Anda di halaman 1dari 103

Sabtu, 08 Desember 2012

Askep Ca Mammae
LaporanPendahuluan
ALatarBelakang
PerkembanganKankertelahdikenalolehparapemikirsebelumnyadimanaHipokrates
memberi nama kanker berasal dari bahasa latin yaitu cancri atau kepitingkarena
penyebarannyakesemuaarahsepertikakikepitingdanpadafaselanjutmemberikanriwayat
tidakdapatdisembuhkan.Terminologisecaraumumdipakaisekarangadalahtumormalignaatau
neoplasmadimananeoplasmasendiriberasaldaribahasayunaniyangberartipertumbuhanbaru
ataupembentukanbaru.Selnormaldalamprosespembelahanseldanmembagidiridalamproses
yangteraturdengantujuanyangkhasdariperkembanganseluntukmenggantiselyangrusak
ataucederasedangkankalauselitumembentukjaringanbarudisebuttumoratauneoplasma.
(long,1996)
Neoplasma pada masa abnormal terdiri dari selsel yang mengalami proliferasi (proses
bertambah banyak) bersifat otonom dan tak terkoordinasi, tidak adaptif meskipun rangsang
dihilangkanterustumbuhsertadibedakanatasjinak(benigna)yangseringdisebutdengantumor
dan ganas (maligna) yang sering disebut kanker. Sifat neoplasma jinak (tumor) peristiwa
lokal/setempat,proliferasibersifatkohesif,pertumbuhanbersifatsebtrifugaldenganbatasnyata,
bergerakkeluar,menyebabkandesakanjaringansekitar,tidakmenyebarjauh,lajupertumbuhan
lambatdanukurantetapstabilselamaberbulanbulan/bertahuntahunsedangkansifatneoplasma
ganas(Kanker)bertumbuhlebihcepat,progresif,tidakkohesif,penyebarantidakteratur,tidak
berkapsul,sukardipisahkandenganjaringansekitardanmenyerbukedaerahsekitar(infiltrasi),
mencarijalansecaradestruktifdimanaselneoplasmamelepaskandiridaritumorprimermenuju
sirkulasimengakibatkanemboliselsehinggatersangkut,keluarpembuluhdarahberproliferasi
menjaditumorsekunderbersifatmetastasisataupengalihanpenyakitdaribagian/alattubuhsatu
kealatataubagiantubuhlainnyayangtidaksalingberhubunganyangbiasanyabersifatlebih
ganasdimanaproduksiselselyangtidaknormaldantidakmengikutijaringanyangnormal.
Salahsatuneoplasmaganasyangseringterjadipadabeberapakasusadalahcarcinomamammae
danjaringansekitarnya
Sehinggaperanperawatdalammemberiasuhankeperwatankepadapasiensangatbesardan
sangat berpengaruh dimana perawat harus memiliki pengetahuan untuk pencegahan,
pengawasan,danpengobatankhususnyamengenaicarcinomamammaeataukankermammae
yangmeliputi:
BTujuanAskepCaMammae
TujuanUmum
1.Menurunkanangkakematiankankerpayudara
2.Meningkatkankulalitashiduppenderitakankerpayudara

3.Mengurangipermasalahanpsikososialpenderitakankerpayudara.
TujuanKhusus
1.Mempersiapkanmentalpenderitapreoperatif
2.Mengurangiperasaannyeripredanpostoperatif
3.Mengurangibaubusukulkusyangtidakmengenakan
4.Melatihpergerakkansendibahusupayatidakmengalamikontraktur
5.Menghindaripembengkakanlengan
6.Mencegahinfeksilukaoperasi
C.KonsepDasarCarsinomaMammae
Pengertian
CarsinomaMammaeadalahpertumbuhandanpembelahanselkhususnyaselpada
jaringanmammaeyangtidaknormal/abnormalyangterbatasyangbertumbuhperlahankarena
suplailimpatikyangjarangketempatsekitarjaringanmamaeyangbanyakmengandungbanyak
pembuluhlimfedanmeluasdengancepatdansegerabermetastase.
Penyakit kanker payudara/mammae adalah penyakit keganasan yang berasal dari struktur
parenchimpayudara.Palingbanyakberasaldariefitelduktuslaktiferus(70%),efitellobulus
(10%) sisanya sebagian kecil mengenai jaringan otot dan kulit payudara, kanker
payudara/mammaetumbuhlokalditempatsemula,laluselangbeberapawaktumenyebarmelalui
saluranlimfe(penyebaransisitemik)keorganvitallainsepertiparuparu,tulang,hati,otakdan
kulit.
Etiologi
Karsinoma mammae secara pasti tidak diketahui penyebabnya tapi pencetus yang sering
disebabkan olah estorogen yang lebih dikenal sebagai estorogen dependent mengandung
eseptoryang mengikat estradiol, suatu tife esterogen yang pertumbuhnya diangsang oleh
esterogen,karenareseptorinitidakmunculpadajaringanpayudarayangnormal
TandadanGejala
Tandadangejalapalingdiniadalahberupatumbuhnyabenjolanpadadaerahmamae,
KlasifikasiTNMKankerPayudara/mammae
Tahapan ukuran tumor
I kurang dari 2 cm
II Kurang dari 5 cm (T1 dan
T2)
III lebih dari 5 cm dengan
invai kulit atau melebar pada
dinding dada
IV setiap ukuran

Prognosa

Keterlibatan nodul
Tidak aa NO
Axillary nodes dapat
berpindah (N1)
Axillary nodes tetap atu dpat
berpindah (N dan N2)
Setiap nodes

Metatasis
Tidak ada (MO)
Tidak ada (MO)
Tidak ada (MO)
Ya (M1)

Prognosakankerpayudaradlamhalpencapaiansurvivalyangtinggidanperbaikankualitasidup
dipengaruhiolehbanyakfaktor.Faktorprognostikprimerantaralain:
1. Statuskelenjargetahening(lympanodestatus):jum;ahkelenjargetahbeninginvasi
kapsul
2. Diametertumor(tumorsize):diametrtumormempunyaikorelasidengan
penyebarannyakelenjargetahbening
3. Hormonreseptor(HR)status:esterogenreseptor(ER),progesteronreseptor(PR)
4. Histopathologystatus:nuclearrade,histologicgrade
5. Sphase:indeksprofilasisell
6. DNAploidy:ondeksdiploiddanundiploidcell
7. HER2/newreseptor(CerB2reseptor
8. P53
9. Epiermalgrowthfaktorreseptor(EGFR)
10. CathepsinD
11. Angiognesis
12. Umur
13. Staadiumpanyakit
Patologi

Ket:
oApoptosis:programseldimatikankalauabnormal
oProtoencogen:mengaturprosespertumbuhan
oTumorsupresorgen:yangmengaturpertumbuhan
oBCL2&MDM2:meregulasiproteinyangdihasilkanolehgen
suppresor
oNER:Nucleotineeksesionrefair:genperbaikkan
oP53:proteinyangmengaturexpresiP21
oP21:proteinyangmenekanCDK4,6
oCDK:Cyclindependentproteinkinase:yangberperandalam
pembelahansel
Patofisiologi
Kanker mammae merupakan penyebab utama kematian pada wanita karena kanker (Maternity
Nursing, 1997: 254). Penyebab pasti belum diketahui, namun ada beberapa teori yang
menjelaskanbagaimanaterjadinyakeganasanpadamammae,yaitu:
Mekanismehormonal,dimanaperubahankeseimbanganhormoneestrogendanprogesteroneyang
dihasilkan oleh ovarium mempengaruhi factor pertumbuhan sel mammae (Smeltzer & Bare,
2002:1589).Dimanasalahsatufungsiestrogenadalahmerangasangpertumbuhanselmammae.
Suatupenelitianmenyatakanbahwawanitayangdiangkatovariumnyapadausiamudalebih
jarang ditemukan menderita karcinoma mammae, tetapi hal itu tidak membuktikan bahwa
hormoneestrogenlahyang,menyebabkankankermammaepadamanusia.Namunmenarchedini

