Anda di halaman 1dari 57

SKENARI

O2
Kelompok7
Doa sebelum
belajar
‫سَ رليأ َ مريح ص دري‬ َ‫لل ع‬
َ
‫ي‬
‫و‬ ‫قَ ةد‬
َ ‫مَ ن‬
َ
‫لي رح ش َ با‬
‫ييَ فقَ هوا‬
‫ي لسان‬
‫قَ ول‬
Robbis rohlii shodrii, wa yassirlii amrii, wahlul 'uqdatam mil lisaani
yafqohu qoulii’
“Ya Allah, lapangkanlah dadaku, dan mudahkanlah urusanku, dan lepaskanlah kekakuan
dari lidahku, supaya mereka mengerti perkataanku”

(QS. Thoha: 25-28)


Ra‫ر‬bbiَ‫بز‬zi‫د‬dnَ‫ن‬ii‫‘ي‬ilm‫عَل‬aَn‫مـا‬wَ‫و‬a‫ر‬rَzَ ‫ز‬u‫ق‬q‫ن‬nَ‫ـ‬i‫ي‬i‫ف‬fَa
‫ه‬hَm‫مـا‬an
“Ya Allah, tambahkanlah kepadaku ilmu dan berikanlah aku
pengertian yang baik.” (QS. Thaha : 114)
َ‫سه ل‬ ‫وأَ ن‬ َ‫ه‬ َ‫س إلال‬‫ه‬
‫تج عَ الَ ل‬ ‫حَ ز‬
َ‫ش‬ َ ‫مال‬ َ َ ‫ا‬
‫م‬ ‫ا‬
‫نإذ ا‬ ‫س تئ‬ ‫له‬
َ‫ه َ للَ ََ جع‬
Allaahumma Laa Sahla Illaa Maa Ja’altahu Sahlaa Wa Anta Taj’alul
‫ لت‬Syi’ta Sahlaa
Hazna Idza
“Ya Allah, tidak ada kemudahan kecuali apa yang Engkau jadikan mudah. Dan
apabila Engkau berkehendak, Engkau akan menjadikan kesusahan menjadi
kemudahan.”
(HR Anas bin Malik ra)
Skenar
io
W adalah seorang mahasiswa kedokteran yang tertarik dengan ilmu kedokteran
olahraga. W menjadi tertarik karena beberapa minggu ini ia mendapat bahan
observasi yang bagus untuk diikuti. Dua orang teman W yang bernama T dan D
sekarang rajin ke tempat fitness milik kakaknya. Kedua temannya ingin memiliki
kebugaran jasmani yang baik sekaligus juga memiliki bentuk musculus regio brachii
yang kekar dan tubuh atletis. T memilih untuk jenis strenght training menggunakan
dumbbell salah satunya. Sedangkan, D memilih untuk endurance exercise
menggunakan treadmill dibandungkan dengan stationary bike. Dia berharap bahwa
kekuatan musculus pada regio femoris, regio cruris akan bertambah. Setelah
berjalan 3 bulan latihan tersebut, tibalah saatnya untuk dinilai hasil dari latihan
fisiktersebut.Ternyata sudahnampakhasilyangberbeda dari Tdan D.
Keywo
rd
Kedokeranolahraga, kebugaranjasmani,observasi, endimen exercise, tubuh
atletis,latihan fisik,musculus,fitness.
Kata
sulit
● Strengthtraining ● Regiocruris

● EnduranceExercise ● Kebugaranjasmani
● Dumbbell ● Treadmill
● Musculusregiobrachi

● Stationarybike

● Regiofemoris

● Kedokteranolahraga
Klarifikasi
istilah
1. Strengthtraining

Adalah latihan secarakonsistenyangditujukan untukmeningkatkanrunning


economy (RE)dan karakteristikneuromuscular seperti kemampuan untuk
memproduksi kekuatandan kecepatanmaksimal( Blagrove,2018 )
2. EnduranceExercise

