Anda di halaman 1dari 18

This is the html version of the

file http://repository.usu.ac.id/bitstream/123456789/30934/4/Chapter%20II.pdf.
Google automatically generates html versions of documents as we crawl the web.
Page 1
TINJAUANPUSTAKA
Broiler
Broilermerupakanternakyangpalingekonomisbiladibandingkandengan
ternaklain,kelebihanyangdimilikiadalahkecepatanpertambahan/produksi
dagingdalamwaktuyangrelatifcepatatausingkatsekitar45mingguproduksi
dagingsudahdapatdipasarkanataudikonsumsi(Murtidjo,2003)
MenurutRasyaf(2004)yangdimaksuddenganbroiler(ayampotong)
adalahayamyangmudajantanataubetinayangberumurdibawah8minggu
denganbobottertentu,pertumbuhanyangcepattimbunandagingbaikdan
banyak.SedangkanmenurutSiregar(2005)menyebutkanbroileradalahayam
mudayangberumurkurangdari8minggu,daginglembut,empuk,dangurih
denganbobothidupberkisarantara1,52,0kg/ekor.
BroilerdiIndonesiaadalahayamraspedagingjantanataubetinayang
dipotongpadaumur56minggu,dimanaayamtersebutmasihmudadan
mempunyaidagingyangmasihlunak(HardjosworodanRukmiasih,2000)
CiriciriDayOldChick
BeberapaciriDOCyangkualitasyangbaikberdasarkanpenampilan
secaraumumdariluar(generalappearance)sebagaiberikut:
1Bebasdaripenyakit(freedisease)terutamapenyakitpullorum,omphalitisdan
jamur.
2.Berasaldariindukyangmatangumurdandaripembibityangberpengalaman.
3.DOCterlihataktif,matacerahdanlincah.
4.DOCmemilikikekebalandariindukyangtinggi.
5.kakibesardanbasah.
6.bulucerah,tidakkusamdanpenuh.
7.anusbersih,tidakadakotoranataupastaputih.
UniversitasSumateraUtara

Page 2
8.keadaantubuhayamnormal.
9.beratbadansesuaidenganstandarstrain,biasanyadiatas37g(Fadilah,2000)
SalahsatustrainbroileradalahCOBBLH500dengankarakteristik
dapatdilihatpadaTabel1.
Tabel1.DatabiologisCOBBLH500
DataBiologis
Satuan
Bobothidupumur6minggu
1.56kg
Konversipakan
1.93

Beratbersih
70%
Dayahidup
98%
Warnakulit
Kuning
Warnabulu
Putih

Sumber:Murtidjo(1987)

PertumbuhandanPertambahanBobotBadanBroiler
MenurutAnggorodi(1990)pertumbuhanpadahewanmerupakansuatu
fenomenauniversalyangbermuladarisuatuselteluryangdibuahidanberlanjut
sampaihewanmencapaidewasanya.Pertambahanbobotbadandanbobotdari
jaringansepertiberatdaging,tulang,otakdanjaringanlainnya,diartikansebagai
pertumbuhan.
Pertambahanberatbadankerapkalidigunakansebagaipegangan
berproduksibagiparapeternakdanparaahli.Akantetapi,perludiketahuibahwa
adabibitayamyangmemangpertambahanberatbadannyahebat,tetapihebatpula
makanannya.Padahalbiayauntukransumadalahyangterbesarbagisuatu
peternakanayam.Olehkarenaitu,pertambahanberatbadanharuslahpula
dikaitkandengankonsumsiransumnya(Rasyaf,1993)
Pertumbuhanbiasanyamulaiperlahanlahankemudianberlangsunglebih
cepatdanakhirnyaperlahanlahanlagiatausamasekaliterhenti.Polasepertiini
menghasilkankurvapertumbuhanyangberbentuksigmoid(S).tahapcepat
UniversitasSumateraUtara

Page 3
peretumbuhanterjadipadasaatkedewasaantubuhhampirtercapai(Anggorodi,
1990)
KebutuhanNutrisiBroiler
Untukkeperluanhidupnyadanuntukproduksiayammembutuhkan
sejumlahunsuryaituproteinyangmengandungasamaminoseimbangdan
berkualitas,energiyangberintikankarbohidratdanlemak,vitamindanmineral
(Rasyaf,1997)
Kartadisastra(1994)menyatakanjumlahransumyangdiberikansangat
bergantungdarijenisayamyangdipelihara,sistempemeliharaandantujuan
produksi.Disampingitujugadipengaruhiolehbeberapafaktoryangberkaitan
dengangenetikdanlingkungantempatternakitudipelihara.
Penggolonganzatzatnutrisiadalahkarbohidrat,lemak,protein,mineral,
vitamindanair.Fungsikarbohidratpadaunggasadalahsebagaienergidanpanas
sertadisimpansebagailemakjikaberlebihan,sementarakarenalemakmudah
tengik,makasebagianlemakmudahtengik,makasebagianbesarransum
mengandungtidaklebihdarisekitar45%lemak.Proteinadalahunsurpokokalat
tubuhdanjaringanlunaktubuhternakunggas.Zattersebutdiperlukanuntuk

pertumbuhan,pengelolaandanproduksitelursertamerupakanbagiansemua
enzimdalamtubuh.Zatzatmineraldanvitaminmerupakannutrisimikropenting
untukmencegahpenyakitdefisiensi.Sementaraairmempunyaiperananpenting
sebagaistabilisatorsuhu(Anggorodi,1990).
Kebutuhanzatmakananbroilerpadaperiodestartersampaifinisher
terlihatpadaTabel2.
Tabel2.Kebutuhanzatmakananbroilerpadaperiodestartersampaifinisher
Umur
Protein(%)
ME(Kcal/kg)
Lemak(%)SK(%)
UniversitasSumateraUtara

