Anda di halaman 1dari 78

REFERAT

ANESTESIAPADAPASIENGAGALGINJAL

Pembimbing:
dr.AsepHendradiana,Sp.An
dr.M.Naufal,Sp.An
dr.RizaM.Farid,Sp.An
dr.SonnyTrisnadi,Sp.An
Disusunoleh:
ClarissaTertia20100710009
MarthaRiestiana20100710026
AmiradytaMahartiza20100710076
NainaKaraminaS.20100710109

KEPANITERAANKLINIKANESTESIOLOGI
RUMAHSAKITTK.1BHAYANGKARARADENSAIDSUKANTO
PERIODE21SEPTEMBER17OKTOBER2015
FAKULTASKEDOKTERANUNIVERSITASPELITAHARAPAN

DAFTARISI

DAFTARISI.........................................................................2
KATAPENGANTAR...............................................................3
PENDAHULUAN.................................................................... 4
BABI.................................................................................5

FISIOLOGIGINJAL.....................................................................5

BABII................................................................................9

GAGAL GINJAL AKUT............................................................................. 9


GAGAL GINJAL KRONIS........................................................................20
BABIV......................................................................................47
AGEN INTRAVENA...............................................................................47
AGEN-AGEN ANTIKOLINERGIK.............................................................50
AGEN-AGEN INHALASI.........................................................................51
PELUMPUH OTOT................................................................................ 51
OBAT-OBAT REVERSAL........................................................................53
BAB V......................................................................................54
ANESTESI PADA PASIEN DENGAN GANGGUAN GINJAL RINGAN SAMPAI
SEDANG.............................................................................................. 54
BAB VI.....................................................................................60
PRINSIP ANESTESIA PADA PASIEN DENGAN GAGAL GINJAL KRONIK....60
ANESTESIA PADA PASIEN DENGAN GAGAL GINJAL..............................61
TEKNIK ANESTESI YANG SESUAI PADA PASIEN CKD............................69
PERTIMBANGAN INTRAOPERATIF.........................................................71
BAB VII.................................................................................73
MANAGEMENT POSTOPERASI..............................................................73

KATAPENGANTAR
Puji syukur kehadirat Tuhan Yang Maha Esa atas segala limpahan Rahmat dan
karunia-Nya sehingga kami dapat menyelesaikan penyusunan referat ini yang
berjudul Anestesi pada Pasien dengan Penyakit Ginjal dalam bentuk maupun isinya
yang sangat sederhana.
Dalam kesempatan ini penulis ingin menyampaikan ucapan terima kasih yang
sebesar-besarnya kepada para dokter anestesi di RS. Bhayangkara TK. I RS Polri
Sukamto atas bimbingan yang sentiasa diberikan tanpa lelah. Terima kasih juga kami
ucapkan kepada teman-teman yang sentiasa mendukung kami dan berbagi ilmu dalam
proses pembuatan referat ini. Tidak lupa juga terima kasih pada semua pihak yang
turut membantu dalam menyelesaikan referat ini.
Kami sangat menyadari bahwa penyusunan referat ini masih banyak
kekurangan yang harus diperbaiki. Oleh karena itu, kritik dan saran serta masukan
yang membangun terhadap referat ini akan diterima dengan tangan terbuka semoga
kedepannya akan lebih baik. Akhir kata, kami berharap agar referat ini dapat
membantu menambah pengetahuan dan pengalaman bagi para pembaca mengenai
Anestesi pada Pasien dengan Penyakit Ginjal secara singkat dan mendalam.

Jakarta, Oktober 2015

Penulis

PENDAHULUAN
Penyakit ginjal bervariasi dalam bentuk dan tingkat keparahan. Pasien
mungkindatangdenganberbagaikondisi,darigejalaasimtomatikhinggaterancam.
Olehkarenaitu,strategimanajemenanestesiharussesuaidengankebutuhanpasien
tertentu.
Penyakitginjalmungkintidakterdiagnosispadatahapawalkarenatingginya
ureadarahnitrogen(BUN)dankreatininhanyaterjadiketikafungsiginjalberkurang
hingga50%70%darinormal. Karenavariabilitasbesardalamjenisdantingkat
keparahan penyakit ginjal, pemeriksaan dan pengujian laboratorium fisik lengkap
(misalnya,CBC,panelkimiaserum,urinalisis)digunakanuntukmenentukankondisi
pasiendanmenentukanrencanapengelolaanperianestesiaterbaik.
Kebanyakan obat biasanya dieliminasi dari tubuh melalui ginjal. Zat yang
larutdalamairbiasanyadiekskresikantidakberubah,sedangkanmolekullarutlemak
biasanyadikonversikemetabolityanglarutdalamair,dankemudiandiekskresikan
dalam urin. Pada pasien dengan gagal ginjal kronik menyebabkan penurunan laju
ekskresiginjal,karenagangguanpadafiltrasiglomerulusginjaldanfungsitubular.
Hal ini dapat menyebabkan akumulasi obat dan metabolitnya. Konsekuensi ini
tergantungpadakarakteristikobatdanberatnyagagalginjal.
Banyak obatobatan yang biasanya digunakan selama anestesia yang
setidaknyasebagiantergantungpadaekskresirenaluntukeliminasi.Denganadanya
kerusakanginjal, modifikasidosisharusdilakukanuntukmencegahakumulasiobat
atau metabolit aktif. Efek sistemik azotemia bisa menyebabkan potensiasi kerja
farmakologikal dari agenagen ini. Observasi terakhir mungkin bisa disebabkan
menurunnyaikatanproteindenganobat,penetrasikeotaklebihbesarolehkarena
perubahanpadasawardarahotak,atauefeksinergisdengantoxinyangtertahanpada
gagalginjal.

BABI.
FisiologiGinjal
FungsiGinjal
Ginjalmerupakanorganyangpalingdominanberkerjadalamsistemurinaria,
dimana organ lainnya berfungsi hanya sebagai tempat penyimpanan dan saluran
urinaria.Adapunfungsiginjaladalahsebagaiberikut.

Mempertahankanosmolaritascairantubuhdengancaramengaturkeseimbangan

cairandalamtubuh.
Meregulasi konsentrasi dan kuantitas ionion ECF, seperti NA+, CL, K+,
Ca2+,HCO3,PO43,SO42,Mg2+.Keseimbanganioninisangatpentinguntukdijaga
karena sedikit perubahan terhadap keseimbangan ion dapat berdampak fatal,

contohimabalansionK+.
Mengaturdanmempertahankanvolumeplasma.
Mengaturkeseimbanganasamdanbasa
Mengekskresi sisa hasil metabolisme tubuh seperti urea, asam urat, kreatinin,
bilirubin. Zatzat tersebut bersifat toksik, terutama terhadap otak, bila terjadi
penumpukanakibatakumulasizatzattersebutyangtidakdapatdibuang.Selain
itu, ginjal juga mengekskresi substansisubstansi asing, seperti obat, pengawet

makanan,danbahanbahanlainyangtidakdapatdimetabolismedalamtubuh.
Memproduksihormonhormon,sepertihormonerythropoietinyangmenstimulasi
produksiseldarahmerahdancacitriol,bentukaktifvitaminD,yangmeregulasi

homeostasiskalsium.
Membantumeregulasitekanandarah.Denganmensekresikanenzimrenin,yang
mengaktifkan reninangiotensinaldosteron sehingga terjadi kenaikan tekanan
darah.

Prosesmekanismeproduksiurin
FiltrasiGlomerular
Filtrasiglomerular adalah proses masuknyaatau terfiltrasinya plasma non
proteindarahyangmelewatiglomerulusdariarteriolaferenkekapsulaBowman.

Biasanyasekitar1620%daridarahyangmelewatiglomerulusakanterfiltrasimasuk
ke kapsula Bowman. Ratarata, hasil filtrasi glomerular adalah 125ml/menit atau
sekitar 180L/hari. Namun, 99% hasil filtrasi glomerular akan kembali ke darah
melaluireabsorpsitubularsehinggalhanya12Lyangakandieksresikansebagaiurin.

Gambar6.LapisanlapisankapsulaBowman
Untuk memasuki kapsula Bowman, darah harus melewati 3 lapisan yang
membentuk membran glomerular. Lapisan pertama adalah sel endotel glomerular
yangmempunyaiporiporibesaryangdisebutfenetrasi,dimanaterjadiperpindahan
airdansolute,namuntidakterjadiperpindahanselseldarah.Lapisankeduaadalah
basallamina,lapisanberisikolagendanglikoproteinyangbermuatannegatifsehingga
memprevensi perpindahan protein plasma yang juga bermuatan negatif. Lapisan
terakhiradalahselpodositdenganproyeksiyangdisebutpediclessalingberkaitsatu
samalainmembungkus kapilerglomerular.Celahsempitdiatarapredicles disebut
filtrationslits,menyediakancelahuntukmasuknyaair,glukosa,vitamin,asamamino,
amonia,urea,ion,danproteinyangsangatkecil.
Untuk darah dari glomerular bisa memasuki kapsul Bowman, harus ada
tekananyangmendorongnya.Tekananyangberperandalamfiltrasiglomerular:

Tekananhidrostatikdarikapilerglomerular(GBHP)yaitusekitar55mmHg,lebih
besardaritekanankapilerlainnyakarenalebihbesarnyadiameterarteriolaferen
daripadaarterioneferen.Tekananinimemaksadarahuntukmemasukikapsula
Bowman.

Tekananhidrostatikkapsular(CHP)sekitar15mmHg.Tekananiniditimbulkan
daricairanyangsudahadadikapsulardantubularmenahanmasuknyadarahke

kapsul.
Tekananosmotickoloiddarah(BCOP)sekitar30mmHg.Tekananiniditimbulkan
dariadanyaproteindiplasmadarahsehinggamenahanmasuknyadarakekapsul.

Sehingga dapat disimpulkan, tekanan yang menjadikan adanya filtrasi atau Net
FiltrationPressure(NFP)adalahGBHPCHPBCOP=55mmHg15mmHg30
mmHg=10mmHg.
GlomerularFiltrationRate(GFR)adalahjumlahfiltratyangdibentukrenal
corpusclekeduaginjalsetiapmenitnya.GFRnormaladalah125mL/menituntukpria
dan 105 mL/menit untuk wanita. GFR sangat dipengaruhi oleh NFP dan
mempengaruhi filtrasi glomerular. Untuk itu, ada tiga mekanisme tubuh untuk
menjaga GFR tetap konstan, yaitu autoregulasi ginjal, mekanisme neural dan
hormonal.
Autoregulasiginjalterjadidalamduamekanisme,yaitumekanismemyogenic
dan feedback tubuloglomerular. Naiknya tekanan darah di arteriol aferen akan
meregangkandindingarterioldansebagairespons,dindingarteriolakankontriksidan
alirandarahkerenalterlimitasisehinggaGFRtidakmengalamikenaikan.Feedback
tubuloglomerularterjadipadamaculadensadijuxtaglomerularapparatus.Kenaikan
GFRakibatnaiknyatekanandarahsistemikakanmambuathasilfiltrasibergeraklebih
cepatketubularsehinggakadargaramdanairditubulusdistalnaikdanmenyebabkan
keluarnyaATPdanadenosinedarimaculadensadanmenyebabkankonstriksiarteriol
aferen yang nantinya membuat GFR menurun. Autoregulasi ini dapat
mempertahankanGFRtetapkonstanselamatekanandarahsistemikberkisarpada80
180mmHg.
Mekanisme neural terjadi karena inervasi ginjal oleh simpatis yang
mengeluarkan epinefrin melalui aktivasi reseptor alpha1. Saat istirahat, stimulasi
simpatis cenderung rendah sehingga arteriol aferen dan eferen terdilatasi. Namun,
padakeadaanolahragaataupendarahan,stimulasisimpatisakanlebihkuatsehingga
terjadi predominasi arteriol aferen yang membuat berkurangnya urine output dan
meningkatkan aliran darah ke jaringan tubuh lain. Mekanisme hormonal terjadi
karenahormonAngiotensinIIdanAtrialNatriureticPeptide(ANP).AngiotensinII

merupakan vasokonstriktor poten arteriol aferen dan eferen sedangkan ANP yang
dikeluarkanjikavolumedarahmerengankanatriumakanmeningkatkankapilaritas
glomerularsehinggameningkatkanGFR.
ReabsorpsiTubular
Karenahasilfiltrasiglomerularyangtinggi,substansipentingsepertiair,gula,
danioniongaramakandiserapkembaliditubular,terutamaditubulusproksimal.
Carareabsorpsiadadua,yaitureabsorpsiparaselulardimanasubstansidarilumen
tubularmasukkepembuluhdarahdenganmelaluitightjunctionsdiantaraseltubular
atau reabsorpsi transelular dimana substansi harus melalui sel tubular dulu untuk
masukkepembuluhdarah.
Solutyangbiasanyadireabsorpsiadalahglukosa,asalamino,urea,danionion
sepertiNA+,CL,K+,Ca2+,HCO3,danHPO42.Reabsorpsidariairakanmenyebabkan
reabsorpsiairsecaraosmosis(reabsorpsiobligatori).90%darireabsorpsiairadalah
reabsorpsi obligatori dan biasa terjadi pada tubulus proximal dan lengkung Henle
descenden.Sedangkan10%sisanyamerupakanreabsorpsifakultatif,yaitureabsorpsi
airyangtergantungdarihormonantidiuretic,biasanyaterjadipadaduktuskolektivus.
SekresiTubular
Karenahanya20%dariplasmayangmasukkekapsulaBowmandan80%
lainnya langsung melewati arteriol eferen ke kapiler peritubular, sekresi tubular
memfasilitasi mekanisme yang cepat untuk mentransport substansi yang tidak
berguna untuk tubuh dari darah ke lumen tubular sehingga bisa di dieksresikan
sebagai urin. Substansi yang biasanya disekresi tubular adalah H+, K+, ureum,
kreatinin,dansubstansiasingsepertiobatobatandantoksinenvironmental.
H+ biasanya disekresikan ke tubulus proksimal, distal, dan kolektivus
tergantungdariasiditasdarahsehinggasekresiH+ginjalinipentinguntukmeregulasi
asambasatubuh.EksresidariK+ sangatdipengaruhidarihormonaldosteroneyang
akanmengakibatkanreabsorpsiNa+dansekresiK+.

BABII.
GAGALGINJALAKUT
Acute Kidney Injury (AKI) atau gagal ginjal akut adalah sindrom yang terdiri
dari penurunan kemampuan filtrasi ginjal yang mendadak, menyebabkan retensi urea
dan produk buangan dari nitrogen, dan terjadi gangguan elektrolit dan disregulasi
volume ekstraseluler. Kondisi ini biasanya ditandai oleh peningkatan konsentrasi
kreatinin serum atau azotemia (peningkatan konsentrasi BUN (Blood Urea Nitrogen).
Setelah cedera ginjal terjadi, tingkat konsentrasi BUN kembali normal, sehingga yang
menjadi patokan adanya kerusakan ginjal adalah penurunan produksi urin.
Komplikasi gagal ginjal akut menyebabkan 5% pasien masuk RS dan 30% masuk di
ICU. Terjadi oliguri (pengeluaran urin < 400mL/d) namun jarang terjadi sebagai
manifestasi klinis. Gagal ginjal akut sering asimtomatik dan sering didapat dengan
tanda peningkatan konsentrasi ureum dan kreatinin. Kebanyakan gagal ginjal
reversible karena dapat kembali ke fungsi normal setelah penyakit mendasar diterapi.
Gagal ginjal akut berat yang memerlukan dialisis, mempunyai mortalitas tinggi
melebihi 50%. Nilai ini akan meningkat apabila disertai kegagalan multi organ.
Walaupun terdapat perbaikan yang nyata pada terapi penunjang, angka mortalitas
belum berkurang karena usia pasien dan pasien dengan penyakit kronik lainnya.
Etiologi dan Klasifikasi Gagal Ginjal
Penyebab gagal ginjal akut secara garis besar dibagi menjadi 3 bagian, yaitu
pre-renal (gagal ginjal sirkulatorik), renal (gagal ginjal intrinsik), dan post-renal
(uropati obstruksi akut).
Penyebab pre-renal adalah hipoperfusi ginjal, ini disebabkan oleh:
1. Hipovolemia, penyebab hipovolemi misalnya pada perdarahan, luka bakar,
diare, asupan kurang, pemakaian diuretik yang berlebihan. Kurang lebih
sekitar 3% neonatus masuk di ICU akibat gagal ginjal prerenal.
2. Penurunan curah jantung pada gagal jantung kongestif, infark miokardium,
tamponade jantung, dan emboli paru.
3. Vasodilatasi perifer terjadi pada syok septic, anafilaksis dan cedera, dan
pemberian obat antihipertensi.

4. Gangguan pada pembuluh darah ginjal, terjadi pada proses pembedahan,


penggunaan obat anestesi, obat penghambat prostaglandin, sindrom hepatorenal, obstruksi pembuluh darah ginjal, disebabkan karena adanya stenosis
arteri ginjal, embolisme, trombosis, dan vaskulitis.
5. Pada wanita hamil disebabkan oleh sindrom HELLP, perlengketan plasenta
dan perdarahan postpartum yang biasanya terjadi pada trimester 3.
Penyebab gagal ginjal pada renal (gagal ginjal intrinsik) dibagi antara lain1:
1. Kelainan pembuluh darah ginjal, terjadi pada hipertensi maligna, emboli
kolesterol, vaskulitis, purpura, trombositopenia trombotik, sindrom uremia
hemolitik, krisis ginjal, scleroderma, dan toksemia kehamilan.
2. Penyakit pada glomerolus, terjadi pada pascainfeksi akut, glomerulonefritis,
proliferatif difus dan progresif, lupus eritematosus sistemik, endokarditis
infektif, sindrom Goodpasture, dan vaskulitis.
3. Nekrosis tubulus akut akibat iskemia, zat nefrotksik (aminoglikosida,
sefalosporin,

siklosporin,

amfoterisin

B,

asiklovir, pentamidin,

obat

kemoterapi, zat warna kontras radiografik, logam berat, hidrokarbon,


anaestetik),

rabdomiolisis

dengan

mioglobulinuria,

hemolisis

dengan

hemoglobulinuria, hiperkalsemia, protein mieloma, nefropati rantai ringan


4. Penyakit interstisial pada nefritis interstisial alergi (antibiotika, diuretic,
allopurinol, rifampin, fenitoin, simetidin, NSAID), infeksi (stafilokokus,
bakteri gram negatif, leptospirosis, bruselosis, virus, jamur, basil tahan asam)
dan penyakit infiltratif (leukemia, limfoma, sarkoidosis).
Penyebab gagal ginjal post-renal dibagi menjadi dua yaitu terjadinya :
1. Sumbatan ureter yang terjadi pada fibrosis atau tumor retroperitoneal, striktura
bilateral pascaoperasi atau radiasi, batu ureter bilateral, nekrosis papiler
lateral, dan bola jamur bilateral.
2. Sumbatan uretra, hipertrofi prostate benigna, kanker prostat, striktura ureter,
kanker kandung kemih, kanker serviks, dan kandung kemih neurogenik.

