Anda di halaman 1dari 34

BAB I

PENDAHULUAN

A.

Latar Belakang
Kanker

ovarium

merupakan

sebuah

penyakit

dimana ovarium yang

dimiliki wanita memiliki perkembangan sel-sel abnormal. Secara umum, kanker


ovarium merupakan suatu bentuk kanker yang menyerang ovarium. Kanker ini bisa
berkembang sangat cepat, bahkan, dari stadium awal hingga stadium lanjut bisa
terjadi hanya dalam satu tahun saja. Kanker ovarium merupakan suatu proses lebih
lanjut dari suatu tumor malignan di ovarium. Tumor malignan sendiri merupakan
suatu bentuk perkembangan sel-sel yang tidak terkontrol sehingga berpotensi menjadi
kanker.Di Inggris, British Medical Journal dan Target Ovarium Center menjelaskan
bahwa dibutuhkan waktu satu bulan untuk mengetahui penyakit ini, setelah gejala
muncul. Pengertian kanker ovarium memang sangat penting diketahui. Namun,
gejala-gejalanya juga tidak kalah penting untuk diketahui. Pengertian kanker ovarium
tidak bisa dilepaskan dari gejala-gejala yang berkaitan dengan penyakit ini. Terdapat
beberapa gejala umum yang dapat dengan mudah dikenali. Jika pengertian kanker
rahim, khususnya gajala umum tersebut diketahui para wanita, pengobatannya pun
bisa lebih cepat dan peluang untuk sembuh lebih besar . Oleh karena itu, pengertian
kanker ovarium sangat penting diketahui oleh para wanita.

1| K a n k e r O v a r i u m

Selain wajib mengetahui pengertian kanker ovarium, para wanita juga wajib
mengetahui gejala umum kanker ovarium (Wikipedia.org)
B. RumusanMasalah
1. Apa definisi dari kanker ovarium?
2. Bagaimana etiologi terjadinya kanker ovarium?
3. Apa saja factor resiko yang dapat menyebabkan kanker ovarium?
4. Bagaimana tanda dan gejala dari kanker ovarium?
5. Apa saja jenis kanker ovarium?
6. Apa saja stadium kanker ovarium?
7. Bagaimana penyebaran kanker ovarium?
8. Bagaimana penanganan kanker ovarium?
9. Bagaimana prognosis kanker ovarium?
10. Bagaimana skrinning dan deteksi dari kanker ovarium?
11. Bagaimana diagnosis dan terapi medis yang dilakukan untuk penderita
kanker ovarium?
12. Bagaimana asuhan keperawatan pada penderita kanker ovarium?

C. TujuanMakalah
1. Mengetahui pengertian dari kanker ovarium
2. Mengetahui etiologi terjadinya kanker ovarium
3. Mengetahui tanda dan gejala dari kanker ovarium
4. Mengetahui klasifikasi stadium kanker ovarium
5. Mengetahui jenis kanker ovarium
6. proses penyebaran kanker ovarium
7. Mengetahui bagaimana penanganan kanker ovarium
8. Mengetahui prognosis kanker ovarium
9. Mengetahui skrinning dan deteksi dari kanker ovarium

2| kankero v a r i u m

10. Mengetahui diagnosis dan terapi medis yang dilakukan untuk


penderita kanker ovarium
11. Mengetahui asuhan keperawatan pada penderita kanker ovarium

BAB II
PEMBAHASAN
A. Kajian Teoritis
1. Definisi Kanker Ovarium
Kanker ovarium adalah tumor ganas pada ovarium (indung telur) yang
paling sering ditemukan pada wanita berusia 50 70 tahun. Kanker ovarium
bisa menyebar ke bagian lain, panggul, dan perut melalui sistem getah bening
dan melalui sistem pembuluh darah menyebar ke hati dan paru-paru. Kanker
ovarium sangat sulit didiagnosa dan kemungkinan kanker ovarium ini
merupakan awal dari banyak kanker primer. (Wingo, 1995).
Satu dari 70 wanita akan mengalami kanker ovarium dalam kehidupan
nya. Suatu neoplasma letal, kanker ovarium , menyebabkan lebih banyak
kematian dibandingkan kombinasi kanker endometrium dan serviks.
3| kankero v a r i u m

Frekuensi neoplasma ovarium ganas meningkat dalam setiap decade


kehidupan ,dari 4 % pada wanita muda berusia kurang dari 30 tahun sekitar
50% pada wanita berusia lebh dari 60 tahun.Sebelum menopause,45% masa
ovariumbersifatganas(paxeet.al.,).

2. Etiologi Kanker Ovarium


Penyebab kanker ovarium sampai saat ini belum diketahui secara pasti.
Ca mamae diduga memiliki hubungan terhadap kejadian kanker ovarium pada
wanita. Sebaliknya pada wanita pada wanita yang mengidap Ca ovarium juga
mempunyai faktor resiko mengidap Ca mamae 3-4x lipat. Akan tetapi banyakteori
yang menjelaskan tentang etiologi kanker ovarium, diantaranya:
a. Hipotesis incessant ovulation Teori menyatakan bahwa terjadi kerusakan pada selsel epitel ovarium untuk penyembuhan luka pada saat terjadi ovulasi. Proses
penyembuhan sel-se lepitel yang terganggu dapat menimbulkan proses transformasi
menjadi sel-sel tumor.
b. Hipotesis androgen Androgen mempunyai peran penting dalam terbentuknya kanker ovarium.
Hal ini didasarkan pada hasil percobaan bahwa epitel ovarium mengandung reseptor androgen.
Dalam percobaan in-vitro, androgen dapat menstimulasi pertumbuhan epitel ovarium
normal dan sel-sel kanker ovarium
3. Faktor Resiko Kanker Ovarium
Faktor resiko kanker ovarium adalah sebagai berikut;
4| kankero v a r i u m

Diet tinggi lemak

Merokok, minum alcohol

Polutan lingkungan

Riwayat 2 orang dalam satu tingkat silsilah keluarga mengalami


kanker payudara atau kanker ovarium (resiko 50%).