Page 4
Faseawal
2123
29003200
58
35
Faseakhir1921
29003200
58
35
Sumber:Wahyu(1998)

Padapenyusunanformulasiransumsecarapraktis,perhitungankebutuhan
nutrienhanyadidasarkanpadakebutuhanenergidanprotein,sedangkan
kebutuhannutrienyanglaindisesuaikan.Apabilaternakmenunjukkangejala
defisiensimakaperluditambahkansuplementerutamavitamindanmineral.
Tingkatkandunganenergiransumharusdisesuaikandengankandungan
proteinnya,karenaproteinnyakurangmakalajupertumbuhandanproduksiakan
terganggu.Olehkarenaitu,perludiperhitungkankeseimbanganantaratingkat
energidanproteinsehinggapenggunaanransummenjadiefisien(Suprijatna,
UmiyatidanRuhyat,2005).
KandunganNutrisiPadaRansumKomersil
Susunanataukomposisiyangterkandungpadaransumkomersilsebagaimakanan
komplittepungmasaawalanakayampedagingumur12minggu.
Komposisi
Jumlah
KadarAir
13%
ProteinKasar
23%
LemakKasar
8%

SeratKasar
5%
Abu
7%
Kalsium
1.20%
Posphor
1.00%
Bahanbahanyangdipakaiyaitu:Jagung,Dedak,TepungIkan,Bungkil
Kedalai,bungkilKelapa,TepungDagingdanTulang,PecahanGandum,Bungkil
KacangTanah,TepungDaun,CarnolaVitamin,Calcium,PhosphatedanTrace
Mineral.(CharoenPokphandIndonesia)
UniversitasSumateraUtara

Page 5
Susunanataukomposisiyangterkandungpadaransumkomersilsebagaimakanan
komplittepungmasaakhiranakayampedagingumur35minggu.
Komposisi
Jumlah
KadarAir
14%
ProteinKasar
21%
LemakKasar
8%
SeratKasar
5%
Abu
7%
Kalsium
1.20%
Posphor
1.00%
Bahanbahanyangdipakaiyaitu:Jagungkuning,DedakHapermut,
DedakPadi,TepungIkan,BungkilKacangTanah,BungkilKacangKedelai,
BungkilKelapa,DicalciumFosfat,CalciumCarbonat,NatriumChlorida,Vitamin
A,B2,B6,B12,D3,Niacin,TraceMineral,danCalciumDPantotenate,Cholin
ChloridadanAntioxidant.(CharoenPokphandIndonesia)
AwalPemberianRansum
Dipeternakankomersilseringkalidayoldchick(DOC)tidaklangsung
diberimakan,tetapidipuasakantigahari,dengantujuanmengoptimalkansisa
kuningtelurdanperadangansisakuningtelur(omphalistis)menjadiberkurang.
Faktanyaadalahayamyangdipuasakanakanmengalamipenyerapansisakuning
telurmenjadilebihlama,sehinggapeluanguntukterinfeksiolehkuman

lingkunganmenjadijauhlebihbesar(NoydanSklan,1996dalamUnandar1997).
Pemberianransumpadaayamseawalmungkinmemangberpengaruh
terhadapperkembanganusus.Villeakanberkembangsempurna,peristaltikakan
dipacuseawalmungkinsehinggasistemtransportdalamususberlangsungbaik.
UniversitasSumateraUtara

Page 6
Enzimpankreasdangaramempedudigertakseawalmungkin,seiringdengan
makananyangmasuk.Beratbadanberbedanyatasejalandenganpenyerapan
ransumyangmaksimal,sehinggaayamyangdiberiransumlebihdinimempunyai
penampilanakhirlebihbaik(Sulistyonigsih,2004).
Konsumsiayamyangdiberiransumharike1,ternyatakonsumsi
ransumnyalebihtinggisebesar4.8%daripadaayamyangdiberiransumharike2
(Sulistyonigsih,2004).HalinidiperjelasolehpendapatWidjaja(1999)yang
menyatakanbahwapadaharipertamasajahanya50%darikebutuhanenergidan
43%darikebutuhanproteinyangdapatdipenuhidarisisakuningteluryangada.
Hariketigabiasanyapeternakbarumulaimemberiransumpadaanakayam,
ternyatasisakuningteluryangadahanyamensuplai6%darikebutuhanenergi
dan10%untukkebutuhanprotein.
SelanjutnyaUnandar(1997)menyatakanadabeberapaefeknegatifakan
munculjikaterjadiketerlambatanpemberianransum/minumpadatahapawal
kehidupandariayam(lebihdari2hari).Efeknegatifakantersebutantaralain
bobotbadantidakakanmencapaibobotstandar.
Kuningtelurdapatmemenuhikebutuhannutrisipadamasaembrional
dalamtelurhinggamenetas.Sisakuningteluryangmengandungair(50%),
protein(28%)diantaranyameternalantibodi(7%)danlipid(20%),dianggap
memenuhikebutuhanDOC.Kebutuhanyangdapatdipenuhidarikuningtelur,
sepertiyangterteradalamTabel3dibawahini.Kenyataannyasisakuningtelurini
sangatterbatasdanhanyacukupuntukmempertahankankehidupannyabukan
untukpertumbuhannya.Padaharipertamasajahannya50%darikebutuhanenergi
dan43%darikebutuhanproteinyangdapatdipenuhidarisisakuningteluryang
UniversitasSumateraUtara

Page 7
ada.Hariketigabiasanyapeternakbarumulaimemberiransumpadaanakayam,
ternyatasisakuningteluryangadahanyamensuplai6%darikebutuhanenergi
dan10%untukkebutuhanprotein(Widjaja,1999).
Kebutuhanenergidanproteinyangterpenuhidarikuningtelurdapat
terlihatpadaTabel3.
Tabel3.Kebutuhanenergidanproteinyangterpenuhidarikuningtelur
Umur
(Hari)
EnergiKasar

