Anda di halaman 1dari 28

Bab 3

Diagnosis dalam Proses Assessment


Diperbarui dan revisi oleh
Katherine A. Heimsch & Gina B. Polychronopoulos

Dalam Essentials Menguji dan Penilaian


Oleh Ed Neukrug dan Charlie Fawcett

Salinan meja dapat diperoleh pada: www.cengage.com

Diagnosis dalam Proses Assessment


Bab 3
Ia adalah 1975, dan bagian dari pekerjaan saya sebagai terapis bicara rawat jalan di
pusat kesehatan mental membawakan menjawab telepon konseling krisis setiap malam
kesembilan. Aku akan tidur di pusat dan menjawab telepon yang sangat keras yang akan
berdering secara berkala sepanjang malam, biasanya dengan seseorang dalam krisis
pada ujung yang lain setiap sekali dalam sementara, mantan klien pusat panggilan akan
dalam dan mulai membaca keras dari catatan kasus-nya, yang telah dicuri dari pusat.
Bagian dari catatan ini merupakan gambaran diagnosis-nya dari apa yang kemudian
edisi kedua diagnostik, dan Manual Statistik (DSM- II ). Dalam sebuah kadang-kadang
marah, kadang-kadang lucu, ia akan nada membaca ketentuan klinis yang ini
seharusnya menggambarkan dia. Saya dapat memahami rasa frustrasi-nya ketika
membaca catatan ini melalui telepon, seperti dalam beberapa hal, diagnosis tampak
dihapus dari perso n - label . "Adalah benar-benar menggambarkan orang ini, dan
bagaimana membantu untuk dia?" Saya akan sering heran.
-Ed Neukrug
Aspek penting dari penilaian klinis dan proses penilaian adalah diagnosis terampil. Hari ini,
penggunaan diagnosis meresapi profesi kesehatan mental, dan walaupun ada terus menjadi
beberapa pertanyaan serta helpfulness, jelas bahwa pembuatan mendiagnosis berbagai dan
menggunakan mereka dalam perencanaan perawatan telah menjadi bagian integral dari semua
apa yang para profesional kesehatan mental melakukan. Dengan itu, dalam bab ini kita mengkaji
penggunaan diagnosis.
Kami memulai bab ini dengan mendiskusikan pentingnya diagnosis dalam proses penilaian
dan kemudian memberikan penjelasan umum tentang sejarah diagnostik, dan Manual Statistik
dari gangguan mental (DSM) dan evolusinya selama beberapa dekade terakhir. Kita
kemudiannya memperkenalkan diagnostik, dan Manual Statistik dari gangguan Mental , Editio
Keliman (DSM-5) dan catatan beberapa perbedaan dari versi sebelumnya, seperti penggunaan
sumbu tunggal dan faktor-faktor yang sekarang berperan saat membuat dan melaporkan
diagnosis. Selanjutnya, kita sorot DSM-5 kategori diagnostik dan menindaklanjuti dengan
2

pertimbangan penting lain apabila membuat diagnosis, seperti masalah medis, dan keprihatinan
lingkungan psikososial, dan isu-isu lintas budaya. Ada beberapa studi kasus dan latihan yang
akan membantu untuk mengasah beberapa kemampuan diagnostik anda. Di akhir bab ini, kami
berhubungan pentingnya merumuskan diagnosis dalam proses assessment secara keseluruhan.
PENTINGNYA DIAGNOSIS

Yohanes adalah dalam kelas kelima dan telah dinilai sebagai memiliki gangguan melakukan
perhatian dan defisit/aktifitas berlebihan disorder (anak pederita). Ibu Yohanes telah
gangguan panik dan adalah mengambil antianxiety obat-obatan. Ayahnya telah bipolar dan
adalah mengambil baterai litium. Jill adalah John penasihat sekolah. John secara individual
rencana pendidikan (Aku EP) menyatakan bahwa dia akan bekerja dengan Jill secara
individu dan dalam kelompok-kelompok kecil untuk perilaku alamat, perhatian, dan keahlian
sosial membengkak. Jill juga harus secara berkala konsultasikan dengan ibu Yohanes, bapa,
dan guru.

Tam araa baru saja dimulai college. Setelah berpecah dengan pacarnya, ia menjadi depresi
berat dan tidak dapat berkonsentrasi pada dia schoolwork; dia telah turun dari kelas sebagai
untuk Cs. Ia datang ke pusat konseling perguruan tinggi dan berkabunglah selama hampir
sesi pertama dengan penasihat perempuan itu. Ia mengaku memiliki selalu bergumul dengan
depresi tetapi menyatakan bahwa "Ini adalah lebih buruk lagi; saya perlu mendapatkan lebih
baik jika aku pergi untuk tinggal di sekolah. Anda dapat memberikan obat kepadaku untuk
membantu aku, maka aku tidak akan memiliki untuk drop out?"

Benyamin pergi setiap hari untuk hari pusat pengobatan di pusat kesehatan mental lokal. Ia
kelihatan masuk akal, dan secara umum dalam roh yang baik. Dia telah dirawat di rumah
sakit untuk skizofrenia pada sejumlah kesempatan dan sekarang mengambil untuk
menghilangkan risperdone gejala-Nya. Dia mengaku untuk Jordana, salah satu penasihatpenasihatnya, bahwa ketika ia tidak mengambil obat-nya karena ia percaya bahwa komputer
memiliki kesadaran dan mengadakan persepakatan melalui World Wide Web untuk
mengambil alih dunia. Perusahaan asuransi-nya membayar untuk pengobatan-Nya. Ia tidak
akan menerima pengobatan Jordana menetapkan diagnosis kecuali pada bentuk asuransi.
Seperti yang dapat anda lihat dari contoh-contoh ini, diagnosis adalah alat penting untuk

professiryon als dalam berbagai setelan. Kenyataannya, penelitian saat ini menyarankan bahwa
3

hingga 20% dari semua anak-anak dan orang dewasa berjuang dengan gangguan mental yang
dilakukan oleh WHO setiap tahun ( Centers for Disease Control and Prevention [CDC], tahun
2013 ; penyalahgunaan NAPZA dan orangtal Layanan Kesehatan Administration, 2012 ), dan
sekitar 50 persen orang dewasa di Amerika Serikat akan mengalami penyakit mental di masa
pakai mereka ( CDC, 2011 ). Oleh karena itu, semua orang melayani dalam peran membantu
akan menghadapi orang berurusan dengan gangguan mental dan akan perlu terbiasa dengan
bahasa diagnostik umum terbaik untuk melayani individu ini dan untuk berkomunikasi secara
efektif dengan para profesional yang lain. Pentingnya diagnosa yang akurat relatif baru dan
merupakan hasil dari beberapa perubahan yang telah terjadi selama tahun-tahun terakhir.
Beberapa ini meliputi hal-hal sebagai berikut:
1. Dan akomodasi untuk anak-anak intervensi dengan emosional, dan perilaku, gangguan
belajar diperlukan oleh undang-undang negara bagian dan federal (misalnya, PL94-142,
orang-orang yang memiliki kekurangan fisik undang-undang Pendidikan [gagasan]) dan
diagnosis biasanya diperlukan jika tenaga profesional untuk mengenali siswa dengan
gangguan seperti itu. Hari ini, guru, para penasihat sekolah sekolah, psikolog, anggota
tim studi anak, dan sekolah lain tenaga profesional sering kali yang pertama untuk
mengenali dan mendiagnosis kaum muda dengan gangguan tidur ini.
2. Hari ini, sebuah diagnosis dilihat sebagai satu aspek dari pemahaman holistically klien.
Bersama dengan percobaan, wawancara, dan langkah-langkah lain, ia dapat digunakan
untuk membantu conceptualize masalah klien dan membantu dalam pengembangan
rencana perawatan yang akurat.
3. Karena hukum seperti orang Amerika dengan kekurangan fisik bertindak (misalnya,
Amerika Serikat Departemen Kehakiman, n.d. ), majikan diperlukan untuk membuat
akomodasi yang wajar untuk orang-orang yang memiliki kekurangan fisik, termasuk
orang-orang dengan gangguan mental. Para profesional kesehatan mental harus tahu
tentang diagnosis jika mereka untuk membantu mempertahankan diri mereka bekerja
individu dan membantu majikan dalam memahami syarat-syarat individu dengan
gangguan mental.
4. Dalam 50 tahun terakhir, gangguan mental diagnosis secara umum telah menjadi
mengikat jika asuransi kesehatan adalah untuk menggantikan biaya perawatan. Akurat
penting karena mendiagnosis operator asuransi sering memungkinkan hanya beberapa
4

pengobatan per diagnosis tertentu.