Riwayat pribadi menderita kanker kolon ,payudara,atau endometrium.

Factor

factor

tertentu

dapat

melindungi

wanita

dari

kanker

ovarium.Faktor tersebut meliputi multiparitas dan penggunaan kontrasepsioral


dalam waktu lama.(lebih dari satu tahun).kehamilan dan kontrasepsi oral
dalam sementara waktu menghilangkan stimulasi FSH dan LH,kemungkinan
mencegah pembentukan kista inklusi epitel dan transformasi sel selanjutnya
yang mengarah ke ganas.
4. Tanda dan Gejala Kanker Ovarium
Tumor ini sering tidak memberi gejala sehingga penderita sering baru datang
ke dokter dalam keadaan terlambat. Perasaan tidak enak di perut dan gangguan
ringan pada saluran pencernaan dapat terjadi dan menyebabkan penderita pergi
ke dokter. Jika dokter kurang waspada, mungkin akan dilakukan pemeriksaanpemeriksaan yang berlarut-larut sehingga diagnosis makin terlambat dibuat.
Gangguan tersebut dapat disebabkan rangsangan peritoneum atau gangguan
5| kankero v a r i u m

mekanik karena penekanan atau infiltrasi sel-sel tumor ganas ke saluran


pencernaan. Tanda-tanda abdomen mendadak dapat disebabkan oleh terputarnya
tangkai tumor, tumor pecah, tumor mengalami infeksi atau terjadi penyumbatan
pada saluran pencernaan. Anemi dan penurunan berat badan biasanya baru
terjadi pada tingkatan lanjut.
Pembesaran perut ditemukan pada tumor yang besar dan dapat menyebabkan
timbulnya gejala-gejala penekanan kea lat-alat sekitar dan atau pendorongan
diafragma.
Tumor sel granulose dan tumor sel theca ( dimasukan di golongan ganas)
menimbulkan pubertas praecox pada anak-anak dan

perdarahan-perdarahan

yang tidak normal pada masa reproduksi. Perubahan bentuk abdomen baru
terjadi jika tumor ovarium sudah sebesar tinju atau lebih. Pada pemeriksaan
dalam tumor tersebut akan teraba disamping uterus tetapi kadang-kadang terletak
di tengah dan mendorong uterus ke samping, depan atau belakang sehingga
hanya dapat dikenal dengan pemeriksaan yang teliti atau dengan pemeriksaan
tambahan seperti ultrasonografi atau dengan CT scanner. Bentuk tumor mungkin
bundar lonjong atau berbenjol benjol tergantung dari jumlah loci yang ada.jika
tumor ovarium bersifat padat biasanya pada permukaan nya teraba nuduli
halu.Dengan adanya ascites sering masa tumor sulit di tentukan sebelum ascites
di kurangi, kecuali dengan pemeriksaaan ultrasonografi atau pemeriksaan
dengan CT scanner.
B. Pembahasan
1. Jenis kanker Ovarium
6| kankero v a r i u m

1. Tumor ovarium yang maligna


Pembagian tumor ini ada bermacam-macam. Ada 3 macam pembagian yang
sering, yaitu :
a. Berdasarkan terjadinya
Dapat bersifat primer dari ovarium, atau skunder dari organ-organ lain.
b. Berdasarkan konsistensi tumor
Klasifikasi ini lebih banyak penganutnya.
Kanker ovarium dibagi dalam 2 golongan, yakni :
1. Kanker ovarii yang solid
2. Carsinoma ovarii yang kistik
Jenis yang kedua lebih sering dijumpai.Perlu diketahui bahwa carsinoma yang
solid sering mengadakan degenerasi kistik. Menurut mayer, perbandingan yang kistik
dan yang solid 205 dan 139. Bersifat bilateral 50,9%. Kesimpulan lainnya yang
dibuat Meyer ialah bahwa 14,9% dari tumor neoplastik adalah maligna. Frekwensi
carsinoma ovarii sukar ditemukan, tetapi menurut randal, pada wanita usia 40 tahun,
kemungkinan untuk mendapatkan carsinoma ovarii kurang lebih 0,9%. Angka ini
naik sampai 4% pada umur 70 tahun, untuk kemudian turun lagi
c. Berdasarkan penyebaran klinik
Yang mengusulkan pembagian ini adalah Helsel. Dia membaginya
sebagai berikut :
a. Gr. I: Carsinoma terbatas pada satu ovarium.
7| kankero v a r i u m

b. Gr. 2

: carsinoma telah mengenai kedua ovarium,

Atau bila telah disertai penyebaran secara lokal yang masih dapat
diangkat.
c. Gr.III

: Carsinoma dengan penyebaran lokal yang sudah tidak

dapat diangkat lagi, atau tumor pecah pada waktu oprasi.


d. Gr.IV

: carsinoma yang sudah lanjut = forzen pelvic, yang

disertai metastase ketempat-tempat yang jauh.


e. Pembagian menurut F.I.G.O adalah sebagai berikut ;
Stage I
Stage II

: terbatas pada ovarium


: pertumbuhan mengenai 1 atau 2 ovarium dengan

Stage III

penyebaran dalam pelvis


: pertumbuhan mengenai 1 atau 2 ovarium dengan
metastase kedalam rongga perut seperti omentum, usus

Stage IV

dan mesentrium.
: Pertumbuhan mengenai 1 atau 2 ovarium dengan
metastase jauh ke luar rongga perut.

1) Carsinoma ovarii primer yang solid


a) Adenocarsinoma
Jenis yang paling sering dijumpai, dikenal karena gambaran
kelenjarnya. Seperti juga pada carsinoma epidermoid disinipun tampak
8| kankero v a r i u m

bermacam-macam diferensiasi. Kadang-kadang tampak gambaran yang


menyerupai adenocarsinoma endometriil. Sampson mengadakan bahwa
sebagian dari tumor ini berasal dari jaringan endometrium di ovarium.
Umumnya

adenocarcinoma

yag

berasal

dari

kista

endometrial

mempunyai gambaran adenocarcinoma.


