Anda di halaman 1dari 24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

PENDIDIKAN
KEWARGANEGARAAN

Biologi

Iklanoleh Google

WahanaInfoAktual,Inspiratif,NormatifdanAspiratif

HOME

PENELITIANPTKPTS

LINKWEBBLOGFAVORIT

INFOSERTIFIKASI

INFOLOMBA

DOWNLOAD

BAHANAJARPKN

HomeBeritaInfoLombaLombaSiswaCONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)
BIOLOGISMP
PostedbyPENDIDIKANKEWARGANEGARAANonThursday,February5,2015

Buat Situs Web Bisnis


Buat & Gunakan Domain Bisnis
Dengan Google Sites. Gratis 30
Hari!

InilahcontohSoalOlimpiadeSainsNasionalatauOSNIPABiologiSMP
A.SOALPILIHANGANDA
1.TeoriHoraldUreymenyatakanbahwa,jikaterjadiloncatanlistrikdanradiasisinarkosmisdenganzatzat
kimiadiatmosferakanterbentuk...
A.glukosa
B.karbohidrat
C.lemak
D.asamamino

CB

2.PerbedaanyangsangatmendasarpadapercobaanyangdilakukanolehF.RedidanL.Spallanzaniterletak
pada...
A.bahanyangdigunakan
B.alatyangdigunakan
C.prosedurkerja
D.kesimpulanyangdihasilkan

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

1/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

3.Prosesperubahanbentukenergikimiauntukberbagaiaktivitassebagaicirimahiukhidupdisebut...
A.nutrisi
B.respirasi
C.asimilasi
D.transportasi
4.Salahsatucirikhasmakhlukhidupadalahmelakukanekskresiyangberarti...
A.pengaturanprosesdalamtubuh
B.pembentukanenergymelaluioksidasizat
C.penyusunanzatpembentuprotoplasmasel
D.mengeluarkansisametabolismdandalamtubuh
5. Sifat yang dapat membedakan tumbuhan mangga sebagai rnakhluk hidup dengan batu sebagai benda
matiadalah
A.bereproduksi
B.bergerak
C.memilikistrukturyangrumit
D.butuhenergi
6.LimacontohtumbuhanyangtermasukkelompokKormofitaadalah:
Kelapa(Cococnucfera)
Nanas(Ananassativus)
Pisang(Musaparadisiaca)
Jahe(Zingiberoffcinale)
Rumputteki(Cyperusrotundus)
Persamaantandatandaatauciriciriyangdimilikiolehke5tumbuhandiatasadalah...
A.akardanbatangberkambiurn
B.berkaspembuluhpadabatangtersebar
C.daundaunnyakaku
D.tidakmempunyaibunga
7.Diantaraurutanberikutyangmerupakandaurhiduplumutadalah
A.tumbuhanlurnutgarnetzigottalus
B.tumbuhanlumutzigottalusgarnet
C.talusselgarnetzigottumbuhanlumut
D.taluszigotselgarnettumbuhanlumut
8. Tumbuhan tebu diberi nama ilmiah Saccharum officinarum, sedangkan tumbuhan gelagah diberi nama
ilmiahSaccharumspontaneum.iniberartibahwatumbuhantebudangelagahmerniliki
A.margaberbeda,spesiesberbeda
B.marga,spesiessama
C.margabeda,spesiessama
D.margasarna,spesiesherbeda
9.Hirarkikategoritaksonomikmakhlukhidupdantingkatyangtinggisampaitingkatrendahadalah
A.jenis,marga,bangsa,kelas,suku,divisi
B.jenis,marga,suku,bangsa,kelas,divisi
C.jenis,marga,bangsa,suku,kelas,divisi
D.jenis,marga,bangsa,kelas,suku,divisi
10.Kegiatanyangmenyebabkanhilangnyahabitatantaralain
A.programpemuliaantanaman
B.pembuatancagaralam
C.ekstensifikasipertanian
D.perlindungansatwa
11. Sel fagosit berperan penting dalam memangsa benda asing yang masuk ke dalam tubuh, sehingga
organelabanyakterdapatdalamselyangbersifatgafositadalah
http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