5. Tatanama diagnostik DSM telah semakin menjadi sangat penting dan efektif
berkomunikasi dengan mitra masyarakat yang mungkin menjadi bagian dari klien yang
sama (misalnya tim pengobatan, para profesional kesehatan mental lain, dokter,
perwakilan dari sistem hukum).
6. Semakin jelas bahwa secara akurat dan tepat dipalikasikan berkomunikasi sebuah
kesehatan mental diagnosis untuk klien dapat membantu individu memahami prognosis
atau perempuan itu dan membantu membentuk ekspektasi yang wajar untuk pengobatan.
Item ini menunjukkan kenapa ianya penting untuk beragam tenaga profesional untuk memahami
diagnosis. Walaupun DSM-IV-TR (edisi 4 dengan revisi teks; Asosiasi Kejiwaan Amerika
[APA], 2000 ) telah yang paling terkenal sistem klasifikasi diagnostik, dengan rilis baru-baru ini
DSM-5 ( APA, tahun 2013 ), revisi tatanama dikembangkan. Tetapi apakah DSM dan bagaimana
cara kerjanya?
DIAGNOSTIK, DAN MANUAL STATISTIK (DSM): SEJARAH SINGKAT
Berasal dari kata-kata Yunani d saya sebuah (selain) dan gnosis (untuk menganggap atau untuk
mengetahui), istilah diagnosis merujuk untuk membuat penilaian dari sebuah di luar individual,
atau obyektif sudut pandang, ( Segal & Dingin dge aku, 2001 ). Salah satu upaya pertama untuk
menggolongkan penyakit mental terjadi selama pertengahan 1800, ketika Amerika Serikat Biro
Sensus mulai menghitung insiden "idiocy" dan "warasan" ( Smith, 2012 ). Namun, ia tidak
sampai 1943 bahwa sebuah sistem klasifikasi formal yang disebut 203 Medis dikembangkan oleh
Departemen Perang AS ( Houts, 2000 ). Revisi sepanjang beberapa tahun, di 1952 publikasi ini
menjadi dasar untuk apa yang pertama (DSM DSM-I), yang disertakan dalam diagnosis 106 3
kategori luas ( APA, 1952 ; Houts, 2000 ). Dalam tahun 1968 DSM-II telah dirilis ( APA, 1968 ),
yang menciptakan 11 kategori diagnostik dengan 185 diagnosis diskrit dan disertakan
peningkatan besar dalam diagnosis masa kanak-kanak. Dalam sebuah upaya untuk meningkatkan
ilmu pengetahuan di balik diagnosis serta meningkatkan kompatibilitas dengan Asosiasi Medis
Amerika Klasifikasi Internasional Penyakit (ICD manual), edisi ketiga DSM diluncurkan pada
tahun 1980 ( APA, 1980 ), yang disertakan 265 mendiagnosis berbagai dan sebuah pendekatan
multiaxial untuk diagnosis. Dalam tahun 1994 DSM-IV telah dilepaskan, dan pada tahun 2000
sebuah teks tambahan revisi DSM-IV menjadi tersedia (DSM-IV-TR) dan berisi 365
5

mendiagnosis berbagai ( APA, 1994, 2000 ). Walaupun ada banyak kritik dari DSM-IV-TR (
Beutler & Malik, 2002 ; Thyer, 2006 ; Zalaquett, Fuerth, Stein, Ivey, & Ivey, 2008 ), ia menjadi
paling banyak dimanfaatkan sistem klasifikasi diagnostik untuk gangguan kesehatan mental (
Seligman, 1999, 2004 ). Sebuah DSM-IV diagnosis terdiri dari lima kapak yang disertakan
gangguan klinis, gangguan kepribadian dan retardasi mental, kondisi medis, dan faktor-faktor
lingkungan, psikososial dan penilaian global berfungsi (GAF skala) (lihat Tabel 3.1 ).

3.1 Mantan Lima Poros tabel Sistem Diagnostik


Poros
Poros saya
Poros II
Poros III
Poros IV
Poros V

Kategori
Gangguan klinis

Contoh-contoh
Depresi, kecemasan, bipolar,
skizofrenia, dsb.
Gangguan kepribadian dan retardasi Borderline gangguan
mental
kepribadian, gangguan
kepribadian, dll. antisocial
Kondisi medis umum
Tekanan darah tinggi, diabetes,
salah urat-pontoh, dsb.
Faktor-faktor lingkungan dan
Hilangnya pekerjaan baru-baru
psikososial
ini, perceraian, homelessness
baru-baru ini, dsb.
Penilaian Global berfungsi
Skor satu dari 1 sampai 100
abstrak satu berfungsi dan gejala

Amalan yang memanfaatkan multiaxial sistem diagnostik profesional kesehatan mental yang
diizinkan untuk mempresentasikan keterangan menyeluruh dari klien dan berkomunikasi
keprihatinan mereka dan untuk profesi lain gejala ( Neukrug & Schwitzer, 2006 ). Namun, ada
kemunduran untuk sebuah pendekatan multiaxial dan DSM-5 bergerak menuju satu-pendekatan
poros.
DALAM DSM-5
Manual diagnostik terbaru, DSM- 5 ( APA, tahun 2013 ), adalah di bawah dari tahun 1999 untuk
pembangunan 2013 ( Smith, 2012 ) dan ini pertama kali diterbitkan di Mei 2013. DSM-5 yang
6

mencakup, mungil nama yang akrab dengan komputer lainnya, yang akan menggantikan angka
rumi tradisi DSM. Edisi berikutnya, seperti perangkat lunak komputer, akan mengikuti edisi
dengan 5.1, 5.2, 5.3, dan seterusnya. Selain itu ke versi cetak DSM-5, sebuah komponen online
(www.psychiatry.org/dsm5) sekarang tersedia untuk bahan-bahan pelengkap seperti langkahlangkah assessment, tetapi juga termasuk artikel berita terkait, lembaran fakta, dan bahan-bahan
audiovisual. Perubahan penting lain yang telah dibuat kepada DSM-5 adalah sebuah upaya untuk
mensejajarkannya dengan ICD-9 dan yang lebih baru,, ICD-10 (tanggal pelepas: 1 Oktober,
2014). Bendera ini untuk menyatukan diagnostik, dan proses penagihan antara profesi
kedokteran dan psikologis. Justru itu, DSM-5 memberikan kedua-dua ICD-9 ICD dan kode-10,
dan apabila membuat diagnosis, yang mungkin anda untuk menyebutkan ICD kode-9 dan pasang
ICD pertama-10 daftar dalam tanda kurung. Jelas, penting untuk mengetahui versi yang sedang
digunakan ketika ICD membuat diagnosis anda.

SINGLE-AXIS

VS.

MULTIAXIAL DIAGNOSIS

Mungkin yang paling perubahan yang signifikan dalam DSM-5 adalah kembali ke satu-diagnosis
poros ( APA, tahun 2013 ; Wakefield, tahun 2013 ). Ini dilakukan karena beberapa alasan.
Pertama, pemisahan gangguan kepribadian sumbu ke II di bawah DSM-IV memberikan
gangguan ini status yang tidak berdasar dan kepercayaan sesat yang mereka sebagian besar
untreatable ( Baik, 2012 ; Krueger & Eaton, 2010 ). Klien yang memenuhi kriteria untuk sebuah
poros II diagnosis mungkin sekarang merasa lebih mudah untuk mengarahkan perawatan
kesehatan mental seperti mereka tidak lagi dapat dilihat sebagai orang yang memiliki diagnosis
yang lebih sulit untuk mengobati dari host dari gangguan lainnya. Dalam kondisi medis DSM-5,
tidak lagi yang tercantum pada sumbu terpisah (Poros dalam DSM III dan IV). Justru itu, mereka
akan cenderung lebih mengambil peran penting dalam kesehatan mental diagnosis serta mereka
dapat tercantum berdampingan dengan gangguan mental ( Wakefield, tahun 2013 ). Juga,
lingkungan dan mengalami stres psikososial, yang tercantum pada poros sebelumnya IV dari
DSM-IV, akan disenaraikan di samping gangguan mental dan masalah kesehatan fisik.
Kenyataannya, DSM-5 telah meningkatkan jumlah "kode V" (Z ICD-10) dalam kode, yang
dianggap nondisordered kondisi yang kadang-kadang menjadi fokus utama pengobatan dan
sering gambaran dari host dari masalah lingkungan dan psikososial (misalnya, homelessness,
7

perceraian, dsb.). Sebagai untuk skor GAF, sebelumnya pada poros V dari DSM-IV, apa yang
ditujukan untuk memasang kembali alat bantu (62-10) secara historis ini dengan penilaian
penskalaan berbeda sama sekali. Salah satu instrumen assessment, sekarang sedang diteliti,
adalah Organisasi Kesehatan Dunia Cacat Jadwal Assessment 2.0 (WHODAS 2.0). 36 item-ini,
self questionnaire mengkaji klien berfungsi dalam enam domain: pemahaman dan
berkomunikasi, untuk berkeliling, perawatan diri, bekerja sama dengan orang-orang, kegiatan
kehidupan, dan partisipasi masyarakat dalam ( APA, tahun 2013 ). Penilaian lain dan gangguan
yang di bawah meninjau untuk penelitian selanjutnya dapat ditemukan dalam bagian III DSM-5.
MEMBUAT