Adenocarcinoma bisa bersifat papilliferum atau non palliferum.
b) Carcinoma
Juga sering terjadi. Disini tampak gambaran kelenjar. Biasanya
berjenis palliferum, medullair, olveolair atau scirrhus.
(1) Makroskopis
Ukuran dari tumor ini berlain-lain walaupun pada umumnya
dapat mencapai ukuran yang cukup besar, sehingga dapat memberikan
keluhan. Pada gambaran penampang, tampak permukaan yang berbintikbintik, keabu-abuan, tetapi sering juga menyerupai jaringan otak, disertai
ruangan-ruangan yang terbentuk oleh adanya nekrose. Pada jenis scirrhus,
konsitensi dapat keras dan fibrotik.
Pada permulaannya tumor ini bersifat unilateral, tetapi dalam keaadaan yang lebih
lanjut , biasanya menjadi bilateral.
c) Mesonephroma dari ovarium
Pada tahun 1939, Schiller, melaoprkan adanya jenis tumor dari
ovarium, yang berasal dari ductus mesonephros. Tumor ini berbentuk
9| kankero v a r i u m

tubulus, dan lumen-lumennya dilapisi epitel kubis yang pendek dengan


kadang-kadang disertai penonjolan intraluminasi. Gambaran ini disebut
Schillers mesonephroma.
Kemudian Saphir dan Lackner melaporkan kasus-kasus clear cell
adenocarcinoma dari ovarium yang identik dengan tumor ginjal. Jenis
hypernephroma atau hypernephroid dari ovarium, dianggap berasal dari
mesonephron.
Nevak, woodruff dan navok, mengajukan 2 pandangan penting :
(1). Ada tumor-tumor yang menunjukan gambaran campuran dari gambaran
Schiller dan clear cell adenocarcinoma.
(2) Lesi semacam ini hanya ditemukan pada tempat-tempat dimana ada sisa
mesonephron, misalnya vagina, fornices dan ligamentum latum. Tumor
jenis mesonephron ini sangat ganas. Walaupun masih terbatas pada
ovarium, angaka kematian mencapai 50%, meskipun telah dilakukan
oprasi dan radiasi.
Bila tumor sudah ada di luar ovarium, praktis tidak dapat diobati lagi.
Kadang-kadang kita tidak bisa membedakan clear cell tumor yang berasal
dari ovarium dengan tumor adrenal.
2) Carcinoma kistik primer ovarium
Carcinom dari ovarium dapat terjadi sebagai tumor kistik, dapat pula
terjadi dari cystadenoma ovarii yang jinak.Tidak jarang carcinoma pada
sebagian dinding kista yang jinak, yang telah lama diketahui. Juga pada
carcinoma, sering masih ditemukan gambaran histologis yang jinak, pada

10| kankero v a r i u m

daerah yang cukup luas. Adenocarcinoma harus dianggap sebagai


prototype keganasan dari kedua jenis cytadenoma yang jinak.
Atas dasar tersebut diatas, dapat dibedakan 3 jenis carcinoma ovarii
primer yang kistik.
a) Cystadenocarcinoma mucinosum
Ini merupakan prototype keganasan dari cystadenoma muscinosum.
Hanya 5% dari jenis kista ini yang berubah menjadi gans. Perubahan ini
dapat mengenai sebagian dari kista, tetapi pada umumnya mengenai
seluruh jaringan ovarium.
(1) Mikroskopis
Tampak

gambaran

yang

khas

dari

adenocarcinoma,

dengan

kemungkinan bermacam-macam diferensiasi.


Sel-selnya masih tetap mempunyai sifat mucoid, sehingga kita sering
menemukan ruangan-ruangan keci yang berisi cairan gelatinosa.
b) Cystadenocarcinoma serosum
Ini merupakan jenis ganas dari cystadenoma serosum. Jenis ini lebih
sering terjadi, dan hampir selalu tampak gambaran papilliferum yang
khas.Perkembangan papila dapat ke luar atau ke dalam ruangan kista.
Pada gambaran histologis, tampak bermacam-macam bentuk transisi
anatra jenis papilliferum yang jinak dan ganas, dengan di sana-sini
tampak ruangan-ruangan kecil.
11| kankero v a r i u m

(1) Mikroskopis.
Pemeriksaan histologi sering menyukarkan, oleh karena kadangkadang sukar dibedakan dengan yang jinak.
Walaupun secara histologis tidak ditemukan tanda keganasan yang
khas, tetapi secara klinis sering bersifat ganas terutama dengan adanya
implantasi di peritoneum.
Oleh karena itu, sebaiknya jenis kista ini dianggap ganas dan
dilakukan tindakan radikal, dengan mengangkat adnexa dan uterus. Pada
sebagian jenis tumor ini dapat dilihat dengan jelas lapisan epitel yang
banyak, perbedaan bentuk dan ukuran dari sel-sel terutama intinya yang
hyperchromasi dan aktivitas mitosis yag jelas.
Invasi stroma oleh sel-sel epitel sering dilihat, gambarannya benarbenar bersifat papilliferum dan jaringan epitelnya kadang-kadang
menunjukan gambaran kelenjar dan kadang tidak.
c) Karsinoma skunder pada kista dermoid
Karsinoma ini jarang terjadi. Menurut Blackwell hanya 1 3 % dari
kista dermoid yang menjadi ganas,biasanya merupakan karsinoma
epidermoid, karena berasal dari unsur-unsur yang menyerupai kulit.
3) Karsinoma ovarium sekunder atau metastatik.
Segala jenis karsinoma dapat ditemukan di ovarium, sebagai akibat
metastase dari tumor induknya di tempat-tempat lain dari badan terutama
pada stadium lanjut. Jenis yang sering ditemukan ialah yang berhubungan
12| kankero v a r i u m