Tabel 1. Klasifikasi GGA menurut The Acute Dialysis Quality Initiations Group
Risk
Injury
Failure
Loss

Kriteria laju filtrasi glomerulus


Peningkatan serum kreatinin 1,5 kali atau

Kriteria jumlah urine


< 0,5 ml/kg/jam selama 6

LFG menurun 25%

jam

Peningkatan serum kreatinin 2 kali atau


LFG menurun 50%

< 0,5 ml/kg/jam selama 12

Peningkatan serum kreatinin 3 kali atau

jam

LFG menurun 75%

< 0,3 ml/kg/jam selama 24

Gagal ginjal akut persisten, kerusakan total

jam atau anuria selama 12

fungsi ginjal selama lebih dari 4 minggu

jam

ESRD
Gagal ginjal terminal lebih dari 3 bulan
Tabel 2. Kriteria diagnostik menurut The Acute Kidney Injury Network (AKIN)
Stage 1
Stage 2

Kriteria serum kreatinin


Kriteria jumlah urine
Peningkatan konsentrasi serum kreatinin < 0,5 ml/kg/jam selama >6
0,3 mg/dL dari baseline atau 50%

jam

Peningkatan serum kreatinin >100%

< 0,5 ml/kg/jam selama


>12 jam

Stage 3

Peningkatan serum kreatinin >200%

< 0,3 ml/kg/jam selama 24


jam atau anuria selama 12

jam
Tabel 3. Kriteria diagnostik menurut The Kidney Disease: Improving Global
Outcomes
Stage 1

Kriteria laju filtrasi glomerulus


Kriteria jumlah urine
Peningkatan konsentrasi serum kreatinin 1,5- < 0,5 ml/kg/jam selama 61,9 kali dari baseline atau Peningkatan 12 jam
konsentrasi serum kreatinin 0,3 mg/dL

Stage 2

Peningkatan konsentrasi serum kreatinin 2- < 0,5 ml/kg/jam selama


2,9 kali dari baseline

Stage 3

12 jam

Peningkatan konsentrasi serum kreatinin 3 < 0,3 ml/kg/jam selama 24


kali

dari

baseline

atau

peningkatan jam atau anuria selama 12

konsentrasi serum kreatinin 4,0 mg/dL

jam

Patofisiologi
Unit kerja fungsional ginjal disebut sebagai nefron. Setiap nefron terdiri dari
kapsula Bowman yang mengitari kapiler glomerolus, tubulus kontortus proksimal,
lengkung Henle, dan tubulus kontortus distal yang mengosongkan diri ke duktus
pengumpul.
Dalam keadaan normal aliran darah ginjal dan laju filtrasi glomerolus relatif
konstan yang diatur oleh suatu mekanisme yang disebut otoregulasi. Dua mekanisme
yang berperan dalam autoregulasi ini adalah:

Reseptor regangan miogenik dalam otot polos vascular arteriol aferen

Timbal balik tubuloglomerular


Selain itu norepinefrin, angiotensin II, dan hormon lain juga dapat

mempengaruhi autoregulasi. Pada gagal ginjal pre-renal yang utama disebabkan oleh
hipoperfusi ginjal. Pada keadaan hipovolemi akan terjadi penurunan tekanan darah,
yang akan mengaktivasi baroreseptor kardiovaskular yang selanjutnya mengaktifasi
sistim saraf simpatis, sistem renin-angiotensin serta merangsang pelepasan
vasopressin dan endothelin-I (ET-1), yang merupakan mekanisme tubuh untuk
mempertahankan tekanan darah dan curah jantung serta perfusi serebral. Pada
keadaan ini mekanisme otoregulasi ginjal akan mempertahankan aliran darah ginjal
dan laju filtrasi glomerulus (LFG) dengan vasodilatasi arteriol afferent yang
dipengaruhi oleh reflek miogenik, prostaglandin dan nitric oxide (NO), serta
vasokonstriksi arteriol afferent yang terutama dipengaruhi oleh angiotensin-II dan ET1.
Pada hipoperfusi ginjal yang berat (tekanan arteri rata-rata < 70 mmHg) serta
berlangsung dalam jangka waktu lama, maka mekanisme otoregulasi tersebut akan
terganggu dimana arteriol afferent mengalami vasokonstriksi, terjadi kontraksi
mesangial dan penigkatan reabsorbsi natrium dan air. Keadaan ini disebut prerenal
atau gagal ginjal akut fungsional dimana belum terjadi kerusakan struktural dari
ginjal.
Penanganan terhadap hipoperfusi ini akan memperbaiki homeostasis intrarenal
menjadi normal kembali. Otoregulasi ginjal bisa dipengaruhi oleh berbagai macam
obat seperti ACEI, NSAID terutama pada pasien pasien berusia di atas 60 tahun
dengan kadar serum kreatinin 2 mg/dL sehingga dapat terjadi GGA pre-renal. Proses
ini lebih mudah terjadi pada kondisi hiponatremi, hipotensi, penggunaan diuretic,

sirosis hati dan gagal jantung. Perlu diingat bahwa pada pasien usia lanjut dapat
timbul keadaan keadaan yang merupakan resiko GGA pre-renal seperti penyempitan
pembuluh darah ginjal (penyakit renovaskuler), penyakit ginjal polikistik, dan
nefrosklerosis intrarenal. Sebuah penelitian terhadap tikus yaitu gagal ginjal ginjal
akut prerenal akan terjadi 24 jam setelah ditutupnya arteri renalis.
Pada gagal ginjal renal terjadi kelainan vaskular yang sering menyebabkan
nekrosis tubular akut. Dimana pada NTA terjadi kelainan vascular dan tubular Pada
kelainan vaskuler terjadi:
1) peningkatan Ca2+ sitosolik pada arteriol afferent glomerolus yang menyebabkan
sensitifitas terhadap substansi-substansi vasokonstriktor dan gangguan otoregulasi.
2) terjadi peningkatan stress oksidatif yang menyebabkan kerusakan sel endotel
vaskular ginjal, yang mngakibatkan peningkatan A-II dan ET-1 serta penurunan
prostaglandin dan ketersediaan nitric oxide yang bearasal dari endotelial NO-sintase.
3) peningkatan mediator inflamasi seperti tumor nekrosis faktor dan interleukin-18,
yang selanjutnya akan meningkatkan ekspresi dari intraseluler adhesion molecule-1
dan P-selectin dari sel endotel, sehingga peningkatan perlekatan sel radang terutama
sel netrofil. Keadaan ini akan menyebabkan peningkatan radikal bebas oksigen.
Kesuluruhan proses di atas secara bersama-sama menyebabkan vasokonstriksi
intrarenal yang akan menyebabkan penurunan GFR.

Gambar 1. Patofisiologi gagal ginjal akut di renal.


Pada kelainan tubular terjadi:

1) Peningkatan Ca2+, yang menyebabkan peningkatan calpain sitosolik phospholipase


A2 serta kerusakan actin, yang akan menyebabkan kerusakan sitoskeleton. Keadaan
ini akan mengakibatkan penurunan basolateral Na+/K+-ATP ase yang selanjutnya
menyebabkan penurunan reabsorbsi natrium di tubulus proximalis serta terjadi
pelepasan NaCl ke macula densa. Hal tersebut mengakibatkan peningkatan umpan
tubuloglomeruler.
2) Peningkatan NO yang berasal dari inducible NO syntase, caspases dan
metalloproteinase serta defisiensi heat shock protein akan menyebabkan nekrosis dan
apoptosis sel.
3) obstruksi tubulus, mikrofili tubulus proksimalis yang terlepas bersama debris
seluler akan membentuk substrat yang menyumbat tubulus, dalam hal ini pada thick
assending limb diproduksi Tamm-Horsfall protein (THP) yang disekresikan ke dalam
tubulus dalam bentuk monomer yang kemudian berubah menjadi polimer yang akan
membentuk materi berupa gel dengan adanya natrium yang konsentrasinya meningkat
pada tubulus distalis. Gel polimerik THP bersama sel epitel tubulus yang terlepas baik
sel yang sehat, nekrotik maupun yang apoptopik, mikrofili dan matriks ekstraseluler
seperti fibronektin akan membentuk silinder-silinder yang menyebabkan obstruksi
tubulus ginjal.
4) kerusakan sel tubulus menyebabkan kebocoran kembali dari cairan intratubuler
masuk ke dalam sirkulasi peritubuler. Keseluruhan proses tersebut di atas secara
bersama-sama yang akan menyebabkan penurunan GFR.
Gagal ginjal post-renal, GGA post-renal merupakan 10% dari keseluruhan
GGA. GGA post-renal disebabkan oleh obstruksi intra-renal dan ekstrarenal.
Obstruksi intrarenal terjadi karena deposisi kristal (urat, oksalat, sulfonamide) dan
protein ( mioglobin, hemoglobin). Obstruksi ekstrarenal dapat terjadi pada pelvis
ureter oleh obstruksi intrinsic (tumor, batu, nekrosis papilla) dan ekstrinsik
( keganasan pada pelvis dan retroperitoneal, fibrosis) serta pada kandung kemih (batu,
tumor, hipertrofi/ keganasan prostate) dan uretra (striktura). GGA post-renal terjadi
bila obstruksi akut terjadi pada uretra, buli buli dan ureter bilateral, atau obstruksi
pada ureter unilateral dimana ginjal satunya tidak berfungsi.
Pada fase awal dari obstruksi total ureter yang akut terjadi peningkatan aliran
darah ginjal dan peningkatan tekanan pelvis ginjal dimana hal ini disebabkan oleh
prostaglandin-E2. Pada fase ke-2, setelah 1,5-2 jam, terjadi penurunan aliran darah
ginjal dibawah normal akibat pengaruh tromboxane-A2 dan A-II. Tekanan pelvis

ginjal tetap meningkat tetapi setelah 5 jam mulai menetap. Fase ke-3 atau fase kronik,
ditandai oleh aliran ginjal yang makin menurun dan penurunan tekanan pelvis ginjal
ke normal dalam beberapa minggu. Aliran darah ginjal setelah 24 jam adalah 50%
dari normal dan setelah 2 minggu tinggal 20% dari normal. Pada fase ini mulai terjadi
pengeluaran mediator inflamasi dan faktorfaktor pertumbuhan yang menyebabkan
fibrosis interstisial ginjal.

Gambar 2. Batu pada ginjal


Gejala Klinis
Gejala klinis yang sering timbul pada gagal ginjal akut adalah jumlah volume
urine berkurang dalam bentuk oligouri bila produksi urine > 40 ml/hari, anuri bila
produksi urin < 50 ml/hari, jumlah urine > 1000 ml/hari tetapi kemampuan
konsentrasi terganggu, dalam keadaan ini disebut high output renal failure. Gejala lain
yang timbul adalah uremia dimana BUN di atas 40 mmol/l, edema paru terjadi pada
penderita yang mendapat terapi cairan, asidosis metabolik dengan manifestasi
takipnea dan gejala klinik lain tergantung dari faktor penyebabnya.
Diagnosis
Diagnosis ditegakkan untuk dapat membedakan GGA pre-renal, renal, dan
post-renal. Diawali dengan menanyakan riwayat penyakit untuk mengetahui saat
mulainya GGA serta faktor-faktor pencetus yang terjadi, tanyakan pula riwayat
penyakit dahulu. Pemeriksaan fisik yang harus diperhatikan adalah status volume,
pemeriksaan kardiovaskuler, pelvis, dan rectum, dan pemasangan kateter untuk
memonitor jumlah urine yang keluar selama pemberian terapi cairan. Pemeriksaan

laboratorium harus mencakup elektrolit serum, BUN, kreatinin serum, kalsium,


fosfor, dan asam urat.
Pemeriksaan penunjang lain yang penting adalah pemeriksan USG ginjal
untuk menentukan ukuran ginjal dan untuk mengenali batu dan hidronefrosis, bila
perlu lakukan biopsy ginjal sebelum terapi akut dilakukan pada pasien dengan GGA
yang etiologinya tidak diketahui. Angiografi (pemeriksaan rontgen pada arteri dan
vena) dilakukan jika diduga penyebabnya adalah penyumbatan pembuluh darah.
Pemeriksaan lainnya yang bisa membantu adalah CT scan dan MRI. Jika pemeriksaan
tersebut tidak dapat menunjukkan penyebab dari gagal ginjal akut, maka dilakukan
biopsi (pengambilan jaringan untuk pemeriksaan mikroskopis) misalnya pada
nekrosis tubular akut. Perlu diingat pada angigografi dengan menggunakan medium
kontras dapat menimbulkan komplikasi klinis yang ditandai dengan peningkatan
absolute konsentrasi kreatinin serum setidaknya 0,5 mg/dl (44,2 mol/l) atau dengan
peningkatan relative setidaknya 25 % dari nilai dasar.
Penatalaksanaan
Tujuan utama dari pengelolaan GGA adalah mencegah terjadinya kerusakan
ginjal, mempertahankan hemostasis, melakukan resusitasi, mencegah komplikasi
metabolik dan infeksi, serta mempertahankan pasien tetap hidup sampai faal ginjalnya
sembuh secara spontan. Penatalaksanaan gagal ginjal meliputi, perbaikan faktor
prerenal dan post renal, evaluasi pengobatan yang telah diberikan pada pasien,
mengoptimalkan curah jantung dan aliran darah ke ginjal, mengevaluasi jumlah urin,
mengobati komplikasi akut pada gagal ginjal, asupan nutrisi yang kuat, atasi infeksi,
perawatan menyeluruh yang baik, memulai terapi dialisis sebelum timbul komplikasi,
dan pemberian obat sesuai dengan LFG.
Status volume pasien harus ditentukan dan dioptimalkan dengan pemantauan
berat badan pasien serta asupan dan keluaran cairan setiap hari. Pada pasien dengan
kelebihan volume, keseimbangan cairan dapat dipertahankan dengan menggunakan
diuretika Furosemid sampai dengan 400 mg/hari. Dosis obat harus disesuaikan
dengan tingkat fungsi ginjal, obat-obat yang mengandung magnesium (laksatif dan
anatasida) harus dihentikan. Antibiotik bisa diberikan untuk mencegah atau mengobati
infeksi. Untuk dukungan gizi yang optimal pada GGA, penderita dianjurkan
menjalani diet kaya karbohidrat serta rendah protein, natrium dan kalium.

PrioritasTatalaksanapadaPasiendenganAKI:
1. Mencaripenyebabdanmengoreksiprerenaldanpostrenal.
2. Riwayat medikasi dan berhentikan semua medikasi yang menyebabkan
nefrotoksin.
3. Pemberianmedikasisesuaidosisterhadapklirens.
4. Optimisasicurahjantungdanalirandarahkerenal.
5. Monitorintakedanoutputcairan,menghitungberatbadansetiapharinya.
6. Mencari dan mentatalaksana komplikasi akut seperti hiperkalemia,
hiponatremia,asidosis,hiperfosfatemia,danedemapulmonal.
7. Mencaridanmentatalaksanadengancepatinfeksidansepsis.
8. Menyediakannutrisiawal.
Menyediakan pelayanan suportif seperti kateter, profilaksis tromboembolik vena
dalamdanpsikologis
Terapi khusus GGA
Dialisis diindikasikan pada GGA untuk mengobati gejala uremia, kelebihan
volume, asidemia, hiperkalemia, perikarditis uremia, dan hiponatremia. Indikasi
dilakukannya dialisa adalah:
1. Oligouria : produksi urine < 200 ml dalam 12 jam
2. Anuria : produksi urine < 50 ml dalam 12 jam
3. Hiperkalemia : kadar potassium >6,5 mmol/L
4. Asidemia : pH < 7,0
5. Azotemia : kadar urea > 30 mmol/L
6. Ensefalopati uremikum
7. Neuropati/miopati uremikum
8. Perikarditis uremikum
9. Hipertermia
10. Keracunan obat
Kebutuhan gizi pada gagal ginjal akut :

1. Energi 2030 kkal/kgBB/hari


2. Karbohidrat 35 (max. 7) g/kgBB/hari
3. Lemak 0.81.2 (max. 1.5) g/kgBB/hari
4. Protein (essential dan non-essential amino acids)
Terapi konservatif 0.60.8 (max. 1.0) g/kgBB/hari
Extracorporeal therapy 1.01.5 g/kgBB/hari
5. CCRT hypercatabolism maximum 1.7g/kgBB/hari
GGA post-renal memerlukan tindakan cepat bersama dengan ahli urologi
misalnya tindakan nefrostomi, mengatasi infeksi saluran kemih dan menghilangkan
sumbatan yang dapat disebabkan oleh batu, striktur uretra atau pembesaran prostat.
Tabel 2. Pengobatan suportif pada gagal ginjal akut
Komplikasi
Kelebihan volume intravaskuler

Pengobatan
Batasi garam (1-2 g/hari) dan air (< 1L/hari)
Furosemid, ultrafiltrasi atau dialysis

Hiponatremia

Batasi asupan air (< 1 L/hari), hindari infuse


larutan hipotonik.
Batasi asupan diit K (<40 mmol/hari), hindari

Hiperkalemia

diuretic hemat kalium


Natrium bikarbonat ( upayakan bikarbonat

Asidosis metabolic

serum > 15 mmol/L, pH >7.2 )


Batasi asupan diit fosfat (<800 mg/hari)

Hiperfosfatemia

Obat pengikat fosfat (kalsium asetat, kalsium


karbonat)
Kalsium karbonat; kalsium glukonat ( 10-20

Hipokalsemia

ml larutan 10% )
Batasi asupan protein (0,8-1 g/kgBB/hari) jika
tidak dalam kondisi katabolik

Nutrisi

Karbohidrat 100 g/hari


Nutrisi enteral atau parenteral, jika perjalanan
klinik lama atau katabolik
Indikasi hemodialisa pada gagal ginjal akut:
1. GGT ( klirens kreatinin < 5 ml/m)
2. GGA berkepanjangan ( > 5 hari)

3. GGA dengan : a. keadaan umum yang buruk


b. K serum > 6 mEq/L
c. BUN > 200 mg%
d. pH darah < 7,1
e. Fluid overload
4. Intoksikasi obat yg gagal dengan terapi konservatif
Komplikasi
Komplikasi metabolik berupa kelebihan cairan, hiperkalemia, asidosis
metabolik, hipokalsemia, serta peningkatan ureum yang lebih cepat pada keadaan
hiperkatabolik. Pada oligurik dapat timbul edema kaki, hipertensi dan edema paru,
yang dapat menimbulkan keadaan gawat. Hiperkalemia terjadi karena beberapa hal
seperti ekskresi melalui ginjal terganggu, perpindahan kalium keluar sel, kerusakan
sel akibat proses katabolik, trauma, sepsis, infeksi, atau dapat juga disebabkan karena
asupan kalium yang berlebih, keadaan ini berbahaya karena bisa menyebabkan henti
jantung dalam keadaan diastolik. Asidosis terjadi karena bikarbonat darah menurun
akibat ekskresi asam nonvolatile terganggu dimana juga meningkatkan anion gap.
Hipokalsemia sering terjadi pada awal GGA dan pada fase penyembuhan GGA.
Komplikasi sistemik seperti:
1. Jantung
Edema paru, aritmia dan efusi pericardium.
2. Gangguan elektrolit
Hiperkalemia, hiponatremia, dan asidosis
3. Neurologi:
Iritabilitas neuromuskular, tremor, dan koma, gangguan kesadaran dan
kejang.
4. Gastrointestinal:
Mual, muntah, gastritis, dan ulkus peptikum.
5. Perdarahan gastrointestinal
6. Hematologi
Anemia, dan diastesis hemoragik
7. Infeksi
Pneumonia, septikemia, dan infeksi nosokomial.
8. Hambatan penyembuhan luka

Prognosis
Mortalitas akibat GGA bergantung keadaan klinik dan derajat gagal ginjal.
Perlu diperhatikan faktor usia, makin tua makin jelek prognosanya, adanya infeksi
yang menyertai, perdarahan gastrointestinal, penyebab yang berat akan memperburuk
prognosa. Penyebab kematian tersering adalah infeksi (30-50%), perdarahan terutama
saluran cerna (10-20%), jantung (10-20%), gagal nafas (15%), dan gagal multiorgan
dengan kombinasi hipotensi, septikemia, dan sebagainya. Pasien dengan GGA yang
menjalani dialysis angka kematiannya sebesar 50-60%, karena itu pencegahan,
diagnosis dini, dan terapi dini perlu ditekankan.