dan menopause lambat ternyata disertai peninmgkatan resiko Kanker mammae dan resiko
kankermammaelebihtinggipadawanitayangmelahirkananakpertamapadausialebihdari30
tahun.
Virus,Invasivirusyangdidugaadapadaairsusuibumenyebabkanadanyamassaabnormalpada
selyangsedangmengalamiproliferasi.
Genetik
Kanker mammae yang bersifat herediter dapat terjadi karena adanya linkage genetic
autosomal

dominan.
Penelitian tentang biomolekuler kanker menyatakan delesi kromosom 17 mempunyai
peranan

penting

untuk

terjadinya

transformasi

malignan.
mutasigenBRCA1danBRCA2biasanyaditemukanpadakliendenganriwayatkeluarga
kankermammaedanovarium(Robbin&kumar,1995)sertamutasigensupresortumorp53
(Murray,2002).
Defisiensi

imun
Defesiensi imun terutama limfosit T menyebabkan penurunan produksi interferon yang
berfungsiuntukmenghambatterjadinyaproliferasiseldanjaringankankerdanmeningkatkan
aktivitas

antitumor

.
Gangguanproliferasitersebutakanmenyebabkantimbulnyaselkankerpadajaringaepithelial
danpalingseringpadasystemduktal.Mulamulaterjadihyperplasiaseldenganperkembangan
selatipikal.Seliniakanberlanjutmenjadikarsinomainshtudanmenginvasistroma.Kanker
butuhwaktu7tahununtukdapattumbuhdarisebuahseltunggalmenjadimassayangcukup
besaruntukbiasdiraba.Invasiselkankeryangmengenaijaringanyangpekaterhadapsensasi
nyeriakanmenimbulkanrasanyeri,sepertiperiosteumdanpelksussaraf.Benjolanyangtumbuh
dapat pecah dan terjadi ulserasi pada kanker lanjut.
Pertumbuhanselterjadiirregulardanbisamenyebarmelaluisaluranlimfedanmelaluialiran
darah.Darisaluranlimfeakansampaidi kelenjerlimfemenyebabkanterjadinyapembesaran
kelenjer limfe regional. Disamping itu juga bisa menyebabkan edema limfatik dan kulit
bercawak (peau d orange). Penyebaran yang terjadi secara hematogen akan menyebabkan
timbulnya metastasis pada jaringan paru, pleura, otak tulang (terutama tulang tengkorak,
vertebredan

panggul)
Padatahapterminallanjutpenderitaumumnyamenderitakehilanganprogersiflemaktubuhdan
badannyamenjadikurusdisertaikelemahanyangsangat,anoreksiadananemia.Simdromyang
melemahkaninidinyatakansebagaikakeksikanker.
D.PenatalaksanaanCaMammae/kankerpayudara
1.Pembedahan
Terapibedahbertujuankuratifdanpaliatif
Jenisterapi:lokal/lokoregional
Jenisterapi:terapiutama/terapitambahan
Prinsifterapikuratifbedah
Pengangkatanselkankersecarakuratifdapatdilakukandengancara:
Modifiedradikalmastektomi
Breastconversingtreatment(BCT)rekontruksipayudara

Tumorrektomi/lumpektomi/kuadrantektomi/parsialmastektomidiseksiaxsila
Pengobatan bedah kuratif dilakukan pada kanker payudara dini (stadium 0, I, dan II), dan
pegobatanpaliatifbedahadalahdenganmengangkatkankerpayudarasecaramakroskopisdan
masihmeninggalkanselkankersecaramikroskopisdanbiasanyadilakukanpadastadiumIIdan
IV dan juga untk mengurangi keluhankeluhan penderita baik perdarahan, patah tulang dan
pengobatanulkus
Tifetifepembedahanuntukmembuangcamammae
Lympectomi:
Pembuangansederhanabenjolantumor
Mastektomiparsial:
pembuangantumordan2,57,5cm(1sampai3inci)jaringansekitarnyaubcutaneoous
Mastektomy:
pembuangan seluruh jaringan yang mendasari tumor payudara , meninggalkan /membiarkan
kulit,areoladanmemasukkanputtingintact)
mastectomysederhana:
menghilangkanseluruhpayudaratapitidakdengannodusaxillary
modifikasimastektomyradikal:
menghilangkanseluruhpayudara(denganatautanpapectoralisminor)menghilangkanbeberapa
axillalympanodes
mastectoyradikal:
menghilangkanseluruhpayudara,acillarylympanodes,pectolarismuscle(besarataukecil,dan
lemakdanfasiayangberdekatandenganpembedahan

2.Radioterapi
Pegobatan radioterapi adalah untu penobatanlokal /lokoregional yang sifatnya bisa kuratif
ataupaliatif.Radioterapidapatmerupakanterapiutama,misalnyapadaoperasiBCTdankanker
payudara stadium lanjut III. Sebagai terapi tambahan/adjuvan biasanya diberikan bersama
denganterapibedahdankemoterapipadakankerstadiumI,IIdanIIIA.Pengobatankemoterapi
umumnya diberikan dalam regimen poliferasi lebih baik dibanding pemberian pengobatan
monofaramasi/monoterapi
3.Hormonterapi
Pengobatan hormon terapi untuk pengobatan sistemik untuk meningkatkan survival, yaitu
dengan pemberian anti esterogen, pemberian hormon aromatase inhibitor, antiGn RH,
ovorektomi.PemberianhormoninisebagaiadjuvanstadiumI,II,III,IVterutamapadapasiien
yangreceptor hormon positif, hormon terpi dapat juga digunakansebagai terapi p[ravelensi
kankerpayudara.
4.TerapiPaliatifdanpain
Terapipaliatifuntukdapatdikerjakansesuaidengankeluhanpasien,untuktujuanperbaikan
kualitashhdup.Dapatbersifatmedikamentosa,paliatif(pemberianobatobatpaliatif)dannon
medicamentosa(radiasipaliatifdanpembedahanpaliatif)
5.Immunoterapidanioterapi
Sampaisaatinipenggunaanimmunoterapisepertipemberianinterferon,modifiedmolekuler,
biologi agent, masih bersifat terbatas sebagai terapi adjuvan untuk mendukung keberhasilan
pengobatanpengobatanlainnya.
Pengobatan bioterapi dengan rekayasa genetika u ntuk mengoreksi mutasi genetik untuk
mengoreksimutasigenetikmasihdalampenelitian.
6.Rehabilitasifisikdanpsikis
Penderita kanker payudara sebaiknya setelah mendapatpengobatan konvensiobnal seperti
pembedahan, penyinaran, kemoterapi sebaiknya dilakukan rehabolitasi fisik untuk mencegah
timbulnya komplikasi akiabt treatment tersebut. Rehabilitasi psikis juga diperlukan untuk
mendorongsemangathidupyanglebhbaik.
7.Kemoterapi
Pengobatankemoterapiadalahpengobatansisitemikyangmengguanakanobatobatsitostatika
melaluialiransisitemik,sebagaiterapiutamapadakankerstadiumlanjut(stadiumIIIBdanIV)
dansebagaiterapitambahan
Pada kasus karsinoma mammae dapat dilakukan pengobatan dengan radiasi dan
pengangkatanmammae(Mastektomi).Pengangatantergantungsejauhmanapertumbuhandan
penyebaranyadipilihberdasarstadiumnya.danchemoterapy
AsuhanKeperawatanklienpradanpascabedahPayudara,meliputi:
Persiapandanperawatansebelumdansesudahoperasi
1Sebelumdilakukanpembedahan,penderitadisiapkansecaraoptimalantaralain:

a.Persiapanpsikologis,
Persiapan psikologis bertujuan untuk membantu klien mempersiapkandiri dalam memhadapi
operasi, perawta diharapkan mengetahui informasi dokter kepada pasien maupun keluarga,
tentang macam tindakan yang akn dilakukan manfaatdan akibat yang mungkin muncul dan
terjadisertamemberikanpenjelasantentangprosedurproseduryangakandilakukansebelum
operasi.
b.psikososial,
persiapan psikososial di tujukan menghindari adanya gangguan hubungan sosisal dan
interpersonaldanperandimasyarakat,akiabtperubahankondisikesehatandimanaklienseolah
olahklientidakmampumenerimasimpatidarioranglain,meraikdiridaripergaulandanmerasa
canggungdanbersoislaisasidenganmasyarakatdalamkehidupanseharihari
c.persiapanfisikyangbaik,seperti:
perawatanulkuspadakankerpayudara
adanyabauyangtidaksedapyangdapatmengganngulingkungansekitaranya,kaenaituperlu
adanyaperawatanyangintensifsebeluoperasi,bauiniterjadikarenaadanyajaringannekrotik
yangdisertaidenganinfeksisekunde,untukmengaurangibautersebutdapatdilakukannekrotomi
danpencucianluka,bisadenganBWC3%,betadine10%,danantiseptiklainnya,danjangan
lupamengerjakankulturpusdansensitifitastesbakterinya.
untukmengatasikesulitankesulitanataukomplikasiyangtimbulkerenaintervensianesthesii
maupuntraumapembedahannya.
Mengontroldatadatalaboratorium,sepertipemeriksaandarah,fungsilever,fungsinormal,faal
hemostasis,guladarah,,urine.
Menontrol kelengkapan datadata radiologi, seperti fhoto thorak, USG mamma, Mammografi,
bonescan.
Pengosongansaluranpencernaan68jamdipuasakankemudian34jamdilakukanlavemen,
Pencukuranrambutketiakdilakukan2jamsebelumoperasi
Mandibersihdankeramas.
2.Perawatansesudahoperasi
Mastektomiadalahsuatutindakanpengangkatantumorbesertapayudaradankelenjaraxilla.
a. Fasepascaanesthesi
Setelahdilakukanmastektomi,penderitadipindahkeruangpemulihandisertaidenganolehahli
anesthesidanstafprofesionallainnya.
b. Mempertahankanventilasipulmoner
Menghindari terjadiya obstruksipada periode anestesipada saluran pernafasan,
diakibatkanpenyumbatan olehlidahyangjatuh,kebelakang dantumpukan sekret,lendiryang
terkumpuldalamfaringtrakeaataubronkhialinidapatdicegahdenganposisiyangtepatdengan
posisimiring/setengahtelungkupdengankepaladitengadahkanbilaklientidakbisabatukdan
mengeluarkandahakataulendir,harusdilakukanpenghisapandengansuction.
c. Mempertahankansirkulasi

Padasaatkliensadar,baikdanstabil,makaposisitidurdiatursemifowleruntukmengurangi
oozingvenous(keluarnyadarahdaripembuluhpembuluhdarahhalus)lengandiangkatuntuk
meningkatkan sirkulasi dan mencegah terjadinya udema, semua masalah ini gangguan rasa
nyaman(nyeri)akibatdarisayatanlukaoperasimerupakanhalyangpailingseringterjadi
d. Masalahpsikologis
Payudaramerupakanalatvitalseseorangibudanwanita,kelainanataukehilanganakibatoperasi
payudarasangat terasaoleh pasien,haknya seperti dirampas sebagaiwanitanormal,ada rasa
kehilangantentanghubungannyadenganssuami,danhilangnyadayatariksertasertapengaruh
terhadapanakdarisegimenyusui.
e. Mobilisasifisik
Pada pasien pasca mastektomi perlu adanya latihanlatihan untuk mencegah atropi otototot
kekakuandankontraktursendibahu,untukmencegahkelainanbentuk(diformity)lainnya,maka
latihanharusseimbangdenganmenggunakansecarabersamaan.
Latihanawalbagipasienpascamastektomi:
Padaharipembedahan,melenturkandanmeluaskangerakkanjarijarimembalikbalikanlengan
Haripertemapascaoperasiharussudahdimulaifisioterafipasifdanaktif
Seperti:
oFisioterapi aktif : melatih gerakkangerakkan sendi bahu reduksi, rotasi ssendi bahu jika
fisioteraifiditerapkansediimungkintidakakanterjadikontraktursendibahudikemudianhari,
danjugadneganfisioterafidini,alirandrainlebihaktifdanlancar.
oSelanjutnya pasien dapat mengosokkan gigi dan menyisir rambut, pasien haurs mengetahui
gerakkanapayangdilakukandalamsetiaplatihan,misalnyadapat,mengangkatlengankeatas,
kesamping, dan kedepan, dapat menyisir rambut sendiri dan dapat memakai rambut sendiri,
denganlenganyangsakit,latihanharuskontiyudanistirahatbilamerasasakit
3.Perawatanpostmastektomi
a. Pemasanganplester/hipafik
Dalamhalinipemasanganplesterpadaoperasimastektomihendaknyadiperhatikanarahtarikan
tarikan kulit (langer line) agar tidak melawan gerakkangerakkan alamiah, sehingga pasien
dengan rileks menggerakkan sendi bahu tanpa hambatan dan tidak nyeri untuk itu perlu
diperhatikancarameletakkankasapadalukaoperasidancaramelakukanfiksasiplesterpada
dindingdada.
Plestermedialmelewatigarismidsternal
Plesterposteriormelewatigarisaxillarisline/garisketiak
Plesterposterior(belakang)melewatigarisaxillarispsoterior
Plestersuperiortidakmelewaticlavicula
Plesteriferiorharusmelewatilubangdrain
Untukdibawahklaviculaujughifavikdipotongmiringsepertimemotongbajudandipasangmiring
dibawahketiaksehinggatidakmengangugrakkantangan.
b. Perawatanpadalukaeksisitumor

Bila dikerjakan tumorektomi,pakai hipafik ukuran 10 cm yang dibuat seperti BH sehingga


menyanggapayudara
c. Pemakaiandrainredonmharustetapvakumdandiukurjumlahcairanyangtertampung
dalambotoldraintiappagi,biladrainbuntu,misalnyaterjadibekuandarah,bilain
draindenganPZ510ccsupayatetaplancar.Padamastektomiradikalatauradikal
modifikasi,drainumumnyadicabutsetelahjumlahcairandalam24jamtidakmelebihi
2030cc,padaeksisitumormammatidakmelebihi5cc
d. Klienyangdikerjakantransplantasikulitkalaukasapenutuplukabasahdengandarah
atau serumharus segera diganti, tetapi bola penutup(thiersch) tidak boleh dibuka.
Thierschumumnyadibukapadaharike7pascbedahuntukmelihatapakahhidupatau
mati
Kalauhidup,tutuplagidengansofratuledankasasteril
Kalautidakhidup,lukadapatdikompresdenganlarutasnboorataularutangaramfisiologisdan
buangjaringanyangnekrotik.
Demikianpulahalnyakasapenutupdonordandibukaharike14,keculaikalauadatandatanda
infeksi
e. Pemberianinjeksidanpengambilandarah
Padaklienyangdilakukanmastektomiradikalmodifikasisebagianbesarkelenjardarisaluran
getah bening axilla dieksisi, yang memudahkan terjadinya oedema lengan. Untuk
mencegahnyajangan melkukan injekdi, mamasang infus, mengabil darah, dsb pada sisi yang
sakit.Penderitaharusmenjagalengndantangannyadenganbaiksupayajangansampaiterjadi
luka atau injeksi yangakan menambah kerusakansluran limfe diketiak yang sudah minimal,
karena kalau terjadi oedema lengan sangat sukar mengoreksinya dan mungkin memerlukan
operasitrasposisiomentumuntukmengatasinya.
f.Pengukurantensi
Pemgukuran tensi jaringan pada lengan homolateral dan diseksi axilla karena memudahkan
terjadinyaoedemalengan.
E.Dasardatapengkajiankeperawatan
Datapredanpostoperasitergantungpadatipekhususataulokasiproseskankerdankomplikasi
yangada.