2/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

organelabanyakterdapatdalamselyangbersifatgafositadalah
A.reticulumendoplasma
B.mitokondria
C.ribosom
D.lisosom
12.Fasemetaphasepembelahanmitosismempunyaiciricirikhasyaitu...
A.kromatidlenyapdanterbentukintibaru
B.kromosomtersebardibidangequator
C.kromosommenjadilebihtebal
D.kromatidbergerakmenjauhibidangequator
13.Berikutiniadalahcirriciriberbagaimacamjaringanhewan:
1.Satulapisselberbentukpipih
2.Satulapisselberbentukgelembung
3.Terdapatdiseluruhtubuh
4.Mengandunggarammineral
5.Memilikimatriks
6.Membentukligament
Cirijaringanikatadalahyangbernomor
A.3,5dan6
B.1,3dan4
C.2,3dan4
D.3,4dan5
14.Jaringanepitelselapisterdapatpada
A.pembulubdarabtubulusginjalsaluranpernafasan
B.uterussalurancernalapisankulit
C.kukutubulusginjalalveoliparuparu
D.rambutsalurancernasaluranpernafasan
15.Organyangmembangunsistemekskresiadalah
A.pancreas,paruparu,dankulit
B.kulit,paruparu,danginjal
C.ginjal,kulit,danususbesar
D.hati,usushalus,danparuparu
16.Perhatikangambarberikut!

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

3/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

Bagiantengkorakyangmempunyaitipesendidiartrosisditunjukkanolehhuruf
A.A
B.B
C.C
D.D
17.Perhatikangambar.

Saatotottrisepberkontraksi,yangterjadidenganbendayangdipegangadalah.
A.bendaakanturun
B.bendaakannaik
C.bendatetappadaposisinya
D.bendaakanterlepasdanpegangan
18. Gerakan migrasi vertikal fitoplankton menuju permukaan air yang dipicu oleh adanya sinar matahari
disebutgerak
A.tropisme
B.nasti
C.taksis
D.endonom
19.Contohgeraknastipadatumbuhanadalah...
A.batangtumbuhanyangbergerakmenujuarahdatangnyacahaya
B.geraktumbuhakartumbuhanmenujupusatbumi
C.menutupnyadaunputrimaluketikadisentuh
D.geraktumbuhbatangtumbuhanmelawangravitasi
20. Kelainan tulang lordosis yang disebabkan karena kebiasaan sikap tubuh yang salah ditunjukkan oleh
gambar

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

4/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

A.A
B.B
C.C
D.BdanC
21.Rangkamanusiamempunyaifungsisebagaiberikut,kecuali
A.alatgerakaktif
B.melindungibagiantubuhvital
C.memberibentuktubuh
D.menegakkantubuh
22.Hewanberikutdapatbergerakdenganmenggunakandoronganaliranair,kecuali
A.bintanglaut
B.cumicumi
C.spons
D.teripang
23.Padasistempencernaanmanusia,sekresikanbahankimiayangmembantumencernalemakdilkukan
oleh
A.empedu
B.hati
C.lambung
D.usushalus
24.Dalamsistempencemaanmanusiamulutmempunyaifungsisepertidibawahini,kecuali
A.mencernakarbohidratyangterkandungdalammakanan
B.mencernalemakyangterkandungdalammakanan
C.membuatmakananmenjadilembutdanmudahditelan
D.memotongmotongmakanan
25.Perhatikangambarberikut:

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

5/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

Cairandalamkantungempedudihasilkanolehorganyangditunjukkanolehhuruf
A.A
B.B
C.C
D.D
26.Zatmakananyangsarinyadiserapmasukkedalamsistemperedarandarahadalah
A.lemakdankarbohidrat
B.karbohidratdanprotein
C.proteindanlemak
D.lemak,karbohidrat,danprotein
27.Sarimakananpenghasilenergiutamadaninstanbagitubuhadalah
A.asamlemak
B.asamamino
C.gula
D.vitamin
28.Salahsatucontohkelainansistempencernaanyangdisebabkankurangmengkonsumsimakananyang
berseratadalah
A.diare
B.konstipasi
C.rnaag
D.sariawan
29.Kerusakanorganpencernaandapatpulamenimbulkanmasalahpadasisternsekskresi,yaitupada
A.lambung
B.pankreas
C.eosophagus
D.usus
30.Sapimemilikisaluranpencernaanyangmemungkinkannyamenjadihewanpemamahbiak.Saluran
pencernaanyangdimaksudadalah
A.perutbesar(rumen)
B.perutjala(reticulum)
C.perutkitab(omasum)
D.perutmasam(abomasum)
31.Pemyataanberikutyangbenardalammenjelaskanmekanismepemapasanpadamanusiaadalah
A.ototdiafragmarelaksasi,volumeronggadadamembesar,tekananudaradalamronggadadameningkat,
udarakeluar
http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