dengan karsinoma alat-alat pencernaan dan payudara. Gambaran


histologis alat pencernaan dan ovarium sama, biasanya adenokarsinoma.
Tumor ovarium yang metastasik biasanya bilateral dan solid.
a) Tumor Krukenberg.
Jenis ini biasanya terjadi bersamaan dengan karsinoma primer di
bagian lain, terutama diaat pencernaan. Yang paling sering dari pylorus,
tetapi juga dari rectum, colon, usus kecil, hepar atau kandung kencing.
Walaupun pada umumnya, tumor ini dianggap sebagai metastase tetapi
Woodruff dan Novak mengatakan bahwa 20% dari kasus-kasus ini
bersifat primer. Tidak semua karsinoma ovarium bersifat tumor
Krukenberg berasal dari tractus intestinalis. Teratoma, kista mucinosum
dan degenerasi mucoid dari tumor Brenner, dapat memberikan suasana
ovarium yang baik untuk perkembangan tumor Krukenberg. Keadaan
diatas telah dibuktikan misalnya, dengan autopsi dari wanita yang
meninggal oleh sebab-sebab lain atau pada mereka yang hidup lama tanpa
gangguan dari lat pencernaan. Cara-cara sel karsinoma masuk dalam
ovarium dari tumor induknya, misalnya pylorus , masih merupakan bahan
perbedaan.
Teori-teori yang diajukan bermacam-macam , misalnya:

13| kankero v a r i u m

(1) Seletah menembus dinding lambung, sel-sel tersebut bergerak kebawah,


ke ovarium melalui cairan peritoneum. Ovarium dengan adanya ovulasi
menjad tempat yang mudah diimplantasi.
(2) Transplantasi lympatik yang retrograd.
(3) Haematogen.
(a) Makroskopis
Tumor ini biasanya bilateral (50%). Konsistensinya solid solid dan biasanya
masih mempunyai bentuk ovarium yang asli, yaitu ovoid atau bentuk ginjal.
Permukaan rata, kadang kadang nokuler. Gambaran penampang bermacam-macam,
sering disertai daerah-daerah dengan konsisten yang gelatinosa.
(b) Mikroskopis.
Gambarannya jelas, dan diagnosa hanya dibuat atas dasar pemeriksaan
histologis. Sarang-sarang kecil atau acini dari sel-sel epitel, tersebar diseluruh stroma
yang fibromateus yang karakteristik ialah yang yang disebut signet cell. Dimana
pengumpulan mucoid dalam sitoplasma mendorong inti sel yang gepeng ke satu arah
dari satu sel. Kadang-kadang tampak hiperplasia dari stroma yang menyerupai
sarkoma dan adanya reaksi dari stroma (theca) yang dapat menyebabkan pendarahan.

14| kankero v a r i u m

2. Stadium Kanker Ovarium


Stadium I
Ia

: Pertumbuhan terbatas pada ovarium


: Pertumbuhan terbatas ovarium, tidak asites, tidak ada tumor pada
permukaan eksternal, kapsul utuh.

Ib

: Pertumbuhan terbatas pada dua ovarium, tidak asites, tidak ada tumor

Ic

pada permukaan eksternal, kapsul utuh.


: Tumor stadium Ia atau Ib, namun tumor terletak pada permukaan
salah satu atau kedua ovarium, kapsul mengalami rupture, terdapat
asites yang mengandung sel ganas, atau bilas peritoneum menunjukan
hasil positif

Stadium II

: Pertumbuhan terjadi pada salah satu atau kedua ovarium dengan


perluasan ke panggul.

IIa

: Perluasan atau metastasis ke uterus atau tuba.

IIb
IIc

: Perluasan ke jaringan panggul lain.


: Tumor stadium IIa atau IIb namun tumor terletak pada permukaan
salah satu atau kedua ovarium, kapsul mengalami rupture, terdapat
asites yang mengandung sel ganas, atau bilas peritoneum menunjukan
hasil positif.

Stadium III : Tumor terdapat pada salah satu atau kedua ovarium

15| kankero v a r i u m

IIIa : Tumor sangat terbatas pada panggul minor, nodus negative, tetapi
pemeriksaan histologist membenarkan adanya penyebaran mikrskopik
ke permukaan peritoneum abdomen.
IIIb : Tumor terdapat pada salah satu atau kedua ovarium, pemeriksaan
histologist menunjukan adanya implan pada permukaan peritoneum
abdomen, dengan diameter tidak lebih dari 2 cm, nodus negatif.
IIIc : Diameter implant abdomen lebih dari 2 cm atau nodus
retroperitoneum atau inguinal positif
Stadium

IV : Pertumbuhan terjadi pada salah satu atau kedua ovarium dengan

metastase ang jauh. Jika terdapat efusi pleura, hasil sitologi untuk stadium IV
dipastikan positif. Metastase ke parenkim hati terjadi pada stadium IV.
3. Penyebaran Kanker Ovarium
Penyebaran dapat terjadi secara langsung,secara impalantasi,atau melalui
pembuluh limf.kapsul tumor dapat ditembus atau tumor pecah secara spontan
sehingga sel tumor ganas akan merangsan peritoneum dan akan terjadi ascites dan
tentunya terjadi penyebaran ke cavum peritonei.
Penyebaran ke ovarium yang lain,pada jenis serosum ditemukan sebanyak 47% 71%, pada jenis mucinosum15%,pada jenis endometrioid 50%,sedangkan pada
dysgeminoma jarang dan lebih sering penyebaran ditemukan e kelenjar
retroperitoneal.