ASUHANKEPERAWATANPADAKLIENDENGAN

CAMAMMAE
Pengkajian
1.Biodata
Camammaeterjaditerutamapadausialanjut(diatas50th),tetapi80%terjadipadausia35tahunsampai
65tahuncendrungmeningkat6kalilipat
Jeniskelamin:lakilakidibanding1:100
2.Keluhanutama
DataSubjektif
Klienmengeluhadanyabenjolanatauulkuspadapayudaraankadangkadangtimbulnyeri,sertaperasaan
takutataucemas.
DataObjektif
Padapayudaraterdapatadanyaborokataunodulnodulyangmengerassertabautidakenakyang
menyengat
Klientampakengganbergauldanberintegrasidenganpasienlain
Klienterlihatsedihdanseringmelamun
Observasigejalamemegangpayudaradanwajahtampakmenyeringai
3.Riwayatpenyakit

Sekarang:Klienmengeluhadanyabenjolanatauulkuspadapayudaradankadang

kadangtimbulnyeri,sertaperasaantakutataucemas.Padapayudaraterdapatadanyaborokatau
nodulnodulyangmengerassertabautidakenakyangmenyengatKlientampakengganbergaul
danberintegrasidenganpasienlainKlienterlihatsedihdanseringmelamun,Observasigejala
memegangpayudaradanwajahtampakmenyeringai

Dahulu:adanyasiklusperubahanhormonalyanglamadantidakadahetihentinya,menarcheawal,menopuse

terlambat dan tidak adakehamilan,(long,1996), adanya riwayat kanker sebelumnya, riwayat

kehamilan (nullipara, multipara), penggunaan obatobatan hormonal kontrapsepsi, riwayat


menstruasi(earlymenarce,latemenopouse).Adanyapapaaranradiasiriwayatpeminumalkohol

Keluarga:Ibu dan anak prempuan khususnya dengan kankerpremenopuse atau kanker payudara bilateral,

adanyaanggotakeluargayangmenderitacamammae
4.PemeriksaanCaMammae/kankerpayudarameliputi:
oPemeriksaanskrening
Tujuanuntukmenemukankankerpayudaradinipadapenderitaasimptomatis(tanpakeluhan)dengan
tujuanmenurunkanankakamtianstandarpemeriksaanskriningpayudaradapatdilakukandengan
Mammografi: tebukti lebih akurat mendeteksi kanker payudara berdiameter kurang dari 0,5 cm
denganacurationrate:8090%
oPemeriksaanDiagnostik
Meliputi:
1.Anamnesacermatmengenaiwaktutimbulnyatuordanadatidaknyafaktorresiko
2.Ifeksitandatandakecurigaankankerpayudara
3.Palpasi,tandatandakankerpayudara.
oPemeriksaanImaging

Terdiridari:
1.Mammografi
2.USG
3.MRI
oPemeriksaanMikroskopik
Pemeriksaanmikroskopikterdiridari:
1.Pemeriksaanbiopsiterbuka(openBiopsy):insisionalbiopsidaneksisionalbiopsi
2.Pemeriksaanbiopsitertutup(minimalinvasifbiopsy):needleaspirationbiopsy,trucutbiopsy
Needleaspiratonbiopsymerupakanpilihautamauntukpemeriksaandiagnostiktumorpayudarayang
palpablemass,accurationrate95%
oPemeriksaantambahan
1.Pemeriksaantorakfhoto
2.Pemeriksaaanbonescaning/bonesurvey
3.PemeriksaanUSGAbdomen/Bonesiurvey
4.PemeriksaanUSGabdomen/CTscanabdomen
5.Pemeriksaantumormarker
6.Pemeriksaandarah/fungsiliverdantulang
7.PemeriksaanheadCTscan
KOMPLIKASIKEMOTHERAPI
Efeksamping:
nausea,vomiting
alopecia
rasa(pengecap)menurun
mucositis
toksik
hematologik:depresisumsumtulang,anemia
ginjal,hepar
PENGKAJIANKEPERAWATAN
A.SistemIntegumen
1.Perhatikan:nyeri,bengkak,flebitis,ulkus
2.Inspeksikemerahan&gatal,eritema
3.Perhatikanpigmentasikulit
4.Kondisigusi,gigi,mukosa&lidah
B.SistemGastrointestinalis
1.Kajifrekwensi,mulai,durasi,beratringannyamual&muntahsetelahpemberiankemotherapi
2.Observasiperubahankeseimbangancairan&elektrolit
3.Kajidiare&konstipasi
4.Kajianoreksia
5.Kaji:jaundice,nyeriabdomenkuadranataskanan
C.SistemHematopoetik
1.KajiNetropenia

Kajitandainfeksi
Auskultasiparu
Perhatikanbatukproduktif&nafasdispnoe
Kajisuhu
2.KajiTrombositopenia:<50.000/m3menengah,<20.000/m3berat
3.KajiAnemia
Warnakulit,capilarryrefill
Dispnoe,lemah,palpitasi,vertigo
D.SistemRespiratorik&Kardiovaskular
1.Kajiterhadapfibrosisparuyangditandai:Dispnoe,kering,batuknonproduktifterutamableomisin
2.KajitandaCHF
3.LakukanpemeriksaanEKG
E.SistemNeuromuskular
1.Perhatikanadanyaperubahanaktifitasmotorik
2.Perhatikanadanyaparestesia
3.Evaluasirefleks
4.Kajiataksia,lemah,menyeretkaki
5.Kajigangguanpendengaran
6.DiskusikanADL
F.Sistemgenitourinari
1.KajifrekwensiBAK
2.Perhatikanbau,warna,kekeruhanurine
3.Kaji:hematuria,oliguria,anuria
4.MonitorBUN,kreatinin
DIAGNOSAKEPERAWATAN
1.Resikoterjadiinfeksiberhubungandengannetropenia
2.Resikoperlukaanberhubungandengantrombositopenia
3.Lemahberhubungandengananemia
4.Perubahannutrisi:kurangdarikebutuhanberhubungandenganefeksamping
5.Perubahanselaputmukosaberhubungandenganstomatitis
6.Perubahangambarandiriberhubungandenganalopecia
INTERVENSIKEPERAWATAN
1.Mencegahinfeksi
2.Mencegahperdarahan
3.Mengurangikelelahan
4.Meningkatkannutrisi
5.Mengurangistomatitis
6.Meningkatkankopingpadaperubahangambarandiri
THERAPIRADIASI
Terapiradiasimenggunakanenergitinggi&getaranion.Dapatmenimbulkankerusakanmolekulseldan
perubahanbiokimia:mematikanselkanker

Jenistherapiradiasi:
Teletherapi:cobalt,lineacc
Brakhitherapi:dosistinggilebihterlokalisasi
Intraoperativeradioterapi,hipertermia
Pertimbanganklinis:
Indikasi:digunakantersendiriataukombinasi
Perencanaanpengobatan
Komplikasi:
Komplikasitergantungdarilokasi,jenisradiasi,dosis,statuskesehatanklien
1.Efeksampingakut16bulan
eritema
lemah&lunglai
nausea,muntah,diare
oral:kering,mucositis,xerostomia
dispnoe,pnemonia
sistitis
2.Efeksampingkronis>dari6bulan
Kulit:fibrosis,kehitamanpermanenatropi
Gastrointestinal:fibrosis,obstruksi,ulkus,striktur
Oral:xerostomia,pengecapanmenurun,cariesgigi
Paru:fibrosis
Ginjal:nefritis,fibrosis
Kankerlain57%leukemia
Pengkajian
1.Sistemterkait
2.Emosi/psikologisklien
IntervensiKeperawatan
1.Mempertahankanperawatankulitsecaraoptimal
informasikantentangreaksikulit
janganmenggunakanlotion,minyakkosmetikpadalokasitherapihanyatepungmaizena
hindari,penekanan,penggosokan,garuk
2.Memastikanterlindungidariefekradiasi