6/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

udarakeluar
B.ototdiafragmaberkontraksi,volumeronggadadamengecil,tekananudaradalamronggadadamenurun,
udaramasuk
C.ototantartulangrusukberkontraksi,tulangrusuknaik,volumeronggadadamembesar,tekananudara
dalamroggadadameningkat,udaramasuk
D.ototantartulangrusukrelaksasi,tulangrusukturun,volumeronggadadamengecil,tekananudara
dalamronggadadameningkat,udarakeluar
32. Paruparu manusia memiliki bagian untuk memperluas permukaan tempat difusi gas. Bagian tersebut
adalah
A.alveolus
B.bronkus
C.bronkiolus
D.trakea
33.Penyakitpadasistempernapasanyangbukandisebabkanseranganvirusadalah
A.influenza
B.TBC
C.fluburung
D.SARS
34. Salah satu organ pada sistem pernapasan juga berperan pada sistem fungsi yang lain. Sistem fungsi
yangdimaksudadalah
A.ekskresi
B.koordinasi
C.pencernaan
D.transportasi
35.Hewanberikutmemilikialatbantupernapasanselainalatpernapasanutama,kecuali
A.ikanlele
B.cacingtanah
C.penyu
D.katak
36.Istilahtrakeolusdapatkitatemukanpadasistempernapasanhewan
A.lintah
B.uburubur
C.capung
D.burung
37.Organismeyangterseleksiolehalamsehinggatidakmampumelanjutkanketurunannyaadalah...
A.katakyangtinggaldihangtanahyanglembab
B.landakyangtubuhnyaberduri
C.pohonjatiyangmenggugurkandaundimusimkemarau
D.kupukupuberagamwarnapadadaerahindustri
38.Bentukadaptasiberuangkutubpadamusimdinginyangpanjangadalah...
A.melakukantidurpanjanguntukmenghematenergi
B.mengubahwarnatubuhnyauntukmengelabuimusuh
C.merontokkanrambutditubuhnyauntukmenahanpanas
D.berburumakanansebanyakmungkinuntukpersediaanmakanan
39. Kondisi demografi kotakota besar di Indonesia menunjukkan laju pertambahan penduduk yang terus
meningkatdantahunketahun,namunluaswilayahtetap.Dampakdankondisitersebutadalah...
A.meningkatnyakadaruapairdiudara
B.meningkatnyakadaroksigendiudara
C.menurunnyakadarkarbondioksidadiudara
D.lahanpertaniansemakinberkurang

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

7/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

40.TabeldibawahinimenunjukanhasilpengamatansiswaterhadappenyebaranMimosapudicadikebun
sekolah.

PersentasikeberadaandanMimosapudicaadalah...
A.25%
B.36%
C.66%
D.70%
41.Likenadalahorganismayangsensitifterhadappolusiudara.Grafikberikutinimenunjukanbagaimana
pengaruhjarakdanpertambanganbatubaraberdampakterhadappertumbuhanjumlahdanjenisliken.
Kesimpulanapayangdapatdibuatberdasarkaninformasidangrafiktersebut?
A.Likentumbuhdengancepatdidekatpertambangan
B.Likentumbuhlebihlambatdekatdenganpertambangan
C.TerdapatsedikitjenisLikenyangtumbuhdekatpertambangan
D.TerdapatbanyakjenisLikenyangtumbuhdekatpertambangan
42.Gambardisampingmerupakanjaringanyangditemukanpada...

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

8/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

A.dauntumbuhanpaku
B.daunturnbuhanlumut
C.dauntumbuhandikotil
D.dauntumbuhanmonokotil
43.Perhatikangambarstrukturtumbuhandibawahini.Strukturgambartersebutdapatdijurnpaipada
tumbuhan...

A.Jagung
BMangga
CPepaya
DCoklat
44.Bagiandanjaringanseltumbuhanyangberperandalampengangkutanairdilakukanoleh.
A.Xylem
B.Phloem
C.Parenkim
D.Epidermis
45.Perangkatpercobaanfotosintesisdibawahinidigunakanuntukmenunjukanbahwa

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

9/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

A.dalamfotosintesiskarbondioksidadiserap
B.dalamfotosintesisdihasilkanoksigen
C.fotosintesismengeluarkankarbondioksida
D.fotosintesismenyerapoksigen
46.Bagiandauntumbuhanhijauyangtidakdapatmelakukanfotosintesisadalah...
A.kutikula
B.selpenjaga
C.parenkimpagar
D.Parenkimbungakarang
47.GrafikdibawahinimenunjukanpengaruhfaktorXpadalajufotosintesis.