Adalah latihan yang dilakukan dengan tujuan meningkatkan kemampuan


manusiauntukmengatasikelelahanyangtimbul setelahmelakukanaktifitas
tubuh olahragadalamwaktuyanglama( AhmadI.P,2014) .
3. Dumbbell

dumbbell adalah beban yang praktis dan aman untuk meningkatkan


kekuatan,dayaledak,dan dayatahanotot,yangmerupakan salahsatufariasi
dari latihan beban yang memiliki tujuan untuk meningkatkan kekuatan otot
lengandan bahu terutamaototbisep( Hamid M., 2018 )
4. Musculusregio brachii

Adalah otot otot yangterletakdibagianlenganatasdibagimenjadidua yaitu


bagianventraldan dorsal ( Sobottaedidi 24,Hal:41-42 )
5. Stationarybike

adalahsebuahperangkatlatihan untukmelatih komponenritmik natural


padatubuh manusia( MaculawiczJ.,2015)
6.Regio femoris

terdiri dari dua katayaitu Regio adalah posisi , sedangkan femoris adalah
tungkaiatas.Jadi,regiofemorisadalahdaerahtungkaiatas( Sobottaedisi21,
Hal:405)
1. Kedokteranolahraga

merupakan salah satu cabang ilmu kedokteran yang mengkhususkan


pembahasan pada penggunaan olahraga sebagai media atau sarana untuk
mencapaiderajatkesehatanyangoptimalmelaluiupayapromotif, preventif,
kuratif, dan rehabilitatif ( Afriwardi, 2011)
1. Regiocruris

Merupakan anggotagerakyangberfugsi untukmelakukanpergerakandan


menahan berat tubuh ataumenahan gayaberat sehinggaanggotagerakini
memilikitulang yangbesardan strukturpersendian yangrelatif lebihstabil (
RezaM., 2015 )

Merupakan anggotagerakbagianinferior yangterdiri dari fibula dan tibia


sertaotot otot ( Sobotta, Hal:244 )
1. Kebugaranjasmani

Adalah kemampuan tubu seseorang untuk melakukan tugas dan pekerjaan


seharihari dengan giatdan waspadatanpamengalamikelelahanyangberarti,
sertamemilikicadanganenergiuntukmenghadapi hal haldarurat yangtidak
terduga sebelumnya( Bilianti,Dkk,2018 ).
Treadmill
adalahsalahsatuolahragayangbersifatkardiovaskular yangbaikdigunakan
untuk menjadi alernatif pilihan dalam mengatur tekanan darah yang
gunanya adalah untuk menilai kondisi jantung, dengan cara merekam
jantung disertailatihan fisik( EnggelB.,2013 )

adalahalatolahragayangberfungsiuntuklatihan kekuatanotot jantung dan


paru untukmeningkatkankebugaranVO2max( IndahS.,2012 )
Rumusanmas
alah
1.Apakahperbedaandari enduranceexercisedenganstrength training?

2.Apaperbedaanenduranceexercisemenggunakantreadmilldengan stationary bike?

3.Bagaimanacarauntuk menambahkekuatansertamassamusculus?

4.Mengapakebugaranjasmanidapatdipengaruhi oleh strengthtraining dan


enduranceexercise?

5.Bagaimanastruktur anatomidari extremitasatasdan bawah?


Hipote
1. Apakah perbedaan dari endurance exercisedengan strengthtraining?
sis Endurance Exercise Strength training

Latihan stamina Otot

Tujuan Untuk meningkatkan kemampuanserta Untuk meningkatkan running economy (RE) dan
mengatasi kelelahan karakteristik neuromuscular
Adaptasi Memacu denyut jantung Hipertropi

Alat Menggunakan alat alat yang membuat lelah Menggunakan alat beban sepertidumbbell

Otot Ekstremitas bawah Ekstremitas atas/ bawah

Fisiologis Terjadi hipertropi namun tidak sebesar Terjadi hipertropi yang lebih besar dari pada
strength training, serta menaikkan intensistas endurance training
denyut jantung
2. Apaperbedaanenduranceexercisemenggunakan treadmilldengan
stationarybike?