Protein
Diet
Yolk
Diet
Yolk
(Kcal)(%)(Kcal)(%)(Kcal)(%)(Kcal)(%)
1
9.30
50
9.40
50
0.46
57
0.35
43
2
19.80
74
6.80
26
0.97
56
0.77
44
3
35.10
94
2.40
6
1.72
90
0.20
10
4
54.20
98
0.90
2
2.66
94
0.17
6
5
69.00100

0.40
0
3.39
99
0.04
1

Sumber:Widjaja(1999)

Prosesutamayangterjadidalampertumbuhananakayam,yaitu:
Hiperplasia(pertambahanjumlahselseltubuh)danhipertrofi(perbesaran
ukuranseltubuh).Proseshiperplasialebihbesardaripadahipertropiapada
minggupertamadankedua,mingguketigaseimbangdanberikutnyahipertropia
lebihdominan.Tentusajaapabilapersedianselseltidakadajumlahyangcukup
padaminggupertama,akansangatsulituntukmencapaipertumbuhanmaksimal
padaminggumingguselanjutnya.
Manfaatyangdapatdilihatdaripemberianransumawaladalah:
a.Sistempencernaanmakanan
Pemberianransumakanmarangsangperkembanganusus.Vilidapat
berkembangsempurna.Motilitas/peristaltikjugadipacuseawalmungkin,
sehinggasistemtransportdalamususberlangsungbaik.Enzimpankreasdan
garamempedudigertakseawalmungkin,seiringdenganmakananyangmasuk.
b.Sistemimunitas
UniversitasSumateraUtara

Page 8
Antibodimaternal
Metabolismeyangsempurnaakanmendukungprosespenyerapanantibodi
maternal(dariinduk).Antibodimaternalmenjadikuncipertahanantubuhdi
mingguawal,padasaatorganlimfoidbelummeresponsecaramaksimaldan
menghasilkanantibodiaktifjikapenyerapanzatkebalinduktidakmaksimal,
berartiayamtidakakanmendapatperlindunganyanglebihbaikterhadap
seranganbibitpenyakitdarilingkungan,sehinggakematianakanlebihtinggi
danpenampilanayamtidakbisamaksimal(Unandar1997).
Menstimulasiperkembanganjaringanlimfoidsepanjangusus.Jaringanyang
palingmudahuntukmenggertaksistemkekebalanlokaladalahdengan
pemberianransumsedinimungkin.GutAssociatedLymphoidTisue(GALT)
seperticecatonsil,peyerpatchesdisepanjangususakansegaraberaktivitas
maksimalbeberapasaatsetelahadanyagertakanransum.Puasajustruakan
menstimulasisekresikorticosteroidyangmenghambatproliferasiselsel
tubuhyangbertanggungjawabpadasistemimun.
Jaringanlimfoidlain(Bursafabricius)
Antigendidalamususternyatadapatmenggertakselselepitelbursa.Hasil
penelitianmenyatakan,bobotbursaanakayamyangdipuasakandanyang
segeradiberimakanternyataberbedasangatnyata.Anakayamyangdiberi
ransumsedinimungkinmempunyaibobotbursalebihbesar.

c.Penampilanayam
Beratbadandankonversiransumberbedanyatasejalandenganpenyerapan
ransumyangmaksimaldansistempertahanantubuhyangdapatdiandalkan.Pada
beberapapenelitian,ternyatajikaprosespenyerapansisakuningtelurberjalan
UniversitasSumateraUtara

Page 9
secaranormal,makakondisisepertiiniakanmengaktivasiorganyangberkaitan
denganprosespadaayam(Noyetal.,1996;Unandar1997).
KegunaanKuningTelur(Yolk)padaAnakAyam
YolkSac(kantongkuningtelur)merupakanmembranyangmembungkus
kuningtelurselamaprosesperkembanganembrioberlangsung.Yolksacdansisa
kuningtelurakandiserapdanmasukkedalamronggatubuhembrioyangsedang
berkembang,seharisebelumtelurmenetasataupadaharike20pengeramanan.
Bahaniniakanmenjadicadanganmakananbagianakayamyangbarumenetas
(AusticdanNesheim,1990).
Banyakpendapatyangmenyatakanbahwaanakayamsejakberumursatu
sampaiduaharimasihmempunyaicadanganmakananyangtertimbundalam
tubuhberupasisasisakuningtelur(yolk).Cadanganmakanantersebutmasih
cukupuntukmemenuhikebutuhananakayamselama48jamsejakmenetas.
Sebagianahlilainnyaberpendapat,sekalipunmempunyaisisasisakuningtelur,
bahwaanakayammasihmembutuhkanmakanan.Pendapatinipunmasukakal,
sebabpertumbuhanpertamadarianakayamberlangsungsangatcepat,sehingga
banyakmembutuhkanzatputihtelur(protein).Karenaitusisasisakuningtelur
taditidakmencukupikebutuhananakayamuntukmendukungpertumbuhan
tubuhnya(Muslim,1993).
Anakayamyangbarumenetasdapatbertahantidakmakanselamadua
harisejakiaditetaskan,karenadidalamperutnyamasihadasisakuningtelur
yangdigunakansebagaisumberenergi(Rasyaf,1989).
Padaperkembanganembrioselanjutnya,kuningtelurmerupakansumber
energi.Selamapenetasan,kuningtelurterdiridari20%adalahberatbadananak
UniversitasSumateraUtara

