ATGCTTCTGGCAGATCTGAACAGTGTTACTGA ATGCTTCTGGCAGATCTGAACAGTGTTACTGAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATA ATGCTTCTGGCAGATCTGAACAGTGTTACTGATAT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTG ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGC ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT ATGCTTCTGGCAGATCTGAACAGTGTTACTGATATTGCTT .

.

uma para cada base Etapa 2 Eletroforese Eletroforese separa fragmentos de diferentes tamanhos Leitura manual da sequência de baixo pra cima .Modelo original Etapa 1 Amplificação Tipo-PCr Marcação do primer 4 reações necessárias.

.Sanger e o fago Phi 174 De fato. . esse tipo de sequenciamento manual continuou acontecendo por décadas..

1938- .Modelo moderno Applied Byosystems. 1986 Marcação fluorescente do ddNTP 1 reação necessária.com/ watch?v=ezAefHhvecM Leroy Hood. por um laser http://www.youtube. de baixo pra cima. todas as bases lidas ao mesmo tempo Eletroforese separa fragmentos de diferentes tamanhos Leitura da automática sequência.

Cromatograma .

as sequências de diferentes tamanhos contendo os didesóxi amplificados devem ser enviadas ao sequenciador de DNA mais próximo .As máquinas necessárias para o sequenciamento • Primeira etapa: junta-se os reagentes em poços de placas e coloca-se na máquina de PCR para a reação de amplificação interrompida • Diferenças com relação ao PCR – Utilização de um só primer – Utilização dos ddNTPs • Uma vez prontas.

O que faz um sequenciador de DNA? • Segunda etapa: realiza a eletroforese capilar – O sequenciador executa a eletroforese em géis capilares ultra-finos – Um sensor é responsável por emitir um laser e verificar qual o comprimento de onda emitido pelo didesóxi .

.

com/watch? v=dUjMf2ZezIw&feature=related .Exercício Dê a sequência de DNA da canaleta apontada azul = Guanina amarelo = Timina vermelha = Adenina verde = Citosina http://www.youtube.