LAPORAN DAN

DIAGNOSIS

Dalam bagian selanjutnya bab ini, kita akan membahas kategori diagnostik tertentu, tetapi
pertama-tama mari kita melihat faktor-faktor lain yang terlibat dalam membuat dan diagnosis
pelaporan, termasuk cara memesan mendiagnosis berbagai; penggunaan subtypes, specifiers, dan
keseriusan; membuat diagnosis provisi; dan penggunaan "ditetapkan lain" atau "unspecified
gangguan".
Memesan mendiagnosis berbagai. individu akan sering memiliki lebih dari satu diagnosis,
oleh karena itu, sangatlah penting untuk mempertimbangkan jabatan mereka. Diagnosis pertama
adalah dipanggil kepala sekolah diagnosis. Dalam sebuah setelan rawat inap, ini akan menjadi
faktor yang paling berguna yang dihasilkan dalam pengakuan ( APA, tahun 2013 ). Dalam
sebuah lingkungan rawat jalan, ini akan menjadi alasan untuk kunjungan atau menjadi fokus
utama pengobatan. Perguruan Tinggi dan sekunder diagnosis harus dicantumkan dalam susunan
perlu untuk perhatian klinis. Jika kesehatan mental diagnosis karena suatu kondisi medis umum,
aturan coding ICD memerlukan kode dalam kondisi medis pertama, diikuti oleh diagnosis
kejiwaan, karena kondisi medis umum.
Subtypes, Specifiers, dan keseriusan. Subtypes untuk diagnosis dapat digunakan untuk
membantu berkomunikasi kejelasan. Mereka dapat dikenalpasti dalam DSM-5 oleh "menetapkan
apakah" instruksi dan mewakili kelompok-kelompok eksklusif kedua belah pihak gejala
(misalnya, clinician hanya dapat memilih salah satu). Misalnya, anak pederita memiliki tiga
subtypes berbeda untuk memilih dari: terutamanya inattentive, terutamanya hyperactive/spontan,
atau presentasi gabungan. Specifiers, pada sisi lain, tidak saling eksklusif, jadi lebih dari satu
dapat digunakan. Clinician memilih yang specifiers yang berlaku, jika ada, dan mereka yang
8

tercantum dalam manual sebagai "Menetapkan jika." anak pederita diagnosis hanya menawarkan
satu specifier yang "dalam pengampunan" ( sebagian APA, 2013, mukasurat 60 ). Beberapa
mendiagnosis berbagai akan menawarkan kesempatan untuk rate keseriusan gejala-gejala. Ini
dikenalpasti dalam DSM sebagai "Menetapkan keseriusan saat ini." Merujuk pada anak pederita
diagnosis, ada tiga opsi keseriusan: ringan, moderat, atau parah. Penulis DSM-5 yang telah
berusaha untuk menawarkan fleksibilitas yang lebih besar dalam keseriusan peringkat melalui
diagnosis dimensi . Misalnya, beberapa mendiagnosis berbagai opsi yang lebih besar ketika
menawarkan keseriusan peringkat. Gangguan Spektrum Autisme yang telah "Tabel 2 tingkat
keseriusan autisme gangguan spektrum" ( APA, 2013, mukasurat 52 ), yang menggolongkan
autisme pada tiga tingkat keseriusan dari "memerlukan dukungan," "memerlukan bantuan," dan
"memerlukan dukungan yang amat substansial." Demikian pula, skizofrenia telah pergi ke
pengguna "Clinician-Rated Psikosis Dimensi" chart Keseriusan Gejala ( mukasurat 941-744 )
untuk gejala suku bunga pada lima-point skala Likert. Ianya mudah untuk melihat bagaimana
perusahaan asuransi mungkin menggunakan klasifikasi keseriusan sebagai satu metode untuk
menentukan klien yang mereka akan berobat dana. Dalam ringkasan, tiga jenis specifiers telah
diidentifikasi oleh:

: "menetapkan apakah subjenisnya "-hanya memilih salah satu,

Specifier: "Menetapkan jika "-pilih sebagai berlaku, dan

Keseriusan: "Menetapkan keseriusan saat ini "-pilih tingkat symptomology paling akurat.

Diagnosis provisi. Kadang-kadang, clinician mempunyai kecenderungan yang kuat klien


akan memenuhi kriteria untuk diagnosis, tetapi belum memiliki informasi yang cukup untuk
membuat diagnosis. Ini adalah apabila clinician dapat membuat diagnosis provisi. Setelah
kriteria tersebut kemudian disahkan, label provisi dapat dihapus. Situasi ini sering terjadi bila
klien tidak dapat memberikan sebuah sejarah yang memadai atau agunan diperlukan informasi
lebih lanjut. Selain itu, ada label diagnostik informal yang tidak tercantum dalam DSM-5 yang
membantu dalam berkomunikasi informasi tambahan. Mereka umumnya ditemukan dalam
ringkasan diagnostik atau saat berkomunikasi secara informal dengan klinisi lainnya. Mereka
termasuk yang berikut:

Aturan keluar-klien memenuhi banyak dari gejala-gejala tetapi tidak cukup untuk membuat
diagnosis pada waktu ini; ia harus dianggap lebih lanjut (misalnya, aturan dari gangguan
9

depresif berat).

Sifat-sifat-orang ini tidak memenuhi kriteria, bagaimanapun, ia mempersembahkan dengan


banyak fitur dari diagnosis (misalnya, borderline pekerti atau cluster B pekerti).

Oleh history-record sebelumnya (penyedia lain atau rumah sakit) menandakan diagnosis ini;
mencatatkan dapat tidak akurat atau kedaluwarsa (misalnya, ketergantungan alkohol oleh
sejarah).

Oleh laporan diri-klien menuntut sebagai diagnosis; ia saat ini dipaksa; ini dapat tidak akurat
(misalnya, bipolar oleh laporan diri).

Misalnya, Anda mungkin menerima sebuah dari rumah sakit atau faks penyedia lain yang
mungkin mengatakan, "Borderline Gangguan Kepribadian Provisi. Diagnosis gangguan bipolar
oleh laporan diri-tidak ada gejala dikenalpasti." pingkal
Gangguan ditetapkan lain dan gangguan reproduksi yang. DSM-IV telah diagnosis tidak
ditetapkan (NOS) untuk menangkap symptomology yang tidak sesuai ke dalam kategori
terstruktur. Sebagai pengganti dari NOS diagnosis, DSM-5 menawarkan dua opsi ketika situasi
ini muncul. Ditetapkan lain dan gangguan reproduksi yang harus digunakan apabila penyedia
percaya perseorangan gangguan fungsi atau kesesakan adalah, namun secara bermakna, ia tidak
memenuhi kriteria diagnostik tertentu dalam kategori tersebut. "orang lain" yang ditetapkan
harus digunakan bila clinician ingin berkomunikasi secara spesifik mengapa kriteria tidak cocok.
"gangguan reproduksi yang" harus digunakan ketika ia tidak ingin, atau tidak dapat,
berkomunikasi secara spesifik. Misalnya, jika seseorang tampak yang signifikan serangan panik
tetapi hanya mempunyai tiga dari empat kriteria yang diperlukan, diagnosis dapat "Ditetapkan
Gangguan Panik Lain-karena gejala tidak memadai." Jika tidak, clinician laporan akan
"Unspecified Gangguan panik."
KATEGORI DIAGNOSTIK

TERTENTU

Bagian II dari DSM-5 menawarkan sebuah diskusi mendalam dari 22 kategori diagnostik yang
luas dan subtypes mereka serta keterangan tentang gangguan yang diinduksi oleh obat dan apa
yang disebut "keadaan lain yang mungkin menjadi fokus perhatian klinis." yang berikut
menawarkan penjelasan singkat dari gangguan tidur ini dan ini diringkas dari DSM-5 ( APA,
tahun 2013 ). Silakan merujuk ke DSM-5 untuk kajian yang mendalam gangguan masingmasing. Bila Anda selesai meninjau diagnosis ini, kelas Latihan mungkin ingin melakukannya
10

3.1.

Gangguan Neurodevelopmental. Kelompok ini biasanya gangguan ini merujuk kepada


mereka yang nyata selama pengembangan awal, walaupun mendiagnosis berbagai kadangkadang tidak ditetapkan hingga dewasa. Contoh-contoh gangguan neurodevelopmental
termasuk orang yang memiliki kekurangan fisik, intelektual gangguan komunikasi, autisme
gangguan spektrum (penggabungan mantan kategori-kategori gangguan autistik, gangguan di
Asperger, gangguan disintegrative masa kanak-kanak, dan gangguan perkembangan), anak
pederita, gangguan belajar tertentu, gangguan motor, dan gangguan neurodevelopmental
lainnya.