F.Prioritaskeperawatanpredanpostoperasi
PREOPERASI
1.Ansietas berhubungan dengankurangpengetahuantentangpradanpascaoperasi
dantakutakankecacatan.
Batasan Karakteristik: Mengungkapkan keluhan khusus, merasa tidak mampu, meminta
informasi,mengungkapkankurangmengertidangelisah,menolakoperasi.
Goal:Cemasberkurangatauhilang.
Kriteria Hasil: Mengungkapkan perasaan dan pikirannya secara terbuka, melaporkan
berkurangnyacemasdantakut,mengungkapkanmengertitentangpredanpostoperasi,secara

verbal mengemukakan menyadari terhadap apa yang diinginkannya yaitu menyesuaikan diri
terhadapperubahanfisiknya.
RencanaTindakan:
1.Jelaskanapayangterjadiselamaperiodepraoperasidanpascaoperasi,termasukteslaboratorium
praoperasi,persiapankulit,alasanstatuspuasa,obatobatanpraoperasi,obatobatanposoperasi,
tinggal di ruang pemulihan, dan program paskaoprasi. Informasikan pada klien obat nyeri
tersedia bila diperlukan untuk mengontrol nyeri.Rasionalpengetahuan tentang apa yang
diperkirakanmembantumengurangikecemasandanmeningkatkankerjasamapasien.
2.Jika mastektomi akan dilakukan, konsultasikan dulu dengan pasien dan dokter untuk
mendapatkankunjungandaritimmedisyangbersangkutan.Aturwaktuuntukberdiskusidengan
terapitentangalternatifmetodametodauntukrehabilitasisuara.Rasionalmengetahuiapayang
diharapkandan melihat hasil yang sukses membantu menurunkan kecemasan dan
memungkinkanpasienberpikirrealistik.
3.Izinkanpasienuntukmengetahuikeadaanpascaoperasi:satuatauduahariakandirawatdiUPI
sebelumkembalikeruangansemula,.Rasionalpengetahuantentangapayangdiharapkandari
intervensi bedah membantu menurunkan kecemasan dan memungkinkan pasien untuk
memikirkantujuanyangrealistik.
4.Jikaakandilakukanmatektomi,ajarkanpasiendanlatihcaracaralatihansebagaiberikut:
Latihanawalbagipasienpascamastektomi:
Padaharipembedahan,melenturkandanmeluaskangerakkanjarijarimembalikbalikanlengan
Haripertemapascaoperasiharussudahdimulaifisioterafipasifdanaktif
Seperti:
oFisioterapi aktif : melatih gerakkangerakkan sendi bahu reduksi, rotasi ssendi bahu jika
fisioteraifiditerapkansediimungkintidakakanterj`dikontraktursendibahudikemudianhari,
danjugadneganfisioterafidini,alirandrainlebihaktifdanlancar.
oSelanjutnya pasien dapat mengosokkan gigi dan menyisir rambut, pasien haurs mengetahui
gerakkanapayangdilakukandalamsetiaplatihan,misalnyadapat,mengangkatlengankeatas,
kesamping, dan kedepan, dapat menyisir rambut sendiri dan dapat memakai rambut sendiri,
denganlenganyangsakit,latihanharuskontiyudanistirahatbilamerasasakit
2.Menolak operasi berhubungan dengan kurang pengetahuan tentang prosedur pre dan
pascaoperasi,kecemasan,ketakutanakankecacatandanancamankematian.
Karakteristik data:kurang kerjasama dan menolak untuk dioperasi,menanyakan informasi
tentangpersiapanpredanprosedurposoperasi.
Goal:Klienakanbersediadioperasi.
Kriteriahasil:Mengungkapkanperasaandanpikirannyasecaraterbuka,mengatakanmengerti
predanposoperasi,mengatakanberkurangnyakecemasan,kliendioperasi.
Rencanatindakan:
1.Kajifaktorfaktoryangmenyebabkanklienmenolakuntukdioperasi.
2.Anjurkankeluargauntukmemberikansuportsepertidukunganspiritual.
3.Direncanakantindakansesuaidiagnosakeperawatanno.1.

POStOPERASI
1.Mempertahankanjalannapastetapterbuka,ventilasiadekuat.
2.Membantupasiendalammengembangkanmetodekomunikasialternatif.
3.Memperbaikiataumempertahankanintegritaskulit.
4.Membuatataumempertahankannutrisiadekuat.
5.Memberikandukunganemosiuntukpenerimaangambarandiriyangterganggu.
6.Memberikaninformasitentangprosespenyakitatauprognosisdanpengobatan.
TujuanPemulangan
1.Ventilasiatauoksigenasiadekuatuntukkebutuhanindividu.
2.Komunikasidenganefektif.
3.Komplikasitercegahatauminimal.
4.Memulaiuntukmengatasigambarandiri.
5.Prosespenyakitatauprognosisdanprogramterapidapatdipahami.
DiagnosaKeperawatan
1.Bersihan jalan napas tidak efektif berhubungan dengan efek dari anestesi, gangguan
kemampuanuntukbernapas,batukdanmenelan,sertasekresibanyakdankental.
Batasan karakteristik: sulit bernapas, perubahan pada frekwensi atau kedalaman
pernapasan,penggunaanototaksesoripernapasan,bunyinapastidaknormal,sianosis.
Goal:Klienakanmempertahankanjalannapastetapterbuka.
Kriteriahasil:bunyinapasbersihdanjelas,tidaksesak,tidaksianosis,frekwensinapasnormal.
Rencanatindakan:
Mandiri
1)Awasi frekwensi atau kedalaman pernapasan.Auskultasi bunyi napas. Selidiki kegelisahan,
dispnea,dansianosis.Rasionalperubahanpadapernapasan,adanyaronki,mengi,didugaadanya
retensisekret.
2)Tinggikankepala3045derajat.Rasionalmemudahkandrainasesekret,kerjapernapasandan
ekspansiparu.
3)Dorongmenelanbilapasienmampu.Rasionalmencegahpengumpulansekretoralmenurunkan
resikoaspirasi.Catatan:menelanterganggubilaepiglotisdiangkatatauedemapaskaoperasi
bermaknadannyeriterjadi.
4)Dorongbatukefektifdannapasdalam.Rasionalmemobilisasisekretuntukmembersihkanjalan
napasdanmembantumencegahkomplikasipernapasan.
5)Hisapselanglaringektomiatautrakeotomi,oraldanrongganasal.Catatjumlah,warnadan
konsistensi sekret. Rasionalmencegah sekresi menyumbat jalan napas, khususnya bila
kemampuanmenelanterganggudanpasientidakdapatmeniuplewathidung.
6)Observasi jaringan sekitar selang terhadap adanya perdarahan. Ubah posisi pasien untuk
memeriksaadanyapengumpulandarahdibelakangleherataubalutanposterior.Rasionalsedikit
jumlah perembesan mungkin terjadi. Namun perdarahan terusmenerus atau timbulnya
perdarahantibatibayangtidakterkontroldanmenunjukkansulitbernapassecaratibatiba.
7)Gantiselangataukanulsesuaiindikasi.Rasionalmencegahakumulasisekretdanperlengketan
mukosatebaldariobstruksijalannapas.Catatan:inipenyebabumumdistrespernapasanatau
hentinapaspadapaskaoperasi.