GAGALGINJALKRONIS
DEFINISI
Chronic Kidney Disease (CKD), menurut definisi oleh National Kidney
Foundation(NKF),merupakankondisiterjadinyakerusakanginjalataupenurunan
fungsi ginjal yang dinilai dengan ratio filtrasi glomerulus (GFR) dibawah 60
mL/menit/1.73mselamalebihdari3bulan.
Dengan menurunnya fungsi ginjal, maka abilitas tubuh untuk
mengekskresikanzazatsisa,sepertiurea,kreatinin,potassium,dansebagainyaakan
berkurang. Pada umumnya gejala klinis tidak aka muncul hingga jumlah sel
fungsionalnefronginjalturundibawah70%.Jikakondisiiniterusberlanjutdanunit
fungsional ginjal turun dibawah 20%, maka keadaan tersebut akan membutuhkan
terapi pengganti ginjal berupa hemodialisis atau transplantasi ginjal agar dapat
bertahanhidupdarikeadaankeadaanmengancamkehidupansepertitingginyakadar
uremiadalamdarah.KondisiinidisebutsebagaiEndStageRenalDisease(ESRD).

EPIDEMIOLOGI
National Institute of Diabetes Digestive and Kidney Disease (NIDDK)
melaporkan bahwa 1 dari 10 orang dewasa di Amerika Serikat mengidap CKD.
Tingkat insiden CKD pada kelompok usia 20 64 tahun mengalami sedikit
peningkatandaritahun20002008,sebaliknyapadakelompokusiadiatas65tahun,
tingkatinsidenCKDmeningkat2kalilipatdaritahun20002008,yaitudari1.8%
menjadi4.3%.
PrevalensiCKDmeningkatsecaradramatisseiringdenganbertambahnyausia,
yaituprevalensi4%padakelompokusia2939tahunmenjadi47%padakelompok
usiadiatas70tahun.MenurutdataUnitedStateRenalDataSystem(USRDS)tahun
2011,insidenESRDlebihtinggipadakelompokgenderlakilakidengantingkat
insiden41.1perjutapopulasipendudukdibandingkandengan256.5perjutapopulasi
pendudukpadakelompokgenderperempuan.
TingkatinsidendariCKDsemakinmeningkatsepanjangtahun.Halinidapat
dilihatdalamstudiepidemiologidivisiNephrologiFakultasKedokteranUniversitas

Indonesia (Prodjosudjadi, Suhadjono, 2009). Tingkat insiden per 1 juta populasi


pasienESRDyangmenjalanihemodialisismeningkatsetiaptahunnyadaritahun2002
sampaitahun2006,yaitu14.5,14.0,18.0,24.6,dan30.7.
TabeldibawahmennunjukkantingkatinsidensidaripasienESRDsertaterapiyang
didapatkannyadibagiberdasarkanpenyebaranareanyadiIndonesiadaritahun2002
hinggatahun2006.

ETIOLOGI
Menurut studi yang dilakukan USRDS tahun
2007, penyebab utama dari gagal ginjal kronis
adalah diabetes mellitus (43.8%), diikuti oleh
hipertensi (26.8%), glomerulonephritis (7.6%),
penyakitkistik(2.3%),penyakiturologi(2.0%),dan
sebablainnya(17.5%).
MenurutstudiepidemiologidaridivisiNefrologi
FKUI(Prodjosuadji,Suhardjono,2009),penyebab
ESRD antara lain, glomerulonefritis (36.4%),
penyakit ginjal obstruktif dan infektif (24.4%),

penyakit ginjal diabetic (19.9%), hipertensi (9.1%), sebab lain (5.2%), idiopatik
(3.8%)danpenyakitginjalpolikistik(1.2%).
AdapunpenyebabpenyebabdariCKDantaralain:

Diabetes

Hipertensi

Penyakitvascular(Renalarterystenosis,Renalveinthrombosis,Hypertensive
nephrosclerosis)

Penyakitglomerularprimer(IgAnefropati,glomerulonephritis)

Penyakit glomerular sekunder(autoimun seperti SLE dan RA,penggunaan


heroin,thromboticthrombocytopenicpurpura)

Penyakitginjalkistik

Penyakittubulointerstitial(obatobatansepertiSulfonamidedanallopurinol
infeksi,dansarcoidosis)

Obstruksiataudisfungsitraktusurinarius(BPH,urolithiasis,striktururetra,
tumortraktusurinarius)

Defekcongenitaldariginjalataubulibuli

AcuteKidneyInjury(AKI)yangtidaktuntaspenyembuhannya

PATOFISIOLOGI
Ginjalsehatmemilikikirakira1jutanefron,dimanatiaptiapdarinefron
tersebutberkontribusipadatotalGFR.Jikaterjadikerusakanginjal,ginjalmemiliki
kemampuanuntukmempertahankanGFR,dengancaramelakukankompensasipada
nefronsisayangmasihsehat,denganhiperfiltrasidanhipertrofisehinggaginjaltetap
dapat mempertahankan fungsinya untuk mengekskresikan produk sisa metabolism
tubuh. Biasanya perubahan komposisi darah, seperti kenaikan kadar ureum dan
kreatininbaruakanmunculjikatotalGFRsudahturundibawah50mL/menit/1.73m.
Kompensasihipretrofidanhiperfiltrasiyangdilakukanolehnefronsehatsisanya
ini akan menyebabkan perubahan fungsional ginjal yang walaupun memiliki efek
yang menguntungkan, namun nantinya akan menyebabkan kerusakan pada nefron

tersebut, terutama pada bagian


glomerulus. Penurunan jumlah
nefron akan memaksa nefron
sisanyauntukterjadihipertrofidan
vasodilatasi serta peningkatan
tekanan arterial via aktivitas
RAAS untuk menaikkan GFR.
Kondisi ini akan meningkatkan
tekanan

glomerular

dan

menyebabkan hiperfiltrasi, yang


nantinya akan bermanifestasi sebagai proteinuria. Peningkatan tekanan glomerular
danstretchingdariarteriolglomerularinilahyangdipercayamenyebabkansklerosis
atau penggantian jaringan normal dengan jaringan fibrotic pada glomerular.
Proteinurianantinyaakanberefekmeningkatkanreabsorpsiproteinpadatubular,yang
nantinya akan membuat inflamasi dan fibrosis pada tubulointerstitial. Adanya lesi
fibroticinikemudianakanmenyebabanreduksilebihlanjutdarijumlahnefron,yang
kembalimemicukompensasiadaptifnefronsisanya,sehingganantinyaberakhirpada
faseESRD.
FaktoryangdinilaipalingberperandalamperkembanganpenyakitCKDadalah
proteinuriadanangiotensinII.AngiotensinIIakanberkontribusipadaaktivitassel
sel inflamatorik dan faktor faktor pertumbuhan yang berpartisipasi dalam
tubulointerstitial fibrosis. Selain itu, angiotensin II menyebabkan hiperfiltrasi dan
glomerular hipertensi dengan membuat arteriol eferen vasokostriksi dan dengan
membuat hipertensi sistemik. Tingginya tekanan intraglomerular jangka panjang
nantinya akan membuat permeablitas kapiler glomerular naik. Kompensasi
hiperfiltrasidannaiknyapermeabilitasglomerularakanmengakibatkanproteinuria.
Proteinuria ini nantinya akan berkontribusi terhadap kerusakan tubulointerstitial
denganberakumulasidiruanginterstitialdanmengaktifkankomplemenproteindan
mediatorlainnyasepertimakrofagsehinggamenyebabkanterjadinyainflamasidan
fibrosis.
Kerusakanginjalpadalokasitertentujugasangatberperandalamhilangnyafungsi
ginjal.Kerusakanpadabagianglomerularakanmengakibatkankondisiproteinuria,

hematuria, ataupun sindroma nefrotik. Sementara itu, jika kerusakannya ada pada
bagian tubular atau interstitial, maka kondisi yang lebih sering muncul adalah
asidosis,imbalanselektrolit,danabnormalitasanalisisurin.
Proses penuaan juga berperan dalam perubahan struktural maupun fungsional
ginjal.GFRmencapaipuncaknyapadausiakirakira30tahun,yaitusebesar120
mL/menit/1.73m,kemudianginjalmengalamipenurunanfungsidengankecepatan
penurunan GFR rata rata 1 mL/menit/1.73m, menjadi kira kira 70
mL/menit/1.73mpadausia70tahun.
AdanyapenurunanfungsiginjalselainberefekpadaGFR,jugamensupresifungsi
fungsi ginjal lainnya sehingga mengakibatkan komplikasi komplikasi seperti
anemia (akibat penurunan produksi hormon eritropoietin), asidosis metabolic
(ketidakmampuanginjaluntukmenekskresiionhydrogendanammonium),retensi
natrium dan cairan (penurunan GFR mengaktivasi sistem RAAS sehingga
meningkatkankadarrenin),hiperkalemia,hipokalsemiadanhiperfosfatemia.

Uremiamerupakansindromaklinisyangterdiridariimbalanscairan,elektrolit
danhormonsertaabnormalitasmetabolk,terjadibersamaandenganpenurunanfungsi
ginjal. Uremia pada umumnya terjadi jika Creatinine Clearance < 10 mL/menit.
Biasanyakelainanyangterjadiadalahanemia,asidosis,hiperkalemia,hiperparatiroid,
malnutrisi,danjugahipertensi.

KLASIFIKASI
StagingCKDdiklasifikasikanmenurutbesarpenurunandarifungsiginjal,yang
diukurdenganGlomerularFiltrationRate(GFR),yangmembandingkankadarproduk
sisadidarahpasiendenganyangadadiurinpasien.GFRdapdtdigunakanuntuk
mengukurseberapaabanyakzatsisayangdapatdifiltrasiolehginjaltiapmenitnya.
GinjalyangehatmemilikinilaiGFR>90mL/menit/1.73m.
Stage
1
2
3
4
5

Deskripsi
KerusakanginjaldenganGFRyangnormal
PenurunanGFRringan
PenurunanGFRsedang
PenurunanGFRberat
Gagalginjal

GFR(mL/menit/1.73m)
>90
6089
3059
1529
<15

Pada CKD stage 1 dan 2, penurunan GFR saja tidak dapat menegakkan
diagnosis, harus ditemukan penanda lain adanya kerusakan ginjal, seperti

abnormalitas pada komposisi darah dan urin atau abnormalitas struktural yang
tergambarkandalampemeriksaanpencitraan/imaging.Penandayangbiasanyapaling
sering digunakan untuk menilai kerusakan ginjal ini adalah adanya albuminuria.
Menurut National Kidney Foundation, GFR dan albuminuria harus dinilai secara
bersamaanuntukmenambahakurasipenilaianprigresifitasdanprognosisCKD.
MANIFESTASIKLINIS
Karena ginjal merupakan organ yang memiliki fungsi yang berkaitan dengan
sistemsistemlain,makagejalaklinisdaripenurunanfungsiginjaltidakspesifik
padaatuorgan,melainkanbermanifestasikeseluruhtubuh.Manifestasiklinisinijuga
muncul tidak secara bersamaan dalam satu periode, melainkan pada fase dimana
fungsi ginjal tersebut sudah tidak bias lagi dikompensasi tubuh sehingga
menimbulkankomplikasikomplikasiyangbermanifestasisecaraklinis.Padatable
dibawahdapatdilihatmanifestasiklinisyangbiasanyamunculseiringberjalannya
progresifitasCKD.
Stage
1
2
3

GFR(mL/menit/1.73m)
>90
6089
3059

Gejalaataukomplikasiyangmuncul
Biasanyaasimptomatis
Hipertensi
Hipertensi
Nokturia
Kenaikanserumkreatinindanureum
Hipokalsemia

1529

Anemiaringan
Hipertensi
Kenaikankreatinindanureum
Anemiaberat
Neuropathy
Hiperkalemia
Hiperfosfatemia
Dislipidemia
Retensicairan
Leftventricularhypertrophy

Anorexia
Hipertensi

<15

Kenaikanserumkreatinindanureum
Azotemia
Malnutrisi
Anemiaberat
Hiperparatiroid
Asidosismetabolik
CKD pada stage 1 sampai 3 biasanya masih belum menunjukkan gejala atau
asimtomatis.PenurunanGFRyangterjadipadastageinimasihdapatdikompensasi
oleh nefron nefron sehat yang tersisa sehingga gangguan balans cairan atau
elektrolit,kelainanendokrindanmetabolikbelumbermanifestasisecaraklinis.
PadaumumnyagejalagejalaCKDbarumunculdaristage4dimanaginjalmulai
tidakdapatmengkompensasikerusakanlanjutdarinefron.GejaladariCKDsendiri
sebenarnyaawalnyatidakspesifik,sepeetirasalelah,tidakenakbadan,danmerasa
kurangenergy.Jikafungsiginjalterusmenurun,komplikasikomplikasilainmulai
muncul,sepertiimbalanselektrolit,retensicairan,sertaasidosismetabolic.PadaCKD
stage5(ESRD)manifestasiklinisdariCKDbiasmenjadifataljikatidakditangani
akibatmanifestasitingginyakadaruremiadalamdarah.
BerikuttabelmanifestasiklinisCKDsecarasistemik.
Sistem
Skeletal

Manifestasi
Mekanisme
- Frakturpatologis
- Osteitis fibrosa (inflamasi
- Nyeritulang
tulang dengan degenerasi
- Deformitastulangpanjang
fibrosa

akibat
-

hiperparatiroid)
Osteomalacia

(resorpsi

tulang akibat defisiensi Ca


Pulmonar

Edema pulmonary (sesak


nafas, memburuk jika

danvitD)
Retensi
menyebabkan

cairan

edema

Kardiovaskular

berbaring)
Asidosis

metabolic

metabolic

(pernafasan kussmaul,

disebabkan oleh kegagalan

nyeri kepala, letargi,

renal tubular meregulasi

koma)
Hipertrofiventrikelkiri
Hipertensi
Aterosklerosis
Penyakit jantung iskemik

asambasa
Hipertensi

(nyeridadakirimemberat
-

pulmonary
Asidosis

akibat

hipersekresi renin serta


-

retensicairan
HipertrofiLVsertapenyakit
jantung iskemik karena

saataktifitas,sesaknafas)
Perikarditis (nyeri pada

anemiadanhipertensiyang

dada kiri mendadak,


memberat saat inspirasi

memberatkankerjajantung
Hiperlipidemia
mempercepat terjadinya

danbatuk)
-

ateroskelrosis
Toksin toksin dapat
berpresipitasi

Neurologi

Encephalopathy (konfusi,
sulit konsentrasi, kognitif

pericardium
Akumulasitoksinuremik
Dialysis jangka panjang
atau

penurunan

kesadaran,kejang)
Neuropati

perifer

di

bias mengakibatkan stroke

menurun, mual, muntah,


anoreksia,

perdarahan

intraserebral
Uremia

mengganggu

membrane axon saraf serta

(hipoestesia,reflextendon

inhibisiNaKATPase,serta

menurun,atrofiotot

uremia masuk ke rongga


endoneural

dan

mengakibatkan kerusakan
Endokrin

Pertumbuhan terhambat

padaanakanak
Osteomalacia

langsungpadasaraf
Tingginya kadar hormone

PTH
Uremia

mengurangi

konversi T3 menjadi T4
sehingga terjadi nonthyroid

illnesssyndrome(euthyroid
Hematologi

Anemia

normositik

sicksyndrome)
Menurunnya

sekresi

eritropoetin
Toksin

uremik

normokromik (mudah
-

lelah)
Disfungsi platelet (waktu

memperpendekwaktuhidup

perdarahanmemanjang)
Gastrointestinal

Integument

sel darah merah dan

Anorexia,mual,muntah
Stomatitis
GIbleeding
Uremicfetor
Uremicenterocolitis

Uremicfrost
Gatal
Kulit tampak pucat

(anemis)
Kulittampakkegelapan
Hematoma,ekimosis

disfungsiplatelet
Hasil pemecahan oleh
enzim

saliva

akan

menghasilkan bau yang


khas(uremisfetor)
Disfungsiplateletmembuat
resiko

terbentuknya

ekimosis dan hematoma


-

lebihbesar
Uremic frost terjadi jika
urea terakumulasi pada
keringat dan terkristalisast

setelahevaporasi
Penumpukan fosfat pada
kulit menyebabkan kulit

Imunologi

Meningkatnyaresikoinfeksi

kehitamandanrasagatal
Terjadinya

supresi
chemotaxis, fagositosis,
produksi antibody, dan

Reproduktif

Kelainanmenstruasi
Kurangnyalibido
Infertilitas

responimunseluler
Uremia mengurangi siklus
LH surge sehingga
menyebabkananovulasidan
amenorea

PemeriksaanfisikyangdapatditemukanpadapasienCKD
Tandatandavital
PadapasienCKDhamperselaluditemukantekanandarahyangtinggi.Halini
disebabkanolehaktivasisistemRAAhasilkompensasidaripenurunanfungsiginjal.
Lajunafasjugadapatmeningkatjikapasienmengalamikomplikasisepertiasidosis
metabolik.
Kulit
Salah satu komplikasi dari CKD adalah anemia dan koagulopati, sehingga
padakulitpenderitaCKDdapatditemukanhematomamaupunekimosisyangterjadi
akibatdisfungsiplatelet,ataupunpenampakankulitpasienyangpucatkarenaanemia.
Uremicpruritusataurasagatalyangterjadikarenatingginyakadaruremia
darahjugaseringmenimbulkanekskoriasiataulikenifikasijikasudahkronik.Rasa
gatalinihilangtimbulselamabeberapamenit,biasanyamemburukpadamalamhari,
dan akan diperburuk dengan udara panas, keringat, dan stress. Daerah yang gatal
biasanyaadalahdaerahpunggung,ekstremitas,dada,dankepala.
Uremicfrostmerupakandeposisidariureadanproduksisanitrogenlainyang
terakumulasipadakeringatdanterkristalisasisetelahevaporasi.Biasanyadeposisiini
berwarnaputih,tersebardantampaksepertibekuan,danterjadipadadaerahwajah.
HaliniterjadikarenakonsentrasiureadalamkeringatmeningkatjikakadarBUN
darah meningkat, evaporasi dari keringat akan mengakibatkan konsentrasi urea
tersebutterkristalisasidanberdeposisidikulit..