Page 10
ayamdanmengandung2040%lemakserta2025%protein.Menjelang
berakhirnyamasainkubasisisakuningtelurterkumpuldidalamrongga
abdominal.Bagianakayamyangbarumenetas,kuningtelurtersediasebagai
energisedangkanproteinuntukkelangsunganhidupdanpertumbuhan.Sisa
kuningtelurcukupuntukkelangsunganhidupanakayamhinggaumur34hari
tanpadiberikanransum,tetapitidakdapatmendukungperkembangansaluran
pencernaandansistemkekebalanataupunpertambahanberatbadan.Selanjutnya
kebanyakanproteinberisiberbagaibiomolekulerberhargasepertimaternal
antibodiyangdigunakanuntukkekebalanpasifyangbergunadaripadasebagai
sumberasamamino.Pecahanlipiddarikuningtelursebagianbesarberisi

trigliserida,phospolipiddansejumlahkecilesterkolesterolsertaasamlemaktidak
bebas.Padasaatpenetasananakayam,kuningtelurdimanfaatkanbaikoleh
endositosisdarikandungankuningtelurkedalamsirkulasiatauolehbatang
kuningtelurkedalamusushalus.Pergerakanantiperistaltikmentransferkuning
telurkeusushalusdimanaacyllipiddicernaolehenzimlipasedaripankreas
dandiserapnya(CharoenPokphandBulletinService,2006).
PemberianRansumyangLebihAwalDapatMempercepatPenyerapan
KuningTelur
Sisakuningtelurpadaumumnyaakanhabishingga4harisetelahmenetas.
Studiterbarumengindikasikanbahwasisakuningtelurdigunakanlebihcepatoleh
anakayamyangsudahmendapatkanransumlebihawalpadaanakayambroiler
saatmenetasadalah6,5gram,yangberkurangmenjadi0,4gramdalamwaktu
96jampadaanakayamyangdiberiransumsegerasetelahmenetas(Gambar2),
tetapiberatkuningteluryangtersisapadaanakayamyangdipuasakan24dan
UniversitasSumateraUtara

Page 11
48jamadalah0,7gramdan1,5gramsetelah96jam.Halinidisebabkankarena
gerakanantiperistaltikyangmentransferkuningtelurhinggakeduodenumkarena
dirangsangdengankehadiranmakanandidalamsaluranusus.Tetapipadaproses
penetasananakayamdiperunggasankomersial,anakayamakanditransferdari
inkubatorketikasebagianbesartelahterlepasdarikerabangtelur.Diikutidengan
prosesselanjutnyasepertisexing,vaksinasidanpengemasanyangdilakukan
sebelumdimasukkankedalamboxuntukdikirim.Jadidalamkenyataannya,anak
ayamseringkalitidakmendapatkanairminumdanransum,yangmenyebabkan
kelangsunganhidupdanpertumbuhanterlambat.Olehkarenasegerasetelah
penetasanmerupakanperiodekritisuntukperkembangandankelangsunganhidup
bagianakayam(CharoenPokphandBulletinService,2006).
Gambar2.Grafikpengaruhketiadaanransumsetelahpenetasan(048jam)
iiterhadapberatbadanbroilerpadainterval48jam
EfekKuningTelur(Yolk)TerhadapPertambahanBeratBadan
Studiterbarumengenaidayoldchick(DOC)broilermenjelaskanbahwa
setelahpenetasan,anakayamyangmendapatkanransumlebihcepatakandicapai
UniversitasSumateraUtara

Page 12
beratlebihbesardibandingkandengananakayamyangdipuasakan48jam(
Gambar2).
Sedangkanpadaanakayamyangdiberiransumsegeradandipuasakan
24jamtidakadaperbedaanyangsignifikanterhadapberatbadan.Dilaporkanjuga
daristudilainbahwaayamyangtidakdiberiransumdanairminumdalamkurun
waktu48jamsetelahmenetasdapatmenurunkanberatbadan7,8%dibandingkan
dengananakayamyangdiberiransumsegerasetelahmenetas.Padapercobaan
laindilaporkanbahwapulletdananakayamyangdipuasakanselama48jamatau

lebihakanmemperlambatpertambahanberatbadandanperkembanganusus,
menurunkanarealpenyerapanususdanmembatasikapasitaspengambilannutrien
yangpenting,jadimerupakankontribusiuntukpertumbuhanterlambatdi
kemudianhariakanmenurun.Pemberianransumyanglebihcepatpadaanak
ayamakanmeningkatkanpersentasedagingdadayangdihasilkanhingga79%
jikadibandingkandengananakayamyangdipuasakan.Haliniberkaitandengan
perbedaanperkembangankerangkadanototatauefekjangkapanjangdengan
pemberianransumyanglebihawal(CharoenPokphandBulletinService,2006).
Keterlambatanpemberianransumternyatamemberikanefekyangnegatif
terhadappertambahanberatbadanbroiler.Keterlambatanpemberianransum
setelah15jampengirimanDOCmenyebabkanpertambahanberatbadanayam
lebihlambat.Padaharike7sampaiharike8,ayamyangdiberikanransumlebih
awalmenghasilkanberatbadanyanglebihtinggi20gdibandingkanberatbadan
ayamyangterlambat15jamdiberiransum.Pengaruhketerlambataniniterlihat
sangatsignifikanpadaumur3540hari.Perbedaanberatbadanmencapai80g
UniversitasSumateraUtara

Page 13
yangmanadapatmengurangipendapatanpeternakbroiler(CharoenPokphand
BulletinService,2006).
Gambar3.Grafikpengaruhberatbadaniiterhadapketerlambatanpemberian
ransumsetelah15jampengirimanDOC
EfekKuningTelur(Yolk)TerhadapSaluranPencernaan
Padasaatpenetasan,anatomisistempencernaananakayambelum
sempurnadankapasitasfungsiawalnyabelumberkembangseluruhnya.Saluran
pencernaanmengalamiperubahanmorfologi(bertambahnyapanjangususserta
kepadatandantinggivili)danperubahanfisiologi(meningkatnyaproduksi
pankreasdanenzimpencernaan)termasukmeningkatnyaareapermukaan
pencernaandanpenyerapan.Segerasetelahperiodepenetasan,beratusushalus
akanmeningkatlebihcepatdariberattubuhdanakanterusmeningkathingga
maksimumsampaiumur610hari.Namunorganpencernaansepertigizzard
(rempela)ukurannyatidakmenunjukkanpeningkatanperubahanparaleldalam
ukuranyangrelatif.Keberadaannutrisipadalumenususakanmerangsang
pertumbuhanviliusus.Morfologiepitheliumususterutamadipengaruhioleh
UniversitasSumateraUtara