Untuk endurance exercisemenggunakan treadmill, gerakan ketika berlari


lebih kegerakan ekstensi, dimana pada regio femoralis, M. quadriceps
femorisdan sartorius sertapadaregio cruris(M. Tibialisanterior, M. Extensor
digitorum longus,M extensorhallucislongus,M. Fibularis longus,M. Fibularis
brevis, M. Fibularis tertius) lebih sering mengalami kontraksi. Sehingga otot
otot tersebutterlatih dan mengalamihipertrofi.(Prometheus Edisi 3)
● 2. Apaperbedaanenduranceexercisemenggunakan treadmill dengan
stationarybike?
Sedangkanuntukstationarybikeadalahgerakangabungandari ekstensidan
fleksi,dimanaseluruh otot yangberada di ekstremitasinferior berkontraksi
dan terlatih sehinggamengalamihipertrofi.
3. Bagaimanacarauntukmenambahkekuatansertamassa musculus?

1. Dengan olahragadalambentuk peningkatankardio ataulatihan aerobik


dalam waktuseminggu 3kali
2. Latihanbebandengan dumbbell
3. Cukuptidur atauistirahat7-8 jam sehari
4.Cukupprotein dan kalori,karbohidratrendah lemaktakjenuh
( AlfinH., 2016 )

Dengan caralatihan latihan otot sepertiangkatbeban,pull-up, dan lain lain


4. Mengapakebugaranjasmanidapat dipengaruhi oleh strengthtrainingdan
enduranceexercise?
Latihanyangdilakukansecarateratur dan sistematissesuaidenganprogram
yang telah dibuat dengan baik mampu memberikan efek yang signifikan
terhadap otot-otot yang terlibat dalam pelaksanaan latihan. Dengan
menerapkan program latihan yang memperhatikan prinsip ini, maka otot
senantiasa akan memperoleh rangsang yang memungkinkannya berubah,
atau dengan katalain mengalami adaptasi latihan Tubuh akan melakukan
adaptasi sehingga menimbulakan efek bagi otot. Adaptasi sebagai efek
latihan pada otot menyebakan terjadinya perubahan pada sistem aerobik
dan sistem anaerobik pada otot, adapun perubahannya adalah sebagai
berikut:
1. Perubahan yangterjadi pada sistem aerobik
a.MeningkatnyakandunganmyoglobinMyoglobinadalahsenyawa protein
yangkomplekyangmenyerupai hemoglobin
didalamdarah. Oksigendi simpandi dalam ototmelalui gabungan senyawa
kimiawidan myosin. Myoglobinsering diistilahkan sebagaihemoglobin otot,
karna fungsinyayang samadengan hemoglobin dan terdapat di dalam otot.
Selain menyimpan oksigen myoglobin juga berfungsi untuk memfasilitasi
penyaluran oksigen dari darah kemitokondria. Myoglobin lebih banyak
terdapat pada otot slowtwitch.Padalatihan ketahananbanyakmemerlukan
oksigensehinggapadalatihan ketahanan kadarmyoglobindapatmeningkat
75%- 85%.
b.Meningkatnya oksidasi glikogen
Latihandapatmeningkatkankapasitasotot sketeluntuk memecahglukosamelalui
prosesoksidasisehinggamenghasilkanenergi. Halini terjadi padaolahragaaerobik
sepertilari dengan intensitassubmkasimal,padasaatberlari otot akanmenguras
energiyangterbuktidari kadatglukosadarah yangmengalamipenurunan setelah
latihan,namun tubuh berupaya memperbaiki kadarglukosadarah pada saatfase
pemulihan(LesmanHS,2018).Latihanyangdilaksanakansecararutin menyebabkan
otot teradaptasikarenabisamenggunakan oksigensecaralebih efisiensehinggabisa
lebih memiliki ketahanan beraktivitas tanpa kelelahan Dengan kata lain otot akan
beradaptasisehinggakapasitasotot sketeluntuk menghasilkanenergi secaraaerobik
meningkat. Dua hal yang menyebankan terjadinya peningkatan oksidasi oksigen
karena latihan adalah meningkatnya jumlah dan ukuran mitokondria dan
meningkatnyaaktivitasenzim sirkluskrebdan transport elektron.
● 1)Meningkatnya jumlah dan ukuran mitokondria
Latihan daya tahan menghasilkan peningkatan dalam ukuran dan jumlah
mitokondria dalam otot rangka yang terlibat dalam latihan. Kemampuan
untuk menggunakan oksigen dan menghasilkan ATPtergantung pada
jumlah, ukuran,dan efisiensi pada mitokondriamenjadilebihbesar.Jumlah
mitokondriabergantung padatingkataktivitasmetabolismesuatu sel.
Semakinbanyakaktivitas,makaakansemakinbanyakpula mitokondria-nya
Latihanbanyakmenyebabkangangguandalam homeostasisselulerdi tulang
otot,sehinggamustahiluntukmenentukanfaktoryangbanyakbertanggung
jawab
5. Bagaimanastruktur anatomidari extremitasatasdan bawah?
Ekstremitassuperior
Ekstremitasatasmemilikianatomi yanglebihspesifik, yakni
klavikula,scapula,tulanglenganatas(humerus),dua tulanglenganbawah
radiusdan ulna,delapan tulang pergelangan,limaruasjari-jari (metacarpal)
dan empatbelasruasjari (phalanx)yangmerupakananggotatubuh yang
seringdigunakan(Norton, 1996:7).
EkstremitasInferior
Anatomiekstremitasbawahterdiri atastulangpelvis,femur, tibia, fibula,
tarsal,metatarsal,dan tulang-tulangphalangs.
Peta Exercise

