Anda di halaman 1dari 13

PERBAIKAN DNA (DNA REPAIRING)

Sel-sel prokariotik maupun eukariotik


memiliki sistem perbaikan yang
berhubungan dengan keusakan DNA.
Semua sistem tersebut memperbaiki
secara enzimatis. Beberapa sistem
memprrbaiki secara langsung, dan ada
beberapa yang memperbaiki dengan
cara memotong bagian yang rusak.
MEKANISME PERBAIKAN DNA
Perbaikan Kerusakan DNA
Perbaikan Kerusakan DNA
dengan cara membuang
Akibat Mutasi secara langsung
pasangan basa

Perbaikan melalui
Perbaikan oleh aktivitas
pemotongan (excision
enzim polimerase DNA
repair)
Fotoreaktivasi dimer
Perbaikan dengan bantuan
pirimidin yang diinduksi
Glikosilase
oleh UV
Perbaikan melalui koreksi
Perbaikan kerusakan akibat
pasangan basa yang salah
alkilasi
(mismatch repair)
FotoreaktivasidimerpirimidinyangdiinduksiolehUV
Perbaikankerusakanakibatalkilasi
Lanjutan........
Perbaikanmelaluipemotongan(excisionrepair)
PerbaikandenganbantuanGlikosilase
Perbaikanmelaluikoreksipasanganbasa
yangsalah(mismatchrepair)
Untuk memperbaiki basa yang tidak berpasangan harus
diketahuipasanganbasamanayangsalah.PadaE. coli,ini
dapat diketahui oleh methylase yang disebut dengan "Dam
methylase", dimana dapat memetilasi adenines yang
terdapat pada urutan (5') GATC . Segera sesudah replikasi
DNA, template strand dimetilasi, tetapi strand yang baru
disintesa belum dimetilasi.Jadi antara template strand dan
newstrandakanberbeda.
Dimulai dengan berikatannya protein
MutS pada mismatched base pairs.
Kemudian MutL mengaktifkan MutH
untuk bergabung bersama pada
urutan GATC. MutH akan membelah
strand yang tidak dimetilasi pada
tempat GATC . Selanjutnya, segment
dari tempat pembelahan akan
dibuang oleh enzim exonuclease
(dengan bantuan enzim helicase II
dan SSB proteins).
Bila pembelahannya pada bagian 3' dari
kerusakan, akan dipotong oleh enzim
exonuclease I dan bila pada bagian 5' oleh
enzim exonuclease VII atau RecJ untuk
mendegradasi single tranded DNA.
Kekosongannya akan diisi dengan bantuan
enzim DNA polymerase III dan DNA ligase.
Jarak antara tempat GATC dengan
kerusakan bisa mencapai sepanjang 1,000
base pairs
Bagaimanapun juga perbaikan sistem ini
mahal dan tidak efisien.