16| kankero v a r i u m

Pada tumor tumor ganas ovarium metastatic,penyebaran ke ovarium biasanya


terjadi melaluipembuluh darah pembuluh limf,atau secara langsung.biasanya tumor
tumor primer berada pada buah dada , saluran pencernaan, alat genital, atau pada
system retikulo endotial (RES).
4. Penanganan Kanker Ovarium
Penanganan pada bentuk bentuk jinak dan praganas seperti golongan histologik
B merupakan salah satu cara pencegahan terjadinya carcinoma ovarii.Pada tumor
ganas ovarium ,operasi merupakan cara utama pembatasan cacad.jenis operasi yang
dianjurkan sekarang ialah histerektomi total + salpingooofforektomi + reseksi
omentum +appendektomi.Sebelum operasi tumor ovarium ,persiapan yang baik
harus dilakukan.
Kemungkinan adanya keganasan selalu harus diingat dan segala tindakan yang
mungkin akan dilakukan perlu dibicarakan dengan penderita dan suaminya dan
orang tuanya.3 hari sebelum operasi ,kaca benda yang dilapisii albumin dipersiapkan
sebagai langkah pemeriksaan sitologik pada saat operasi.pada waktu operasi
,sesudah peritoneum terbuka sebelum tereksploralisasi dilakukan,bahan untuk
pemeriksaan sitologik diambil dari cavum douglasi,darah appendix dan daerah dekat
diafragma.Bahan tersebut diusapkan ke gelas benda yang susah dilapisi albumin dan
segera diawetkan dan kemudian di pulas dan diperiksa langsung dengan mikroskop
sewaktu operasi masih berlangsung.

17| kankero v a r i u m

Tumor ovarium harus dikeluarkan utuh kecuali bila tidak mungkin dan segera
diperiksa secara potong beku.jika ganas, dilakukan operasi seperti disebut di ats
tanpa mengindahka usia dan paritas penderita.jika tumor masuk golongan histologik
B

atau

tingkat

klinik

hanya

ia

dan

golongan

mucinosum,endometrioidmesonefroid,dysgerminoma

histologik

atau

ternyata

tumor

sel

granulose.tindakan konservatif (hanya mengeluarka satu ovarium yang telah


menjadi tumor) masih diijinkan dilakukan pada penderita yng msih muda dan sangat
mengingikan anak.Pembatasan cacad selanjutnya sesudah operasi ialah penyinaran
daerah panggul sebanak 5000-6000 R dank e daerah paraaortik sebanyak 3000
R.sebenarnya lebih dianjurkan pemberian sitostatika sesudah operasi misalnya
gabungan Cis-Pt + Cytosan,atau gabungan Cis-Pt + alkeran +leukeraan. Jika pada
laparotomi tumor ovarium ,pemeriksaan sediaan beku tidak dilakukan atau
dilakukan tetapi keganasaan tidak ditemukan , maka tindakan yang mungkin
dilakukan

hanya

salpingoooforektomi

unilateral

saja.jika

kemudian

hasil

histopatologik ternyata ganas walaupun terbatas ,maka relaparotomi harus dilkukan


untuk mengeluarkan uterus ,tuba,dan ovarium yang tertinggal asalkan tumor
dikeluarkan utuh dan jenis histologiknya serosum.jika kapsul tumor tidak utuh
lagi,atau usia sudah tua walaupun jenisnya bukan serosum ,relaparotomi harus
dilakukan juga tetapi jika ditolak oleh penderita atau telah terjadi perlekatan hebat di
rongga panggul,maka harus dipikirkan penanganan lanjut dengan penyinaran yang
tinggi di cavum douglasi ,pemasangan radium intrauterus ,dengan penyinaran luar
18| kankero v a r i u m

mungkin diberikan. Beberapa kali penulis melihat hasil yag sangat menyedihkan
dengan cara demikian walaupun tingkat klinik msih ia. Oleh karna itu tindakan
relaparotomi harus ditekan kan jangan sampai di tolak oleh penderita .sesudah
relapraotomi ,kemoterapi dilakukan seperti biasa.Sering pada saat laparotomi tidak
dapat dilakukan pengangkatan tumor sedikitpun kecuali biopsy saja.biopsi berguna
untuk menentuan jenis histopatologik dan mungkin pula untk tes resistensi terhadap
sitostatika.dalam

hal

demikian

pemberian

sitostatika

atau

gabungan

sitostatikadengan penyinaran diberikan sampai terjdi mobilitas tumor dan


uterus,kemudian dilakukan relaparotomi untk mengelurkan massa tumor sebanyak
mungkin mengeluarkan uterus , adnexa,omentum,appendix.Gabungan MMC + E
pada penderita carcinoma ovarii tingkat klinik III ternyata dapat menyebabkan
regresi ,namun banyak penyulit terjadi dan akhirnya penderita akan meninggal
sebelum 3 tahun kecuali kasus yang masih hidup sampai sekarang.
Mengingat :
1.penyinaran sesudah tindakan operasi pada carcinoma ovarii tingkat klinik III tidak
bermanfaat.
2.harga sitostatika mahal dan pemberiannya tidak luput dari penyulit penyulit yang
harus di tangani dengan tambahan biaya.
3.carcinoma ovarii tngkat klinik III akan meninggal dalam 3 bulan sampai 3 tahun
dengan atau tanpa pemberian sitostatika.

19| kankero v a r i u m

Maka penulis beranggapan ,kasus kasus carcinoma ovarii tingkat III cukup
ditangani dengan obat-obatan simptomatik saja agar keluarga yang ditinggalkan tidak
menghambur hamburkan harta mereka secara percuma.
5. Prognosis Kanker Ovarium
Prognosis tumor ini masih buruk karna sering terlambat didiagnosis.dengan
terlambatnya diagnosis dibuat,tingkatan klinik sudah lanjut.Oleh karna itu usaha
usaha kearah membuat diagnosis dini tumor ini sasngt perlu .perlu diketahui bahwa
pada tingkatan klinik ia ternyata pada cavum peritonei sel sel tumor sudah terdapat
sebanyak 20%. Untuk tingkat klinik ia McGarrty melaporkan hasil 5 tahun sebanyak
67%sedangkan tingkat Ib30,8%.ni tentunya tidak jauh berbeda dengan hasil
kottmeier 65,5%dan 36,4%.ascites akan memperburuk prognosis karena kesulitan
pemberian penyinaran luar dan adanya penyebaran di cavum peritonei;
berbeda dengan di atas kottmeier melaporkan bahwa ascites tidak memperburuk
prognosis dari segi kasus kasus yang dilporkannya.Tindakan konservatif walaupun
masih tingkat klinik ia tidak menguntungkan sehingga tindakan demikian hanya
dilakukan eksepsional saja.Pada tindakan operasi,tumor harus dikeluarkan utuh
karena pecahnya tumor akan mempengaruhi prognosis seperti terlihat dari laporan
McGrarity bahwa tumor yang pecah dan yang utuh dikeluarkan memberi hasil 5
tahun yang berbeda nyata (30%dan 77%)
Selanjutnya dilaporkan bahwa hasil 5 tahun pada tingkat klinik IIa ialah 22,2%
dan pada tingkat IIb sebanyak 14,8%.Muller melakukan operasi yang diteruskan
20| kankero v a r i u m