konsep
Strength Menghasilkan
Endurance
training Exercise

Stationar
Dumbell Treadmill
y Bike

Extremit as Extremita
Superior s Inferior

Vaskulari
Tulang Vaskularisasi Otot Otot Tulang
sasi

Adaptasi
Adaptasi Adaptasi Adaptasi Kardiovas
Molekuler Metabolisme Otot kular
LO
1. Fisiologis ototrangka

2. Strukturanatomiextremitassuperior dan inferior


3. Exercise
4. AerobdanAnaerob
5. Adaptasiotot rangkapada latihan enduranceexercisedan strength
training
Fisiologis Otot

Sistem otot (Otot rangka) menggerakkan tulang, tempat melekatnya otot


rangka. Otot rangka biasa digolongkan sebagai alat gerak aktif sementara
tulang tempat otot melekat disebut alat gerak pasif. Beberapa otot bekerja
secara sinergistik untuk menghasilkan aktifitas yang sama sementara yg
lain bekerja antagonistik. Beberapa otot yang bekerja bersama disebut otot
sinergis sementara beberapa yg bekerja saling berlawanan disebut otot
antagonis. Sistem saraf mengatur aktifitas otot ini dengan sangat cermat
sehingga gerakan menjadi normal dan tidak terpatah-patah. Suatu gerakan
sesungguhnya merupakan rangsangan bersama baik pada otot sinergis dan
otot antagonis akan tetapi sistim saraf akan mengatur otot yang mana yang
dieksitasi dan otot mana yang diinhibisi.
Fisiologis Otot Rangka
Jaringanotot rangka terutama melekat pada tulang dan berfungsi
menggerakkan bagian-bagian skeleton. Jaringanotot ini tergolong otot
bercorak/striated karena pada pengamatan mikroskopik jaringan ini
memperlihatkanadanyagaris/pitagelapterangbergantian.Jaringanotot rangka
bersifat volunter karena berkontraksi dan berelaksasi di bawah kontrol
kesadaran. Jaringanotot jantung juga tergolong otot bercorak tetapi
kontraksinyatidakdibawahkontrolkesadaran(sunnywangko, 2014)
Fisiologi otot
• Otot • Beberapa
Rangka • Serat Nukleus
Otot
(Silindris)