Page 14
ketiadaanmakanan.Halinidilaporkanbahwatinggivilliduodenumdan
perputaranselusussecarasignifikanberkurangpadaanakayamyangdipuasakan
24jam.Dilaporkanjugabahwatidakadanyaransumdanairminumdalam24,48
dan72jamsetelahanakayammenetasakanmempengaruhiperkembanganvili
usus.Jadi,pengaruhpeningkatanpertumbuhandaripemberianransumyanglebih
awaldapatditerangkandenganperubahanperkembangansaluranpencernaan.
Datahasilpenelitianmengungkapkanbahwapemberianransumlebihawalpada

anakayamsetelahmenetas(dalamwaktu2448jam)akanmempengaruhi
perkembangansaluranpencernaan(Tabel4)
Tabel4.iPengaruhbagianorgantertentu(%beratbadan)terhadapketiadaan
ransumpada
umur4hari
Ketiadaan
ransum
setelah
penetasan
Hat
i
Proventriculu
sdan
Gizzard
Pankrea
s
Duodenu
m
Jejenu
m
Ileu
m
0jam
3.76
7.91
0.38
2.94
2.82
2.12
24jam
3.71
8.03
0.36
2.89
2.85
2.07
48jam
3.24
7.80
0.20
2.78
2.39
1.65

Ayamyangdiberikanransumlebihawalakanmeningkatkanpermukaan
penyerapanusus,menujukeassimilasinutrisiyanglebihbesardantumbuhlebih
baik.Usushalusakanberkembanglebihbaikdenganadanyamakanan,namun
jikaransumeksogenoustidakadamakaanakayamakanberkembangdipacu
denganmengkonsumsiransumdanenziminiakanterusmenerusdisekresikan
relatifkonstanjikaanakayammengkonsumsiransum.Anakayamyangmencerna
makananmakaaktifitasenzimtripsin,amilasedanlipaseakanmeningkatyang
berkorelasidenganpeningkatanberatususdanberatbadan.Pengambilannutrisi
sepertiglukosadanmetioninadalahrendah(2530%)segerasetelahayam
menetas.Pemberianransumyangrendahnatriumakanmenurunkanpengambilan
UniversitasSumateraUtara

Page 15
nutrisidiusussehinggadisarankannutrisipentingdiberikandiawalperiode
penetasan.Pankreas,hatidanusushalusberkembangcepatsetelahanakayam
menetas,sehinggahaliniperludiperhatikan.Pemberianransumlebihawalakan
merangsangperkembanganorgantersebut,meningkatkankapasitaspencernaan
danpenyerapanusus.Totalaktifitasenzimpencernaancenderungmeningkat
selamaperiodesetelahbereaksidenganadanyamakanandalamusus(Charoen
PokphandBulletinService,2006).
PematanganSistemPencernaan
Disampingkemampuandayoldchick(DOC)dalammengaturtemperatur
tubuhnyayangsempurnadarisaluranpencernaanadalahhalyangsamapenting
terhadapperformancebroiler.Sebelumanakayampipping(mematukkerabang
telur)padaharike19inkubasi,embrioakanmulaimenarikkuningtelurtelah
diserap.Residukuningtelurkayaakanlemakyangpentingsebagaisumberenergi
untukDOCdanselanjutnyamerupakanpetangandarisemuaorgansempurnadan
kontrolfisiologis(CharoenPokphandBulletinService,2007).
BobotPotong
Bobotpotongadalahbobotyangdidapatdengancarapenimbanganbobot
ayamsetelahdipuasakanselama12jam.Bobotpotongperludiperhatikankarena
berpengaruhterhadapbobotkarkas,olehkarenaitudiperhatikankualitasdan
kuantitaskarkasdariransumyangdikonsumsi,sehinggadidapatpertumbahan
yangbaik.
Tujuanutamapemberianransumadalahuntukmenghasilkanpertumbuhan
yangpalingcepatsedapatmungkindenganjumlahransumyangpalingsedikit,
UniversitasSumateraUtara

Page 16
sertahasilakhiryangmemuaskandalamjangkawaktuekonomisyangpendek
(BlakelyandBade,1998).
KarkasBroiler
Karkasmerupakandagingbersamatulangdarihasilpemotongansetelah
dipisahkandarikepalasampaibataspangkalleher,kakisampaibataslutut,isi

ronggaperut,darahdanbulu(Rasyaf,1992).
Menurutsiregar(1980)bahwakarkasyangbaikberbentukpadatdantidak
kurus,tidakterdapatkerusakankulitataupundagingnya.Sedangkankarkasyang
kurangbaikmempunyaidagingyangkurangpadatpadabagiandadasehingga
kelihatanpanjangdankurus.Padadasarnyamutudanpersentasebobotkarkas
dipengaruhiolehgalur,jeniskelamin,umur,bobotdankualitasmakananyang
dibentuk.HalinijugadidukungolehBergdanButterfield(1972).Yang
menyatakanbahwakarkasyangbaikditandaidenganjumlahdagingyang
maksimum,sedangkantulangnyaminimumdanjumlahlemakyangoptimum.
Faktoryangmenentukannilaikakasmeliputiberatkarkas,jumlah
dagingyangdihasilkandankualitasdagingdarikarkasyangbersangkutan.Nilai
karkasdikelompokanberdasarkanjeniskelaminternakyangmenghasilkan
karkas,umurternak,danjumlahlemakintramuskulardalamotot.Komposisi
karkasbroilerdipengaruhiolehbanyakfaktorantaralainbangsa,jeniskelamin,
umur,dantingkatkepadatankandang.Padaumuryangrelatifmudaakan
menghasilkanpersentasekarkasyanglebihrendahdibandingkanumuryangsudah
dewasa.Produksikarkaserathubungannyadenganbobotbadan.Selainfaktor
bobotbadan,bobotkarkasjugamempengaruhigenetisataustrain,umur,mutu
ransum,tatalaksanadankesehatanternak(Soeparno,1994).Padabroilerterdapat
UniversitasSumateraUtara