Spektrum skizofrenia dan gangguan psikotik lainnya. gangguan yang dimiliki untuk bagian
ini semua memiliki satu ciri umum: gejala psikotik, yang, khayalan, halusinasi, perilaku
terdisorganisasi atau perilaku motor abnormal, dan/atau gejala-gejala negatif. Gangguangangguan kepribadian schizotypal mencakup (yang terdaftar lagi, dan dijelaskan secara
komprehensif, dalam kategori gangguan kepribadian dalam DSM-5), gangguan bersifat
waham, gangguan psikotik singkat, gangguan schizophreniform, skizofrenia, gangguan
skizoafektif, zat/obat-obatan yang diinduksi oleh gangguan psikotik, gangguan psikotik
karena kondisi medis lain, dan gangguan katatonik.

Bipolar dan gangguan terkait gangguan. dalam kategori ini merujuk kepada gangguan di
suasana di mana siklus klien melalui tahap-tahap mania, atau mania dan depresi. Kedua-dua
anak-anak dan orang dewasa dapat didiagnosis dengan gangguan bipolar, dan clinician dapat
bekerja untuk mengidentifikasi pola presentasi mood, seperti bersepeda cepat, yang lebih
sering dipelihara pada anak-anak. Gangguan tidur ini termasuk bipolar saya, bipolar II,
gangguan cyclothymic, zat/obat-obatan yang disebabkan, bipolar dan gangguan terkait untuk
kondisi medis lain, dan lain-lain ditetapkan atau unspecified bipolar dan gangguan terkait.

Gangguan depresif berat. Sebelumnya dikelompokkan dalam kategori yang lebih luas dari
"gangguan mood" dalam DSM-IV-TR, gangguan tidur ini menerangkan keadaan di mana
mood depresif adalah kekhawatiran jangka panjang. Mereka termasuk gangguan
dysregulation mood dialirkan, gangguan depresif berat, terus-menerus gangguan depresif
berat (juga dikenal sebagai dysthymia), dan gangguan dysphoric premenstrual.

Ansietas. Terdapat beragam ansietas, yang dapat didiagnosis dengan mengidentifikasi


penyebab tertentu atau umum ketidak senangan atau takut. Kecemasan ini atau takut akan
11

dianggap secara bermakna saat ini dan terus-menerus dari waktu ke waktu yang berlebihan.
Contoh-contoh ansietas (yang biasanya nyata di awal termasuk pemisahan kegelisahan
pembangunan dan selektif ketidak-mampuan untuk berbicara. Contoh-contoh lain ansietas
adalah phobia tertentu, gangguan kecemasan sosial (juga dikenal sebagai phobia sosial),
gangguan panik, dan generalized kecemasan kekacauan.

Obsessive-Compulsive dan gangguan Terkait Gangguan. dalam kategori ini semua


melibatkan pikiran dan perilaku compulsive pria obsesif yang tidak terkendali dan klien
merasa dipaksa untuk melakukan mereka. Dalam kategori ini termasuk diagnosis pria
obsesif-gangguan compulsive, gangguan dysmorphic tubuh, memiliki kekacauan,
trichotillomania (atau rambut-menarik), dan excoriation kekacauan (atau kulit-memetik
gangguan).

Trauma- dan gangguan Stressor-Related. sebuah kategori baru untuk DSM-5, trauma dan
gangguan stress menekankan bahwa kehidupan peristiwa dampak yang menyelimuti dapat
memiliki pada perseorangan emosional dan kesejahteraan fizikal. Mendiagnosis berbagai
termasuk reaktif gangguan lampiran, disinhibited gangguan keterlibatan sosial, posttraumatic
stress disorder, stress disorder akut, dan gangguan penyesuaian.

Gangguan Dissociative. gangguan tidur ini menandakan sementara atau gangguan


berkepanjangan untuk kesadaran yang dapat mengakibatkan individu untuk salah
menafsirkan identitas, lingkungannya, dan kenangan. Termasuk dissociative diagnosis
gangguan identitas (sebelumnya dikenal sebagai beberapa gangguan kepribadian), amnesia,
depersonalization dissociative/derealization kekacauan, dan lain-lain dan unspecified
gangguan dissociative yang ditetapkan.

Gejala somatik dan gangguan terkait. Somatik gangguan gejala sebelumnya disebut sebagai
"gangguan somatoform" dan ditandai oleh mengalami gejala fisik tanpa bukti fisik yang
menyebabkan, justeru penyebab psikologis. Gangguan gejala somatik termasuk gejala
penyakit, kelainan somatik kecemasan disorder (sebelumnya hypochondriasis), konversi
(atau fungsi gejala neurologis gangguan), faktor psikologis mempengaruhi kondisi medis
lainnya, dan gangguan factitious.

Tabung dan gangguan makan . kelompok ini menerangkan klien yang memiliki gangguan
keprihatinan berat tentang jumlah atau jenis makanan yang mereka makan untuk titik bahwa
masalah kesehatan serius, atau bahkan kematian, dapat menyebabkan dari perilaku makan.
12

Contoh-contoh tersebut meliputi avoidant/membatasi gangguan asupan makanan, gangguan


anorexia nervosa, bulimia nervosa, "pesta makan, pica, dan gangguan rumination.

Gangguan penghapusan. gangguan tidur ini dapat terwujud pada titik mana pun dalam
kehidupan seseorang, walaupun mereka biasanya didiagnosa pada awal masa anak-anak atau
remaja. Mereka termasuk enuresis, yang adalah penghapusan tidak tepat, dan encopresis urin,
yang tidak tepat penghapusan feses. Perilaku ini mungkin atau mungkin tidak disengaja.

Gangguan Sleep-Wake. kategori ini merujuk ke di mana satu, gangguan pola tidur yang
terkena dampak parah, dan mereka sering co-terjadi dengan gangguan lainnya (misalnya,
depresi atau cemas). Beberapa contoh-contoh tersebut meliputi kekacauan, gangguan
hypersomnolence insomnia, restless legs syndrome, narcolepsy, dan gangguan mimpi buruk.
Beberapa gangguan pengaktifan-tidur melibatkan berbagai variasi bernafas, seperti sleeprelated hypoventilation, obstructive sleep apnea hypopnea, atau central sleep apnea. Lihat
DSM-5 untuk daftar lengkap dan keterangan dari gangguan tidur ini.

Bahkan Terhenti seksual. gangguan tidur ini berhubungan dengan masalah yang mengganggu
fungsi seksual atau kemampuan untuk mengalami kesenangan seksual. Mereka terjadi pada
semua jenis kelamin dan termasuk ditunda, gangguan disfungsi ejakulasi, gangguan orgasmic
perempuan, dan langkah prematur (atau awal) gangguan ejakulasi, antara lain.

Dysphoria jender. Sebelumnya yang dipanggil, "gangguan identitas jender," kategori ini
meliputi mereka individu yang mengalami kesesakan signifikan dengan jenis kelamin mereka
lahir dan dengan peran-peran gender yang terkait. Diagnosis ini telah dipisahkan dari
kategori gangguan seksual, seperti sekarang ini diterima bahwa gender dysphoria tidak
berkaitan dengan atraksi seksual seseorang.

Impuls, dialirkan, dan gangguan melakukan kontrol. gangguan tidur ini ditandai oleh
diterima secara sosial atau jika tidak kacau dan perilaku berbahaya yang berada di luar
kontrol individu. Secara umum, lebih umum pada laki-laki dari pada perempuan, dan sering
pertama kali terlihat dalam masa kanak-kanak, mereka termasuk berseberangan gangguan
perlawanannya, gangguan melakukan, gangguan bahan peledak terputus-putus, gangguan
kepribadian antisocial (yang juga dikodekan di dalam kategori gangguan kepribadian),
kleptomania, dan pyromania.

Substance-Related dan gangguan Puding Caramel pencuci. Zat menggunakan termasuk


gangguan dalam berfungsi sebagai gangguan hasil mengimpikan atau dorongan yang kuat.
13

Biasanya disebabkan oleh ditentukan dan obat-obatan haram atau paparan terhadap racun,
dengan gangguan tidur ini otak upah jalur sistem diaktifkan bila zat ini diambil (atau dalam
kasus gangguan perjudian, ketika kelakuan yang sedang dilakukan). Beberapa bahan umum
termasuk alkohol, kafein, nikotin, mirip cannabis, opioids, inhalants, amphetamine,
phencyclidine (PCP), sedatif, karena hipnotik atau anxiolytics. Kelainan menggunakan zat
yang ditetapkan lebih lanjut dengan istilah berikut: keracunan, pengunduran, dicetuskan, atau
unspecified.

Gangguan Neurokognitif. gangguan tidur ini didiagnosis ketika penurunan di salah satu
fungsi kognitif adalah berbeda bermakna dari masa lalu dan biasanya merupakan hasil dari
suatu kondisi medis (misalnya, Penyakit Parkinson, atau penyakit Alzheimer), penggunaan
zat/obat-obatan, atau trauma luka, di antara otak fenomena lainnya. Contoh-contoh gangguan
neurokognitif (NCD) termasuk keresahan, dan beberapa jenis dan utama NCD seperti
frontotemporal ringan untuk NCD, Untuk NCD karena penyakit Parkinson, Untuk NCD
karena infeksi HIV, untuk NCD karena penyakit Alzheimer, zat- atau obat-dicetuskan NCD,
dan untuk NCD vaskular, antara lain.