FaktorXtersebutadalah...
A.temperatureLaju
B.intensitascahayafotosintesis
C.kecepatanangin
D.kadarkarbondioksida
48.Lajufotosintesisdipengaruhiolehbeberapafaktorberikut,kecuali
A.temperature
B.intensitascahaya
C.kadarkarbondioksida
D.kadaroksigen
49. Tommy baru saja mengalami kecelakaan sehingga kehilangan banyak darah, ia memerlukan donor
untukmenggantidarahnya.Sebelumdilakukantransfusi,terlebihdahuludimasukkanteslaboratorium
untukmenentukangolongandarahnya.DarahTommymenggumpalketikaditetesiaglutininlzatantia.
dantidakmenggumpalketikaditetesizatanti13.Berdasarkankasustersebut,makagolongandarah
dimilikiTommyadalah...
A.AB
B.A
http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

10/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

B.A
C.B
D.O
50. Sel darah putih yang dihasilkan oleh limfa dan sumsum tulang belakang bergerak cepat dan bersifat
fagositadalah
A.eosinofil
B.netrofil
C.basofil
D.limfosit
51.Pemyataanyangberhubungandengancirijantungpadahurtingdibawahinibenar,kecuali
A.jantungterdiriatasempatruang
B.memilikilengkungaortakin
C.jantungterbagiduaatriumdanduaventrikel
D.memilikilengkungaortakanan
52.Perhatikanarahalirandarahdibawahini:
Lengkungaorta)pembuluhventral)kapiler(seluruhjaringantubuh)pembuluhdorsal*lengkung
aorta(pembuluhjantung).Hewanyangmemilikisistemperedarantersebutadalah
A.Cacingusus
B.Cacingpita
C.Cacingtanah
D.Planaria
53.Pernyataanyangbenartentangstrukturpembuluhnadi(arteri)adalah
A.Dindingpembuluhnaditebaldanelastis
B.Dindingpembuluhnaditipisdantidakelastis
C.Dindingpembuluhnaditebaldantidakelastis
D.Dindingpembuluhnaditipisdanelastis
54. Gangguan peredaran darah yang berupa pengerasan pembuluh nadi yang disebabkan karena adanya
endapankapurdisebut
A.hemofili
B.miokarditis
C.artheroskierosis
D.embolus
55. Setelah proses perkecambahan maka terbentuk tanaman muda, pertumbuhan selanjutnya ditentukan
oleh jaringan primer pada akar dan batang. Bagian yang paling cepat tumbuh memanjang pada akar
terletakpada
A.daerahbagianbelakangujungakar
B.daerahbagiandepanujungakar
C.jaringanepidermis
D.jaringanendodermis
56.Salahsatufaktoryangmempengaruhipertumbuhandanperkembanganpadatumbuhanadalahnutrisi.
Apabilatumbuhanmengilamigejalakiorosis,makasebaiknyatanahtempattumbuhnyadiberikan.
A.Urea
B.N,P,K
C.FedanMg
D.Fosfat
57.Jaringanyangdapatmelindungikerusakanlpecahpecahbagiankulitpalingluarpadatumbuhandikotil,
akibatpercepatanaktivitaskambiummembentukxylemdanfloemadalah
A.vasis
B.gabus
C.felogen
D.lentisel
58.Setiapmakhlukhidupmengalamipertumbuhandanperkembanganyangterjadisecarabersamaan.
http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

11/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

58.Setiapmakhlukhidupmengalamipertumbuhandanperkembanganyangterjadisecarabersamaan.
Perbedaanpertumbuhandanperkembangandibawahinibenar,kecuali...
Pertumbuhan
Perkembangan
A
Dapatdiukur
Tidakdapatdiukur
B
Dialamidifasepertengahan
Dialamipadaseluruhfase
kehidupan
kehidupan
C
Bersifatkuantitatifdanirreversible
Bersifatkualitatifdanreversible
D
Memilikibatasanusia
Tidakdibatasiusia