Mata
Conjunctivalerythemaataubiasadisebuturemiaredeyeseringditemukan
pada pasienCKD yangdisebabkan dariadanya presipitasicalcium pyrophosphate
padakorneadankonjungtivaakibatkondisihipefosfatemiapadadarah.Gejalanya
yangmunculantaralain,hiperemiskonjungtivadansubkonjungtivasertairitasiyang
nyeri.
Uremicamaurosismerupakankebutaankortikalsementarayangbiasterjadi
padakeadaanuremia,namunkejadianinisangatjarangsekaliterjadi.Padapeeriksaan
fisik,reflexpupilterhadapcahayatetapadadanpemeriksaanfunduskopijugadalam
batasnormal.Kebutaaninibiasanyahilangsendiridalam2448jamsetelahterpai
dialysisdijalankan.
Thoraks
Pada thoraks, pemeriksaan biasanya dilakukan untuk melihat adanya
komplikasipadasistemsistemkardiovaskularmaupunpulmonar.Pemeriksaanfisik
jantung meliputi inspeksi dan palpasi iktus kordis, perkusi batas jantung untuk
menentukanadanyakardiomegali,danjugaauskultasibunyijantung.
Penyakitjantunghipertensifdanjantungiskemikpadaumunyamemberikan
gambarankardiomegali.BunyijantungS4biasanyadapatterdengardanmenunjukan
adanya ventrikel yang kaku dan noncompliant karena overload yang kronik dan
hipertrofiventrikelkiri.S3lebihjarangterdengar,namunkeberadaannyabiasanya

menunjukan adanya kegagalan jantung. Bunyi murmur biasanya terdengar pada


pasiendengankegagalanjantunglanjut.
Perikarditismemilikipatognomonikspesifik,yaituberupapericardialfriction
rub yang dijumpai pada 33 85% kasus. Penemuan pericardial friction rub ini
menegakkan diagnosis walaupun ketidakadaanya tidak menyingkirkan diagnosis
perikarditis.
Penemuandalampemeriksaanfisikedemapulmonalmeliputiperkusipekakpada
basal paru, serta dapat didengarkan crackels inspiratorik pada saat pemeriksaan
auskultasi.
Ekstremitas
EkstremitaspadapasienCKDpadaumumnyadapatditemukanedema,halini
disebabkan retensi cairan. Selain itu, komplikasi kardiovaskular CKD yaitu gagal
jantungjugamenyebabkanedemapadakeduaekstremitasbawah.
Adanya hipoestesi pada ekstremitas atau kelemahan motorik dapat
menunjukanterjadinyaneuropatiperiferyangjugamerupakansalahsatukomplikasi
dariCKD.

PEMERIKSAANPENUNJANG
PemeriksaanLaboratorium

Pemeriksaandarahlengkap
o Hemoglobin dan hematokrit akan mengalami penurunan karena
terjadianemianormositiknormokromik.
o Dapat terjadi penurunan jumlah trombosit sebagai akibat dari
koagulopatikarenadisfungsiplateletakibaturemia.
o Leukosit dapat terjadi peningkatan karena pasien dengan CKD
rentanterkenainfeksi.

Kenaikanserumureumdankreatinin

Serumelektrolit
o HiperkalemiaseringterjadipadapasiendenganCKD.

Serumfofat,kalsium,danhormonparatiroid
o Tejadihiperfosfatemia,hipokalsemia,danhiperparatioridism.

Analisagasdarah
o Pasien CKD sering kali terjadi asidosis metabolic. Dapat dilihat
adanyapenurunanpHdarahsertarendahnyaserumbikarbonat.

Serumlipidprofile
o PasienCKDmakinmempermudahterjadinyaprosesaterosklerosis
danseringterjadikomplikasikesistemkardiovaskuler.

Urinalisis
Pemeriksaanurin dilakukan padapemeriksaan CKD karena seiringdengan
penurunan fungsi ginjal, kemampuan tubuh untuk mengkonsentrasikan dan
mengasidifiasikan urin juga menurun. Biasanya urinalisis dilakukan untuk
mengkonfirmasi proteinuria serta urin 24 jam untuk melihat total protein dan
creatinineclearance.
Menurut guideline dari KDOQI National Kidney Foundation, pasien tanpa
faktor resiko untuk CKD bias dilakukan screening total protein dengan tes urin
dipstick standart. Jika tes dipstick ini positif, maka pasien akan melanjutkan tes
lainnya untuk mengkonfirmasi proteinuria, seperti penghitungan total protein atau
creatinineclearancetestdariurin24jam.Pemeriksaanselanjutnyaadalahspoturin
untukrasioproteindengankreatinin(P/C).pasiendenganrasioP/Clebihdari200mg
harusmengikutipemeriksaandiagnostiklengkap.
PadascreeningpasiendenganfaktorresikoCKD,KDOQImerekomendasikan
tesurindipstickyangspesifikuntukalbumin.Hasilpositifdaripemeriksaaniniharus
dilanjutkandenganperhitunganrasioalbumindengankreatinin(ACR),denganrasio
yanglebihtinggidari30mgharusmelanjutkanevaluasidiagnostiklengkap.
KalkulasiFungsiGinjal
FungsiginjaldapatdikalkulasidenganperhitungaCreatinineClearanceTest
(CrCl)ataupundenganperhitunganGFR.
Creatinine clearance menunjukan berapa banyak darah yang bersih dari
kreatinindalamwaktutertentu.Normalnyacreatinineclearaceberkisarantara97

137mL/menitpadalakilakidan88128mL/menitpadawanita.Estimasidari
creatinine clearance dapat dihitung dengan menggunakan formula CockcroftGaut,
yaitu:
CrCl = [({140umur} x berat badan) / (serum creatinine x 72)] x (0.85 jika
perempuan)
Creatinine clearance juga dapat dihitung dengan membandingkan jumlah
keratininpadadarahdenganjumlahkreatininpadaurin24jamyaitudenganrumus
sepertiberikut:
CrCl=(urincreatinine/serumcreatinine)x(totalvolumeurin/totalwaktu)
GFRpadaumumnyadapatdihitungdenganmenggunakanbeberapaformula,
duadiantaranyayaituModificationofDietinRenalDisease(MDRD)equationdan
Chronic Kidney Disease Epidemiology Collaboration (CKDEPI) collaboration.
Antara dua formula ini, formula CKDEPI ditimbang lebih akurat dan bias
mengestimasiGFRpadapasienyangGFR>60mL/menit/1.73m.meskipunbegitu,
studiyangdilakukanSilvieromenunjukabahwakeduaformulakurangakuratdalam
menentukanGFRpasiendenganDMtipe2,dimanaakurasiekuasiCKDEPIadalah
sebesar67%dibandingkandengan74%padaformulaMDRD.
ModificationofDietinRenalDisease(MDRD)formula:

ChronicKidneyDiseaseEpidemiologyCollaboration(CKDEPI)equation:

K=0.7(wanita)atau0.9(lakilaki),a=0.329(perempuan)atau0.411(lakilaki)
RenalImaging
Renalultrasonografibiaanyadilakukanuntukmelihatukurandanbentukdari
ginjal,sertamelihathidronefrosisatauobstruksiyangbisamenjadipenyebabCKD.
Pasiendengangagalginjalbiasmemilikiginjalyangkecildanekogenik,selainitu
dapat juga ditemukan ginjal dengan ukuran normal pada padien dengan diabetic
nefropati karena adanya kompensasi. USG juga bisa mengobservasi abnormalitas
strukturalyangbiasmenyebabkanCKD,sepertipenyakitginjalpolkistik.

PadapasiendengantemuannegativepadaUSGnamundidapatkankecurigaan
akan obstruksi maka bias juga dilakukan pemeriksaan intarvena pyelografi (IVP).
Namunkarenaadanyapenggunaankontraspadapemeriksaanini,makapemeriksaan
inijarangdilakukamkarenaadanyapotensitoksisitasrenaldanhanyadilakukanjika
fungsiginjalmasihbaik,denganpembuktiankadarureumdancreatinineyangbaik
dalam darah. Untuk itu sebagai ganti dari pemeriksaan IVP dapat dilakukan
pencitraanXraytanpakontrasdenganBNO,walaupunhasilnyatidaksebaikIVP.
Untuk melihat adanya abnormalitas struktural lain pada ginjal, dapat
digunakanmodalitassepertiCTscanataupunMRI.CTscanmerupakanmodalitas
yang paling sensitive untuk mengidentifikasi batu, namun penggunaan IV contast
pada CT scan harus dihindari pada pasien dengan gangguan ginjal. Untuk pasien
tersebutdapatdilakukandenganmodalitasMRI.
RenalBiopsy
Renal biopsy paling sering dilakukan dengan cara biopsy renal perkutan
denganbantuanUSG.Biasanyapemeriksaaninidiindikasikanuntukpasiendengan
gangguanginjaldan/atauproteinuriayangdiagnosisinyamasihbelumbiasditegakkan
denganpemeriksaanpenunjanglainnya.Pemeriksaaninijugadapatdilakukanjika
diagnosispasiensudahditegakkan,namunmanajemenselanjutnyasangatbergantung
pada hasil biospsi, seperti pada penyakit lupus nefritis. Biopsy ginjal tidak
diindikasikanjikapadaUSGterlihatginjaldenganukuranyangkecildanekogenik
karenapenemuaninimenunjukaadanyaprosesscarringlanjutsertainjurikronikdan
irreversibel.
Komplikasi dari biopsy ginjal adalah perdarahan, sehingga jika resiko
perdarahansangattinggi,biopsydenganoperasiterbukadapatdiindikasikan.Biopsy
denganoperasiterbukajugadipilihjikaginjalmerupakanginjaltunggalataujika
biopsysecaraperkutansultuntukdilakukan.
Pada pemeriksaan histopatologis dari hasil specimen yang diambil dengan
biopsyginjal,dapatdilihatadanyaglomerulosclerosisdanscarringglomerulardengan
interstitialfibrosis.Penemuanininonspesifikdantidakdapatmenentukanpenyebab
darigagalginjal.

ChestXray
Pemeriksaaninidilakukanpadapasiendengankeluhannyeridadaataupun
sesak nafas. Pada pasien dengan HHD penemuan yang paling sering ditemukan
adalahhipertrofiventrikelkiri.Selaintemuantersebut,seringjugadapatdijumpai
gambarancorakanbronkovaskularkasaryangmenandakanadanyaedemapulmonal.
Electrocardiography(ECG)
Pemeriksaaninidiindikasikanpadapasiendengankeluhannyeridadaataupun
didapatkannyatemuanabnormalpadaimagingthorax.KomplikasiCKDyangsering
ditemukan pada sistem kardiovaskular adalah penyakit jantung iskemik, penyakit
jantunghipertensif,sertaperikarditis.
Pada perikarditi, perubahan ECG yang sering ditemukan adalah elevasi
segmenSTdandepresisegmenPRpadaseluruhlead,danbiasanyaditemukandalam
hitunganjamsejakterjadinysonsetsebelumterjadinormalisasisegmenSTdanPR.
BrainImaging(CT/MRI)
BrainCT/MRIdapatdilakukanjikaadanyaperubahansignifikanpadastatus
mental pasien. Pada kadar BUN darah 150 200 mg/dL, biasanya dapat terjadi
hematomasubduralspontan.PasiendengankadarBUNyangtinggijugabiasterkena
ensefalopati uremikum walaupun tidak ada penemuan yang spesifik dengan
pencitraanpadagangguanini.

PENATALAKSANAAN
CKD merupakan penyakit yang tidak dapat disembuhkan, hanya dapat
dikontroldenganobatobatanyangada.PadaapsienCKDterjadihilangnyafungsi
ginjal yang irreversibel. Glomerular dan tubular yang sudah fibrosclerosis dan
scarring tidak bias kembali menjadi glomerular dan tubular yang normal. Namun
injuriminimalyangterjadi padaglomerular masih dapatkembali menjadinormal
(reversible)jikasegeraditanganipenyebabnya.Makadenganpenangananyangtepat,
kita dapat melihat adanya perbaikan fungsi ginjal melalui kenaikan GFR dan
stabilisasi dari fungsi ginjal. Penanganan pada pasien CKD biasanya mempunyai
focusdalam:

MenahanprogresifitasCKD
MenanganimanifestasiklinisCKD
Merencanakanterapipenggantiginjaljangkapanjang

MenundaataumenahanprogresfitasCKD
Penangananyangdapatdilakukanuntukmenundaataumenahanprogresifitas
CKDantaralain:
-

MenanganikondisiyangmenjadipenyebabCKD
Mengontrol tekanan darah dan hiperlipidemia pada batasan tertentu sesuai

guidelineyangada
Mengontrol glukosa darah sesuai dengan rekomendasi American Diabetes

Association(ADA)yaitutargetHbA1c<7%
Menghindaripenggunaanobatobatannefrotoksik,sepertiIVradiocontrast,
NSAID,danaminoglikosida

Antihipertensi
Penggunaan antihipertensif pada pasien dengan CKD memiliki 3 tujuan
utama,yaituuntukmenurunkantekanandarah,memperlambatprogresifitasCKD,dan
mengurangi resiko komplikasi terjadinya CVD. Pada hasil konferensi JNC 7 (the
seventhreportoftheJointNationalCommitteeonPrevention,Detection,Evaluation,
andTreatmentofHighBloodPressure)direkomendasikanbahwatargettekanandarah
padapasiendenganCKDadalahkurangdari130/80mmHgdandibutuhkanlebihdari
1antihipertensiveagentuntukmencapaigoalini.PadalaporanJNC7disebutkanjuga
bahwadalamstudiMDRD,pasiendenganproteinuriamempunyaikecepatanyang
lebihlambatuntukprogresifitasnyamenjadiESRDjikatekanansistoliknya<130
mmHg.
JNC 7 merekomendasikan bahwa regimen antihipertensif berupa ACE
inhibitordanARBmerupakanregimenyangelektifdalammemperlambatprogresi
CKD dibandingkan dengan regimen lainnya. Guideline JNC 7 mengindikasikan
bahwa pasien CKD sebaiknya mendapatkan kombinasi ACE inhibitor atau ARB
ditambahdengandiuretic,dalamhaliniloopdiuretic,sepertifurosemide,lebihdipilih
dibandingkanthiazide.
Penggunaan ACEinhibitor atau ARB terbukti dapat menurunkan ekskresi
proteinhingga3540%,lebihbesardibandingkandenganantihipertensiflainnya

seperti diuretic dan beta bloker yang tidak menunjukan adanya efek signifikan
terhadapproteinuria.EfekACEinhibitordanARBterhadapproteinuriainilahyang
membuat regimen ini direkomendasikanmenjadi terapi antihipertensifutamapada
pasiendenganCKD.
Penggunaan ACEinhibitor atau ARB harus selalu dimonitor terjadinya
hipotensi, penurunan GFR segera setelah konsumsi, dan hiperkalemia, namun ini
dapat ditangani tanpa diskontinuitas obat. Pada kondisi dimana serum creatinine
meningkat30%daribaseline,GFRmenurun<30%daribaselineselama4bulan,dan
serumpotassium<5.5mEq/L,makapenggunaanantihipertensifiniharusdihentikan.
PenurunanGFRsegerasetelahpenggunaanACEinhibitorbukanlahhalyang
buruk,karenabiasanyapenurunannyahanya<20%danbiasanyabersifatsementara.
Hal ini disebabkan adanya reversal dari kompensasi hiperfiltrasi sehingga terjadi
penurunanGFRsegerasertakenaikanserumureumdankreatinin.Halinmemang
diantisipasi dalam penggunaan regimen tersebut, bukan berarti obat tersebut haru
didiskontinuasikan, namun malah mengindikasikan bahwa terapi tersebut sudah
mengeluarkan efek benefisialnya dalam mempertahankan fungsi ginjal. Penurunan
GFRsementarainikemudianakandiikutistabilisasibahkankenaikanGFRkarena
efekrenoprotektifdariACEinhibitoratauARBdalamjangkapanjang.
TabelberikutmenunjukkankondisidimanapenggunaanACEinhibitordan
ARBharusdihindarkan.

Antihiperglikemia
Hiperglikemia merupakan penyebab fundamental dari komplikasi vascular
CKD.Olehkarenaitu,penangananhiperglikemiamenvegahkenaikanalbuminuria
atau menghambat progresifitas penyakit. Target penanganan hiperglikemia pada
pasienCKDadalahHbA1c<7%.