Kolaborasi
8)Berikanhumidifikasitambahan,contohtekananudaraatauoksigendanpeningkatanmasukan
cairan.Rasional fisiologi normal ( hidung) berarti menyaring atau melembabkanudara yang
lewat.Tambahankelembabanmenurunkanmengerasnyamukosadanmemudahkanbatukatau
penghisapansekretmelaluistoma.
9)Awasi seri GDA atau nadi oksimetri, foto dada. Rasional pengumpulan sekret atau adanya
ateletaksisdapatmenimbulkanpneumoniayangmemerlukantindakanterapilebihagresif.
2.Kerusakan integritas kulit atau jaringan berhubungan dengan bedahpengangkatan,
radiasiatauagenkemoterapi,gangguansirkulasiatausuplaidarah,pembentukanudema
danpengumpulanataudrainaseterusmenerus.
Karakteristik data :kerusakan permukaan kulit atau jaringan, kerusakan lapisan kulit atau
jaringan.
Goal:Menunjukkanwaktupenyembuhanyangtepattanpakomplikasi.
Kriteriahasil:integritasjaringandankulitsembuhtanpakomplikasi
Rencanatindakan:
1)Kajiwarnakulit,suhudanpengisiankapilerpadaareaoperasidantandurkulit.Rasionalkulit
harusberwarnamerahmudaataumiripdenganwarnakulitsekitarnya.Sianosisdanpengisian
lambat dapat menunjukkan kongesti vena, yang dapat menimbulkan iskemia atau nekrosis
jaringan.
2)Pertahankankepalatempattidur3045derajat.Awasiedemawajah(biasanyameningkatpada
hariketigakelimapascaoperasi).Rasionalmeminimalkankongestijaringanpaskaoperasidan
edemasehubungandenganeksisisaluranlimfe.
3)Pertahankanposisisomifowlerpadapunggungatausisiyangtidaksakitdenganlengantinggi
dandisokongdenganbantalRasionalmemabantudrainasedenganbantuangravitasi
4)Awasidrainaseberdarahdarisisioperasi,jahitandandrein.Rasionaldrainaseberdarahbiasanya
tetap sedikit setelah 24 jam pertama. Perdarahan terusmenerus menunjukkan masalah yang
memerlukanperhatianmedik.
5)Catatataulaporkanadanyadrainasesepertisusu.Rasionaldrainasesepertisusumenunjukkan
kebocoran duktus limfe torakal ( dapat menyebabkan kekurangan cairan tubuh dan
elektrolit).Kebocoraninidapatsembuhspontanataumemerlukanpenutupanbedah.
6)Ganti balutan sesuai indikasi bila digunakan. Rasional balutan basah meningkatkan resiko
kerusakanjaringanatauinfeksi.Catatan:balutantekantidakdigunakandiataslembarankulit
karenasuplaidarahmudahdipengaruhi.
7)Bersihkaninsisidengancairangaramfaalsterildanperoksida(campuran1:1)setelahbalutan
diangkat. Rasional mencegah pembetukan kerak , yang dapat menjebak drainase purulen,
merusaktepikulit,danmeningkatkanukuranluka.Peroksidatidakbanyakdigunakankarena
dapatmembakartepidanmenggangupenyembuhan.
8)JanganmelakukanpengukuranTDmmenginjeksikanobatataumemasukkanIVpadalengan
yangsakit.Rasional,meningkatkanpontensialkonstriksiinfewksi,danlimfademapadasisiyang
sakit
9)Kosongkandrainlukasecaraperiodikcatatjumlahdankarakteristikdrainase

Rasional, akumulasi cairan drainase (cont, limfe, darah meningkatkan penyembuhan dan
menurunkankerentananterhadapinfeksi,alatpenghisap(contoh,hemovac,jacsonfart)sering
dimasukkanselamamasapembedahanuntukmempetahankantekanannegatifpadaluka,selang
bisanyadiangkatsekitarhariketigaataubiladrainaseberhenti.
Kolaborasi
10)Berikan antibiotik oral,topikaldan IV sesuaiindikasi.Rasionalmencegah ataumengontrol
infeksi.
3.Perubahanmembranmukosaoralberhubungandengandehidrasi,kebersihanoraltidak
adekuat,kankeroral,penurunanproduksisalivasekunderterhadapradiasiatauprosedur
pembedahandandefisitnutrisi.
Karakteristikdata:Xerostomia(mulutkering),ketidaknyamananmulut,salivakentalatau
banyak,penurunanproduksisaliva,lidahkering,pecahdankotor,bibirinflamasi,tidakadagigi.
Goal:menunjukkanmembranmukosaoralbaikatauintegritasmembranmukosabaik.
KriteriaHasil:mulutlembabatautidakkering,mulutterasasegar,lidahnormal,bersihdan
tidakpecah,tidakadatandainflamasipadabibir.
Rencanatindakan:
Mandiri
1)Inspeksironggaoraldanperhatikanperubahanpadasaliva.Rasionalkerusakanpadakelenjar
saliva dapat menurunkan produksi saliva, mengakibatkan mulut kering. Penumpukan dan
pengaliransalivadapatterjadikarenapenurunankemampuanmenelanataunyeritenggorokdan
mulut.
2)Perhatikan perubahan pada lidah, bibir, geligi dan gusi serta membran mukosa. Rasional
pembedahanmeliputireseksiparsialdarilidah,platumlunak,danfaring.Pasienakanmengalami
penurunansensasidangerakanlidah,dengankesulitanmenelandanpeningkatanresikoaspirasi
sekresi, serta potensial hemoragi. Pembedahan dapat mengankat bagian bibir mengakibatkan
pengaliran saliva tidak terkontrol. Geligi mungkin tidak utuh (pembedahan )atau mungkin
kondisinyaburukkarenamalnutrisidanterapikimia.Gusijugadapatterinflamasikarenahigiene
yangburuk,riwayatlamadarimerokokataumengunyahtembakauatauterapikimia.Membran
mukosamungkinsangatkering,ulserasi,eritema,danedema.
3)Hisapanronggaoralsecaraperlahanatausering.Biarkanpasienmelakukanpengisapansendiri
bilamungkinataumenggunakankasauntukmengalirkansekresi.Rasionalsalivamengandung
enzim pencernaan yang mungkin bersifat erosif pada jaringan yang terpajan. Karena
pengalirannya konstan, pasien dapat meningkatkan kenyamanan sendiri dan meningkatkan
higieneoral.
4)Tunjukkanpasienbagaimanamenyikatbagiandalammulut,platum,lidahdangeligidengan
sering.Rasionalmenurunkanbakteridanresikoinfeksi,meningkatkanpenyembuhanjaringan
dankenyamanan.
5)Berikan pelumas pada bibir; berikan irigasi oral sesuai indikasi. Rasional mengatasi efek
kekeringandaritindakanterapeutik;menghilangkansifaterosifdarisekresi.
4.Nyeri akut berhubungan dengan insisi bedah, pembengkakan jaringan,adanya selang
nasogastrikatauorogastrik.

Karakteristikdata:Ketidaknyamananpadaareabedahataunyerikarenainsisibedah,perilaku
distraksi,gelisah,perilakuberhatihati.
Goal:Nyeriklienakanberkurangatauhilang.
Kriteriahasil:klienmengatakannyerihilang,tidakgelisah,rileksdanekpresiwajahceria.
Rencanatindakan:
1)Kajikeluahannyeri,perhatikanlokasi,lamanyadanintensitasnyeri(o10).Perhatikanpetunjuk
verbaldannorverbal.Rasionalmembantudalammengidentifikasiderajatketidaknyamanandan
kebutuhanuntukefektifanalgesik.Jumlahjaringan,otot,dansisitemlimfatikdiangkatdapat
dapat mempengaruhi jumlah nyeri yang dialami. Kerusakan saraf pada regio aksilaris yang
menyebabkankebaspadalenganatasdanregioskapulayangdapatditoleransidaripadanyeri
pembedahancatatan:nyeripadadindingdapatterjadidariteganganotot,dipengaruhiolehpanas
ataudinginekstrem,danberlanjutselamabeberapabulan.
2)Diskusikan masih adanya sensasipayudara normal. Rasional memberikan kenyakinan bahwa
sensasibukanimajinasidanpenghilangandapatdilakukan
3)Batupasienmenemukanposisiyangnyaman.Rasional.Peninggianlengan,ukuranbaju,dan
adanyadrainmempengaruhikemampuanpasienutukrilwksdantidur/istirahatsecaraefektif.
4)Catat indikator non verbal dan respon automatik terhadap nyeri. Evaluasi efek analgesik.
Rasionalalatmenentukanadanyanyeridankeefektifanobat.
5)Anjurkanpenggunaanperilakumanajemenstres,contohteknikrelaksasi,bimbinganimajinasi.
Rasionalmeningkatkanrasasehat,dapatmenurunkankebutuhananalgesikdanmeningkatkan
penyembuhan.
6)Kolaborasi dengan pemberian analgesik, contoh codein, ASA, dan Darvon sesuai indikasi.
Rasional derajat nyeri sehubungan dengan luas dan dampak psikologi pembedahan sesuai
dengankondisitubuh.Diharapkandapatmenurunkanataumenghilangkannyeri.
5.Gangguan citra diri berhubungan dengan kehilangan payudara, perubahan anatomi
tubuh.
Karakteristik data:perasaannegatiftentangcitradiri,perubahandalamketerlibatansosial,
ansietas,depresi,kurangkontakmata.
Goal:Mengidentifikasiperasaandanmetodekopinguntukpersepsinegatifpadadirisendiri.
Kriteriahasil:menunjukkanadaptasiawalterhadapperubahantubuhsebagaibuktidengan
partisipasi aktivitas perawatan diri dan interaksi positip dengan orang lain.Berkomunikasi
dengan orang terdekat tentang perubahan peran yang telah terjadi.Mulai mengembangkan
rencana untuk perubahan pola hidup. Berpartisipasi dalam tim sebagai upaya melaksanakan
rehabilitasi.
Rencanatindakan:
1)Diskusikan arti kehilangan atau perubahan dengan pasien, identifikasi persepsi situasi atau
harapanyangakandatang.Rasionalalatdalammengidentifikasiataumengartikanmasalahuntuk
memfokuskanperhatiandanintervensisecarakonstruktif.
2)Catatbahasatubuhnonverbal,perilakunegatifataubicarasendiri.Kajipengrusakandiriatau
perilakubunuhdiri.Rasionaldapatmenunjukkandepresiataukeputusasaan,kebutuhanuntuk
pengkajianlanjutatauintervensilebihintensif.