Gangguan kepribadian. 10 gangguan kepribadian dalam DSM-5 semua melibatkan pola


perilaku dan pengalaman yang terus-menerus, dan kamu meminta disegerakan menyimpang
dari satu harapan budaya. Biasanya, pola ini muncul di masa remaja atau awal usia dewasa
dan menyebabkan kesukaran teruk dalam hubungan-hubungan interpersonal. Gangguan
kepribadian yang dikelompokkan ke tiga gugus berikut berdasarkan pada perilaku serupa:

Gugus A: Paranoid, schizoid, dan schizotypal. Individu-individu ini terlihat


aneh atau tidak biasa dalam perilaku mereka dan hubungan interpersonal.

Cluster B: Antisocial, borderline, histrionic, dan narcissistic. Individu-individu


ini kelihatannya terlalu dibesar-besarkan, emosional, atau tak terduga dalam
perilaku mereka dan hubungan interpersonal.

Cluster C: Avoidant, bergantung, dan pria obsesif-compulsive (tidak


dikelirukan dengan pria obsesif-gangguan compulsive). Individu-individu ini
cenderung muncul gelisah, khawatir, atau pemarah perilaku mereka.

Di samping itu gugus, salah satu dapat didiagnosis dengan ditetapkan atau
unspecified gangguan kepribadian, serta perubahan kepribadian karena m kondisi edical
lain, seperti kepala cedera.
14

Gangguan Paraphilic. gangguan tidur ini didiagnosis ketika klien adalah membangkitkan
untuk keadaan-keadaan yang seksual menyimpang dari rangsangan seksual tradisional dan
ketika perilaku seperti itu menyebabkan merugikan atau kesesakan emosi yang signifikan.
Gangguan-gangguan exhibitionistic mencakup, gangguan voyeuristic, gangguan frotteurisitc
seksual, sadisme dan gangguan masochism seksual, gangguan fetishistic, gangguan
transvestic, gangguan pedophilic, dan lain-lain dan unspecified gangguan paraphilic yang
ditetapkan.

Gangguan Mental lainnya. kategori diagnostik ini termasuk gangguan mental yang tidak
jatuh dalam salah satu kelompok-kelompok yang telah disebutkan di atas dan tidak memiliki
karakteristik menyatukan. Contoh-contoh tersebut meliputi gangguan mental yang ditetapkan
lain untuk kondisi medis lain, unspecified gangguan mental karena kondisi medis lain,
gangguan mental yang ditetapkan lain, dan gangguan mental alat reproduksi.

Gangguan Gerakan Medication-Induced dan efek samping lain dari obat-obatan. gangguan
tidur ini adalah hasil dari efek samping yang berat dan merugikan untuk obat-obatan,
walaupun sebuah link causal tidak dapat ditampilkan. Beberapa dari gangguan tidur ini
termasuk menunjukan neuroleptic malignant parkinsonism yang diinduksi oleh, menunjukan
neuroleptic malignant syndrome, obat-obatan yang disebabkan dystonia, obat-obatan yang
diinduksi oleh akathisia akut, pengobatan bila, hentikan pengobatan akathisia, obat-obatan
yang disebabkan postural tremor, obat lain yang diinduksi oleh gangguan gerak,
antidepressant discontiunation syndrome, dan efek samping lain dari obat-obatan.

Kondisi Lain Yang Mungkin menjadi fokus Penilaian Klinis. Mengingatkan Poros IV DSM
edisi sebelumnya, bagian terakhir ini pada Bagian II berakhir dengan keterangan
kekhawatiran yang dapat secara bermakna, seperti pelecehan/mengabaikan, masalah
psikososial, relasional, dan keprihatinan lingkungan pribadi, pendidikan/masalah kerja,
perumahan dan masalah-masalah ekonomi, dan masalah-masalah yang berhubungan dengan
sistem hukum. Kondisi ini, yang tidak mempertimbangkan gangguan mental, umumnya lised
sebagai V, yang setara dengan kode ICD-9, atau kode Z, yang setara dengan ICD-10.
Kadang-kadang, kondisi kesehatan mental dapat co-terjadi atau menjadi "comorbid."

Misalnya, anggaplah klien menyajikan dengan gangguan kegelisahan tetapi juga pelanggaran
ham alkohol. Dalam situasi ini, ia akan sesuai dengan gangguan melambangkan kedua apabila
15

membuat diagnosis (misalnya, generalized kecemasan kekacauan dan penyalahgunaan alkohol).


Gangguan kadang-kadang bahkan dapat memperburuk satu sama lain. Contoh ini dapat
seseorang yang memenuhi kriteria untuk depresi, tetapi gejala itu, atau hanya ada sementara
penarikan mundur dari kokain menggunakan. Daripada mendiagnosis ini sebagai episode
depresif berat, ia adalah lebih sesuai bahawa dia didiagnosis dengan suatu zat yang diinduksi
oleh gangguan mood (lihat Latihan 3.1 ).

<mulai_box>
LATIHAN3.1:GANGGUANMENDIAGNOSIS
Setelah class telah menjadi terbiasa dengan berbagai, gangguan instruktur dapat meminta kepada
siswa untuk mempraktikkan mengidentifikasi dan gangguan mendiagnosis dengan menjalankan
memainkan peran dalam dyads atau kelompok-kelompok kecil. Anda mungkin ingin
menggunakan DSM-5 sebagai panduan untuk bertindak kriteria.
<akhir kotak_>
PERTIMBANGAN

MEDIS LAINNYA

Kadang-kadang, gejala fisik disebabkan oleh kondisi medis mungkin tampak sangat mirip
dengan satu atau lebih dari gangguan mental. Misalnya, beberapa dari gejala-gejala depresi
meliputi gangguan selera untuk (menambah atau mengurangi), iritasi, atau kegelisahan, hiper
atau insomnia (misalnya, tidur terlalu banyak atau terlalu sedikit), kesulitan memusatkan
perhatian, dan kelelahan atau energi berkurang. Menariknya, semua gejala ini juga dapat
dikaitkan kepada hipertiroidisme atau underactive kelenjar tiroid. Justru itu, selain untuk klien
yang dikaji untuk masalah-masalah kesehatan mental, ia juga penting bagi mereka perlu dikaji
untuk potensi masalah medis. Salah satu cara untuk mengatasi hal ini untuk mendapatkan rincian
spesifik tentang bila klien mulai mengalami gejala atau perempuan itu. Informasi tersebut akan
membantu menentukan apakah gejala mulai sementara kondisi medis hadir dan apakah
kemungkinan bahwa kondisi medis adalah penyebab dari gangguan mental. Sebagai contoh,
anggap anda memiliki sebuah klien yang menghadirkan dengan semua kriteria untuk sebuah
kecemasan disorder (seperti kegelisahan, iritasi, dan insomnia), namun anda tahu bahwa gejalagejala bermula apabila tiroid klien mulai menurun dan ia menemukan underactive itu. Jika klien,
gangguan kecemasan hanya datang tentang karena hipertiroidisme, maka ia akan sesuai untuk
beradu pendapat, yang seperti itu, kegelisahan akibat kelainan kondisi medis umum,
16

hipertiroidisme. Tentu saja, ia selalu bijaksana untuk merujuk kepada klien atau dia dokter
perawatan primer jika ada kecurigaan bahwa masalah medis mungkin sumber masalah psikologis
(lihat Latihan 3.2 ). Jika melaporkan masalah medis, kode ICD untuk masalah tertentu dapat
digunakan bersama dengan DSM-5 gangguan kesehatan mental diagnosis.