Terapi hiperglikemia yang menjadi pilihan untuk pasien CKD menurut


guidelinedariKDOQIadalahobatgolongansulfonylureadaninsulin.Penggunaan
biguanida harus dihindari pada pasien dengan CKD terutama pada pasien dengan
creatinin serum > 1.5 mg/dL, karena obat ini eksresinya sangat dependen dengan
fungsi ginjal, serta efek sampingnya yang bias menyebabkan asidosis laktat.
Tiazolidiones (rosiglitazone dan piaglitazone) dimetabolisme di liver dan tidak
berhubungan dengan fungsi ginjal, namun obat tersebut berpotensi untuk
memperburuk retensi cairan. Alpha glucosidase inhibitor (acarbose, miglitol) juga
tidakbiasdiberikanpadapasiendenganserumkreatinin>2mg/dL.
Sulfonilureagenerasipertama(chlopropamide,tolazamide,dantolbutamide)
harusdihindarikarenaeliminasidariobatobattersebutdependenterhadapginjal.
Regimensulfonylureayangmenjadipilihanadalahgenerasiduadantiga(glipizide,
glibenklamid,danglimepiride).Obatinitidakbiasdiberikanpadaoranghamil,DM
tipe1,alergisulfonylurea,danpasiendenganpenyakitliver.
Sementarainsuinsendiridosisnyatidakdipengaruhiolehderajatkerusakan
ginjal namun dalam monitoring balans glycemic control untuk mencegah
hipoglikemia.Adapunpreparasiinsulindapatdipilihberdasarkanlamakerjanya.

Penanganandislipidemia
GoalterapiatasdislipidemiapadapasienCKDadalahLDLcholesterol<100
mg/dLdantrigliserida<200mg/dL.Terapiinisialyangdiberikanpadakondisiini
adalah obat golongan statin. Pada pasien CKD yang dihemodialisa, dipilih statin
denganekskresirenalyangterbatassepertiatorvastatinataufluvastin.Padapasien
yangtidakbiasmentoleransistatin,makadapatdiberikannicotinicacidataubileacid
squestrant.Kontraindikasistatinadalahpasienhamiltaunmemilikipenyakitliver.
Bile acid squestrant dikontraindikasikan untuk pasien dengan trigliserida >
400mg/dLkarenapenggunaannyabiasmenaikkanleveltrigliseridapadabeberapa
pasien. Kontraindikasi nicotinic acid adalah penyakit liver, gout, dan peptic ulcer
disease.Fibratessendirisesungguhnyadapatmenurunkanleveltrigliserida,namun
resiko rhabdomyolisisnya lebih besar pada pasien dengan CKD serta metabolism
obatnyadiginjal.
MenanganimanifestasiklinisdariCKD

Anemia
Berdasarkan rekomendasi dari guideline KDOQI, target hemoglobin pada
pasien CKD adalah 11 12 g/dL. Sebelum memulai terapi eritropoetin, harus
dilakukanevaluasimengenaiderajatdanpenyebabdarianemia.Dokterharusmulai
mempertimbangkanpenyebablaindarianemiaselaindefisiensieritropetinjikaderajat
anemiatidaksesuaidenganderajatpenurunanfungsiginjal,terdapatbuktidefisieni
besi,danterdapatleucopeniaatautrombositopenia.
Terapi inisial pilihan adalah eritropoiesis stimulating agents (ESA) seperti
epoietinalfadandarbeopoetinalfa.PadapasiendenganterapiESA,Hbharusselalu
dimonitorsetiapbulandandijagatetap1112g/dLdantidakmelebihi13g/dL.
Dosisawal10.000unitepoietinalfapermingguatau0.75ug/kgdarbepoetinalpha
perminggusecarasubkutandapatmenaikkanHb12g/dLselamaperiode48
minggu. Setelah target Hb tercapai, maka pemberiannya menjadi per bulan. Efek
sampingnya adalah nyeri pada daerah suntikan, hipertensi, dan gejela seperti flu
dalam hitungan jam atau hari setelah pemberian ESA. Efek samping yang jarang
terjadiadalahpureredcellaplasia.
Jikapadahasilevaluasianemia,ternyataanemianyamerupakantipedefisiensi
besi(transferinsaturasi<20%danlevelferritin<100ng/mL)makaperluuntuk
diberikan supplemen besi dan dicari penyebabnya. Suplemen besi yang dapat
diberikanadalahferrousgluconate300325mg3xsehariataupemberianIViron
dextran.EfeksampingpemberianyangditimbulkanadalahberupagangguanGI.
BerdasarkanrekomendasiNKFKDOQI,pemberiantransfusidarahhanyadibutuhkan
padapasiendenganperdarahanakut(biasanyaperdarahantraktusgastrointestinal),
akut hemolisis, kurangnya darah saat operasi, adanya inflamasi berat, atau pada
kondisiemergensidimanaterjadipenurunanmendadakdaristatuskesadaranpasien.
Hiperkalemia
Hiperkalemia>6.5mEq/LdenganabnormalitasECGsepertiTwavetinggi
atau AV block merupakan indikasi untuk dialysis segera. Untuk mengurangi
hiperkalemia, dapat digunakan IV calcium gluconate. Hiperkalemia nonemergensi
dapatditerapidenganobatoralpengikatpotassiumyaitupolystyrenesulfonate.

Pada kondisi hiperkalemia juga harus dipertimbangkan untuk diskontinuasi


obat obat yang mungkin berkontribusi atas hiperkalemia seperti, ACEinhibitor,
ARB,betabloker,potassiumsparingdiuretic,danjugaNSAID.
Asidosismetabolik
AsidosismetabolicpadaumunyaterjadipadapasienCKDterutamadengan
GFR < 20 mL/menit/1.73m, dan biasanya pasien tersebut memiliki kadar serum
bikarbonatberkisarantara1220mEq/L.Paraahlimerekomendasikanterapialkali
yaitu bikarbonat untuk mempertahankan serum bikarbonat > 20 mEq/L. Terapi
bikarbonatharusdigunakansecarahatihatipadapasiendenganretensicairandan
hipertensikarenaberesikomemperburukretensicairan.
PadastudiyangdilakukanDeBritoAshurstetal,ditunjukkanbahwapasien
CKDyangmenerimaterapibikarbonatmenunjukkanpenurunanfungsiginjalyang
lebihlambat.Dalamstudiini,pada134pasienCKD(CrCl1520mL/menit,serum
bikarbonat1620mEq/L)menerimaoralsodiumbikarbonatselama2tahun,dan
penurunanCrClpadagrupbikarbonatlebihrendah(1.88mL/menit)dibandingkan
dengan grup control (5.92 mL/menit). Pasien dalam grup bikarbonat lebih jarang
mengalamipemburukancepat(9%)dibandingkandengangrupcontrol(45%)serta
hanya 6% pada pasien dalam grup bikarbonat berkembang menjadi ESRD,
dibandingkandengan33%padakelompokkontrol.
Kelainantulang
PadapasienCKD,kelainanpadatulangyangterjadiadalahosteomalaciadan
osteodystrophyyangterjadiakibatdarikeadaanhipokalsemia,hiperfosfatemia,serta
hiperparatiroidism.
Kondisi hiperfosfatemia biasanya dikontrol dengan restriksi diet yang
mengandung fosfat (susu, keju, coklat, seafood, telur) serta obat pengikat fosfat,
seperti calcium acetate, calcium carbonate, sevelamer carbonate, dan lanthanum
carbonate.
Calciumacetatedancalciucarbonateberkombinasidengandietaryfosfatdi
dalamususmembuatbentukinsolublekalsiumfosfatyangtidakbiasdiserapusus
sehingga mengurangi kondisi hiperfosfatemia. Lanthanum karbonat diindikasikan

untuk pasien CKD stage 5. Dalam traktus GI atas, lanthanum berdisosiasi dan
mengikat dietary fosfat sehingga membentuk kompleks lanthanum fosfat yang
insolubel sehingga menginhibisi absorpsi fosfat. Savalemer diindikasikan untuk
pasienCKDyangmenjalankanhemodialisakarenalebihjarangmenimbulkanepisode
hiperkalsemiadibandingkandenganterapikalsiumasetat.
Kondisi hipokalsemia dan hiperparatiroidism dapat diterapi dengan analog
vitamin D (calcitriol, deoxycalciferol) yang direkomendasikan untuk pasien CKD
stage35yangtidakdialysisdanserumPTHnyamengalamikenaikan.VitaminD
meningkatkanabsorpsikalsiumdiususdanmemprevensisekresikalsiumdiginjal
sehinggamenaikkanserumkalsiumdanmengurangikadarfosfatdanPTH.Untuk
pasienyangmenerimahemodialisa,dapatmenggunakanvitaminDanalogsintetik
yaituparicalcitol.
Terapi lain untuk hiperparatiroidism adalah calcimimetic (cinacalcet) yang
meningkatkan sensitivitas reseptor kalsium di kelenjar PTH atas calcium
ekstraseluler,sehinggasecaralangsungmengurangilevelhormonePTH.Biasanya
diindikasikan untuk keadaan hiperparatiroid pada pasien CKD yang menjalani
dialisis.
RenalReplacementTherapy(RRT)
IndikasidilakukanRRTpadapasienCKDadalah:
-

Asidosismetabolicberat
Hiperkalemia > 6.5 mEq/L atau dengan perubahan ECG menjadi T wave

tinggiatauAVblock
Perikarditis
Ensefalopati
Neuropatiperifer
Overloadcairanyangsukardikontrol
PasienasimtomatisdenganGFR<9mL/menit/1.73m

Dialisis
TerapidialisispadaumumnyadiinisiasikansaatCrCl<10mL/menit,atau
bahkan<15mL/menitpadapasiendenganDM.terapidialisisdapatdilakukansecara

peritoneal dialisis atau dengan hemodialisis. Terapi dialisa tidak menyembuhkan


penyakitginjal,namunhanyamenggantikanfungsiginjalyangtelahrusak.Untuk
pasienyangtidakdapatmendapatkantransplantasiginjal,terapidialisa iniharus
dijalankanseumurhidup.
Untuk menentukan apakah kita sudah mendapatkan cukup dialisis dapat
diukurdenganUreaReductionRatio(URR)ataudenganKt/V.URRmenunjukan
seberapa efektif dialisa membuang zat sisa. URR harus berada diatas 65% untuk
dikatakanterapidialisisadekuat.URRdapatdihitungdengan[(Ureapredialisisurea
postdialisis)/ureapredialisis]x100%.
Kt/Vadalahcaralainuntukmengukuradekuasidialiis.Kmerupakandialyzer
clearance, kecepatan darah melewati dialyzer (mL/menit); t merupakan waktu;
sedangkanvmerupakanvolumeairdalamtubuhpasien(umumnya60%darikgBB).
HasilperhitunganKt/Vharusdiatas12.
Hemodialisa
Saathemodialisa,darahakandialirkankemesindialisaataudialyzer.Untuk
itu,biasanyaakandilakukanoperasiminorpadalenganbawahpasienuntukmembuat
aksesberupaarteriovenousfistulaataugraft.Dalammesindialyzer,akanadadua
bagianberisidarahdandialysateyangdipisahkanolehmembranetipis.Seldarahdan
proteintidakdapatmelewatimembranekarenaukurannyayangterlalubesar.Produk
sisa lainnya dalam darah, seperti kreatinin, potassium, dan urea akan melewati
membranedialysatedanterbuangdaridarah.Hemodialisabiasanyadilakukan23
kalidalam1minggudankirakira4jamperhemodialisa.
Peritonealdialisis
Terdapat 2 jenis peritoneal dialisis antara lain, Continuous Ambulatory
PeritonealDialysis(CAPD)danAutomatedPeritonealDialysis(APD).PadaCAPD,
dialisadilakukansepanjangwaktu,biasanyaakanmembutuhkanwaktu30menitdan
dilakukan 4 5 kali sehari. Untuk CAPD, pasien mempunyai peran aktif untuk
menjaga kebersihan abdomen serta melakukan dialisis ini sendiri. Pasien harus
membersihkan tempat kateter peritonealnya, mengeluarkan dialisate yang tadinya
dibiarkanadadironggaperitonealkekantongplasticdannantinyaakandibuang.

Kemudian pasien menghubungkan kantong berisi solusi yang baru dan


membiarkannya masuk ke rongga peritoneal. Kemudian kantong ini digulung dan
dibiarkanadadipakiandalampasiensampaiwaktudialisaberikutnya.PadaAPD,
digunakanmesihcycleryangsecaraotomatismenggantidialisatasaatpasientidur.
Transplantasiginjal
Transplantasi ginjal adalah pilihan RRT erbaik dan sangat memperbaiki
kualitashidupdansurvivalratepasien.Biasanyatransplantasirenaldipertimbangkan
sebelum dialisis karena waktu untuk menunggu donor bias lebih dari 3 tahun.
Pembedahan pada pasien uremia harus dipertimbangkan dengan teliti karena
tingginyaresikoperdarahan,penyakitkardiovaskular,depresinafas,danAKI.
Kontraindikasiuntuktransplantasiginjaladalahmalignansi,penyakitjantung,
terganggunya sirkulasi ke perifer, intoleransi posttransplantasi medikasi
(imunosupresif, seperti tacrolimus atau cyclosporine A), penyakit paru, dan
malnutrisi.
Kurangdari50%darisemuatransplantasiginjalmengalamiepisoderejeksi,
namun biasanya episode rejeksi tersebut dapat dikontrol dengan imunosupresif.
Gejaladarireaksipenolakanadalahdemamsertabengkak,perdarahan,dannyeridari
lokasiinsisipembedahan.Rejeksiinibiasterjadiakut(dalamwaktu1tahunsetelah
transplantasi)dilihatdarikenaikandrasticdariserumkreatininatausecarakronis,
biasanya diasosiasikan dengan proteinuria. Abnormalitas yang tetap ada dalam 3
bulanmerupakanindikasiuntukbiopsi.

BABIV.
AGENINTRAVENA
a.Propofol
Propofol (2,6diisopropylophenol) merupakan obat pilihan induksi anestesia,
khususnyaketikabangunyangcepatdansempurnadiperlukan.Kecepatanonsetsama
dengan barbiturat intravena, masa pemulihan lebih cepat dan pasien dapat pulang
berobat jalan lebih cepat setelah pemberian propofol. Kelebihan lainnya pasien
merasalebihnyamanpadaperiodepaskabedahdibandinganestesiintravenalainnya.
Mualdanmuntahpaskabedahlebihjarangkarenapropofolmempunyaiefekanti
muntah. Propofol tidak mempengaruhi fungsi ginjal atau hepar sebagaimana
dinyatakanolehkonsentrasienzimtransaminaseliverataukreatinin.

MekanismeKerja
Propofoladalahmodulatorselektifdarireseptorgammaaminobutiricacid(GABA).
GABAadalahneurotransmiterpenghambatutamadalamsusunansarafpusat.Ketika
reseptorGABAdiaktifkan, maka konduksi kloridatransmembran akan meningkat
mengakibatkanhiperpolarisasimembranselpostsinapdanhambatanfungsionaldari
neuronpostsinap.
InduksiAnestesi
Dosis induksi dari propofol pada orang yang sehat adalah 1.5 hingga 2.5
mg/kgBB IV, dengan kadar darah 26 g/ml yang menghasilkan ketidaksadaran
tergantungpadapengobatandanpadausiapasien.Onsethipnosis propofolsangat
cepat(onearmbraincirculation)dengandurasihipnosis510menit.Pasienlansia
membutuhkandosisinduksiyangrendah(25%hingga50%terjadipenurunan).
Rumatananestesi
Dosis khusus dari propofol untuk pemeliharan anestesia adalah 100300
g/kgBB/menitIV,seringkalidikombinasikandenganopioidkerjajangkapendek.
Anestesiaumummenggunakanpropofolmempunyaiefekmualdanmuntahpaska
operasi yang minimal dan kesadaran yang lebih cepat dengan efek residual yang
minimal.

EfekSampingPropofol
1.SindromaInfusPropofol
Sindroma infus propofoladalahkejadian yangjarang terjadidan merupakan
suatukeadaanyangkritispadapasiendenganpenggunaanpropofolyanglama(lebih
dari48jam)dandosisyangtinggi(lebihdari5mg/kgBB/jam).Biasanyaterjadipada
pasienyangmendapatsedasidiunitperawatanintensif.Sindromainiditandaidengan
terjadinya kegagalan jantung, rabdomiolisis, asidosis metabolik dan gagal ginjal.
Penanganannyaadalahoksigenasiyangadekuat,stabilisasihemodinamik,pemberian
dekstrosa,danhemodialisa.
2.Hipotensi
Hipotensimerupakansalahsatuefeksampingdaripropofol.Padadosisinduksi
22,5mg/kgBBmenyebabkanpenurunantekanandarahsistoliksebesar2540%.
Hipotensi yang berlangsung lama dapat mengganggu fungsi ginjal akibat perfusi
ginjalyangmenurun.Halinimengakibatkananuriadenganvolumeurinekurangdari
20 cc/jam. Dengan semakin berkurangnya curah jantung, terjadi respon
kompensatorik, aliran darah keginjal berkurang, retensi natrium dan air sehingga
kadarnatriumdalamkemihjugaberkurang.Sejalandenganmenurunnyalajufiltrasi
glomerulus, terjadi peningkatan ureum kreatinin. Bila hipotensi berat dan
berkepanjanganan,dapatterjadinekrosistubularakutyangkemudiandisusulgagal
ginjalakut.
b.Etomidate
Farmakokinetiketomidatetidakmempunyaiefeknyasecarasignifikanpada
gangguanfungsiginjal.75%berikatandenganprotein,penurunanikatanproteindari
etomidatepadapasienhipoalbuminemiabisamempercepatefekefekfarmakologi.

d.Ketamin
Ketaminmempunyaiefeksedatifdananalgetikyangkuat.Dosisinduksi12
mg/kgBBintravena,35mg/kgBBintramuskular. Farmakokinetikketaminberubah
sedikitkarenapenyakitginjal.Beberapametabolityangaktifdihatitergantungpada

ekskresi ginjal dan bisa terjadi potensial akumulasi pada gagal ginjal. Hipertensi
sekunder akibat efek ketamin bisa tidak diinginkan pada pasienpasien hipertensi
ginjal.
MekanismeKerja
Ketamin berikatan secara non kompetitif terhadap tempat terikatnya
phencyclidine pada reseptor NmethylDaspartate (NMDA), suatu subtipe dari
reseptor glutamat, yang berlokasi di saluran ion. Ketamin menghambat aliran ion
transmembran. Reseptor NMDA adalah suatu reseptor saluran kalsium. Agonis
endogen dari reseptor ini adalah neurotransmiter eksitatori seperti asam glutamat,
asamaspartat,danglisin.Pengaktifandarireseptormengakibatkanterbukanyasaluran
iondandepolarisasineuron.ReseptorNMDAiniterlibatdalaminputsensorispada
levelspinal,talamik,limbikdankortikal.Ketaminmenghambatataumenginterferensi
inputsensoriskesentralyanglebihtinggidarisistemsarafpusat,dimanaterdapat
respon emosional terhadap stimulus dan pada tempat untuk proses belajar dan
memori. Ketamin menghambat pengaktifan dari reseptor NMDA oleh glutamat,
mengurangi pelepasan glutamat di presinaps dan meningkatkan efek dari
neurotransmiterinhibisiGABA.
Ketaminjugaberinteraksidenganreseptormu,deltadankappaopioid.Efek
analgesiketaminmungkindisebabkanolehpengaktifanreseptorinidisentraldan
spinal.Analgesiadiperolehpadadosis0,20,75mg/kgBBintravena.
Beberapa efek ketamin dapat disebabkan karena kerjanya pada sistem
katekolamin, dengan meningkatkan aktivitas dopamin. Efek dopaminergik ini
mungkinberhubungandenganefekeuforia,adiksidanpsikotomimetikdariketamin.
Kerjadariketamininijugadisebabkanolehefekagonispadareseptoradrenergik
dan,efekantagonispadareseptormuskarinikdisistemsarafpusat,danefekagonis
padareseptor.