59. Perkembangan pada wanita dewasa ditentukan oleh kesehatan dan keutuhan organ reproduksinya.
Bagianyangditunjukpadagambarorganreproduksiwanitadibawahiniadalah
A.Ovarium,fimbriae,oviduk,uterus
B.Ovarium,oviduk,fimbriae,uterus
C.Ovarium,fimbriae,oviduk,servik
D.Ovarium,oviduk,uterus,servik
60.Epididimismerupakanmerupakanbagiandanorganreproduksiyangberfungsisebagai...
A.tempatpembentukansperma
B.tempatmemproduksizatyangmengaktiflcansperma
C.tempatpengeluaransperma
D.tempatpenambahanjumlahsperma
B.SOALANALISIS
Berikantandasilang(X)hurufA/BIC[Dyangterdapatpadalembarjawaban.
Berilahtandasilang(X)huruf:
A.jikajawaban(1),(2),dan(3)benar
B.jikajawaban(1)dan(2)benar
C.jikajawaban(2)dan(3)benar
D.jikajawaban(3)benar
61.Apabiladarahdimasukkankedalamlarutanhipertonis,makayangterjadiadalah
1.Membraneakanmengembang
2.Seldarahmerahpecah
3.Membraneselmengkerut
62.Apabiladarahdimasukkankedalamlarutanyanghipotonismakayangterjadi.
1.membranditankkesegalaarah
2.seldarahmerahmengkerut
3.hemoglobinkeluar
63.Pernyataanyangbenartentangsicklecelladalah
1.seldarahmerahberbentukbulansabit
2.eritrosittidakdapatmengikatoksigen
3.salahsatuasamaminonyabermutasi
64.Seldarahputihyangbersifatagranulerdanfagositosisdenganjumlah28%,berbentukbulatdengan
intibesardanjumlahsitoplasmacukupbanyakadalah
1.eosinofil
2.limfosit
3.monosit
65.Pernyataanyangbenarberkaitandenganfungsibagianjantungdibawahiniadalah
1.venacoronariamempunyaifungsimengalirkandarahdanbilikkinjantungkeseluruhtubub
2.arteripulmonalismempunyaifungsimengalirkandarahyangkayakarbondioksidadanventrikelkananke
paruparu
3.venapulmonalisberfungsimengalirkandarahyangkayaoksigendanparuparumenujukeatriumkin
66. Pada masa perkecambahan, pernyataan yang benar tentang pengaruh cahaya terhadap pertumbuhan

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

12/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

66. Pada masa perkecambahan, pernyataan yang benar tentang pengaruh cahaya terhadap pertumbuhan
tanamanadalah...
1.tanamanlebihlambattumbuhditempatgelap
2.tanamantumbuhlebihsuburdansehatditempatgelap
3.tanamanditempatgelaptumbuhlebihcepatnamunkekuranganklorofil
67.Pertumbuhandanperkembanganpadamanusiaditandaidenganterjadinyaprosespembentukanselsel
reproduksi.ProsesOogenesisberbedadenganspermatogenesisdalarnhal
1.adanyabentuksampinganbadankutub
2.jurnlahgarnetyangdihasilkan
3.tidakadanyarneiosisdanmitosis
68.Ekdisonpadaseranggaberperanuntuk
1.mempercepatpernatanganselgonadpadaserangga
2.rnendorongperkembangankarakteristikdewasasepertiperubahandanulatmenjadikupukupu
3.mempercepatperubahaneksoskeleton
69.Tipepersendianengseldapatditernukanpadapersendianantara
1.tulangbahu(humerus)danpergelangan(ulna)
2.tulangpaha(femur)danbetis
3.ruasruasjantangan
70.Contohbentuktipetulangpipihadalah
1.tulangekor
2.tulangrusuk
3.tulangbelikat
71.Pencernaanbahanmakananyangmengandungkarbohidratterjadipadaorgan
1.lambung
2.mulut
3.usus
72.Organsekresiyangberperanuntukmencemabahanmakananyangmengandunglemakadalah
1.usus
2.pankreas
3.empedu
73.Hewanberikutyangbernapasdenganparuparuadalah
1.kudalaut
2.kudanil
3.lumbalumba
74. Teori asal usul kehidupan dibagi menjadi teori kiasik dan teori modem. Tokoh teori kiasik penentang
abiogenesisyangmenggunakanbahanpercobaanberupaairkalduadalah
1.F.Redi
2.L.Pasteur
3.L.Spallanzani
75. Konsep hidup mempunyai ciriciri tertentu. Dalam menjaga kelangsungan hidup generasi berikutnya
makamakhlukhidupmemilikiciriciri...
1.bereaksiterhadapstimulus
2.melakukanprosesmetabolisme
3.berkembangbiak
76.Diantarapasanganhewandibawahini,pasanganyanghubungankekerabatannyajauhadalah...
1.Katakdengansalamander
2.Gorilladengansimpanse
3.Biawakdengansalamander
http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