Otot akan berkontraksi dan


relaksasi ketika menerima
rangsang dari saraf
Proses Kontraksi
Mekanisme Otot Rangka :
Kontraksi otot secara umum mengikuti urutan proses berikut :
1.Aksi potensial dihantarkan sepanjang saraf dan berakhir pada membran otot
2.Pada ujung saraf dilepaskan neurotrasnmitterasetilkolin
3.Asetilkolin akan bekerja pada membran serabut otot dan membuka gate Natrium
4.Masuknya ion Natrium dalam jumlah banyak memulai terjadinya aksi potensial pada membran otot
5.Aksi potensial dihantarkan sepanjang membran otot sebagaimana yang terjadi pada membran saraf
6.Aksi potensial yang terjadi di membran otot akhirnya sampai ke bagian tengah otot yang menstimulasi
retikulum sarkoplasma melepaskan ion Kalsium
7.Ion Kalsium akan berikatan dengan troponin-C, dan ini mengawali ikatan antara aktin dengan myosin
8.Ikatan antara aktin dan myosin menyebabkan kedua filamen ini saling menarik ke arah tengah (sliding
filament mechanism) dan inilah yang disebut kontraksi otot
9.Setelah beberapa waktu, ion Kalsium dipompa kembali ke retikulum sarkoplasma, lalu terjadi pelepasan
ikatan antara aktin dan myosin (relaksasi).
Sistem Metabolik Otot dalam Kerja Fisik
Pengukuran kuantitatif khusus pada aktivitas ketiga sistem metabolisme sangat penting dalam
memahami batas-batas aktivitas fisik. Sistem-sistem tersebut adalah (1) sistem fosfokreatin-kreatin,
(2) sistem glikogen-asam laktat, dan (3) sistem aerobik.
Adenosin Trifosfat. Sumber energi sesungguhnya yang digunakan untuk kontraksi otot adalah
adenosin trifosfat (ATP), yang memiliki rumus dasar sebagai berikut. Adenosin-PO3 ~ PO3 ~ PO3
Ikatan yang melekatkan dua fosfat radikal terakhir kepada molekul, yang dilambangkan dengan simbol
~ .adalah ikatan fosfat berenergi-tinggi. Setiap ikatan ini menyimpan 7.300 kalori energi per mol ATP
pada kondisi standar (dan bahkan sedikit lebih banyak pada kondisi fisik tubuh, yang sudah dibahas
secara mendalam di Bab 67). Oleh karena itu, bila satu radikal fosfat dilepaskan, lebih dari 7.300
kalori energi dibebaskan untuk menggerakkan proses kontraksi otot. Kemudian, bila radikal fosfat
kedua dilepaskan, tersedia lagi 7.300 kalori. Pelepasan fosfat yang pertama mengubah ATP menjadi
adenosin difosfat (ADP), dan pelepasan kedua mengubah ADP menjadi adenosin monofosfat (AMP).
Jumlah ATP dalam otot, meskipun pada atlet yang terlatih dengan baik, cukup untuk mempertahankan
daya otot maksimal selama hanya sekitar 3 detik, mungkin cukup untuk setengah bagian lari cepat 50
m. Oleh karena itu, kecuali untuk beberapa detik, penting bahwa ATP yang baru terus-menerus
dibentuk, bahkan selama performa dalam berbagai lomba atletik yang singkat. Gambar 84-1
menampilkan keseluruhan sistem metabolisme, menggambarkan pemecahan ATP mula-mula menjadi
ADP dan kemudian menjadi AMP, dengan pelepasan energi ke otot untuk kontraksi.
Anatomi Ekstremitas
Superior
● Ekssuperior
Ekstremitasatasmemilikianatomi yang
lebih spesifik,yakni
klavikula,scapula,tulanglenganatas
(humerus),dua tulang lenganbawahradius
dan ulna,delapan tulangpergelangan, lima
ruas jari-jari (metacarpal) dan empat belasruasjari (phalanx)yang
merupakan anggota tubuh yang sering digunakan (Norton, 1996:7).
Pendarahan arteri ekstremitas atas

Pendarahan ekstremitas atas disuplai oleh


a.aksilaris, yang merupakan cabang dari
a.subclavia (baik dextra maupun sinistra).
A.aksilaris ini akan melanjutkan diri sebagai
a.brachialis di sisi ventral lengan atas,
selanjutnya pada fossa cubiti akan bercabang
menjadi a.radialis (berjalan di sisi lateral
lengan bawah, sering digunakan untuk
mengukur tekanan darah dan dapat diraba
pada anatomical snuffbox) dan a.ulnaris
(berjalan di sisi medial lengan bawah).
Pendarahan vena ekstremitas atas