dengan penyinaran luar 3000 RAD dengan pesawat Ro 250 400 KV dan
pemberian koloid Au 198 ke cavum peritonei mendapatkan hasil 5 tahun sebanyak
64% pada tingkat kilnik Ia ,b dan IIa.Pada tingkat III dan IV umumnya didapatkan
hasil yang buruk yaitu 11,1%dan 4,1% oleh McGarrity ; oleh Kottmeir 7,3% dan
7,7% bukan untuk hasil 5 tahun tetapi 3 bulan.
Berdasarkan hasil histopatologik , hasil 5 tahun sangat buruk pada jenis
serosium[Ic].Di bawah ini di cantum kan hasil 5 tahun menurut laporan
kottmeir:serosum 14,8%mucinosum 62,7%,endometrioid 55,4% dan unclassified
21,6%.Pronosis mungkin pula dipengaruhi oleh ada tidak nya sel tumor ganas di
temukan di peredaran darah , walaupun belum dapat dibuktikan secara
statistic.Dalam usaha memperbaiki prognosis carcinoma ovarii, filosofi penanganan
tumor ganas ginokologik harus didasari benar benar .
Pengamatan lanjut harus ketat dilakukan dalam tahun tahun pertama sesudah
penanganan karena umumnya residif terjadi dalam waktu tersebut walaupun tidak
jarang ditemukan lama kemudian.
6. Skrining dan Deteksi Kanker Ovarium
Umumnya kanker ovarium tidak menimbulkan gejala sehingga sulit untk
menegakkan diagnosis secara dini.Lebih dari dua pertiga wanita mengalami
metastase penyakit(stadium II IV) pada saat diagnosis awal.Wanita dengan
penyakit stadium I (terbatas pada ovarium)memiliki tingkat kelangsungan hidup 5
tahun sebanyak 73% , sedangka wanita yang berada pada stadium IV memiliki
21| kankero v a r i u m

tingkat kelangsungan hidup 5 tahun (kotak 10-8) sebanyak 5%. Insidensi tumor
derajat rendah pada wanita yang berusia kurang dari 30 tahun cenderung lebih
tinggi.Hal ini memperkuat fase kanker ovarium praklinis hingga kini tidak ada tes
skrining.Namun hingga kini tidak ada tes skrining yang akurat dan sesuai.USG
abdomen merupakan tes yang sensitive untuk mendeteksi perubahan morfologi yang
mengindikasikan kanker, tapi tingkat positif palsunya masih tinggi.USG vagina
memberikan gambaran vagina yang lebih baik ,tetapi sering kali tidak
memperlihatkan massa besar yang meluas sampai ke atas pelvis minor.CA 125,
sebuah penanda tumor yang menggunakan antibody monoclonal, ditemukan dalam
serum lebih 80% wanita yang menderita kanker ovarium epitel nonmusin. Hanya
23% wanita dengan kanker ovarium stadium I mengalami penngkatan CA 125, dan
nilai tersebut meningkat saat terjadi menstruasi, endometriosis, leiomima, penyakit
radang panggul, hepatitis, dan proses peradangan lain.CA 125 tidak cukup sensitive
atau spesifik untuk digunakan dalam skrining, tetapi saat kadarnya melebihi 65
U/mL dan ditambah adanya massa pada panggul, zat tersebut memiliki tingkat
prediksi yang tinggi dalam mendeteksi penyakit keganasan. Karena kanker ovarium
bersifat heterogen, sangat sulit untuk menemukan penanda tumor yang umum.
Penanda tambahan selain CA 125, seperti CA 54/61, NB/70K, dan fragmen
gonadotropin urine dapat meningkatkan laju deteksi ( Coates, 1993; Plaxe et al.,
1993).Kanker ovarium yang paling sering ditemukan adalah kistadenokarsinoma dan
adenokarsinoma, yang dapat berbentuk padat atau kistik. Metastase ovarium dari
22| kankero v a r i u m

kanker primer lain dapat terjadi. Pada stadium awal, pemeriksaan kanker ovarium
mungkin tidak terasa berbeda dari kista jinak atau massa padat di ovarium.
Selanjutnya, kanker menjadi kaku, berat, dank eras serta memiliki batas yang tidak
jelas. Tumor ganas sering kali tidak menyebabkan nyeri tekan dan hanya
menimbulkan sedikit gejala selain perasaan penuh atau sakit tidak jelas pada
panggul. Tumor abdomen, tetapi ini sering kali dianggap sebagai pertambahan berat
badan di usia paruh baya. Gejala kambung, anoreksia, intoleransi terhadap makanan.
Perdarahan vagina dapat terjadi. Tanda akhir kanker adalah nyeri panggul, kakeksia,
dan anemia.
7. Diagnosis dan Terapi Medis Kanker Ovarium
Penetapan diagnosis medis didasarkan pada karakteristik tumor dan hasil
pemeriksaan diagnostic.
Pengangkatan tumor secara bedah melalui pemeriksaan patologis memunculkan
sejumlah diagnosis dan menetapkan stadium kanker ovarium yang dibuat
berdasarkan sistem internasional. Pemeriksaan cairan vagina, pleura, atau cairan
peritoneum, pemindaian paru dan tulang, tes darah, dan pemeriksaanradiografi dada,
ginjal, dan system gastrointestinal melengkapi hasil pemeriksaan diagnostic dan
mengarahkan pemilihan terapi.Kanker ovarium ditangani sesuai dengan stadium
penyakit.
Pengangkatan tumor dilakukan sebanyak mungkin melalui prosedur bedah.
Pengangkatan ini dapat berkisar dari pengangkatan sederhana sau ovarium sampai
23| kankero v a r i u m