13/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

77.KelashewandibawahinitermasukfilumArthropodaadalah
1.crustaceae
2.myriapoda
3.hexapoda
78. Tiaptiap tingkatan takson disebut kategori takson, dimana semakin tinggi tingkat kategori taksonomi,
maka
1.Jumlahfkisaranvariasisemakinbanyak
2.Jumlahanggotasemakinbanyak
3.Jumlahkarakteryangsama,semakinbanyak
79.Berikutiniadalahkegiatanyangdapatmerusaksumberdayahayati...
1.erosigen
2.bencanaalam
3.ladangberpindah
80.Contohtempatpelestariansecarainsituadalah...
1.HarimaudihutanSumatera
2.KomododipulauKomodo
3.PenangkaranhewanliardiTamanSafari
81.Fungsidanjaringandarahadalah
1.Mengangkutnutrisi
2.Mencegahinfeksiolehparasitlmikroorganisme
3.Mengangkuthormone
82.Tembolokpadaburungdaraberfungsisebagaitempatpenyimpanansementara.Padaburungpemakan
biji,tembolokmerupakanbagiandan
1.Lambung
2.Usustebal
3.kerongkongan
83.Komponenbiotikmemilikiciriyangberbedadengankomponenabiotik.Berikutiniadalahcirikomponen
biotik...
1.bernapas
2.iritabilitas
3.mengalamisikius
84. Dampak dan meningkatnya jumlah penduduk di perkotaan mempengaruhikebutuhan akan pangan,
sehingga pola pertanian pun berubah dan pola pertanian konvensional ke sistem pertanian modem.
Sistempertanianmoderndapatmengakibatkanpermasalahanterhadaplingkunganberupa..
1.resistensihamatanaman
2.pencemaranairtanahdanairpermukaan
3.terrjaminnyakeseimbanganrantaimakanan
85.Berdasarkanjaringjaringmakananberikutini.

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

14/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

Tingkattropikkeduaditempatioleh.
1.burungpipit
2.ulat
3.tikus
86.Fungsijaringanparenkimpadatumbuhanadalah.
1.sebagaipengangkutzat
2.sebagaipenutupluka
3.sebagaipenyimpancadanganmakanan
87.Stomatayangterdapatpadaepidermismemilikifungsi.
1.respirasi
2.transportasi
3.transpirasi
88.Jaringanyangdapatditemukanpadadaunadalah.
1.jaringanpalisade
2.berkaspengangkut
3.silinderpusat
89.Adanyalingkarantahundapatdiketahui...
1.tinggipohon
2.besarpohon
3.usiapohon
90.Prosesyangterjadipadareaksigelapketikaberlangsungnyafotosintesis
1.terjadidistroma
2.terbentuknyaglukosa
3.terjadiprosesfotolisis
91.Padapercobaanfotosintesisdenganmenutupsebagiandaundengankertaskarbonkemudiantumbuhan
diletakkandibawahmatahari,setelahperlakuandidapatkesimpulanberupa...
1.bagiandaunyangditutupkertaskarbonmenjadikuning/pucat
2.karbondioksidadiperlukandalamprosesfotosintesis
3.bagiandaunyangterbukamenjadibirutuasetelahditetesiiodine
92. Berikut ini yang merupakan simbiosis komensalisma yang terjadi di antara sesama makhluk hidup
adalah
1.bakteriyanghidupdidalamususherbivore
2.bakteriRhizobiumpadatumbuhankacangkacangan
3.tanamanbenaluyangmenempeldipohonjambu
93.CFC(kiorofluorokarbon)merupakangasyangtidakberwarna,tidakberbau,dantidakberacun.Akibat
penggunaanCFCyaitu
1.lapisanozondiatmosfirberkurang
2.sinarultravioletyangsampaikepermukaanbumimeningkat
3.mutasigeneticmeningkat
http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

15/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

94.Terjadinyakebakaranhutanpadasaatmusimkemaraumenyebabkan.
1.meningkatnyagasC02
2.pemanasanglobal
3.efekrumahkaca
95.Penggunaanbahanpengawetkedalammakananmembahayakankesehatanmanusia.Bahantambahan
makananyangbolehdigunakandalamjumlahtertentuadalah
1.asamsitrat
2.sodiumglutamate
3.asamboraks
96.Nasijikadikunyahlamakelamaanterasamanis.Haltersebutdisebabkankemampuankerjaenzim...
1.lipaseuntukmengubahkarbohidratmenjadimaltosa
2.ptialinmengubahamilummenjadimaltosa
3.ptialinuntukmengubahamilummenjadiglukosa
97.Apabilajumlahmakanantidaksesuaidengankebutuhantubuhdapatmengakibatkangangguangiziatau
giziburuk.Penyakityangdisebabkankekuranganenergidanproteinyaitu
1.marasmus
2.kwashiorkor
3.xeroftalmia(rabunsenja)
98. Jamur adalah salah satu organisme penyebab penyakit tumbuhan. Upaya pengendaliannya adalah
menggunakan
1.pestisida
2.herbisida
3.fungsida
99.Keuntunganpenanggulanganhamasecarabiologiadalah
1.keseimbanganlingkunganterjaga
2.tidakmencemariiingkungan
3.menimbulkankeanekaragamanyangbaru
100.Gangguanpernapasandapatdisebabkanolehpenyempitanbronkusdandisebabkanbakteriatauvirus.
Namapenyakityangdimaksudadalah
1.asma
2.pneumonia
3.bronchitis