Vena-vena yang ada di tangan, seperti v.intercapitular, v.digiti


palmaris dan v.metacarpal dorsalis akan bermuara pada
v.cephalica dan v.basilica di lengan bawah. Dari distal ke
proksimal, kedua vena ini akan mengalami percabangan dan
penyatuan membentuk v.mediana cephalica, v.mediana basilica,
v.mediana cubiti, v.mediana profunda dan v. mediana
antebrachii sebelum mencapai regio cubiti. Setelah regio cubiti,
vena-vena tersebut kembali membentuk v.cephalica dan
v.basilica. V.basilica akan bersatu dengan v.brachialis (yang
merupakan pertemuan v.radialis dan v.ulnaris) membentuk
v.aksilaris di mana nantinya v.cephalica juga akan menyatu
dengannya (v.aksilaris). V.aksilaris akan terus berjalan menuju
jantung sebagai v.subclavia lalu beranastomosis dengan v.jugularis
interna dan eksterna (dari kepala) membentuk
v.brachiocephalica untuk selanjutnya masuk ke atrium dextra
sebagai vena cava superior.
Anatomi Ekstremitas
Inferior
●Ekstremitas Inferior Extremitas
inferior dapat dibagi dalam
beberapa regio dan ruang.
Regio-regionyaterbagiatasregio
glutea,extremitassuperior, lutut,
extremitasinferior (regio cruris),
pergelangankaki,dan kaki.(Reza M
2015) ,
Otot Primer Ekstremitas Inferior

Otot primer adalah otot


yang paling utama
digunakan saat berlari,
yaitu: quadriceps femoris
group, hamstring group,
gluteus maximus, iliopsoas
dan gastrocnemius.
Pendarahan arteri ekstremitas bawah
Pendarahan ekstremitas bawah disuplai oleh a.femoralis,
yang merupakan kelanjutan dari a.iliaka eksterna (suatu
cabang a.iliaka communis, cabang terminal dari aorta
abdominalis). Selanjutnya a.femoralis memiliki cabang
yaitu a.profunda femoris, sedangkan a.femoralis sendiri
tetap berlanjut menjadi a.poplitea. A.profunda femoris
sendiri memiliki empat cabang a.perfontrantes. Selain itu
juga terdapat a.circumflexa femoris lateral dan
a.circumflexa femoris medial yang merupakan
percabangan dari a.profunda femoris.
Pendarahan vena ekstremitas bawah

Arcus vena dorsalis yang berada di daerah dorsum pedis akan


naik melalui v.saphena magna di bagian anterior medial
tungkai bawah. V.saphena magna tersebut akan bermuara di
v.femoralis. Sedangkan v.saphena parva yang berasal dari
bagian posterior tungkai bawah akan bermuara pada
v.poplitea dan berakhir di v.femoralis. V.tibialis anterior dan
v.tibialis posterior juga bermuara pada v.poplitea.

Dari v.femoralis, akan berlanjut ke v.iliaca externa lalu


menuju v.iliaca communis dan selanjutnya v.cava inferior.

Selain itu terdapat juga v.glutea superior, v.glutea


inferiordan v.pudenda interna di daerah gluteus, yang
bermuara ke v.iliaca interna.
EnduranceExercise
● Endurance training adalah latihan melakukan gerakan secaraterus-
menerus dengan intensitas yang tinggi dan dalam waktu yang lama.
Menurut Suharjana latihan yang baik adalah 2-5 kali dalam seminggu.
Endurance training dibagi menjadi dua yaitu cardiovascular endurance
(dayatahankardiovaskular)dan musculusenduranceand strength(daya
tahan dan kekuatan otot). Dapat disimpulkan juga endurance training
merupakanlatihan mengukur intervalrasiokerjadenganistirahat(IGede
Beni Sanjaya,2016)
Strength Training
Strengthtrainingadalahlatihan yangmenekankanpada kemampuan kondisi
fisikmanusiayangdiperlukandalam peningkatanprestasibelajar gerak.
Strengthtrainingjugamenjadisalahsatuindikatoruntuk pencapaian
kebugaranjasmaniyanglebih baik(BayuPurwo, 2016).
Proses Aerobik
Dengan menerapkan program latihan yang memperhatikan prinsip ini,
maka otot senantiasa akan memperoleh rangsang yang memungkinkannya
berubah, atau dengan kata lain mengalami adaptasi latihan Tubuh akan
melakukan adaptasi sehingga menimbulakan efek bagi otot. Adaptasi
sebagai efek latihan pada otot menyebakan terjadinya perubahan pada
sistem aerobik pada otot, adapun perubahannya adalah sebagai berikut:
1. Meningkatnya kandungan myoglobin
2. Meningkatnya oksidasi glikogen
3. Meningkatnya jumlah dan ukuran mitokondria
4. Meningkatnya aktivitas enzim sirklus kreb dan transfer electron
5. Meningkatnya simpanan glikogen otot.
6. Meningkatnya oksidasi lemak
Meningkatnya kandungan myoglobin