Page 17
berbagaikelasayamyangdijual,yaknikurangdari1kg,1.0sampai1.7kgdan
lebihdari1.7kg.Klasifikasiberatayaminitelahmembudayakarenasudahsejak
lamaberbagailapisankonsumenmenurutbermacammacamberattubuhayam
(Suharno,2000).
Klasifikasikualitaskarkasunggasdidasarkanatastingkatkeempukan
dagingnya.Unggasyangdagingnyaempuk,yaituunggasyangdagingkarkasnya
lunak,lentur,kulitnyaberteksturhalusdankartilagosternalnyafleksibel.Unggas
dengankeempukandagingsedangdiidentifikasikandenganumuryangrelatif
lebihtua,kulityangkasardankartilagosternalnyakurangfleksibel(Swatland,
1984disitasiSoeparno,1994).
Kelassedanginimeliputi:(1)Stag,ayamjantanberumurkurangdari10
bulandan(2)kalkunbetinadanjantanberumursekitar1tahunsampai15bulan.
Kelasunggasdewasameliputiroaster,ayambetinadewasa.Kelasunggasini
memilikidagingyangalot,kulitkasardankartilagosternalkeras.Kelaskarkas
unggasyangdagingnyaempukdapatdibedakanberdasarkanatasspesies,berat
karkasdanjeniskelamin.Padaprinsipnya,jumlahdagingyangdihasilkanadalah
proposionalterhadapjumlahlemakkarkas.Jadipenilaiankarkasdapatdidasarkan
atasberatkarkasdantingkatperlemakan.Meskipundemikian,karenalemaktidak
selaluterdistribusisecaramerata,makaestimasinilainilaikarkas(kualitashasil)
masihmenghadapiproblemyangkompleks(Soeparno,1998).
Untukmendapatkanbobotkarkasyangtinggidapatdilakukandengan
memberikanransumdenganimbanganyangbaikantaraprotein,vitamin,mineral

dandenganpemberianransumyangberenergitinggi(Scottetal.,1982).
UniversitasSumateraUtara

Page 18
Sifatdagingbroilerdiantaranyaadalahkadarlemaktinggisetelahmasa
pertumbuhan.Apabilakadarlemaktinggimakaakandiikutidengan
meningkatnyakadarair.Kadarairyangtinggidalamdagingmerupakansalahsatu
faktoryangmendukungperkembanganjamurataumikroorganisme.Dengan
demikiandagingyangberkualitastinggimempunyaikadarlemakdanairrendah
tetappersentasekarkasnyatinggi(Ketaren,1989).
PersentaseKarkas(%)
Bobotkarkasnormaladalah6070%dariberattubuh.Sedangkan
persentasekarkasadalahperbandinganantarabobotkarkasdenganbobothidup
dikalikan100%(Siregar,1994).
Persentasekarkasmerupakanfaktorterpentinguntukmenilaiproduksi
ternak,karenaproduksierathubungannyadenganbobothidup,dimanasemakin
bertambahbobothidupnya,makaproduksikarkasnyasemakinmeningkat
(Murtidjo,1987).
Persentasekarkasbroileryangnormalyangberkisarantara6567%dari
bobothidup(McNitt,1983).Persentasekarkasdipengaruhiolehbangsa,umur,
jeniskelamin,bobothidupdanmakanan.Persentaseayamjantanlebihbesar
dibandingkanpersentaseayambetinalebihbanyakmenghasilkankulitdanlemak
abdomendaripadajantan(MorranandOrr,1970).
Murtidjo(1987)menyatakanbahwapersentasekarkasmerupakanfaktor
yangpentinguntukmenilaiproduksiternak,karenaproduksierathubungannya
denganbobothidup,dimanasemakinbertambahbobothidupnyamakaproduksi
karkasnyasemakinmeningkat.HaliniditegaskanlagioleholehAhmaddan
Herman(1992)disitasiPresdi(2001)menyatakanbahwaayamyangbobot
UniversitasSumateraUtara

Page 19
tubuhnyatinggimenghasilkanpersentasekarkasyangtinggi,sebaliknyaayam
yangbobothidupnyarendahakanmenghasilkanpersentasekarkasyangrendah.
LemakAbdominal(%)
Lemakabdominalmerupakanlemakyangterdapatdisekitarronggaperut
ataujugadisekitarovarium.Lemaksebagaisumberenergisangatefesiendalam
jumlahatau2.5kalilebihtinggidarikandungankarbohidrat.Namunpemakaian
lemakataukonsumsiunggashanyadibolehkansekitar5%darijumlahtotal
ransum.Halinidisebabkankandunganlemakyangtinggiakanmenghambat
ovulasi(Triyantini,1997).
MenurutHaris(1997)yangmenyatakanbahwaperlemakantubuh
diakibatkandarikonsumsienergiyangberlebihyangakandisimpandalam
jaringantubuhyaitupadabagianintramuscular,subcutandanabdominal.
DitambahkanlagiolehTilmanetal.(1986)yangmenyatakanbahwakelebihan

energipadaayamakanakanmenghasilkankarkasyangmengandunglemaklebih
tinggidanrendahnyakonsumsimenyebabkanlemakdankarbihidratyang
disimpandalamglikogenrendah.
Sembiring(2001)menyatakanbahwatinggirendahnyakualitaskarkas
broilerditentukandarijumlahlemakabdominalyangterdapatdaribroiler
tersebut.Karkasyangbaikharusmengandungdagingyangbanyak,sebagianyang
dimakanharusbaik,mengandungkadarlemakyangtidaktinggi.
Salahsatucaramengurangiperlemakanpadabroileradalahdenganjalan
menvariasikandengannutrienransum,terutamaenetgiprotein.Dengan
meningkatnyaenergiransum,makaakanmeningkatnyakandunganlemak
UniversitasSumateraUtara