Opioid
Banyakopioidyangbiasanyadigunakanpadamanajemenanestesi(morfin,
meperidin, fentanil, sufentanil dan alfentanil) di inaktifasi oleh hati, beberapa
metabolitnya nantinya diekskresi di urin. Farmakokinetik remifentanil tidak
terpengaruh oleh fungsi ginjal karena hidrolisis ester yang cepat di dalam darah,

kecualimorfindanmeferidin,akumulasimetabolitbiasanyatidakterjadipadaagen
agenini.Akumulasimorfin(morfin6glucuronide)danmetabolitmeperidinepernah
dilaporkanmemperpanjangdepresipernafasanpadabeberapapasiendengangagal
ginjal.Peningkatanlevelnormeperidine,metabolitmeperidine,dihubungkandengan
kejangkejang.Farmakokinetikyangseringdigunakandariagonisantagonisopioid
(butorphanolnalbuphinedanbuprenorphine)tidakterpengaruholehgagalginjal.

AGENAGENANTIKOLINERGIK
Dalam dosis premedikasi, atropin dan glycopyrolate biasanya aman pada
pasiengangguanrenalkarenalebihdari50%dariobatobatinidanmetabolitaktifnya
diekskresinormaldiurin,potensiakumulasiterjadibiladosisdiulang.Scopolamine
kurangtergantungpadaekskresiginjal,tapiefeksistemsyarafpusatbisadipertinggi
olehazotemia.

PHENOTHIAZINES, H2 BLOCKERS DAN AGENAGEN YANG


BERHUBUNGAN.
Banyak phenothiazines, seperti promethazine dimetabolisme menjadi
komponen inaktif oleh hati. Walaupun profil farmakokinetik tidak berubah oleh
gangguan ginjal, potensiasi dari depresi pusat oleh azotemia bisa terjadi. Kerja
antiemetiknyabisabergunauntukpenangananmualpreoperatif.Droperidolsebagian
bergantungpadaekskresiginjal.Walaupunakumulasibisadilihatpadadosisbesar
pada pasienpasien dengan gangguan ginjal, biasanya droperidol digunakan pada
dosiskecil(<2,5mg)
Semua H2 reseptor bloker sangat tergantung pada ekskresi ginjal.
Metoclopramide sebagian diekskresinya tidak berubah di urin dan akan
diakumulasikan juga pada gagal ginjal. Walaupun lebih dari 50% dolasetron
diekskresikandiurin,tidakadadosisyangdisesuaikanyangdisarankanuntuk5HT3
blokerpadapasiendenganinsufisiensiginjal.

AGENAGENINHALASI

Agenagenvolatile
Agen anastetik volatile hampir ideal untuk pasienpasien dengan disfungsi
renal karena tidak tergantungnya pada eliminasi ginjal, kemampuan untuk
mengkontroltekanandarahdanbiasanyamempunyaiefeklangsungminimalpada
alirandarahginjal.Walaupunpasiendengangangguanginjalringandansedangtidak
menunjukkanperubahancepatataudistribusi,percepataninduksidantimbulnyabisa
dilihatpadaanemisberat(Hb<5g/dL)denganGGK;observasiinibisadijelaskan
oleh turunnya blood gas portion coefficient atau kurangnya MAC. Enflurane dan
sevoflurane(dengan<2L/minalirangas)disarankantidakbaikuntukpasienpasien
denganpenyakitginjalyangterjadipadaprosedurpanjangkarenapotensiakumulasi
fluoride.

NITROUSOXIDE
BanyakklinisitidakmenggunakanataumembatasipenggunaanNO2sampai
50% pada pasienpasien dengan gagal ginjal dalam tujuan untuk meningkatkan
penggunaanO2arteripadakeadaananemia.Rasionalisasiinibisadilihathanyapada
pasienanemiaberat(Hb<7gr/dL),bahkanpadapeningkatanO2dissolvedmungkin
terlihatpersentasiyangsignifikandariO2arteriterhadapperbedaanO2vena.

PELUMPUHOTOT
Succinylcholine
SCbisadigunakansecaraamanpadagagalginjal,dengankonsentrasiserum
kaliumkurangdari5mEq/Lpadasaatinduksi.BilaKserumlebihtinggi,pelumpuh
ototnondepolsebaiknyadigunakan.Walaupunpenurunanlevelpseudocholinesterase
pernahdilaporkanpadabeberapapasienuremikyangmengikutidialisis,perlamaan
signifikandariblokadeneuromuscularjarangterlihat.

Cisatracurium,atracurium&Mivacurium
Mivacuriumtergantungsecaraminimalpadaginjaluntukeliminasi.Efekyang
sedikit memanjang dapat dilihat karena menurunnya pseudokolinesterase plasma.

Cisatracuriumdanatracuriumdidegradasidiplasmaoleheliminasienzimhidrolisis
esterdannonenzimHofmann.Agenagentersebutmungkinmerupakanobatpilihan
untukpelumpuhototpadapasienpasiendengangagalginjal.
Vecuronium&Rucoronium
Eliminasidarivecuroniumsecaraprimeradadihati,tapilebihdari20%dari
obatdieliminasidiurine.Efekdaridosisbesarvecuronium(>0,1mg/kg)hanyadi
perpanjangsedikitpadapasienpasienrenalinsufisiensi.Rocuroniumsecaraprimer
dieliminasi di hati, tapi perpanjangan kerja pada penyakit ginjal berat pernah
dilaporkan.

Pancuronium,Pipecuronium,Alcuronium,&Doxacurium
Obatobatinitergantungterutamapadaekskresirenal(6090%).Walaupun
pancuronium di metabolisme di hati menjadi metabolit intermediate yang kurang
aktif, eliminasi paruh waktunya masih tergantung pada ekskresi ginjal (6080%).
Fungsineuromuscularharusdimonitorketatjikaobatobatinidigunakanpadafungsi
ginjalabnormal.

Metocurine,Gallamine&Decamethonium
Obatobat ini hampir sepenuhnya tergantung pada ekskresi ginjal untuk
eliminasidanharus dihindari penggunaannya daripasien dengangangguan fungsi
ginjal.

ObatobatReversal
Ekskresiginjaladalahruteutamaeliminasibagiedrophonium,neostigmine&
pyridostigmine.Waktuparuhdariobatobatinipadapasiendengangangguangagal
ginjal memanjang setidaknya sama dengan pelumpuh otot sebelumnya diatas.
Masalahmasalah dengan tidak adekuatnya reversal dari blokade neuromuscular
biasanyadihubungkandenganfaktorfaktorlain.
9.

BAB V.
ANESTESI PADA PASIEN DENGAN GANGGUAN GINJAL RINGAN
SAMPAISEDANG

PERTIMBANGANPREOPERATIF
Ginjalbiasanyamenunjukkanfungsiyangbesar.GFR,yangdapatdiketahui
dengan kreatinin klirens, dapat menurun dari 120 ke 60 mL/ menit tanpa adanya
perubahanklinispadafungsiginjal.Walaupunpadapasiendengankreatininklirens
4060mL/menitumumnyaasimtomatik.Pasieninihanyamemilikigangguanginjal
ringannamunharusdipertimbangkansebagaigangguanginjal.
Ketikakreatininklirensmencapai2540mL/menitgangguanginjalsedang
danpasienbisadisebutmemilikirenalinsufisiensi.Azotemiayangsignifikanselalu
muncul,danhipertensimaupunanemiasecarabersamaan.Manajemenanestesiyang
tepatpada pasieninisama pentingnya padapasien gagal ginjal yangberat. Yang
terakhir ini terutama selama prosedur yang berkaitan dengan insiden yang relatif
tinggidarigagalginjalpostoperasi,sepertipembedahankonstruktifdarijantungdan
aorta. Kehilangan volume intravaskular, sepsis, obstruktif jaundice, kecelakaan,
injeksikontrasdanaminoglikosid,angiotensinconvertingenziminhibitor,atauobat
obatterapisepertiNSAIDsebagairesikoutamapadaperburukanakutpadafungsi
ginjal.Hipovolemiamunculkhususnyasebagaifaktoryangpentingpadagagalginjal
akutpostoperatif.Penekananmanajemenpadapasieniniadalahpencegahan,karena
angkakematiandarigagalginjalpostoperatifsebesar50%60%.Peningkatanresiko
perioperatifberhubungandengankombinasipenyakitginjallanjutdandiabetes.
Profilaksisuntukgagalginjaldengancairandiuresisefektifdandiindikasikan
pada pasien dengan resiko tinggi, rekonstruksi aorta mayor, dan kemungkinan
prosedurpembedahanlainnya.Mannitol(0,5g/kg)seringdigunakandandiberikan
sebagai perioritas pada induksi. Cairan intravena diberikan untuk mencegah
kehilangan intra vaskular. Infus intravena dengan fenoldopam atau dopamin dosis
rendahmemberikanpeningkatanalirandarahginjalmelaluiaktivasidarivasodilator
reseptordopaminpadapembuluhdarahginjal.Loopdiuretikjugadibutuhkanuntuk
menjagapengeluaranurindanmencegahkelebihancairan.

EVALUASI FUNGSI GINJAL


Gangguan renal (renal impairment) bisa mengarah pada disfungsi glomerulus,
fungsi tubulus atau obstruksi traktus urinarius. Karena abnormalitas fungsi glomerulus
disebabkan adanya gangguan yang hebat dan dapat dideteksi, tes laboratorium yang
dapat digunakan adalah yang berhubungan dengan GFR (glomerular filtration rate).
BUN (Blood Urea Nitrogen)
Sumber utama urea dari tubuh adalah hati. Pada saat katabolisme protein,
amonia diproduksi dari deaminasi asam amino. Hati mengkonversi ammonia ke urea
untuk mencegah pembentukan dari toksik amonia :
2NH3 + CO2 H2N CO NH2 + H2O
BUN berhubungan langsung dengan katabolisme protein dan berhubungan
terbalik dengan GFR. Hasilnya, BUN bukanlah indikator yang bisa digunakan untuk
perhitungan GFR kecuali katabolisme protein normal dan konstan. Selain itu, 40%50% dari filtrasi urea secara normal di reabsorpsi secara pasif oleh tubulus renal;
hipovolemi meningkatkan fraksi ini.
Konsentrasi BUN normal adalah 10 20 mg/dl. Nilai yang lebih rendah bisa
didapatkan pada keadaan kelaparan, penyakit hati. Peningkatan biasanya disebabkan
oleh berkurangnya GFR atau meningkatnya katabolisme protein akibat status
katabolisme tinggi (trauma atau sepsis), degradasi darah baik pada traktus digestif
atau hematoma besar, atau diet tinggi protein. Konsentrasi BUN yang lebih besar dari
50 mg/dl biasanya berhubungan dengan gangguan fungsi ginjal.
SERUM KREATININ
Kreatinin adalah produk dari metabolisme otot yang dikonversi ke kreatinin.
Produksi kreatinin pada sebagian besar orang adalah relatif konstan dan berhubungan
dengan massa otot, rata-rata 20-25 mg/kg pada pria dan 15-20 mg/kg pada wanita.
Kreatinin lalu difiltrasi tapi tidak di reabsorpsi di ginjal. Konsentrasi kreatinin serum
berhubungan langsung dengan massa otot tubuh tapi berkebalikan dengan GFR. Oleh
karena massa otot tubuh biasanya konstan, pengukuran kreatinin serum biasanya
berdasarkan indeks GFR. Konsentrasi kreatinin serum normal adalah 0.8 1.3 mg/dl
pada pria dan 0.6-1 mg/dl pada wanita. Pada setiap penggandaan pada kreatinin serum

menunjukkan penurunan GFR 50%. Makan daging dalam jumlah besar, terapi
simetidin, peningkatan asetoasetat (seperti pada ketoasidosis) bisa meningkatkan
pengukuran pada kreatinin serum tanpa perubahan di GFR. Daging meningkatkan
muatan kreatinin dan konsentrasi asetosetat tinggi yang mempengaruhi metode
laboratorium yang biasa pada pengukuran kreatinin. Simetidin menginhibisi sekresi
kreatinin oleh tubulus ginjal.
GFR menurun dengan meningkatnya umur pada sebagian besar orang (5% per
dekade setelah umur 20 tahun), tapi karena massa otot juga menurun, kreatinin serum
tetap relatif normal, produksi kreatinin bisa menurun sampai 10 mg/kg. Pada pasien
usia tua, peningkatan kecil dari kreatinin serum bisa menunjukkan perubahan besar
pada GFR. GFR bisa diperkirakan dengan formula / rumus untuk pria:
[( 140 umur ) x BB]
CrCl = --------------------------72 x kreatinin plasma
Untuk wanita, persamaan tadi dikali dengan 0,85 untuk mengkompensasi
massa otot yang lebih kecil. Konsentrasi serum kreatinin memerlukan 48-72 jam
untuk menyeimbangkan pada level baru yang berhubungan dengan perubahan akut
pada GFR.
RASIO BUN : KREATININ
Aliran yang rendah dari tubulus ginjal membantu reabsorpsi urea namun tidak
mempunyai efek pada ketetapan kreatinin. Oleh karena itu, rasio BUN terhadap
kreatinin serum meningkat diatas 10:1. Penurunan aliran tubulus bisa disebabkan oleh
penurunan perfusi ginjal atau obstruksi traktus urinarius. Rasio BUN : kreatinin lebih
dari 15:1 dapat dilihat pada kekurangan volume dan pada edema dengan gangguan
yang berhubungan dengan berkurangnya aliran tubular (seperti pada gagal jantung,
sirosis, nefrotik sindrom) dan juga pada obstruksi uropati. Peningkatan katabolisme
protein bisa meningkatkan rasio ini.
CREATININ CLEARANCE
Pengukuran CrCl adalah metode yang paling akurat yang tersedia untuk
menilai secara klinik keseluruhan fungsi ginjal. Walaupun biasanya pengukuran
setelah 24 jam, 2 jam adalah akurat dan lebih mudah dilakukan. Mild renal
impairment berdasarkan CrCl 40-60 mL/min. Clearances antara 25 dan 40 mL/min

membentuk disfungsi renal moderate dan hampir biasanya menimbulkan gejala. CrCl
kurang dari 25 mL/min merupakan indikasi dari gagal ginjal.
Penyakit ginjal progresif mempertinggi sekresi kreatinin pada tubulus
proksimal. Sebagai hasil, dengan penurunan fungsi ginjal CrCl secara progresif
melebihi perkiraan GFR sebenarnya. Terlebih lagi, preservasi dari GFR bisa terjadi di
awal penyakit ginjal yang progresif akibat dari kompensasi hiperfiltrasi pada nefronnefron dan peningkatan tekanan filtrasi glomerulus. Oleh karena itu penting untuk
melihat tanda-tanda lain dari perburukan fungsi ginjal seperti hipertensi, proteinuria
atau abnormalitas dari sedimen urin.
URINALISIS
Urinalisis adalah tes rutin yang paling biasa dilakukan untuk evaluasi fungsi
renal. Walaupun penggunaan untuk tujuan itu dipertanyakan, urinalisis bisa membantu
untuk identifikasi beberapa gangguan pada disfungsi tubulus ginjal maupun beberapa
gangguan nonrenal. Urinalisis rutin termasuk pH,berat jenis(BJ), deteksi dan kuantitas
glukosa, protein, bilirubin dan pemeriksaan mikroskopik terhadap sedimen urin. pH
urin membantu bila pH arteri diketahui. Bila pH urin lebih dari 7,0 pada sistemik
asidosis memberi kesan asidosis tubulus renal. BJ (berat jenis) berhubungan dengan
osmolalitas urin 1,010 biasanya berhubungan dengan 290 mOsm/kg. BJ lebih dari
1,018 setelah puasa 1 malam merupakan indikasi adekuatnya kemampuan ginjal
dalam mengkonsentrasi. BJ yang lebih rendah memperlihatkan hiperosmolalitas dari
plasma yang konsisten dengan diabetes insipidus.
Glikosuria adalah hasil dari ambang batas bawah glukosa pada tubulus
(normal 180 mg/dl) atau hiperglikemia. Proteinuri dideteksi dengan urinalisis rutin
yang seharusnya dievaluasi pada pengumpulan urin 24 jam. Ekskresi protein urin
lebih dari 150 mg/dl adalah signifikan. Peningkatan level bilirubin pada urin terlihat
pada obstruksi biliari.
Analisa mikroskopik pada sedimen urin bisa mendeteksi adanya sel darah
merah atau sel darah putih, bakteri, cast, dan kristal.Sel darah merah mungkin
mengindikasikan perdarahan akibat tumor, batu, infeksi, koagulopati atau trauma. Sel
putih dan bakteria biasanya berhubungan dengan infeksi. Proses penyakit pada level
nefron membentuk tubular cast. Kristal mungkin mengindikasikan abnormalitas pada
asam oksalat, asam urat atau metabolisme cistin.

PERTIMBANGANINTRAOPERATIF
Monitoring
Monitorstandardyangdigunakanuntukprosedurtermasukkehilangancairan
yangminimal.Untukoperasiyangbanyakkehilangancairanataudarah,pemantauan
urinoutputdanvolumeintravaskularsangatpenting.Walaupundenganurinoutput
yangcukuptidakmemastikanfungsiginjalbaik,namunselaludiusahakanpencapaian
urinoutputlebihbesardari0,5mL/kgBB/jam.Pemantauantekananintraarterialjuga
dilakukan jika terjadi perubahan tekanan darah yang cepat, misalnya pada pasien
denganhipertensitidakterkontrolatausedangdalampengobatanyangberhubungan
denganperubahanyangmendadakpadapreloadmaupunafterloadjantung.