Myoglobin adalah senyawa protein yang komplek yang menyerupai hemoglobin didalam
darah. Oksigen di simpan di dalam otot melalui gabungan senyawa kimiawi dan myosin.
Myoglobin sering diistilahkan sebagai hemoglobin otot, karna fungsinya yang sama
dengan hemoglobin dan terdapat di dalam otot. Selain menyimpan oksigen myoglobin
juga berfungsi untuk memfasilitasi penyaluran oksigen dari darah ke mitokondria.
Myoglobin lebih banyak terdapat pada otot slow twitch. Pada latihan ketahanan banyak
memerlukan oksigen sehingga pada latihan ketahanan kadar myoglobin dapat
meningkat 75% - 85%.
Meningkatnya oksidasi glikogen

Latihan dapat meningkatkan kapasitas otot sketel untuk memecah glukosa melalui
proses oksidasi sehingga menghasilkan energi. Hal ini terjadi pada olahraga aerobik
seperti lari dengan intensitas submkasimal, pada saat berlari otot akan menguras energi
yang terbukti dari kadat glukosa darah yang mengalami penurunan setelah latihan,
namun tubuh berupaya memperbaiki kadar glukosa darah pada saat fase pemulihan
(Lesman HS, 2018). Latihan yang dilaksanakan secara rutin menyebabkan otot
teradaptasi karena bisa menggunakan oksigen secara lebih efisien sehingga bisa lebih
memiliki ketahanan beraktivitas tanpa kelelahan Dengan kata lain otot akan beradaptasi
sehingga kapasitas otot sketel untuk menghasilkan energi secara aerobik meningkat.
Dua hal yang menyebankan terjadinya peningkatan oksidasi oksigen karena latihan
adalah meningkatnya jumlah dan ukuran mitokondria dan meningkatnya aktivitas
enzim sirklus kreb dan transport elektron.
Meningkatnya jumlah dan ukuran mitokondria

Endurance exercise menghasilkan peningkatan dalam ukuran dan jumlah mitokondria dalam otot
rangka yang terlibat dalam latihan. Kemampuan untuk menggunakan oksigen dan menghasilkan
ATP tergantung pada jumlah, ukuran, dan efisiensi pada mitokondria menjadi lebih besar. Jumlah
mitokondria bergantung pada tingkat aktivitas metabolisme suatu sel. Semakin banyak aktivitas,
maka akan semakin banyak pula mitokondria-nya.
Latihan banyak menyebabkan gangguan dalam homeostasis seluler di tulang otot, sehingga
mustahil untuk menentukan faktor yang banyak bertanggung jawab untuk mendorong
peningkatanbiogenesis mitokondria. Namun John O. Hollozy telah menunjukkan bahwa latihan
olahraga meyebabkan peningkatan pesat dalam biogenesis mitokondria yang dimediasi baik oleh
aktivasi dan peningkatan ekspresi transkripsi (pembuatan) coactivator, Peroksisom proliferator-
diaktifkan reseptor gamma-1alpha coactivator (PGC-1alpha). PGC-1alpha merupakan faktor
transkripsi yang mengatur ekspresi gen nukleus yang menyandi protein mitokondria dan juga dari
gen nukleus yang mengkodekan faktor transkripsi mitokondria A (TFAM). TFAM mengatur
transkripsi DNA mitokondria. Jadi, PGC-1alpha mengatur ekspresi protein mitokondria dalam kedua
gen reaktor dan mitokondria.
Meningkatnya simpanan glikogen otot.

