Anda di halaman 1dari 3

MOUTHWASH

a. Definisi
Obatkumurmerupakansuatularutan air yang
digunakansebagaipembersihuntukmeningkatkankesehatanronggamulut,
estetikadankesegarannafas (Power dansakaguchi, 2006). Mouthwash
dapatjugadigunakansebagaiagenantiinlamasidan analgesic topical (Farah et al., 2009)

b. Fungsi
Obatkumursamahalnyaseperti pasta gigimempunyaifungsi yang
dapatdikategorikansebagaikosmetik, terapeutik, ataukeduanya.
Obatkumurdapatdigunakanuntukmembunuhbakteri, sebagaipenyegar,
menghilangkanbautaksedap,
danmemberikanefekterapeutikdenganmeringankaninfeksiataumencegahkaries (Combe,
1992).Keefektifanobatkumur yang lain adalahkemampuannyamenjangkautempat yang
paling sulitdibersihkandengansikatgigidandapatmerusakpembentukanplak,
tetapipenggunaannyatidak bias sebagaisubtitusisikatgigi (Claffey, 2003)

c. Komposisi
KomposisiobatkumurmenurutCombe (1992)terdiridari :
1. Agenantibakteri, sepertisenyawafenolat, senyawa ammonium
kuarternerdanmintakesensial
2. Astringent, sepertisengklorida, sengasetatdanalumunium potassium sulfat
3. Air sebagaikomponenpokokobatkumur
4. Komposisilain, seperti alcohol, pewarna, agenpemanis, dan surface active agents.

Menurut Powers danSakaguchi (2006),


komposisiobatkumurterdiriatastigakomponenutamayaitu :

1. Bahanaktif, yang secaraspesifikdipilihuntukkesehatanronggamulutseperti anti karies,


antimikroba, pemberian fluoride, ataupenguranganadhesiplak
2. Pelarut, biasanya yang digunakanadalah air atau alcohol.
Alkoholbiasanyadigunakanuntukmelarutkanbahanaktif, menambah rasa,
danbahantambahanuntukmemperlamamasapenyimpanan.
3. Surfaktan, untukmenghilangkan debris padagigidanmelarutkanbahan lain.
Sebagaibahantambahannyadigunakanflavouring agent seperti eucalyptol, mentol,
timol, danmetilsalisilat yang digunakanuntukmenyegarkannafas.

d. Cara pemakaian

Efek
Selainmempunyaibanyakkegunaansepertitelahdisebutkan, ternyata mouthwash bisaberakibat
yang kurangbaikbagikesehatanmulut, terutamajikadipakaiberlebihan.
Umumnya, mouthwash mengandunngantiseptik, yang
digunakanuntukmembunuhmikroorganisme-mikroorganismepenyebabbaumulut.Penggunaan
mouthwash secaraterusmenerusdapatmenyebabkanterganggunya flora normal di
dalammulut.Terganggunya flora normal mulutinidapatmenimbulkanmasalahbaumulut yang lain.

Mouthwash memangbanyakmanfaatnya,
tapimelihatdampaknegatifnyamakapemakaiansecaraterusmenerustidakdianjurkan.Banyakdokterg
igijugamenyarankan agar tidakterlaluseringmenggunakan mouthwash,
untukmenjagakebersihandankesehatanmulut, nomorsatutetapmenggosokgigi,
jikainginmenyegarkanatauadamasalah di mulut, barugunakan mouthwash

a. Kandunganalkohol
Menurut Witt dkk, denganadanya alcohol sebagaikandungandariobatkumur,
akanmembatasipenggunaanobatkumurtersebutuntukgolongan-golongantertentu, antara lain
anak-anak, ibuhamil/menyusuidanpasiendenganxerostomia. Para
ahlitelahmelaporkandankemudiandipublikasikandalam Dental Journal of Australia
bahwaobatkumur yang mengandung alcohol
memberikontribusidalampeningkatanrisikoperkembangankankerronggamulut.Mekanisme
alcohol dalammeningkatkanrisikokankerronggamulutadalahmelaluietanoldalmaobatkumur
yang
berperansebagaizatkarsinogen.Zatkarsinogenberpenetrasidalamlapisanronggamulutdengande
mikiankerusakanterjadi.Di sampingituasetildehid yang merupakanracundari alcohol,
dapatberakumulasidalamronggamulutketikaseseorangberkumur-
kumur.Karenahaltersebutdiataskankermeningkatkarenasenyawainimerupakanpenyebabkank
er.

b. Kandunganklorhexidin
Khlorheksidinmemilikibanyakkeuntungan,
diantaranyamemilikikemampuanbakterisiddanbakteriostatikterhadapbakterironggamulut.
Namunkhlorheksidinjugamemilikikekurangan, yaituefeksampingberupanodadan rasa.Noda
iniberupawarnakuningataucoklatpadagigi, tepitumpatan, danlidah. Hal
inidisebabkaninteraksiantarabahankhlorheksidindenganbahan-bahantertentudalam diet
(Mangundjaja, 2000). Terjadinya staining didugakarenapengendapan sulfide
besidandipengaruhioleh diet.Sulfidabesidibentukakibatreaksi sulfur yang
berasaldarikelompoktioldari protein yang mengalamidenaturasidengan ion besi yang
berasaldarimakanandanminuman (Dalimunthe, 1998). Rasa yang timbuladalah rasa
pahitdanseakantumpul (tidak sensitive membedakan rasa)
selamabeberapamenitsampaibeberapa jam
setelahberkumursesuaidengantingkatsensitifitasmukosamulutamsing-masingindividu. Akan
tetapiefeksampinginihanyabersifattemporer,
dantidakmembahayakan.Jikapemakaiandihentikanefeknyaakanberangsur-angsurmenghilang.
Efekinibaruakantimbulapabiladilakukanpemakaianrutindandalamjangkapanjanglebihdaridua
tahunatauapabilapemakaiantidakmengikutiaturan yang benar(Mangundjaja, 2000).

c. Kandunganastringen
Hipersensitivitasmukosamulutseringdisebabkanolehminyakesensial,
astringenataubahanterapi yang terkandung di dalamobatkumur.Miller
mengemukakanbahwaminyak cinnamon dapatmenyebabkanhipersensitivbitaskontakpada
membrane mukosamulut.