histerektomi radikal dan salpingoooforektomi bilateral. Biopsi atau pengangkatan


nodus dan pemotongan implant jaringan ganas dari organ abdomen dan omenfem
adalah bagian dari prosedur pengurangan massa ( debulking procedure). Radiasi
jarang digunakan karena tidak seefektif kemoterapi. Kemoterapi digunakan pada
sebagian besar kanker ovarium, Karena banyak penyakit termasuk ke dalam stadium
II sampai IV.Obat yang digunakan, sering kali dalam bentuk kombinasi, adalah
sebagai berikut :
Sisplatin ( Platinol )
Karboplatin ( Paraplatin )
Siklofosfamid ( Cytotoxan )
Sisplatin dan doksorubisin ( Adriamycin).

24| kankero v a r i u m

BAB III
ASUHAN KEPERAWATAN KANKER OVARIUM

A. Pengkajian
1.

Identitas klien
Meliputi nama, umur, jenis kelamin, pendidikan, pekerjaan, agama dan
alamat, serta data penanggung jawab

2.

Keluhan klien saat masuk rumah sakit


Biasanya klien merasa nyeri pada daerah perut

3.

Riwayat Kesehatan
a.

Riwayat kesehatan sekarang


Keluhan yang dirasakan klien adalah nyeri pada daerah abdomen, ada

nyeri tekan pada payudara, dan haid tidak teratur.


b.
Riwayat kesehatan dahulu
Klien mengatakan mengalami menopouse dini. Klien juga mengalami
kanker payudara.
c.
Riwayat kesehatan keluarga
Keluarga klien ada yang mengidap kanker ovarium.
d. Riwayat menstruasi
Klien mengalami menopouse dini. Ketika dahulu, haidnya tidak
teratur. Darah menstrual juga banyak ( menoragia)

25| kankero v a r i u m

4.

Pola Fungsi
a. Aktivitas dan istirahat

Gejala :
1) Kelemahan atau keletihan akibat anemia.
2) Perubahan pada pola istirahat dan kebiasaan tidur pada malam hari
3) Adanya faktor-faktor yang mempengaruhi tidur seperti nyeri, ansietas, dan
keringatan malam.
4) Pekerjaan atau profesi dengan penajaman karsinogen lingkungan dan tingkat
stres tinggi.
b. Integritas ego
Gejala :
Faktor stres, merokok, minum alkohol, menunda pencarian pengobatan,
keyakinan religius atau spiritual
c. Eliminasi
Pengkajian eliminasi yang dapat dilakukan oleh perawat adalah sebagai
berikut .
Pada kanker ovarium didapat tanda haid tidak teratur , sering berkemih,
menoupouse dini dan meoragia.
d. Makan dan minum
Gejala :
Pada kanker ovarium : dispnea , rasa tidak nyaman pada abdomen, lingkar
abdomen yang terus meningkat, merasa cepat kenyang.
e. Nyeri atau Kenyamanan
Gejala : adanya nyeri derajat bervariasi, nyeri tekan pada payudara.
f. Pernafasan
Gejala : merokok.
g. Seksualitas
Gejala:
Perubahan pola respon seksual, keputihan (jumlah karakteristik, bau).
h. Interaksi sosial
Gejala :
Ketidaknyamanan atau kelemahan sistem pendukung dan masalah tentang
fungsi atau tanggung jawab peran.
26| kankero v a r i u m

5.

Pemeriksaan Fisik
Dilakukan mulai dari kepala sampai ekstremitas bawah secara

sistematis.
a.
Kepala
1)
Hygiene rambut
2)
Keadaan rambut
b.
Mata
1) Sklera
: ikterik/tidak
2)
Konjungtiva
: anemis/tidak
3)
Mata
: simetris/tidak
c.
Leher
1)
pembengkakan kelenjer tyroid
2)
Tekanan vena jugolaris.
d.
Dada
Pernapasan
1)
Jenis pernapasan
2)
Bunyi napas
3)
Penarikan sela iga
e.
Payudara
1) Adanya nyeri tekan pada payudara
f. Abdomen
1)
Nyeri tekan pada abdomen.
2)
Teraba massa pada abdomen.
g.
Eliminasi, urinasi
1) Sering BAK
6. Data Sosial Ekonomi
Kanker ovarium dapat terjadi pada semua golongan masyarakat dan
berbagai tingkat umur.
7. Data Spritual
Klien

menjalankan

kegiatan

keagamaannya

sesuai

dengan

kepercayaannya
8. Pemeriksaan Penunjang
27| kankero v a r i u m

Data laboratorium
B. DIAGNOSA KEPERAWATAN
kalau dilihat dari tanda gejala dan hasil pemfis ada masalah lain yg
mungkinmuncul coba dilihat lagi
1.Nyeri akut berhubungan dengan agen injury fisik yang ditandai dengan :
Do: - Kien tampak meringis
-Skala nyeri 4( Rentang 1-5)
Ds : - Klien mengatakan nyeri pada daerah perut
-Klien mengatakan tidak dapat tidur
- Klien mengatakan nyeri tekan pada bagian payudara
2. Ansietas berhubungan dengan perubahan fungsi peran ditandai dengan
Do : - Klien tampak gelisah
- Klien tampak cemas
- Klien tampak berkeringat berlebihan
Ds: -Klien mengatakan kurang tidur
- Klien mengatakan adanyadorongan sering berkemih
-Klien mengatakan nyeri pada abdomen
-Klien mengtakan gelisah dan khawatir dengan keadaannya.