3)Catat reaksi emosi, contoh kehilangan, depresi, marah. Rasional pasien dapat mengalami
depresicepatsetelahpembedahanataureaksisyokdanmenyangkal.Penerimaanperubahantidak
dapatdipaksakandanproseskehilanganmembutuhkanwaktuuntukmembaik.
4)Susunbatasanpadaperilakumaladaptif,bantupasienuntukmengidentifikasiperilakupositip
yang akan membaik. Rasional penolakan dapat mengakibatkan penurunan harga diri dan
mempengaruhipenerimaangambarandiriyangbaru.
5)Kolaboratifdenganmerujukpasienatauorangterdekatkesumberpendukung,contohahliterapi
psikologis, pekerja sosial, konseling keluarga. Rasional pendekatan menyeluruh diperlukan
untukmembantupasienmenghadapirehabilitasidankesehatan.Keluargamemerlukanbantuan
dalam pemahaman proses yang pasien lalui dan membantu mereka dalam emosi mereka.
Tujuannyaadalahmemampukanmerekauntukmelawankecendrunganuntukmenolakdariatau
isolasipasiendarikontaksosial.
6.Ganguan mobilisasi fisik berhubungan dengan penurunan massa otot/ kekuatan otot
akiabtlukabekasoperasi
Karakteristik data :perasaannyeri pada saatr aktifitas, menolak untuk bergerak, membatasi
rentanggerak.
Goal:mobilisasifisikdapatterpenuhidanberpartisifasiaktifdalamterapi.
Kriteria hasil :menunukkan tehnik yang memampukan melakukan aktivitas, Peningkatan
kekuatanbagiandalamtubuhyangsakit.
Intervensi:
1)Tinggikan lengan yang sakit sesuaiindikasi mulai melakukan rentang gerak psif (con :
pleksi/ekstensi siku, pronasi/supinasi pergelangan, menekuk/ekstensi jari) sesegera mungkin.
Rasional.Meningkatkanaliranlimfevena,mengurngikemungkinanlimfadema.Latihanpasca
oerasi dini biasanya muaipada 24 jam pertama untuk mencegah kekakuan sendi yang dapat
berlanjutpadaketerbatasangerak/mobilisasi.
2)Biarkan pasien untuk menggunakan lengan utuk kebersihan diri, contoh makan, menyisir
rambut,mencucuimuka,Rasionalpeningkatansirkulasi,membantumeminimalkanedemadan
mempertahankankekuaatandanfungsilengndatangan,aktivitasinimenggunakanlengantanpa
abduksiyangdapatmenekanjahitanpadaperiodepascaoperasi.
3)Bantudalamperawatandirisesuaidengankeperlan.Rasional.menghematenergimencegah
kelelahan.
4)Tingkatkanlatihanssesuaiindikasi,contohekstensiaktiflengandanrotasibahusaatberbaring
sitempat tidur, mengpakkan pendulum, memutar tali, mengangkat lengan untuk menyentuh
ujungjaridibelakangkepala.Rasionalmencegahkekakuansendi,meningkatkansirkulasidan
mempertahankantonusototbahudenganlengan.
5)Lanjttkanpadatangan(jariberjalandidinding)menjepittangandibelakangkepala,danlatihan
abduksipenuhsesgeramungkinpasiendapatmelakukanRasionalkarenakelompoklatihanini
dapatmenyebabkanteganganberlebihanpadainsisi,sampaiterjadiprosespenyembuhanlebih
lanjut,latihandihentikan.
6)Evaluasi adanya /derajat latihan sehubungan dengan nyeri dan perubahan mobilisasi sendi,
mengukur lengan atas dan lengan bawah bila terjadi udema.rasional. mengawasi
kemujuan/perbaikkan koplikasi dapat memerlukan penundaan untuk meningkatkan adanya
latihandanmenunggusampaipenyembuhanberikutnya.

DAFTARPUSTAKA
Dunna,D.I.Etal.1995.MedicalSurgicalNursing;ANursingProcessApproach2ndEdition:WB
Sauders.
Long,C.Barbara(1996).EssentialOfMedicalSurgicalNursingANursingProcessApprocach.C.V
MosbxCompanyStLouis,USA.
PPNIpertemuaanilmiahperawatbedahIndonesia(2000)Pendekatanasuhankeperawtansecara
parifurnadalampenanganankasusbedahSurabaya
Rothrock,C.J.2000.PerencanaanAsuhanKeperawatanPerioperatif.EGC:Jakarta.
Sjamsuhidajat&WimDeJong.1997.BukuAjarIlmuBedah.EGC:Jakarta.
Diposkan oleh laloe Rezan di 21.16
Kirimkan Ini lewat EmailBlogThis!Berbagi ke TwitterBerbagi ke FacebookBagikan ke Pinterest

Tidak ada komentar:


Poskan Komentar
Link ke posting ini
Buat sebuah Link

Posting Lebih BaruPosting LamaBeranda


Langganan: Poskan Komentar (Atom)

Ns.Rezan

laloe Rezan
curiculum vitae
Nama ; Lalu Rezan Saleh S.Kep.,Ners
alamat ; mangkung, kec.praya barat. kab. lombok tengah.NTB
SD 2 mangkung
SMP 2 praya barat
SMA 1 ibrahimy Sukorejo Situbondo
PT.Unipdu jombang

Lihat profil lengkapku


Arsip Blog

2012 (9)
Desember (9)
askep appendiktomi

ASKEP EFUSI PLEURA


ASKEP KISTA OVARI
Askep RHD (Rematik heart diseases)
Askep Hepatoma
Penyakit Jantung Infeksi
Konsep Hipertensi
Askep Ca Mammae

Basic Live Suport


Daily Calendar
Digital clock

Google+ Badge

Total Tayangan Laman

Pengikut
Ns.Rezan. Template Awesome Inc.. Gambar template oleh simonox. Diberdayakan
oleh Blogger.