BACAINFOMENARIKLAINNYA
DOWNLOADAPLIKASIDUPAKDANAPLIKASIPKG(KlikDisini)
ONWLOAD PROGRAM SEKOLAH SEPERTI RKAS, RKS, POGRAM
WAKSEK,PROGRAMPPDB/PSB,MOS/MBPDBDLL
ASYIK ONGKOS NAIK HAJI TAHUN 2015 TURUN 502 DOLLAR INISESUAI
PERPRES NOMOR 64 TAHUN 2015 TENTANG BIAYA IBADAH HAJI (Klik
Disini)
DOWNLOAD RPP LENGKAP UNTUK SD/MI DANSMP/MTS SEMUA MATA
PELAJARANSESUAIKTSP/KURIKULUM2006(klikdisini)
CARA MEMBUAT MEDIA PEMBELAJARAN INTERAKTIF DENGAN
POWERPOINT(Klikdisini)
TERNYATA, SINYAL PONSEL DI SEKOLAHBERPENGARUH TERHADAP

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

16/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

TERNYATA, SINYAL PONSEL DI SEKOLAHBERPENGARUH TERHADAP


KEHADIRANGURU(klikdisini)
BEASISWA S2 BAGI GURU SMP PNS DAN NON PNS TAHUN 2015 (klik
disini)
KEBIJAKAN KEMDIKBUD TERKAIT PELAKSANAAN SERTIFIKASI GURU
2015(klikdisini)
PROSEDURKENAIKANPANGKATOTOMATISBAGIGURUPNS(klikdisini)
DOWNLOAD PETUNJUK TEKNIS JUKNIS PENULISANIJAZAH TAHUN
PELAJARAN2014/2015(klikdisini)
DOWNLOADRATARATAINDEKSINTEGRITASUNSMA/SMKTAHUN2015
KABUPATENKOTASEINDONESIA(klikdisini)
DOWNLOAD APLIKASI DUPAK SESUAI PERMENPAN RBNO 16 TAHUN
2009(klikdisini)
INFOKENAIKANGAJIPNSTAHUN2015DANREALISASIGAJIKE13(klik
disini)
CARACEKSKTPGURUSMADANSMK(klikdisini)
INSTRUMEN DAN PERANGKAT AKREDITASI SEKOLAH MADRASAH
TAHUN2015(klikdisini)
KALENDERPENDIDIKAN20152016(klikdisini)
SURAT EDARAN PERIHAL KEBIJAKAN PERSYARATAN PENERBITAN
NUPTKTERBARU(klikdisini)
BLANKOIJAZAHSDSMPSMADANSMKTAHUN2015(klikdisini)
PEDOMAN PEMILIHAN GURU, TUTOR, KEPALA
PENGAWASBERPRESTASITAHUN2015(klikdisini)

SEKOLAHDAN

LOMBAOSNGURUTAHUN2015(klikdisini)
PENCAIRANTUNJANGANSERTIFIKASIGURUTAHUN2015(klikdisini)
LOMBA INOVASI PEMBELAJARAN BAGI GURU SMP TAHUN 2015 (klik
disini)
PEDOMAN PEMBERIAN DANA BANTUAN PENINGKATAN KARIER PTK
SMPMELALUIMGMPSMPTAHUN2015(klikdisini)
LOMBA INOVASI PEMBELAJARAN TINGKAT NASIONAL P2TK DIKDAS
KHUSUSSDTAHUN2015(klikdisini)
APLIKASI PENGOLAHAN NILAI DAN SKHU UNTUK SEKOLAH DASAR
(klikdisini)
APLIKASINILAISEKOLAHDANSKHUUNTUKSMP(klikdisini)
CEKSKTP2015SDSMP(klikdisini)

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

17/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

CEKSKTP2015SDSMP(klikdisini)

IJAZAHPNSAKANDICEKGUNAMEMASTIKANASLI/PALSU(KlikDiSini)
SOLUSIUNTUKKEKAYAAN!!!
TURUN35kgdlmSEMINGGU!
AndaTerlilitHutang?BthModal
1dari3OrangTURUN4KGdalam
Usaha?atauInginKaya?IniSolusinya! SEMINGGU!HerbalPelangsing
Simpelet!

Tweet

8comments:

andiaswan

April26,2013at3:30PM

mintajawabannyadonk.
Reply

cikal_379

August16,2013at11:41AM

Jawabannyabisadikirimgayalewatemail?Trimakasihsebelumnya
Reply

SilviaSasuke

February21,2014at4:05AM

Maafbolehmintakuncijawabnyagak
Reply

MFandraEkaPratama

March4,2014at11:17AM

Maafbolehmintakuncijawabannyagak?
Reply

OmiieUmmaUchiharuno

January9,2016at12:51PM

Maaf,bolehmintakuncijawabanyangga?
Reply

GhinaArifah
maaf,bolehmintakuncijawabanbuatlatihannyanggak?