<mulai_box>
3.2MENDIAGNOSISKONDISIMEDISLATIHAN
Setelah mempraktikkan merumuskan diagnosis latihan di 3.1, instruktur dapat meminta kepada
siswa untuk bermain peran lagi, yang menggabungkan sebuah kondisi medis waktu ini.
Mengenali kondisi medis serta kondisi kesehatan mental, dan pastikan untuk catatan apakah itu
atau jika ia adalah terpisah penyebab kesehatan mental diagnosis.
<akhir kotak_>
DAN PSIKOSOSIAL PERTIMBANGAN LINGKUNGAN
Sebagai bagian dari sebuah menyelesaikan diagnosis, ia adalah mutlak bagi clinician untuk
menilai psikososial klien dan mengalami stres lingkungan. Fokus seperti mendorong sebuah
pandangan menyeluruh dari klien, menyediakan petunjuk diagnostik, penting dan dapat
membantu untuk mengenali masalah penting dalam perencanaan perawatan. Tidak dianggap
sebagai gangguan mental, beberapa dari banyak keprihatinan lingkungan psikososial dan
mungkin berisi masalah-masalah dengan grup dukungan utama klien, lingkungan sosial,
pendidikan, pendudukan, perumahan, situasi ekonomi, akses ke layanan kesehatan, kejahatan
atau sistem hukum, atau psikososial penting lainnya dan pertimbangan lingkungan ( APA, tahun
2013 ). Sementara keprihatinan-keprihatinan ini sebelumnya yang tercantum pada poros IV dari
DSM-IV, mereka sekarang ditandakan dalam sistem paksi tunggal, kebanyakan yang tercantum
di bawah "keadaan lain yang mungkin menjadi fokus perhatian klinis" yang didiskusikan
sebelumnya, dan di korelasikan untuk kode V di DSM-5 (yang cocok dengan ICD-9) atau kode Z
(sesuai ICD-10 ) (misalnya, Z59.0 Homelessness; Z65.1 Penjara; Z55.3 Underachievement di
sekolah).
17

Untuk menggambarkan pentingnya dan pertimbangan lingkungan psikososial,


pertimbangkan 48-tahun laki-laki mengalami kecemasan berat dan depresi. Dia menjelaskan
bahwa gejala-nya dimulai segera setelah sebuah tornado yang menyebabkan kerusakan parah
pada rumah-Nya dan peternakan tetangga (bencana alam). Orang itu dan keluarganya telah
tinggal dengan saudara sekitar 70 mil dari halaman utama (homelessness), dan mereka tidak
mempunyai sumber penghasilan selama tiga bulan (masalah ekonomi) sejak hasil panen kedelai
yang sudah hancur dalam tornado ( masalah kerja). Dengan memahami psikososial klien dan
pertimbangan lingkungan, kecemasan-nya dan depresi dapat dilihat dalam konteks keadaan
kehidupan-Nya.
PERTIMBANGAN

BUDAYA

Karena orang-orang dari beragam budaya mungkin mengekspresikan diri mereka dengan caracara yang berbeda, symptomatology mungkin berbeda-beda sebagai budaya fungsi ( Mezzich &
Caracci, 2008 ). Justru itu, beberapa telah berpendapat bahwa walaupun diagnosis dapat
membantu dalam perencanaan perawatan, ia dapat membawa ke mempengaruhi salah diagnosis
dalam budaya kelompok tertindas ketika klinisi tidak sepenuhnya mempertimbangkan, jenis
kelamin, dan budaya perbedaan etnis ( Naik & Cheung, 2012 ; Eriksen & Kress, 2005, 2006,
2008 ; Kress, Eriksen, Rayle, & Ford, 2005 ; Madesen & Si lintah, 2007 ).
APA (2013) telah cuba untuk memerangi beberapa masalah-masalah ini dengan
menanyakan klinisi untuk memahami dan mengakui "budaya perbedaan bermotif dalam gejala" (
p. 758 ). Misalnya, budaya Amerika Latin mengakui bahwa ataque de nervios ("menyerang
syaraf") adalah sebuah gangguan umum yang berhubungan dengan sulit dan berat pengalaman
hidup dan mungkin menunjukkan dirinya melalui "sakit kepala dan 'otak pegal' (occipital
ketegangan), iritasi, leher, gangguan lambung, kesulitan tidur, kegelisahan, mudah tearfulness,
ketidakmampuan untuk berkonsentrasi, gentar, kebas sensasi, dan mareos (pusing dengan
berformat vertigo-seperti)" ( eksaserbasi p. 835 ). Sebuah clinician yang mengabaikan budaya
klien dapat dengan mudah misdiagnose klien yang mempersembahkan dengan gejala seperti ini
dan memperlakukan klien dengan strategi yang tidak tepat. Praktik terbaik untuk konseling
multibudaya menunjukkan bahwa clinician memiliki beberapa pemahaman tentang perbedaan
pada cross-ekspresi budaya gejala-gejala dan bahwa clinician mendalami budaya klien dengan
dia sewaktu menentukan pada strategi pengobatan yang tepat.
18

Akhirnya, DSM-5 menawarkan sebuah Rumusan Budaya ruas berjudul Wawancara (CFI)
yang membantu klinisi memahami jenis-jenis nilai-nilai, pengaruh dan pengalaman, yang telah
datang untuk membentuk pandangan klien dan memberikan ringkasan untuk cara wawancara
dengan kejahatannya klien dari latar yang berbeda. Selain itu, DSM-5 menawarkan definisidefinisi beberapa gejala lintas budaya dan mengenali bagaimana dampak masalah lintas budaya
beragam mendiagnosis berbagai.
RANCANGAN AKHIR PADA DSM-5 DALAM PROSES ASSESSMENT
DSM-5 adalah salah satu bagian tambahan total proses assessment. Bersama dengan wawancara,
penggunaan tes, dan prosedur assessment informal, ia dapat memberikan pemahaman yang luas
dari klien dan dapat menjadi bagian penting dalam proses perencanaan perawatan.
Pertimbangkan apa yang mungkin ingin mendirikan sebuah rencana perawatan jika hanya satu
menguji telah digunakan. Kemudian, pertimbangkan apa yang akan seperti jika tes ini
digunakan, dua kemudian dua ujian dan prosedur assessment informal; kemudian dua ujian,
prosedur assessment informal, dan sebuah wawancara; dan akhirnya, dua ujian, prosedur
assessment informal, sebuah wawancara, dan diagnosis. Jelas, lebih "bukti" kita dapat
mengumpulkan, snapshot kami yang lebih jelas dari klien kami menjadi dan hal ini, pada
gilirannya menghasilkan perencanaan perawatan yang lebih baik (lihat 3.3 ).
LATIHANPRAKTIKMEMBUATDIAGNOSIS3.3
Pada anda sendiri, secara berpasangan, atau sebagai satu kelas, membaca studi kasus berikut dan
merumuskan diagnosis untuk setiap orang menggunakan DSM-5 sebagai panduan.
Mendiskusikan bagaimana anda datang untuk diagnosis ini, apa diagnosis lain anda dianggap
tetapi memerintah keluar, dan informasi tambahan apa yang akan membantu dalam telah menilai
skenario. Jawabannya bisa ditemukan di akhir bab ini.
Mikayla
Mikayla adalah 8 perempuan berusia 2 tahun, dalam kelas kedua. Dia tinggal bersama orang
tuanya dan adik laki-laki, dan ibunya menerangkan dia sebagai "segenggam, tetapi sangat
manis." Mikayla harus ulangi kelas kedua karena masalah perilaku di kelas, yang juga
mengakibatkan nilai ujian yang lebih rendah dan kelas miskin. Dia adalah anak populer di
kalangan rekan-rekannya, tetapi ia terus-menerus berjuang dengan gurunya untuk mengikuti arah
jalan, tetap pada tugas, dan tetap duduk. Guru Mikayla telah berunding dengan dia dan kelas tk
guru dan tidak berpikir bahwa Mikayla telah masalah komunikasi atau gangguan belajar tertentu
karena ia melakukan di atas harapan tingkat kelas dalam grup kecil atau dengan satu-pada-satu
perhatian. Dalam situasi kelas besar, ia adalah selalu dalam keadaan bergerak, sorak ketika ia
harus berbicara dengan diam-diam, dan mudah dilalaikan, yang mencegah dia dari ekspektasi
rapat. Paling baru-baru ini, Mikayla adalah merujuk kepada penasihat sekolah setelah ia
19