C. Rencana Asuhan Keperawatan


1. Diagnosa Nyeri akut berhubungan dengan agens injury fisik
28| kankero v a r i u m

Perencanaan
1. NOC (Tujuan)
Setelah dilakukan tindakan keperawatan selama 2 X 24 jam Nyeri akut klien
berkurang , ditadai dengan :
Pain Level,
1. Klien mampu mengontrol nyeri
2. Klien melaporkan bahwa nyeri berkurang menjadi skala 2 dengan
menggunakan manajemen nyeri
3. Klien mampu mengenali nyeri (skala, intensitas, frekuensi dan tanda
nyeri)
4. Klien menyatakan rasa nyaman setelah nyeri berkurang
2. NIC ( Intervensi)
A. Pain Manajemen
1. Selidiki isyarat nonverbal nyeri
2. Ajarkan menggunakan teknik nofarmakologi
3. Berikanobatanalgetikuntukmenguranginyeri

2. Diagnosa Ansietas berhubungan dengan diagnosis


Perencanaan
1. NOC (Tujuan)
Setelah dilakukan tindakan keperawatan selama 2 X 24 jam ansietas klien
dapat berkurang dengan kriteria :
29| kankero v a r i u m

Anxiety control
-

Kegelisahan klien menurun (4-3)


Gangguan tidur klien menurun (3-2)
Klien dapat mengontrol respon ansietas (4-3)

2. NIC ( Intervensi)
A. Anxiety Reduction
1.

Temani pasien untuk memberikan keamanan dan mengurangi takut

2.

Identifikasi tingkat kecemasan

3. Dorong pasien untuk mengungkapkan perasaan, ketakutan, persepsi

D. Implementasi dan Evaluasi


1

Diagnosa Nyeri akut berhubungan dengan agens injury fisik.


a) Implementasi
1. Menyelidiki isyarat nonverbal klien misalnya meringis
Hasil : klien terlihat meringis ketika mengatakan sakit pada daerah abdomen.
Jam, tanggal: hari,bulan, tahun
Pelaksana (ttd nama JelasPerawat)
30| kankero v a r i u m

Mengajarkantekniknafasdalam

Hasil :Klienbersediamempraktekkannafasdalam
Jam, tanggal: hari,bulan, tahun
Pelaksana (ttd nama JelasPerawat)
3

Memberikananalgetik
Hasil :Klienbersediamenerimaobat yang dianjurkan.
Jam, tanggal: hari,bulan, tahun

Pelaksana (ttd nama JelasPerawat)


b) Evaluasi
S :- klien mengatakan nyeri ketika tidak dapat mengatasi rasa sakit klien berusaha
menahan dengan cara berdoa
-

klien telah melakukan nafas dalam klien mengatakan nyeri berkurang


dari 4-3

klien mengatakan bersedia untuk melakukan latihan teknik nafas dalam agar
dapat mempraktekannya sendiri

O:

A:
P:

klien tampakmeringis ketika mengatakan nyeritekanpada daerah abdomen

klien mempraktekkan teknik nafas dalam


Masalah teratasi sebagian
Lanjutkan teknik relaksasi nafas dalamdanpemberiananalgetik

31| kankero v a r i u m

2.Diagnosa Ansietas berhubungan dengan diagnosis


a) Implementasi
-

Menemaniklienuntukmemberikankeamanandanmengurangi rasa takut


RK : Klien tampaklebihnyamanketikaditemani
Jam, tanggal: hari,bulan, tahun

Pelaksana (ttd nama JelasPerawat)


Mengidentifikasitingkatkecemasanklien
Hasil : Klien mengatakan cemasnyaskala 4 ( rentang 1-5)
Jam, tanggal: hari,bulan, tahun
Pelaksana (ttd nama JelasPerawat)

Mendorong pasien untuk mengungkapkan perasaan, ketakutan, persepsi


Hasil : Klien mengungkapkan rasa cemasnya karena didiagnosa kanker
ovarium
Jam, tanggal: hari,bulan, tahun
Pelaksana (ttd nama JelasPerawat)

b) Evaluasi

32| kankero v a r i u m

S:-

Klien mengatakan khawatir dengan keadaannya saat ini dan menginginkan

kesembuhannya.
- Klien mengatakan tingkat ansietas berkurang
ketikaperawatmenemaninyaberbicara dari level 4-3, dan meningkat ketika
O:-

klien merasa kesepian dari level 3-4.


Klienmasihtampakcemasketikaditinggalsendirian.
Klientampaklebihtenangketikaadaperawatdisampingnya.

A:

Masalah teratasi sebagian

P:

Lanjutkan temaniklienuntukmemberikan rasa aman.

BAB IV
KESIMPULAN DAN SARAN
A. Kesimpulan
Kanker ovarium adalah penyakit yang membuat frustasi bagi pasien
dan pemberi kesehatan karena tidak ada gejala peringatan yang menjadi
penyebab mengapa penyakit ini telah mencapai tahap lanjut ketika
didiagnosa.Wanita dengan kanker ovarium mempunyai resiko mengidap
33| kankero v a r i u m

kanker payudara tiga sampai empat kali lipat. Belum ada skrinning dini
yang tersedia untuk saat ini, meskipun penanda tumor sedang dalam
penelitian. Sonogram transvaginal dan pengujian antigen Ca-125 sangat
membantu pada mereka yang beresiko tinggi untuk mengalami kondisi ini.
B. Saran
Untuk para wanita sebaiknya menjauhi faktor-faktor resiko yang dapat
menyebabkan kanker ovarium. Diantaranya hindari diet tinggi lemak,
merokok dan

konsumsi alkohol. Apabila terdapat riwayat kanker

payudara atau memiliki keluarga yang mengidap kanker ovarium


sebaiknya segera periksakan ke rumah sakit terdekat.

34| kankero v a r i u m