Page 20
abdominalnyaakanmenurun.Broilermudasampaiumurenamminggu
mengandunglemakkirakira4%lemakbadan(Wahyu,1985).
Soeparno(1994)menyatakanlemakkarkasyangtinggisebagaiakibatdari
perlakuanransumberenergirendahsehinggaterjadikenaikanpersentaselemak
intramuskulardanmenurunkankadarair.SementaraituKetarenetal.(1999)
menyatakanbahwapemberianprodukterfermentasipadabroilermeskipuntidak
menyebabkanperubahanyangberartiterhadappersentasekarkas,tetapidapat
menurunkankadarlemakabdominalnya.
Komot(1989)menyatakanbahwadiantarafaktorfaktoryang
mempengaruhilemaktubuh,makafaktorransumadalahyangpalingberpengaruh.
Perlemakantubuhdiakibatkandarikonsumsienergiransumyangberlebihyang
akandisimpandalamjaringantubuhyaitubagiandariintramuscular,subcutan
danabdominalnya(Haris,1997).
Mahfud(2000)menyatakanbahwauntukmencernaseratkasardibutuhkan
energiyangbanyaksehinggaayamtidakmemilikienergiyangberlebihanuntuk
disimpandalambentuklemakdaging.
UniversitasSumateraUtara

PANEN, PASCA PANEN AYAM DAN KERUGIAN YANG DIALAMI DALAM


PENGOLAHAN AYAM BROILER
A. Panen
Beberapa hal yang dilakukan sebelum memanen ayam broiler adalah sebagai berikut:
a. Membuat jadwal kandang yang akan dipanen sesuai dengan ukuran berat ayam dan letak
kandang.
b. Menyiapkan peralatan panen seperti timbangan, alat tulis, surat jalan, nota timbangan, tali rafia,
keranjang ayam, dan lampu senter.
c. Membuat laporan stok ayam dan mengambil sampel dahulu untuk ditimbang, sehingga saat
dipanen akan sesuai dengan ukuran yang telah dilaporkan.

a.

Tidak memberi pakan secara penuh pada ayam yang akan dipanen.12 jam atau minimal 8 jam
sebelum dijual hidup (juga bila dijual dalam bentuk sudah dipotong) ayam sudah tidak diberi
ransum lagi, tapi hanya diberi air minum. Tujuannya agar ayam tidak terkontaminasi oleh pakan
(termasuk baunya), dan bilamana akan dipotong tidak menghasilkan kotoran yang terlalu banyak
d. Kondisi ayam yang dipanen harus bebas dari antibiotik minimum 5-14 hari sebelum
panen, dengan tujuan untuk menghindari efek residual atau masih terdapatnya sisa-sisa obatobatan tersebut di dalam daging ayam yang tentu saja akan tidak baik bagi kesehatan manusia
bilamana mengonsumsinya.

Karakteristik Strain Broiler


Karakteristik serta keunggulan strain broiler dan layer di Indonesia antara lain:
Strain Cobb (broiler)
1. Titik tekan pada perbaikan FCR
2. Pengembangan genetik diarahkan pada pembentukan daging dada
3. Mudah beradaptasi dengan lingkungan tropis (heat stress)
4. Produksi efisien (Bobot badan 1,8 2 kg; FCR 1,65)
Strain Hybro (broiler)
1. Fokus terhadap kekuatan dan daya hidup
2. Menjaga keseimbangan antara sifat broiler dan breeder
3. Performa bagus pada iklim tropis
4. Tahan terhadap kasus ascites
5. Fokus pengembangan genetik pada hasil/produk karkas
Strain Ross (broiler)
1. FCR lebih efisien
2. Laju pertumbuhan lebih cepat
3. Daya hidup lebih bagus
4. Fokus pengembangan genetik pada kekuatan kaki sebagai penyeimbang berat badan
sumber www.cjfeed.co.id/

W E D N E S DAY ,

AUGUST

29, 2007

AnimalNutrition VII (Cobb 500...)