melanggar kelas tangki ikan selama kegiatan membaca senyap. "Saya mencoba untuk memberi
makan Sirip," ia menjelaskan.
Tracey
Tracey adalah 25-tahun bekerja ibu tunggal. Anak perempuannya, artis Alicia, adalah tiga tahun
dan di hari perawatan selama minggu kerja. Baru-baru ini Tracey dipisahkan dari artis Alicia
ayah dan telah tahanan satu-satunya anak-anak mereka karena mantan suaminya telah
meloloskan secara fisik. Dalam beberapa tahun terakhir, ketika masalah perkawinan, Tracey
mulai telah dipenuhi dengan cemas tetapi begitu sibuk bahwa ia "tidak memiliki waktu untuk
menanganinya." Ia mulai hari pada 5:30 pagi untuk mendapatkan artis Alicia berpakaian,
dikemas, dan siap untuk perawatan hari sehingga ia dapat mendapatkan untuk bekerja dengan
7:00 pagi Tracey biasanya telah makan pagi di jalan, dan dia frequents drive-melalui pada jalan
untuk bekerja untuk kenyamanan. Di kantor "pergi, pergi, pergi," dan Tracey biasanya tidak
memiliki waktu untuk mematahkan untuk makan siang. Pada saat ia menerimanya artis Alicia
dari hari care dan mendapat rumah, ini tentang 6:00 p.m. Tracey juru masak makan malam oleh
7:00 p.m., yang biasanya terdiri dari makanan seimbang yang sehat. Setelah ia memberikan artis
Alicia mandi dan menempatkan dia di tempat tidur, Tracey akhirnya mendapatkan tertingginya
pada katil untuk bersantai dan menonton TV. Sekarang yang ia sendiri, ia merasa tidak terkendali
mendesak untuk snack yang sering melalui dan kantong besar dari kentang diikuti oleh satu pain
es krim sebelum ia menyadari. Kadang-kadang, ia selesai makan jumlah itu sebelum setengah
jam kesayangannya komedi situasi di atas. "Saya tidak bisa berhenti. Seperti zona aku, dan saya
bahkan tidak menyadari betapa banyak yang telah saya makan. Saya merasa seperti saya tidak
dapat mengendalikan diri saya sendiri. Biasanya, saya merasa sakit secara fisik di akhir dan
hanya terjadi keluar, seperti sebuah koma." Tracey makanan tidak ingin makan makanan sampah
di depan orang lain karena ia malu yang dia telah memperoleh begitu banyak weight sejak
perceraian dan merasa sadar diri. Ia telah makan di seperti ini untuk rahasia tahun lalu sejak
perceraian, dan ia terjadi hampir setiap malam. Ini diperoleh ke tahap di mana dia telah dimulai
mengisolasi dirinya, mengutamakan untuk pulang ke rumah dan snack semua malam di depan
TV sebagai ganti menghabiskan waktu bersama keluarga dan teman-teman.
Alan
Alan adalah 37 tahun, bankir yang diceraikan dari isterinya dua tahun yang lalu. Alan
melaporkan bahwa istrinya meninggalkan dia setelah ia menjadi terlepas dari tautannya dari
perkahwinan. Ia mengingat bahwa ia dan isterinya college sweethearts dan sebelumnya sangat
aktif dalam masyarakat mereka. Kemudian, kira-kira lima tahun yang lalu, Alan mengatakan,
"Saya berlari dari uap." Dia telah terus-menerus mudah tersinggung, dimulai secara masal tidur,
menguat sekitar 45 pon, dan kehilangan yang terlibat dalam sesuatu dan sosial kegiatan. Alan
asap marijuana kira-kira dua hingga empat kali per hari dan minuman vodka pengunjung untuk
"terbaik dan mengambil hati-Ku dari sesuatu." Dia baru-baru ini telah ditahan untuk milik
marijuana dan berkendara di bawah pengaruh, letakkan pada probation untuk satu tahun, dan ini
disebut untuk konseling dengan MK. Alan mengaku menjadi tertekan, tapi mendesak meski, "tak
ada yang saya tidak dapat menangani." Dia tidak ingin menghentikan marijuana atau alkohol-nya
menggunakan tetapi telah pemikiran tentang berhenti karena layar obat bulanan, yang akan
segera diperlukan oleh petugas probation-Nya.
<akhir kotak_>
20

RANGKUMAN
Kami mulai bab ini dengan mendiskusikan pentingnya diagnosis untuk beragam profesional
kesehatan mental. Kami mencatat bahwa sebuah persentase besar orang Amerika ini didiagnosis,,
dengan tahunan gangguan mental, dan menyoroti sejumlah alasan-alasan yang diagnosis telah
menjadi penting bagi tenaga profesional, seperti t waris signifikans dalam mengidentifikasi anakanak di sekolah dengan emosional, dan perilaku, gangguan belajar; fakta bahwa diagnosis dapat
membantu dalam conceptualization kasus dan perencanaan perawatan; fakta bahwa tenaga
profesional dapat membantu majikan membuat akomodasi untuk dan memahami individu
dengan gangguan mental; karena mereka sangat penting untuk penggantian asuransi; karena
mereka membantu tenaga profesional dalam tepat untuk berkomunikasi satu sama lain; dan
karena mereka dapat membantu mereka memahami klien dan ekspektasi pengobatan prognosis
perencanaan.
Selanjutnya, kami menawarkan sebuah sejarah singkat DSM mulai dengan Amerika Serikat
Biro Sensus menghitung mereka yang "idiots" dan "gila" selama pertengahan 1800. Namun, kita
mencatat bahwa ia tidak sampai 1943, dengan 203 Medis militer, bahwa sebuah sistem
klasifikasi formal dikembangkan . Kita kemudian mencatat bahwa DSM-I dikembangkan di
1952 dan mengalami beberapa revisi naik melalui edisi terbaru, DSM-5 pada tahun 2013. Kita
kemudiannya memperkenalkan DSM-5 dan mulai mencatat beberapa perbedaan dari
pendahulunya, khususnya pindah dari lima-kapak di DSM sistem-IV ke salah satu sistem paksi
di DSM--5.
Sebagian besar dari bab dijelaskan DSM-5. Kita mulai dengan menjelaskan mengapa DSM5 dipindahkan ke salah satu sistem paksi-dan dibahas membuat dan melaporkan diagnosis.
Dalam proses ini, kita membahas cara memesan mendiagnosis berbagai; penggunaan subtypes,
specifiers, dan keseriusan; bagaimana membuat diagnosis provisi; dan penggunaan yang
ditetapkan atau gangguan reproduksi yang lain. Selanjutnya, kami menawarkan sangat singkat
keterangan mengenai 22 kategori diagnostik. Kami juga menawarkan sebuah diskusi singkat
tentang ko-terjadi atau gangguan comorbid. Hal ini diikuti oleh sebuah diskusi tentang
pentingnya memahami bagaimana kondisi medis dapat menyebabkan atau memperburuk
diagnosis. Kita kemudian mencatat bahwa sementara dan pertimbangan lingkungan psikososial
ditempatkan pada poros IV dari DSM-IV, mereka sekarang korelasikan untuk sebuah kode ICD,
sering diberikan V atau Z daftar, dan disertakan dalam sistem paksi tunggal. Akhirnya, kita
21

mencatat bahwa orang-orang yang mungkin ada gejala dalam berbagai cara sebagai fungsi
budaya mereka dan berbicara tentang pentingnya dengan mempertimbangkan satu latar belakang
budaya apabila membuat diagnosis. Kita menunjukkan bahwa DSM-5 menawarkan sebuah
Rumusan Budaya Wawancara (CFI) yang dapat membantu dalam proses klien yang beragam,
pemahaman menyediakan beberapa contoh-contoh gejala lintas budaya, dan mengenali
bagaimana dampak masalah lintas budaya beragam mendiagnosis berbagai. Kita berakhir bab
oleh dicatat bahwa DSM-5 adalah seiras dalam total proses penilaian dan menawarkan sebuah
latihan di mana para peserta dapat mencoba untuk mendiagnosis berbagai tiga klien hipotetis.
BabMeninjau
1. Memikirkanbagaimanakesehatanmentaldiagnosisdapatbermanfaatbagiklien.Apayang
mungkinakanbahayadaridiagnosis?
2. Kenapapentinguntukklinisi,dokter,paraprofesionalhukum,danseterusnyauntuk
menggunakanbahasadiagnostikyangsama?
3. JelaskanmengapaiaadalahtanggungjawabetisuntukKlinisiharusberpengetahuantentang
diagnosis.
4. Memberikancontohcontohbagaimanaandadapatmenggunakandiagnosisketika
merumuskanrencanaperawatan.
5. Menerangkanbagaimanakondisimedisdapatrelevanuntukkesehatanmentaldiagnosis.
6. Menerangkanbagaimanadanpertimbanganlingkunganpsikososialsekarangdisertakan
dalamDSM5.
7. Mendalamibagaimanaandadapatmenyertakanpertimbanganmultibudayakediagnosis.
8. Mendiskusikanperbedaanantarapenggunaansubtypes,specifiers,danberatnya.
9. Menjelaskanbagaimanadiagnosisprovisidapatdibuat.
10. Mendiskusikanpenggunaanyangditetapkanataugangguanreproduksiyanglain.
22

11. Menerangkanbagaimanasatusistempaksiyangdapatdigunakanuntukmengenkapsulasi
semuadarilimakapakdariDSMIV.
12. Mengenalidiagnosisdarikategoriapapunyangmembuatandasecarapribadimerasatidak
nyaman.Mendalamidimanaperasaaninidatangdaridanbagaimanaandamungkinpergi
tentangbekerjadenganklienyangmemilikidiagnosisini.
Latihan jawaban
I. 314.01 (F90.2) Perhatian-aktifitas berlebihan kekacauan, digabungkan defisit presentasi;
Faktor-faktor lain: v62.3 (Z55.9) underachievement Akademik.
II. 307.51 (F50.8) "pesta makan, moderat;
Faktor-faktor lain: v63.561.03 (Z) Gangguan keluarga dengan perceraian (); v60.2 barubaru ini (Z59.7); v62.9 Berpenghasilan Rendah (Z60.9) yang berhubungan dengan
masalah reproduksi yang lingkungan sosial: isolasi Sosial.
III. 300.4 (F34.1) terus-menerus gangguan depresif berat (dysthymia);
10.20 303.90 (F) Alkohol menggunakan kekacauan, moderat;
12.20 304.30 (F) mirip cannabis menggunakan kekacauan, moderat;
Faktor-faktor lain: v63.561.03 (Z) Gangguan Keluarga dengan perceraian (dua tahun
yang lalu); v62.5 (Z65.0) keyakinan dalam atau proses pengadilan sipil tanpa penjara:
Probation.
REFERENSI
Asosiasi Kejiwaan Amerika. (1952). Manual statistik diagnostik, dan gangguan mental.
Washington, DC: Penulis.
Asosiasi Kejiwaan Amerika. (1968). Manual statistik diagnostik, dan gangguan mental (2nd
ed.). Washington, DC: Penulis.
23