Induksi
Pemilihanzatinduksitidaksepentingdalammemastikanvolumeintravaskular
yangcukupterlebihdahulu.AnestesiinduksipadapasiendenganRenalInsuffisiensi
biasanya menghasilkan hipotensi jika terjadi hipovolemia. Kecuali jika diberikan
vasopressor,hipotensibiasanyamunculsetelahintubasiataurangsanganpembedahan.
Perfusi ginjal, yang dipengaruhi oleh hipovolemia semakin buruk sebagai hasil
pertama adalah hipotensi dan kemudian secara simpatis atau farmakologis
diperantarai oleh vasokonstriksi ginjal. Jika berlanjut, penurunan perfusi ginjal
pengakibatkankerusakanginjalpostoperatif.Hidrasipreoperatifbiasanyadigunakan
untukmencegahhalini.

Pemeliharaan
Semua zat pemeliharaan dapat diberikan kecuali Methoxyflurane dan
Sevoflurane. Walau enflurane bisa digunakan secara aman pada prosedur singkat,
namunlebihbaikdihindaripadapasiendenganinsuffisiensiginjalkarenamasihada
pilihanobatlainyangmemuaskan.Pemburukanfungsiginjalselamaperiodeinidapat
menghasilkan efek hemodinamik lebih lanjut dari pembedahan (perdarahan) atau
anestesi (depresi jantung atau hipotensi). Efek hormon tidak langsung (aktifasi

simpatoadrenalatausekresiADH),atauventilasitekananpositif.Efekinibiasanya
reversibel ketika diberikan cairan intravena yang cukup untuk mempertahankan
volumeintravaskuleryangnormalataumeluas.Pemberianutamadarivasopresor
adrenergik (phenyleprine dan norepineprine) juga dapat mengganggu. Dosis kecil
intermittenatauinfussingkatmungkinbisabergunauntukmempertahankanaliran
darah ginjal sebelum pemberian yang lain (seperti transfusi) dapat mengatasi
hipotensi. Jika mean tekanan darah arteri, cardiac output dan cairan intravaskuler
cukup,infusdopamindosisrendah(25mikrogram/kg/menit)dapatdiberikandengan
batasan urin output untuk mempertahankan aliran darah ginjal dan fungsi
ginjal.Dosis dopamin untuk ginjaltelah juga dapat menunjukkan setidaknya
sebagianmembalikkanvasokonstriksiarteriginjalselamainfusdenganvasopresor
adrenergik(norepinephrine).Fenoldopamjugamempunyaiefekyangsama.

TerapiCairan
Seperti telah dibicarakan diatas, pertimbangan pemberian cairan sangat
penting untuk pasien dengan penurunan fungsi ginjal. Perhatikan jika ditemukan
pemberian cairan yang berlebihan, namun masalah biasanya jarang dengan pasien
yangurinoutputnyacukup.Makaperludilakukanpemantauanpadaurinoutputnya,
jikacairanyangberlebihandiberikanmakaakanmenyebabkanedemaataukongestif
paruyanglebihmudahditanganidaripadagagalginjalakut.

BAB VI.
PrinsipAnestesiapadaPasiendenganGagalGinjalKronik
Tujuandaripersiapanpraoperasipasiendengangagalginjalkronikadalah
untuk mengidentifikasi dan mengoptimalkan yang sudah ada sebelumnya untuk
meminimalkan risiko anestesi dan pembedahan. Hal ini memerlukan pendekatan
multidisiplin yangmelibatkananestesi,ahlibedahdandokterginjal.Karenagagal
ginjal kronik dapat mempengaruhi semua sistem organ, penting untuk
mengidentifikasidanmengoptimalkanpatologiorganyangada.
Organsistem
Sistemkardiovaskular
Penyakitjantungiskemik
CKDsangatberhubungandenganpenyakitjantungiskemik,sehinggasangatperlu
diperhatikanhalyangmemicuataumembahayakansaattindakanoperasi.Beberapa
bentuk kelainan pembuluh darah yaitu, penyakit serebrovaskular dan hipertensi.
PasienperluditesEKG.
Aksespembuluhdarah
PasiendenganCKDbiasanyasulitdicariaksespembuluhdarahnya.JalurIVsangat
diperlukanselamaterjadinyaoperasi.

Sistemrenal
Pasien dengan gangguan ginjal biasanya melalukan pemeliharaan terapi jangka
panjang.
Halyangperludiperhatikan:

Intakecairan
Produksiurinharian
Terapigantiginjal(contoh:frekuensidilakukannyadialysis)
Fungsirenal
o Konsentrasiserumureadankreatinin
o GFR
Konsentrasiserumelektrolit
o Sodium
o Potasium

ANESTESIAPADAPASIENDENGANGAGALGINJAL
PERTIMBANGANPREOPERASI
GagalGinjalAkut
Gagal ginjal akut adalah penurunan fungsi ginjal secara cepat yang
menghasilkanpenumpukandarisampahnitrogen(azotemia).Zatinisebagianbesar
bersifatracun,dihasilkanolehmetabolismeproteindanasamamino.Termasukurea,
senyawaguanidine(termasukcreatindancreatinin),asamurat,asamaminoalifatik,
berbagai jenis peptida dan metabolisme dari asam amino aromatik. Metabolisme
ginjal yang terganggu pada sirkulasi protein dan peptida juga memegang peranan
dalammeluasnyadisfungsiorgan.
Azotemiadapatdibagimenjadibeberapatipeberdasarkanpenyebabnyayaitu
prerenal,renal,danpostrenal.Prerenalazotemiadisebabkanpenurunanfungsiginjal
yangakutdalamperfusiginjal.RenalAzotemiabiasanyamengarahpadapenyakit
ginjalintrinsik,renaliskemiaataunefrotoxin.PostrenalAzotemiadiakibatkanoleh
karena adanya obstruksi atau gangguan pada saluran kemih. Azotemia renal dan
postrenalbersifatreversiblepadatahapinisialnamunjikadibiarkanterusmenerus
akanmenyebabkangagalginjalintrinsik.Kebanyakanpasiendewasadengangagal
ginjalakanterjadioliguria.Pasienyangnonoliguri(yaitupasiendenganurinoutput
>400mL/hari) terus menerus membentuk urin yang secara kualitatif miskin, pada
pasieninicenderungmemilikipemeliharaanyangcukupbaikdariGFR.Walaupun
filtrasiglomerulusdanfungsitubulusterganggu,kelainannyauntukcenderungburuk
lebihsedikitpadagagalginjalnonoliguri.
Pembahasanmengenaigagalginjalakutbervariasi,namunpadatipeoliguria
bertahansampai2minggudandiikutiolehfasediuretikyangditandaidenganadanya
peningkatanyangprogresifpadaurinoutput.Fasediuretikiniseringmenghasilkan
sangatbanyaknyaurinoutputdanbiasanyatidakditemuipadagagalginjalyangnon
oligurik. Fungsi urinari semakin baik dalam beberapa minggu namun bisa tetap
bertahantidakkembalinormalsampai1tahun.

GagalGinjalKronis

Sindroma ini dikarakteristikkan oleh adanya penurunan fungsi ginjal yang


progresif dan irreversibel dalam waktu 36 bulan. Penyebab utamanya adalah
hipertensinefrosklerosis, diabetiknefropati,glomerulonefritis kronis,dan penyakit
ginjalpolikistik.
Manifestasipenuhdarisindrominiseringdikenaldenganuremiayangakan
terlihat setelah GFR menurun dibawah 25 mL/menit. Pasien dengan clearance
dibawah 10 mL/menit (sering disebut dengan end stage renal disease) akan
bergantungkepadadialisisuntukbertahansampaidilakukantransplantasi.Dialisis
dapatberbentuk intermittenthemodialysis melaluiarteriovenousfistulaataudialisis
terusmenerusmelaluikateteryangdiimplantasikan.
Efek yang meluas dari uremia biasanya dapat dikontrol dengan dialisis.
Banyakpasienyangmenjalanidialisissetiapharidengannormaldanmungkintidak
terjadi discoloration yang terkait dengan end stage renal disease dan dialisis.
Mayoritaspasiendidialisis3kaliperminggu.Sayangnya,semakinlamabiasanya
komplikasiuremiasukardisembuhkan.Lebihlagi,beberapakomplikasiberhubungan
langsung dengan proses dialisis tersebut. Hipotensi, neutropenia, hipoksemia,
sindromadisequilibriumbersifatsementaradanhilangbeberapajamsetelahdialisis.
Beberapa faktor yang menyebabkan hipotensi selama dialisis termasuk efek
vasodilatasidarilarutanasetatdialisat,neuropatiotonomdanpergerakanyangcepat
dari cairan. Interaksi antara sel darah putih dengan membran derivat dialisis
cellophane akan mengakibatkan neutropenia dan leukocytemediated pulmonary
disfunction menyebabkan hipoksemia. Sindroma disequilibrium dikarakteristikkan
olehgejalaneurologissementarayangberhubungandenganpenurunandengancepat
osmolaritasekstraselulardariosmolaritasintraselular.

ManifestasidariGagalGinjal
A. Metabolik
Pasien dengan gagal ginjal yang jelas dapat berkembang mengakibatkan
abnormalitasdarimetabolikyangmultipeltermasukhiperkalemia,hiperphospatemia,
hipokalemia,hipermagnesemia,hiperuricemia,danhipoalbuminemia.Retensiairdan
natriumakanmengakibatkanpemburukandarihiponatremiadancairanekstraseluler
yangberlebihan.Kegagalanuntukmengekskresikanproduksiasamyangnonfolatil

mengakibatkanasidosismetabolikdengananiongapyangtinggi.Hipernatremiadan
hipokalemiaadalahkomplikasiyangjarang.
Hiperkalemia adalah abnormalitas yang paling mematikan karena memiliki
efekpadajantung.Halinibiasanyaditemukanpadapasiendengankreatininklirens
<5mL/menit,namundapatberkembangsecaracepatpadapasiendenganklirensyang
lebih tinggi oleh karena dengan masukan kalium yang besar (trauma, hemolisis,
infeksiataukonsumsikalium).
Hipermagnesia biasanya ringan kecuali masukan magnesium meningkat
(umumnyadariantasidayangmengandungmagnesium).Hipokalsemiaterjadidengan
sebabyangtidakdiketahui.Mekanismeyangdiakibatkanolehdepositkalsiumke
tulang secara sekunder oleh karena hiperphospatemia, resistensi dari hormon
paratiroiddanpenurunanabsorbsiusushalus secarasekundermenurunkansintesa
renaldari1,25dihidroksikolekalsiferol.Gejaladarihipokalsemiajarangberkembang
kecualipasiendalamkondisialkalosis.
Pasien dengan gagal ginjal juga secara cepat kehilangan protein jaringan
sehingga menyebabkan hipoalbuminemia. Anoreksia, restriksi protein dan dialisis
(terutamadialisisperitonium)jugaberperan.

B. Hematologik
Anemia biasanya muncul jika kreatinin klirens dibawah 30 ml/menit.
Konsentrasi hemoglobin umumnya 68 gram/dl. Penurunan produksi eritropoetin
menurunkan produksi sel darah merah, dan menurunkan pertahanan sel. Faktor
tambahantermasukperdarahansalurancerna,hemodilusi,danpenekanansumsum
tulangdariinfeksisebelumnya.Walaupundengantransfusi,konsentrasihemoglobin
meningkatsampai9gram/dlsangatsulituntukdipertahankan.Pemberianeritropoetin
biasanyadapatmengoreksianemia.Peningkatandari2,3difosfogliseratbertanggung
jawab dalam penurunan kapasitas pembawa oksigen. 2,3DPG memfasilitasi
pelepasan oksigen dari hemoglobin. Asidosis metabolik juga mengakibatkan
pergeseran ke kanan pada kurva oksigenhemoglobin dissosiasi. Tanpa adanya
penyakit jantung yang symptomatik beberapa pasien dapat mentoleransi anemia
secarabaik.

Fungsiplateletdanseldarahputihterganggupadapasiendengangagalginjal.
Secaraklinis,halinidimanifestasikansebagaipemanjanganwaktuperdarahandan
gampangterkenainfeksi.PadapasiendenganpenurunanaktivitasplateletfaktorIII,
danjuga penurunanikatandanagregrasiplatelet.Pasienyangdihemodialisajuga
memilikiefeksisaantikoagulandariheparin.

C. Kardiovaskuler
Cardiac Output dapat meningkatpada gagalginjal untukmenjagaoksigen
delivery pada penurunan kapasitas pembawa oksigen. Retensi natrium dan
abnormalitaspadasistemreninangiotensinberakibatpadahipertensisistemikarteri.
Left ventrikuler hipertropi umum dijumpai pada gagal ginjal kronis. Cairan
ekstraseluler yang berlebihan oleh karena retensi natrium bersamaan dengan
peningkatan kebutuhan yang terganggu oleh karena anemia dan hipertensi
mengakibatkan pasien gagal jantung dan edema pulmonum. Peningkatan
permeabilitasdarimembrankapileralveolidapatmenjadifaktorpredisposisi.Blok
konduksi sering ditemukan mungkin diakibatkan oleh deposit kalsium dari sistem
konduksi. Aritmia sering ditemukan dan mungkin berhubungan pada kelainan
metabolik. Perikarditis uremia dapat ditemukan pada beberapa pasien, pasien bisa
asimptomatis,yangditandaidenganadanyanyeridadaatauterbentuknyatamponade
jantung.Pasiendengangagalginjalkronisjugadikarakteristikandenganpeningkatan
pembuluhdarahperiferdanpenyakitarterikoroner.
Depresi volume intravaskuler dapat muncul pada fase diuretik pada gagal
ginjalakutjikareplacementcairantidakadekuat.Hipovolemijugamunculjikaterlalu
banyakcairanyangterlalubanyakdikeluarkanketikadialisis.

D. Pulmonary
Tanpa dialisis atau terapi bikarbonat, pasien bergantung pada peningkatan
ventilasi permenit untuk mengkompensasikan asidosis metabolik. Cairan
ekstravaskular
pulmonum biasanya meningkat dalam bentuk interstitial edema, mengakibatkan
perluasan gradien alveolar ke arterial oksigen yang menyebabkan terjadinya
hipoksemia. Peningkatan permeabilitas dari kapiler alveolar pada beberapa pasien

menyebabkan edema paru walaupun dengan tekanan kapiler paru yang normal,
karakteristikpadafototoraksmenyerupaibutterflywings.

E. Endokrin
Toleransiglukosayangabnormalditandaidenganadanyagagalginjalakut
dariresistensiperiferpadainsulin,pasienmempunyaiglukosadalamdarahdengan
jumlahbesardanjarangmenggunakannya.Hiperparatiroidismeyangsekunderpada
pasiendengangagalginjalkronisdapatmengakibatkanpenyakittulangmetabolik,
yang dapat menyebabkan fraktur. Kelainan pada metabolisme lemak sering
mengakibatkanhipertrigliseridemiadankemungkinanberperandalamatherosklerosis.
Peningkatandaritingkatproteindanpolipeptidayangbiasanyasegeradidegradasikan
di ginjal sering terlihat, hal ini berhubungan dengan hormon paratiroid, insulin,
glukagon,growthhormon,luteinizinghormone,danprolaktin.

F. Gastrointestinal
Anoreksia,nausea,muntahdanileusadinamikumumnyaberhubungandengan
azotemia.Hipersekresidariasamlambungmeningkatkaninsidendaritukakpeptik
dan perdarahan saluran pencernaan, yang muncul pada 1030% dari pasien.
Penundaan pengosongan lambung secara sekunder pada neuropati autonom dapat
mencetuskan adanya aspirasi perioperatif. Pasien dengan gagal ginjal kronis juga
memiliki koinsiden terhadap virus hepatitis (tipe B dan C), sering diikuti oleh
disfungsihepatik.

G. Neurologis
Tubuh kurus (asterixis), letargi, kebingungan, kejang, dan koma adalah
manifestasidariuremikencephalopathy.Gejalapadaumumnyaberhubungandengan
derajat azotemia. Neuropati autonom dan perifer umumnya dijumpai pada pasien
dengan gagal ginjal kronis. Neuropati perifer bersifat sensoris dan melibatkan
ekstremitasdistalbagianbawah.

EVALUASIPREOPERATIF

Efekyangluasdariazotemiamembutuhkanevaluasiyangmenyeluruhpada
pasien dengan gagal ginjal. Kebanyakan pasien dengan gagal ginjal akut
membutuhkan pembedahan karena dalam keadaan sangat sakit. Gagal ginjalnya
berhubungandengankomplikasipostoperatifatautrauma.Pasiendengangagalginjal
akut juga mempercepat pemecahan protein. Manajemen perioperatif yang optimal
tergantung dari dialisis preoperatif. Dialisis biasanya perlu dilakukan 1224 jam
sebelum operasi.Hemodialisis lebih efektif dari pada peritoneal dialisis dan dapat
dilakukanmelaluiinternaljugularyangtemporer,dialisisdengankatetersubklavia
ataufemoral.Kebutuhandialisispadapasiennonoligurikdapatdisesuaikandengan
kebutuhanindividual.Indikasidaridialisisdapatdilihatpadatabel.

Namundapatterdapatbeberapaefekdaridialysissebelumnya,yaitu:

Penumpukandanpenyebarankembalicairankedalamekstravaskularkarenan

penumpukancairanpadaruangintravascular
Gangguanelektrolit,terutamahypokalemia
Antikoagulasiresidudariheparinisasi(penambahanheparinkedalamdarah)
darisirkuithemodialysis

Perludiperhatikankadarelektrolitpostdialisissebelumdilakukannyaoperasiuntuk
mencegahdisiramajantungpadasaatoperasiyangdipicuolehgangguanelektrolit.