Selayang Pandang Broiler Cobb 500


(sebuah rangkuman dari Seminar Broiler Cobb di Sommerset Surabaya, 28 Agustus 2007)
Strain ayam broiler yang cukup banyak dibudidayakan di Indonesia adalah strain Cobb. Pada seminar ini
dijelaskan bahwa Cobb-vantress Inc sebagai perusahaan pembibitan ayam yang telah menggunakan
biotechnology modern mampu menghasilkan genetic make up yang baik dari tahun ketahun. Seleksi genetic
yang ketat mampu menghasilkan strain unggul. Menurut Andrew bourne strain Cobb 500 yang saat ini
dihasilkan oleh Cobb vantress mempunyai keungulan komparatif dibanding strain yang lain seperti growth
rate yang cepat, breast formation yang semakin baik, Feed conversion yang makin baik, mempunyai struktur
tulang dan otot yang lebih baik dan mempuyai qualitas daging yang baik.
Dengan semakin diperbaikinya genetik Cobb maka dapat dipastikan adanya perubahan pada rekomendasi
angka kecukupan gizinya. Pada guide nutrition 2006 yang terbaru terlihat bahwa ada perubahan yang cukup
signifikan dibandingkan dengan guide 2004 yaitu pada balance amino acid serta perubahan di vitamin A dan
vitamin D3. Perubahan ini dimungkinkan akibat perbaikan genetic Cobb itu sendiri. Cobb 500 merupakan
bagian dari Broiler modern dimana mampu berkembang dengan cepat (fast growth) sehingga apabila
kecukupan nutrient untuk pembentukan otot dan tulang tidak terpenuhi maka akan muncul gejala-gejala
kelumpuhan atau leg problem. Sehingga pada seminar ini Andrew bourne menggaris bawahi perubahan
pada angka kecukupan beberapa mineral dan vitamin. Selain itu Andrew juga mengajak peserta untuk
mencoba membuat recording untuk dibandingkan dengan Standard performance Cobb yang ada. Dan juga
menurut Andrew guide nutrition ini tidak fix, tetapi bisa dimodifikasi sesuai dengan kondisi dilapangan.
Modifikasi guide nutrition tersebut telah dilakukan oleh team Nutritionist PT. Sierad Produce Tbk div Sidoarjo
dimana pemakaian pakan Pre Starter AS 100 B mampu melampaui standard Cobb pada minggu pertama
yaitu 160 vs 190-200 g. Dengan kenyataan ini maka perlu pengkajian yang lebih jauh supaya didapat
performance Cobb yang optimal untuk pemeliharaan di daerah tropis.
Selain itu Andrew bourne memberikan penyegaran kembali kepada peserta mengenai manajemen broiler
dari brooding sampai panen, karena sebaik-baiknya qualitas DOC maupun pakan jika tidak disertai dengan
manajemen pemeliharaan yang baik maka performance yang dicapai akan tidak maksimal. Kebanyakan
dilapangan saat ini manajemen dilakukan seadanya atau tidak ada recording yang jelas berbeda dengan
manajemen pemeliharaan layer. Alangkah baiknya jika setidaknya ada recording bobot badan mingguan
maupun konsumsi air harian. Dengan mengetahui komsumsi air harian maka akan membantu peternak
mengontrol kondisi ayam dan lingkungan. Semisal adanya adanya kenaikan konsumsi air minum bisa
menggambarkan adanya cekaman stress panas pada ayam.
Dalam presentasinya ini yang cukup menarik yaitu pembahasan manajemen lighting pada ayam broiler. Pada
umumnya peternakan memberikan penyinaran selama 24 jam, yaitu 12 jam dengan penyinaran alami dan
12 jam berikutnya menggunakan lampu listrik. Hal ini dimungkinkan agar ayam dapat makan sebanyaknya
sehingga feed intakenya masuk dan bobot badan sesuai standard atau bahkan lebih tinggi dari standard
yang dikeluarkan Cobb. Pembahasan lighting program pada broiler ini merupakan implementasi dari konsep

We all need good nights sleeping..


Good nights sleeping is part of natural lifestyle for your Bird
animal walfare. Hal ini senada dengan slogan Cobb Vantress yaitu

Dimana perlakuan lighting program ini mencoba mengurangi waktu terang di dalam kandang sehingga
memberikan kesempatan ayam broiler untuk tidur dan beristirahat. Hasil penelitian ini di Canada
menunjukkan adanya mortality yang rendah, pertumbuhan rata-rata harian bobot badan (ADG) serta FCR
yang rendah pada farm yang menerapkan lighting program. Hal ini sangat logis karena ayam cukup tidur dan
istirahat sehingga cadangan energi dapat digunakan untuk recovery kondisi tubuh ataupun untuk
perkembangan daging. Mortality menurun dikarenakan pada saat adanya perubahan dari light to dark atau
sebaliknya meningkatkan sekresikan hormone melatonin.

Menurut hasil penelitian yang dilakukan Cobb-vantress bahwa melatonin berperan


pada immunocompetency. Ada beberapa hal yang perlu dipersiapkan apabila akan mencoba menerapkan
lighting program pada broiler yaitu jumlah tempat pakan dan tempat minum harus cukup. Dengan lighting
program ini dapat dipastikan pada saat lampu dinyalakan maka ayam tersebut akan makan pada waktu
yang bersamaan sehingga apabila tempat pakan atau minum tidak mencukupi dapat menekan feed intake
dan akibatnya ADG tidak maksimal.

Menurut Andrew bourne perlakuan lighting program ini baru bisa dilaksanakan apabila bobot badan minggu
pertama sesuai dengan standard Cobb yaitu 160 gram. Dan yang perlu digaris bawahi penurunan Feed
intake pada tiga hari pertama perlakuan ini adalah wajar dan selanjutnya akan kembali normal. Lighting
program yang disarankan yaitu 6 Jam gelap dan 18 jam terang, dari umur 7 hari sampai 28 hari dengan
intensitas cahaya 5-10 lux. Setelah itu dari umur ke 29 sampai panen lama waktu gelap dikurangi 1 jam
perharinya. Hal ini dilakukan kemungkinan untuk memberikan kesempatan makan yang lebih banyak
sehingga uniformity saat panen dapat tercapai.

Kesimpulan
Untuk memperoleh performance yang optimal maka :
1.Persiapan brooding yang baik meliputi suhu dan ventilasi kandang
2.Perlakuan yang baik saat DOC datang meliputi persiapan pakan dan air minun yang mengandung nutrisi
anti stress
3.Pembuatan recording sederhana meliputi bobot badan, FI, Konsumsi air, FCR dan Mortality untuk
mengkontrol performace dengan cara membandingkan dengan standard yang ada
4.Manajemen pemeliharaan dan program health control yang baik
5.Mencoba untuk menerapkan konsep-konsep animal walfare di pemeliharaan ayam broiler ini

Note : Andrew bourne (Specialist Cobb dari USA