Pada latihan aerobik, sumber energi lebih banyak dan efisien berasal dari lemak. Sementara
aktivitas enzim yang bertugas untuk mensistesis glikogen meningkat. Dengan demikian
memungkinkan penyimpanan glikogen pada otot bertambah. Pada suatu penelitian dinyatakan
setelah latihan terjadi peningkatan glikogen otot sebanyak 2,5 kali.
Proses Anaerobik
Dengan menerapkan program latihan yang memperhatikan prinsip ini,
maka otot senantiasa akan memperoleh rangsang yang memungkinkannya
berubah, atau dengan kata lain mengalami adaptasi latihan Tubuh akan
melakukan adaptasi sehingga menimbulakan efek bagi otot. Adaptasi
sebagai efek latihan pada otot menyebakan terjadinya perubahan pada
sistem anaerobik pada otot, adapun perubahannya adalah sebagai berikut:
1. Meningkatnya kapasitas sistem ATP – PC
2. Meningkatnya kapasitas glikolitik
Meningkatnya kapasitas sistem ATP –PC

A. Peningkatan simpanan ATP dan PC dalam otot


Phosphagen merupakan sumber energi tercepat yang bisa digunakan oleh otot, efek dari latihan
yang dilakukan dengan intensitas tinggi dan durasi yang cepat dapat meningkatkan kapasitas
Phosphagen. Peningkatan phosphagen terjadi 25% selama latihan berlangsung 2 sampai 3 hari
perminggu.

B. Meningkatnya aktivitas enzim yang membentuk dan memecah ATP


Untuk menghasilkan energi ATP akan dipecah menjadi ADP oleh enzim ATPase, setelah itu
pembentukan kembali ATP dari ADP malalui proses resistensi dengan bantuan enzim myokinase
(MK) dan pembentukan ATP dengan menggunakan phosphocreatine menggunakan enzim creatine
kinase (CPK). Efek dari latihan anaerobik otot skelet akan meningkatkan aktivitas enzim yang
membentuk dan memecah ATP.
Meningkatnya kapasitas glikolitik

Sejumlah penelitian yang dirancang dengan baik telah menunjukkan bahwa beberapa enzim
glikolisis kunci yang mengendalikan secara signifikan diubah oleh latihan fisik. Pentingnya aktivitas
enzim glikolisis meningkat adalah untuk mempercepat laju dan kuantitas glikogen dipecah menjadi
asam laktat. Oleh karena itu energi ATP yang berasal dari sistem asam laktat akan meningkat dan
mempangaruhi aktivitas.
Kesimpulan
T melakukan strength training yang merupakan olahraga anaerob. D
melakukan endurance training yang merupakan olahraga aerob. Di kedua
latihan tersebut terjadi adaptasi molekuler, adaptasi kardiovaskuler,
adaptasi otot dan adaptasi hormon. Strenght training berfokus pada
adaptasi otot karena terjadi hipertrofi otot yag lebih besar daripada
endurance exercise. Sedangkan endurance exercise lebih berfokus pada
adaptasi kardiovaskuler.
1. Guyton and Hall : Textbook of Medical Physiology, 12th edition, Saunder Elsevier, 2011
2. Fox : Human Physiology, 8th edition, The McGraw-Hill Companies, 2003
3. Lesmana HS, Broto EP. 2018. Profil Glukosa Darah Sebelum, Setelah Latihan Fisik
Submaksimal dan Selelah Fase Pemulihan Pada Mahasiswa FIK UNP. “Media Ilmu
Keolahragaan Indonesia”: 8(2): 44-48.
Doasesudah
belajar
َ‫ز َ قنا ا حَ َ قحقَ َ اواَ ر‬ َ‫تـباعه‬
َ ‫ط لباطلَ اللَ َ وأرنا اَ لبا‬
َ ‫ه َ َ م أ رنا ا َ ل‬
Allahumma arinal_haqqo َ‫ وا‬warzuqnat ‫َ قنا اج‬tibaa’ahu
َ ‫_ر‬haqqon ‫ز‬ َ‫تنابه‬
waarinal
baathila baa-thilan warzuqnaj tinaabahu
“Ya Allah Tunjukkanlah kepada kami kebenaran sehinggga kami dapat mengikutinya
Dan tunjukkanlah kepada kami kejelekan sehingga kami dapat menjauhinya”