KoreksiKelainanSerumPotassium
Pasien preoperasi dengan hiper atau hypokalemia perlu dikoreksi. Terapi
emergensihyperkalemiadilakukanjikaterdapatmanifestasiEKGseperti,bradikardia,
PR yang memanjang, melebarnya QRS, gelombang T yang meningkat, blok AV.
Terapiyangdiberikan:
o Bantuanhidupdasar
o Monitorjantungdanmenggunakanjalurintravenayangbesar
o Stabilisasimembranejantungdengankalsiumkloridaataukalsiumglukonat

o Memicupergantianintraselulerserumpotassiummenggunakaninfusinsulin
dandektrosa,dengancatatanperludilakukanmonitoringplasmaglukosa
o Ekskresikelebihanpotassium(metodetergantungpadafungsirenalintrinsic)
pilihannyaterpidiureticuntukmemicuekskresrenal.
Untukterapiemergensipadahipokalemidiperlukanhanyajikaberhubungandengan
aritmia jantung atau perubahan EKG. Perubahannya dapat berupa: gelombang T
inverted ataumendatar,gambarangelombangUyangterlihatsepertipemanjangan
QT, ST depresi dan atrial dan ventricular aritmia. Biasanya disarankan untuk
melakukanterapipenggantipotassium.
Terapiyangdiberikan:
o Bantuanhidupdasar
o Monitorjantungdanmenggunakanjalurintravenayangbesar
o IV penggantian potassium yang diencerkan sebagaimana diperlukan,
pemantauanaritmiajantung.
Selainituterdapatbeberapahalyangperludiperhatikan,antaralain:

Pasiendengangagalginjalkronisumumnyadijumpaidiruangoperasiuntuk
kreasiatauperbaikandariarteriovenousfistuladibawahanestesilokalatauregional.
Berkenaan dengan prosedur anestesi yang terpenuhi, evaluasi yang lengkap
dibutuhkan untuk memastikan pasien berada dalam kondisi yang optimal. Semua
manifestasiyangreversibeldariuremiaharusdikontrol.Dialisispreoperatifpadahari
pembedahanatauharisebelumnyadibutuhkan.
Evaluasifisikdanlaboratoriumharusdifokuskanpadafungsijantungdan
pernafasan.Tandatandakelebihancairanatauhipovolemiaharusdapatdiketahui.
Kekuranganvolumeintravaskulerseringdisebabkanolehdialisis yangberlebihan.
Datahemodinamik,jikatersediadanfotodadasangatbermaknadalamkesanklinis.

Analisa gas darah juga berguna dalam mendeteksi hipoksemia dan mengevaluasi
statusasambasapadapasiendengankeluhansesaknafas.EKGharusdiperiksasecara
hatihatisebagaitandatandadarihiperkalimiaatauhipokalimiasepertipadaiskemia,
blokkonduksi,danventrikularhipertropi.Echocardiographysangatbermaknadalam
mengevaluasi fungsi jantung pada pasien dibawah prosedur pembedahan mayor
karena hal ini dapat mengevaluasi ejeksi fraksi dari ventrikel, seperti halnya
mendeteksi dan kuantitatif hipertropi, pergerakan abnormal pembuluh darah, dan
cairan perikard adanya gesekan bisa tidak terdengar pada auskultasi pada pasien
denganefusiperikard.
Transfusipreoperatifseldarahmerahharusnyadiberikanpadapasiendengan
anemiaberat(hemoglobin<67g/dL)atauketikakehilangandarahsewaktuoperasi
diperkirakan. Waktu perdarahan dan pembekuan dianjurkan, khususnya jika ada
pertimbangan regional anestesi. Serum elektrolit, BUN, dan pengukuran kreatinin
dapat menentukan keadekuatan dialisis. Pengukuran glukosa dibutuhkan dalam
mengevaluasikebutuhanpotensialuntukterapiinsulinperioperatif.
Terapiobatpreoperatifdiberikansecarahatihatipadaobatyangdieliminasidi
ginjal. Penyesuaian dosis dan pengukuran kadar darah (jika memungkinkan)
dibutuhkanuntukmencegahtoksisitasobat.

TeknikanestesiyangsesuaipadapasienCKD
PasiendenganCKDdapatmemerlukantindakanoperasielektrifmaupunemergensi,
berhubunganmaupuntidakberhubungandengangangguanginjalnya.Diantaranya:
A. Aksespembuluhdarah
Pasien CKD tahap akhir yang akan dilakukan terapi ganti ginjal dengan
hemodialisisyangintermitenakanseringmemerlukananestesidanoperasiuntuk
membuatartereivenafistulaataugraft.
Tujuandilakukananestesipadapasienadalahuntuk:
a. membuatpasiennyamansaatopersiberlangsung
b. meminimalisir resiko komplikasi anestesi seperti gangguan jantung
saatoperasi
c. mengoptimalkan keadaan postoperasi, seperti menghindari sedatif
yang berkepanjangan, penggunaan obat analgesik yang minimal
setealahoperasi.
Teknikanestesiyangdilakukanantaralain:
a) anestesilokal(denganatautanpasedatif)
b) anestesireionalmenggunakanblokbrakialpleksus(denganatautanpa
sedatif)
c) anestesiumum
BeberapaperbandinganteknikanestesipadapasienCKD

B. Operasidaruratdantidakterencana
Pasiendapatmengalamioperasidaruratdantidakterencanaterhadapkasus
yangberhubunganatautidakdenganpenyakitginjal,diantaralain:
o Masalahaksesvaskularhemodialisis(fistulayangterhambat/blocked
fistula)
o Peritonitissekunderterhadapinfeksikateterperitonealdialisis

Operasiyangtidakterencanamemilikibanyakimplikasibaikpertimbangangeneral
maupunspesifik:
I. General
a. Kondisiyangmenyebabkangangguanfisiologisepertisepsis
abdomen,perdarahan,obstruksiGI
b. Keluhan perut penuh pada pasien membutuhkan tindakan
pembedahan segera yang menandakan resiko terjadinya
regurgitasidanaspirasidibawahpengaruhanestesiaumum.
c. Perawatanpostoperatif(ICU)
d. Stresspsikologi
II. Spesifik
a. Ganguan elektrolit dan cairan, banyak disebabkan karena
fungsiginjalkronik,dialisis
b. Supresiimunmeningkatkanresikosepsispaskapembedahan
Penilaian preoperatif sangat diperlukan, kecuali keadaan yang sangat emergensi.
Pendekatanterhadapdokterbedah,dokteranestesi,ahlinefrologi.

PREMEDIKASI
Padapasienyangrelatifstabildansadardapatdiberikanpengurangandosis
dari opioid atau benzodiazepin. Promethazin, 12.525 mg intra muskular, berguna
sebagaitambahansedasi dananti emetika. Profilaksis untukaspirasi diberikan H 2
blocker diindikasikan pada pasien mual, muntah atau perdarahan saluran cerna.
Metoclopramide,10mgsecaraoralatauteteslambatintravenajugabergunadalam
mempercepat pengosongan lambung, mencegah mual dan menurunkan resiko
aspirasi. Pengobatan pre operatif terutama obat anti hipertensi harus dilanjutkan
sampaipadasaatpembedahan.
Obatobat dengan potensi yang signifikan berakumulasi pada pasien yang
memilikikelainanginjal(tabel325)

PERTIMBANGANINTRAOPERATIF
Monitoring

Prosedur pembedahan membutuhkan perhatian pada kondisi medis secara


menyeluruh.Karenabahayadariadanyaoklusi,tekanandarahsebaiknyatidakdiukur
daricuffpadalengandenganfistulaarteriovena.Intraarterial,venasentral,danarteri
paru membutuhkan perhatian, terutama pada pasien dibawah prosedur dengan
pergeserancairanyangluas,volumeintravaskulerseringsulitdisesuaikanhanyadari
tandaklinis.Monitoringtekanandarahintraarterisecaralangsungdiindikasikanpada
pasien yang hipertensinya tidak terkontrol. Monitoring invasif yang agresif
diindikasikan khususnya pada pasien diabetes dengan penyakit ginjal berat yang
sedang menjalani pembedahan mayor, pasien jenis ini mungkin memiliki tingkat
morbiditas 10kalilebihbanyakpadapasiendiabetes tanpapenyakitginjal.Yang
terakhirinimenunjukkaninsidenyangtinggipadakomplikasikardiovaskularpada
gruppertama.

Induksi
Pasiendenganmual,muntahatauperdarahansalurancernaharusmenjalani
induksicepatdengantekanankrikoid. Dosisdarizatinduksiharusdikurangiuntuk
pasien yang sangat sakit. Thiopental 23 mg/kg atau propofol 12 mg/kg sering
digunakan. Etomidate, 0,20,4 mg/kg dapat dipertimbangkan pada pasien dengan
hemodinamik yang tidak stabil. Opioid, betabloker (esmolol), atau lidokain bisa
digunakanuntukmengurangiresponhipertensipadaintubasi.Succinylcholine,1,5
mg/kg,bisadigunakanuntukintubasiendotrakealjikakadarkaliumdarahkurangdari
5meq/L.Rocuronium(0,6mg/kg),cisatracurium(0,15mg/kg),atracurium(0,4mg/kg)
ataumivacurium(0,15mg/kg)dapatdigunakanuntukmengintubasipasiendengan
hiperkalemia. Atracurium pada dosis ini umumnya mengakibatkan pelepasan
histamin.Vecuronium,0,1mg/kgtepatdigunakansebagaialternatif,namunefeknya
harusdiperhatikan.

Pemeliharaan
Tehnikpemeliharaanyangidealharusdapatmengkontrolhipertensidengan
efek minimal pada cardiac output, karena peningkatan cardiac output merupakan
kompensasiyangpentingdalammekanismeanemia.Anestesivolatil,nitrousoxide,
fentanyl,sufentanil,alfentanil,danmorfindianggapsebagaiagenpemeliharaanyang

memuaskan.Isofluranedandesfluranemerupakanzatyangmudahmenguappilihan
karenamerekamemilikiefekyangsedikitpadacardiacoutput.Nitrousoxideharus
digunakan secara hatihati pada pasien dengan fungsi ventrikel yang lemah dan
jangandigunakanpadapasiendengankonsentrasihemoglobinyangsangatrendah(<
7g/dL)untukpemberian100%oksigen.Meperidinebukanpilihanyangbagusoleh
karena akumulasi dari normeperidine. Morfin boleh digunakan, namun efek
kelanjutannyaperludiperhatikan.
Ventilasiterkontroladalahmetodeteramanpadapasiendengangagalginjal.
Ventilasi spontan dibawah pengaruh anestesi yang tidak mencukupi dapat
menyebabkan asidosis respiratorik yang mungkin mengeksaserbasi acidemia yang
telahada,yangdapatmenyebabkandepresipernafasanyangberatdanpeningkatan
konsentrasikaliumdidarahyangberbahaya.Alkalosis respiratorikdapatmerusak
karena mengeser kurva disosiasi hemoglobin ke kiri, dan mengeksaserbasi
hipokalemiayangtelahada,danmenurunkanalirandarahotak.

TerapiCairan
Operasi superfisial melibatkan trauma jaringan yang minimal memerlukan
penggantiancairandengan5%dekstrosadalamair.Proseduriniberhubungandengan
kehilangancairanyangbanyakataupergeseranyangmembutuhkankristalloidyang
isotonik, koloid, atau keduanya. Ringer laktat sebaiknya dihindari pada pasien
hiperkalemiayangmembutuhkanbanyakcairan,karenakandungankalium(4meq/L),
normalsalinedapatdigunakan.Cairanbebasglukosadigunakankarenaintoleransi
glukosayangberhubungandenganuremia.Kehilangandarahdigantidenganpacked
red bloodcells.Transfusidarahtidakmemilikiefekataubisabergunapadapasien
gagal ginjal yang hendak menjalani transplantasi karena transfusi mungkin dapat
mengurangiketidakcocokansetelahtransplantasiginjalpadabeberapapasien.

BAB VII.
ManagementPostoperasi
Tatalaksanapostoperativeterbagiatas:
I. Highdependencycare
a. Pasien paska pembedahan yang membutuhkan monitoring jangka
panjangyangdapatdilakukanpadaruangpemulihan
b. Pasientidakstabilmembutuhkanobservasilebih
c. pasien yang tidak membutuhkan ICU namun belum mampu untuk
dipindahkankebangsalumum
II. Intensivecare
a. Pasiendengangagalnapasyangmemerlukanventilator
b. Pasiendengankomorbidkronikmelibatkan1ataulebihsystemorgan
yangmembutuhkanbantuankegagalanyangreversibel

DAFTARPUSTAKA
1. Adamzack Martin, Agarwal Rajiv. Management of Chronic Kidney Disease.
New York: Springer; 2014. (accessed 30 September 2015)
2. Altntepe, Gezgin, Tonbul. Etiology and prognosis in 36 acute renal failure
cases related to pregnancy in central anatolia. Eur J Gen Med 2005; 2(3):
110-113.
3. Anthony Fauci, et al. 2005. Harrisons Principle of Internal Medicine. Edisi
16. USA: McGrawHill.
4. Anton C Schoolwerth, MD, MSHA, Domenic A. Sica, MD, Barbara
J.Ballermann, MD, Christopher S. Wilcox, MD, PhD. 2001. Renal
Considerations in Angiotensin Converting Enzyme Inhibitor Therapy
Available at http://circ.ahajournals.org/content/104/16/1985.full
5. Aram V Chobanian, et al. 2003. Seventh Report of the Joint National
Committee on Prevention, Detection, Evaluation, and Treatment of High
Blood

Pressure

Available

at

http://hyper.ahajournals.org/content/42/6/1206.full.pdf
6. Chin-Chi Kuo, MD, Jin-Bon Hung, MD, Ching-Wei Tsai, MD, Yung-Ming
Chen,

MD.

2010.

Uremic

Frost.

Available

at

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC504253
7. Dennis L. Kasper, Eugene Braunwald, Anthony Fauci. Harrison's Principles of
Internal Medicine 16th Edition. USA : McGraw-Hill, 2004.
8. Dong-Min Kim, 1 Dae Woong Kang, 1 Jong O Kim. Acute Renal Failure due
to Acute Tubular Necrosis caused by Direct Invasion of Orientia
tsutsugamushi. J. Clin. Microbiol 2007; 1128.
9. Eli A Firedman. 2013. Eye disorders associated with Chronic Kidney
Disease

Available

at

http://www.uptodate.com/contents/eye-disorders-

associated-with-chronic-kidney-disease
10. Emil A. Tanagho, Jack W. McAninch. 2008. Smiths General Urology. Edisi
17. Lange: McGrawHill.
11. GoyalP,PuriGD,PandeyCK,SrivastvaS.Evaluationofinductiondosesof
propofol: comparison between endstage renal disease and normal renal
functionpatients.NCBI2002;30(5):584587.
12. Guyton A.C. dan J.E. Hall. 2007. Buku Ajar Fisiologi Kedokteran. Edisi 9.
Jakarta: EGC.
13. Harper CR, Jacobson TA. 2008. Managing Dyslipidemia in Chronic Kidney
Disease Available at http://www.ncbi.nlm.nih.gov/pubmed/18565393

14. Kharasch ED, Schroeder JL, Liggitt HD, Ensign D, Whittington D. New
insights into the mechanism of methoxyflurane nephrotoxicity and
implicationsforanestheticdevelopment(part2):Identificationofnephrotoxic
metabolites..NCBI2006;105(4):737745.
15. Kidney Disease Statistics for the United States. National Kidney and Urologic
Diseases

Information

Clearinghouse

(NKUDIC).

Available

at

http://kidney.niddk.nih.gov/kudiseases/pub/kustats/#17
16. LitzRJ,HblerM,LorenzW,MeierVK,AlbrechtDM.Renalresponsesto
desflurane and isoflurane in patients with renal insufficiency. NCBI 2002;
97(5):11331136.
17. Markum,M.H.S. Gagal Ginjal Akut. In: Sudoyo AW, Setiyohadi B, editors.
Buku Ajar: Ilmu Penyakit Dalam. Jilid I. Edisi ke-4. Jakarta: Balai Penerbit
FKUI, 2006.
18. Massimo Imazio. 2011. Evaluation and Management of Pericarditis
Available at http://www.medscape.com/viewarticle/751203
19. MorganG.E.,MikhailM.S.,&MurrayM.J. (2013). AnesthesiaForPatient
WithKidneyDisease.Morganetal.ClinicalAnesthesiology,5thedition.New
York:LangeMedicalBooks.
20. MorganG.E.,MikhailM.S.,&MurrayM.J. (2013). RenalPhysiologyand
Anesthesia. Morgan et al. Clinical Anesthesiology, 5th edition. New York:
LangeMedicalBooks.
21. National Clinical Practice of Nephrology. 2009. Skin Problems in Chronic
Kidney

Disease:

Uremic

Pruritus

Available

at

http://www.medscape.org/viewarticle/587670
22. Pablo Aschner, MD, MSc, et al. 2007. KDOQI Clinical Practice Guidelines
and Clinical Practice Recommendation for Diabetes and Chronic Kidney
Disease

Available

at

http://www.

Kidney.org/professionals/KDOQI/guideline_diabetes/guide2.htm
23. Pablo Aschner, MD, MSc, et al. 2007. KDOQI Clinical Practice Guidelines
for Managing Dyslipidemias in Chronic Kidney Disease Available at
http://www.kidney.org/professionals/kdoqi/guidelines_lipids/iii.htm
24. Pablo Aschner, MD, MSc, et al. 2007. KDOQI Clinical Practice Guidelines
and Clinical Practice Recommendations for Anemia in Chronic Kidney
Disease

Available

at

http://kidney.org/professionals/KDOQI/guidelines_anemia/cpr34.htm
25. Pradeep Arora, MD. 2013. Chronic Kidney Disease Available at
http://emedicine.medscape.com/article/238798-overview

26. Reddy, SR Keithi, TV patel, AW Amstrong, AK Singh. 2007. Uremic


Pruritus. Available at http://www.uphs.upenn.edu/renal/Dec%20PDFs/uremic
%20pruritus.pdf.
27. Sherwood, Lauralee. 2007. Human Physiology: From Cells to Systems. West
Virginia: Cengage.
28. Stein,Jay H. Kelainan ginjal dan elektrolit. panduan klinik ilmu penyakit
dalam.edisi ke-3. Jakarta : Penerbit Buku Kedokteran EGC, 2001.
29. Takaoka, Kuro, Matsumura. Role of endothelin in the pathogenesis of acute
renal failure. Drug News Perspect 2000, 13(3): 141.
30. Tortora, Gerard J, Bryan H. Derrickson. 2009. Principles of Anatomy and
Physiology Volume 2. Edisi 12. John Wiley & Sons.
31. United State Renal Data System. 2011 Annual Data Report. Available at
http://www.usrds.org/adr.aspx
32. Wiguno Prodjosudjadi, MD, PhD, A. Suhardjono, MD, PhD. 2009. EndStage Renal Disease in Indonesia:Treatmen Development Available at
http://www.ishib.org/journal/19-1s1/ethn-19-01s1-33.pdf