Asosiasi Kejiwaan Amerika. (1980). Manual statistik diagnostik, dan gangguan mental (3rd ed.).
Washington, DC: Penulis.
Asosiasi Kejiwaan Amerika. (1994). Manual statistik diagnostik, dan gangguan mental (edisi 4).
Washington, DC: Penulis.
Asosiasi Kejiwaan Amerika. (2000). Manual statistik diagnostik, dan gangguan mental (edisi 4,
revisi teks). Washington, DC: Penulis.
Asosiasi Kejiwaan Amerika. (2013). Manual statistik diagnostik, dan gangguan mental (ed.) ke5. Washington, DC: Penulis.
Beutler, L. E., & Malik, M. L. (Hasta.). (2002). Memikirkan kembali DSM: sebuah perspektif
psikologis . Washington, DC: Asosiasi Psikologi Amerika.
Centers for Disease Control dan Pencegahan. (2011). Penyakit mental dewasa AS laporan
pengawasan. Diambil dari: http://www.cdc.gov/Features/MentalHealthSurveillance/
Centers for Disease Control dan Pencegahan. (2013). Pengawasan kesehatan mental di antara
anak-anak-Amerika Serikat, 2005-2011 . diambil dari
http://www.cdc.gov/mmwr/preview/mmwrhtml/su6202a1.htm?s_cid=su6202a1_w
Eriksen, K, & Kress, V. (2005). Di luar cerita DSM: kebuntuan, tantangan Etika, dan praktik
terbaik . Ribu Pohon Tarbantin, CA: Sage.
Eriksen, K, & Kress, V. (2006). Dalam DSM dan identitas konseling profesional: Menjembatani
Kesenjangan. Jurnal Kesehatan Mental Konseling, 28 , 202-217.
Eriksen, K, & Kress, V. (2008). Gender dan diagnosis: Perjuangan, dan saran-saran untuk para
penasihat. Journal of konseling dan Pembangunan, 86 , 152-162.
Baik, E. M. (2012). Gangguan kepribadian dalam DSM-5: mengusulkan revisi dan kritik . Jurnal
Kesehatan Mental Konseling, 34 , 1-13.

24

Houts, A. C. (2000). Lima puluh tahun dari nomenklatur kejiwaan: Refleksi pada 1943
Departemen Perang Buletin Teknis, 203 Medis. Journal of Clinical Psikologi, 56 , 935967. doi.org/10.1002/1097-4679(200007)56:7<935::AID-JCLP11>3.0.CO;2-8
Kress, V., Eriksen, K, Rayle, A., & Ford, S. (2005). Dalam DSM-IV-TR dan: pertimbangan
dalam para penasihat budaya. Journal of konseling dan Pembangunan, 83 , 97-104.
Krueger, R. F., & Eaton, N. R. (2010). Sifat-sifat kepribadian dan klasifikasi gangguan mental:
terhadap integrasi yang lebih lengkap dalam DSM-5 dan sebuah model psychopathology
empiris. Gangguan kepribadian: Teori, penelitian, dan Pengobatan, 1 (2), 97-118.
doi:10.1037/sebuah0018990
Madesen, K, & Si lintah, mukasurat (2007). Etika labeling dalam kesehatan mental . Jefferson,
NC: MacFarland & Company.
Mezzich, J. E., & Caracci, G. (Hasta.) (2008). Pembentukan budaya: sebuah reader untuk
diagnosis kejiwaan . Lanham, MD: Jason Aronson.
Neukrug, E., & Schwitzer, A. (2006). Keahlian dan peralatan untuk para penasihat saat ini dan
psychotherapists: Dari membantu untuk konseling profesional alam . Pacific Grove, CA:
Brooks/Cole.
Naik, A. L., & Cheung, M. (2012). DSM-5 research: menilai kebutuhan kesehatan mental orangorang dewasa yang lebih tua dari beragam latar belakang etnis. Journal of Keragaman
Budaya & Etnis Bekerja di Bidang Sosial: Inovasi dalam Teori, Research & Praktik, 21 ,
144-167. doi:10.1080/15313204.2012.673437
Segal, D. L., & Coolidge, F. L. (2001). Diagnosis klasifikasi dan. Dalam M. Hersen & V. B. Van
Hasselt, (Hasta.), psikologi abnormal Lanjutan (2nd ed., mukasurat 5-22). New York:
dipublikasikan oleh Kluwer Law Penerbit Plenum/akademis.

25

Seligman, L. (1999). Dua puluh tahun diagnosis dan DSM. Jurnal Kesehatan Mental Konseling,
21 , 229-239.
Seligman, L. (2004). Diagnosis dan perencanaan perawatan di konseling (3rd ed.). New York:
Plenum.
Smith, T. A. (2012, 15 Oktober). Modernisasi diagnosis & pengobatan menggunakan DSM-5 .
Lokakarya menampilkan di Lembaga Pendidikan CMI, Berita grafis Newport Marriott,
grafis Newport Berita, VA.
Penyalahgunaan Napza dan Layanan Kesehatan Mental Administration. (2012). Hasil dari 2011
Survei nasional pada penggunaan narkoba dan Penemuan Kesehatan Mental: Kesehatan
. Diambil dari
http://www.samhsa.gov/data/NSDUH/2k11MH_FindingsandDetTables/2K11MHFR/NS
DUHmhfr2011.htm#2.1
Thyer, B. A. (2006). Sudah saatnya untuk mengganti nama DSM. Psikologi Manusia etis dan
psikiatri, 8 , 61-67. doi:10.1891/ehpp.8.1.61
Amerika Serikat Departemen Kehakiman. (n.d.). Informasi dan bantuan teknis pada Amerika
dengan kekurangan fisik bertindak. Diambil dari http://www.ada.gov/
Wakefield, J. C. (2013). DSM-5: Ringkasan perubahan dan kontroversi. Jurnal Kerja Sosial
klinis, 41 , 139-154. doi:10.1007/s10615-014-0445-2
Zalaquett, C. MUKASURAT, Fuerth, K. M., Stein, C., Ivey, A. E., & Ivey, M. B. (2008). Tetapi
meluas hingga pembahasan kerangka- DSM-IV-TR dari sebuah perspektif keadilan
sosial/multibudaya. Journal of Konseling & Development, 86 , 364-371.
doi:10.1002/j.1556-6678.2008.tb00521.x
<Teks Marjinal>
Adabanyakalasanuntukmendiagnosis
26

DSMI
Edisipertamaditerbitkanpadatahun1952dengantigakategoriluas
DSMIII
Memperkenalkanmultiaxialdiagnosisditahun1980
DSMIV(TR)
Menggunakanlimadiagnosisaksial
DSM5
Menerimasistemklasifikasidiagnostikuntukgangguanmental
Porostunggal
Berusahamembuatdiagnosisklinisdangangguankepribadianyangsejajardengankodemedis
V&Zkodepemesanan
Memungkinkanmengalamistrespsikososialakandisenaraikandalamdiagnosis
Diagnosisutama
Alasanorangdatanguntukperawatanyangpertamayangterdaftar
Subtipe
"menetapkanapakah"hanyamemilihsalahsatu
Specifier
"Menetapkanjika"pilihsebagaiberlaku
Dimensidiagnosis
Menawarkankemampuanuntukcatatankeseriusangejala
Severity
"Menetapkankeseriusansaatini"pilihtingkatyangpalingakuratsymptomology
27

Diagnosisprovisi
Digunakanbilakecenderungankuattetapitidakdapatlagikonfirmasi
Gangguanditetapkanlain
Tidakpasuntukdiagnosisstandardenganpenjelasanmengapatidak
Gangguanreproduksiyangtidakterdeteksi.
Tidakpasuntukdiagnosisstandartanpapenjelasan
Akanmendapatiradahmengenalfaktorfaktoryangdapatmempengaruhikesehatankesehatan
mental
Kategoridiagnostik
Duapuluhduakategoridisertakandalamsatusumbu
Cogangguanterjadi
Mungkinhidupberdampingandangangguankadangkadangdapatmemperburuksatusamalain
Kondisimedis
Daftardapat,denganmenggunakankodeICD,bersamadenganDSMdiagnosis
Faktorfaktorlingkungan/psikososial
Mengalamistresyangsangatpentinguntukmemahamiseluruhorang
Pertimbanganbudaya
GunakanCFIdandariDSMinfountukmemahamiperbedaandalamsymptomatology
Beberapa"perilaku"mungkinabnormaldianggap"normal"dalambudayabudayalain
Diagnosismenambahkankejelasankeprosesassessment

28