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

February9,2016at5:24PM
18/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

maaf,bolehmintakuncijawabanbuatlatihannyanggak?
Reply

GhinaArifah

February9,2016at5:25PM

maaf,bolehmintakuncijawabanbuatlatihannyanggak?
Reply

MarthinSitumorang

February22,2016at7:57AM

maaf,bolehmintakuncijawabannyagak?maulatihan...
Reply

Enteryourcomment...

Commentas:

Publish

GoogleAccount

Preview

Linkstothispost
CreateaLink

NewerPost

Home

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

OlderPost

19/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

Search

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

20/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

100

StatistikPengunjung

20,955,973

Ads
Modal50Rb,Hasil30Jt/Bln
HasilkanRp1.5Jt/Hari,Garansi400%Dengan
Modal50ribu..

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

InginMENGECILKANPERUT?
PELANGSINGSAVANNAHSOLUSINYA.
SEKARANGDISKON40%!2KotakHANYA340rb

21/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

SEKARANGDISKON40%!2KotakHANYA340rb
PELANGSINGTERDAFTARBPOM
AMAN,MEMILIKIIZINBPOM.PESAN
SEKARANGDISKON40%!KLIKDISINI!
TURUNBERATBADANCepat!
PELANGSINGSAVANNAHSEKARANG
DISKON40%,2Kotak340rb!HERBAL&AMAN

Followers
Jointhissite
withGoogleFriendConnect

Members(265) More

Alreadyamember?Signin

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

22/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

ENTRIPOPULER

ENTRIPOPULER

CEKSKTP2016(SDSMPSMASMK)
ATAUSKTUNJANGANPROFESI

PENCAIRANTUNJANGAN
SERTIFIKASIGURU2016

PENCAIRANTUNJANGAN
SERTIFIKASIGURU2016

REGISTRASI,LOGINDANPETUNJUK
PUPNS2015

SOALDANKUNCIJAWABLATIHAN
UNSMPTAHUN2016

SOALSOALLATIHANUNSMP
TAHUN2016

JADWALUNSMP/MTSSMA/MADAN
SMK/MAK2016TP.2015/2016

CEKSKTP2016(SDSMPSMASMK)
ATAUSKTUNJANGANPROFESI

DOWNLOADSOALLATIHANUNSMA
TAHUN2016

DOWNLOADKISIKISISOALUKG
2015SEMUAMAPEL

DOWNLOADSOALLATIHANDAN
PEMBAHASANUNSMKTAHUN2016

DAFTARGAJIPOKOKPNSTAHUN
2015DANREALISASIGAJIKE13

CARADANJADWALPENDAFTARAN
KULIAHDILEMBAGAPENDIDIKAN
IKATANDINAS(LPID)TAHUN2016

JADWALIMSAKIYAHPUASA
RAMADHAN1436H2015M

SOALSOALLATIHANUNSMP
TAHUN2016
CARACEKKEASLIANIJAZAH,
APAKAHTERDAFTARDIPANGKALAN
DATAPTDIRJENDIKTI
UGMBUKAPENERIMAANBESAR
BESARANCALONDOSENTETAP
NONPNSTAHUN2016

SOALDANKUNCIJAWABLATIHAN
UNSMPTAHUN2016
DOWNLOADPROTA,PROMES,RPP
DANKKMSEMUAMAPELKELAS7,
KELAS8DANKELAS9SMP/MTS
CARACEKKEASLIANIJAZAH,
APAKAHTERDAFTARDIPANGKALAN
DATAPTDIRJENDIKTI

DAFTARISIPOSTING
2016(118)
2015(432)
December(47)
November(38)
October(18)
September(20)
August(34)
July(52)
June(46)
May(40)
April(36)
March(41)
February(29)
http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

23/24

3/23/2016

CONTOHSOALOLIMPIADESAINSNASIONAL(OSN)BIOLOGISMP|PENDIDIKANKEWARGANEGARAAN

January(31)
2014(180)
2013(62)
2012(17)
2011(32)

Copyright2014.PENDIDIKANKEWARGANEGARAAN.AllRightsReserved NewJohnyWussTemplatebyCBBlogger.PoweredbyBlogger
Links:YOURLINK1YOURLINK2YOURLINK3HERE!

http://ainamulyana.blogspot.co.id/2013/02/contohsoalolimpiadesainsnasional.html

OriginalThemebyMastemplate

24/24