LAPORAN PENDAHULUAN MASTEKTOMI

A. LANDASAN TEORITIS MASTEKTOMI


Modified Radical Mastectomy adalah suatu tindakan pembedahan onkologis
pada keganasan payudara yaitu dengan mengangkat seluruh jaringan payudara yang
terdiri dari seluruh stroma dan parenkhim payudara, areola dan puting susu serta kulit
diatas tumornya disertai diseksi kelenjar getah bening aksila ipsilateral level I, II/III
secara en bloc TANPA mengangkat m.pektoralis major dan minor.
Tipe mastektomi dan penanganan kanker payudara bergantung pada beberapa factor
meliputi :
o Usia
o Kesehatan secara menyeluruh
o Status menopause

o Dimensi tumor
o Tahapan tumor dan seberapa luas penyebarannya
o Stadium tumor dan keganasannya
o Status reseptor homon tumor
o Penyebaran tumor telah mencapai simpul limfe atau belum

Tipe pembedahan secara umum dikelompokkan kedalam tiga kategori : mastektomi


radikal, mastektomi total dan prosedur yang lebih terbatas ( contoh segmental,
lumpektomi ).
1. Mastektomi

preventif

preventife

mastectomy)

disebut

juga

prophylactic

mastectomy.operasi ini dapat berupa total mastektomi dengan mengangkat seluruh


payudara dan putting atau berupa subcutaneous mastectomy dimana seluruh payudara
diangkat namun putting tetap dipertahankan .
2. Mastektomi total ( sederhana ) mengangkat semua jaringan payudara tetapi semua
atau kebanyakan nodus limfe dan otot dada tetap utuh.
3. Mastektomi radikal modifikasi mengangkat seluruh payudara , beberapa atau semua
nodus limfe dan kadang-kadang otot pektoralis minor.otot dada mayor masih
utuh.Mastektomi radikal ( halsted ) adalah prosedur yang jarang dilakukan yaitu
pengangkatan seluruh payudara, kulit, otot pektoralis mayor dan minor, nodus limfe
ketiak dan kadang-kadang nodus limfe mamari internal atau supra klavikular.
4. Prosedur membatasi ( contoh : lumpektomi ) mungkin dilakukan pada pasien rawat
jalan yang hanya berupa tumor dan beberapa jaringan sekitarnya diangkat. Lumpektomi
dianggap tumor non-metastatik bila kurang dari 5 cm ukurannya yang tidak melibatkan
putting.prosedur meliputi dignostik ( menentukan tipe sel ) dan atau pengobatan bila
dikombinasi dengan terapi radiasi.
Berdasarkan tujuan terapi pembedahan, mastektomi dibedakan menjadi dua
macam yaitu tujuan kuratif dan tujuan paliatif. Prinsip terapi bedah kuratif adalah
pengangkatan seluruh sel kanker tanpa meninggalkan sel kanker secara mikroskopik.

Terapi bedah kuratif ini dilakukan pada kanker payudara stadium dini(stadium 0, I dan
II).
Sedangkan tujuan terapi bedah palliatif adalah untuk mengangat kanker
payudara secara makroskopik dan masih meninggalkan sel kanker secara mikroskopik.
Pengobatan bedah palliatif ini pada umumnya dilakukan untuk mengurangi keluhankeluhan penderita seperti perdarahan, patah tulang dan pengobatan ulkus, dilakukan
pada kanker payudara stadium lanjut,yaitu stadium III dan IV.
Prosedur pengangkatan sel kanker dapat dilakukan dengan cara sebagai
berikut :
1. Mastektomi radikal, yaitu Mengangkat seluruh payudara, kulit, otot mayor dan minor,
nodus limfe aksila dan jaringan lemak disekitarnya.
2. Mastektomi radikal modifikasi, seperti mastektomi radikal tetapi otot pektoralis mayor
dipertahankan.
3. Mastektomi sederhana, Mengangkat payudara dengan mempertahankan otot-otot yang
menyokong.
4. Mastektomi parsial, Mengangkat lesi dan jaringan disekitarnya termasuk nodus limfe.
5. Lumpektomi, Mengangkat lesi dan 3 sampai 5 cm jaringan ditepinya, jaringan payudara
dan kulitnya dipertahankan.

Beberapa tipe mastektomi yang ada pada saat ini


1. Mastektomi Preventif (Preventive Mastectomy)
Mastektomi preventif disebut juga prophylactic mastectomy. Operasi ini dapat
berupa total mastektomi dengan mengangkat seluruh payudara dan puting. Atau
berupa subcutaneous mastectomy, dimana seluruh payudara diangkat namun puting
tetap dipertahankan. Penelitian menunjukkan bahwa tingkat kekambuhan kanker
payudara dapat dikurangi hingga 90% atau lebih setelah mastektomi preventif pada
wanita dengan risiko tinggi.

MASTEKTOMI

Gambar payudara seorang wanita 25 tahun. menjalani prophylacyic mastectomy dan


telah mengalami rekonstruksi dengan menutup lubang bekas operasi dengan dengan
jaringan yang diambil dari perutnya.

2. Mastektomi Sederhana atau Total (Simple or Total Mastectomy)


Mastektomi dengan mengangkat payudara berikut kulit dan putingnya, namun
simpul limfe masih dipertahankan. Pada beberapa kasus, sentinel node biopsy terpisah
dilakukan untuk membuang satu sampai tiga simpul limfe pertama.

MASTEKTOMI

Total mastectomy

3. Mastektomi Radikal Termodifikasi (Modified Radical Mastectomy)


Terdapat prosedur yang disebut modified radical mastectomy (MRM)-mastektomi
radikal termodifikasi. MRM memberikan trauma yang lebih ringan daripada mastektomi
radikal, dan ssat ini banyak dilakukan di Amerika. Dengan MRM, seluruh payudara akan

diangkat beserta simpul limfe di bawah ketiak, tetapi otot pectoral (mayor dan minor)
otot penggantung payudara masih tetap dipertahankan. Kulit dada dapat diangkat
dapat pula dipertahankan, Prosedur ini akan diikuti dengan rekonstruksi payudara yang
akan dilakukan oleh dokter bedah plastik.

MASTEKTOMI

Modified Radical Mastectomy

4. Mastektomi Radikal (Radical Mastectomy)


Mastektomi radikal merupakan pengangkatan payudara komplit, termasuk puting.
Dokter juga akan mengangkat seluruh kulit payudara, otot dibawah payudara, serta
simpul limfe (getah bening). Karena mastektomi radikal ini tidak lebih efektif namun
merupakan bentuk mastektomi yang lebih ekstrim , saat ini jarang dilakukan.

MASTEKTOMI

4. Mastektomi Parsial atau Segmental (Partial or Segmental Mastectomy)


Dokter dapat melakukan mastektomi parsial kepada wanita dengan kanker
payudara stadium I dan II. Mastektomi parsial merupakan breast-conserving therapyterapi penyelamatan payudara yang akan mengangkat bagian payudara dimana tumor
bersarang. Prosedur ini biasanya akan diikuti dengan terapi radiasi untuk mematikan
sel kanker pada jaringan payudara yang tersisa. Sinar X berkekuatan penuh akan
ditembakkan pada beberapa bagian jaringan payudara. Radiasi akan membunuh
kanker dan mencegahnya menyebar ke bagian tubuh yang lain.

MASTEKTOMI

Partial Mastectomy

5. Quandrantectomy
Tipe lain dari mastektomi parsial disebut quadrantectomy. Pada prosedur ini,
dokter akan mengangkat tumor dan lebih banyak jaringan payudara dibandingkan
dengan lumpektomi.

MASTEKTOMI

Quandrantectomy
Mastektomi tipe ini akan mengangkat seperempat bagian payudara, termasuk kulit dan
jaringan konektif (breast fascia). Cairan berwarna biru disuntikkan untuk
mengidentifikasi simpul limfe yang mengandung sel kanker.

6. Lumpectomy atau sayatan lebar,


Merupakan pembedahan untuk mengangkat tumor payudara dan sedikit jaringan
normal di sekitarnya. Lumpektomi (lumpectomy) hanya mengangkat tumor dan sedikit
area bebas kanker di jaringan payudara di sekitar tumor. Jika sel kanker ditemukan di
kemudian hari, dokter akan mengangkat lebih banyak jaringan. Prosedur ini disebuat
re-excision (terjemahan : pengirisan/penyayatan kembali).

MASTEKTOMI

Lumpectomy

7. Excisional Biopsy
Biopsi dengan sayatan juga mengangkat tumor payudara dan sedikit jaringan
normal di sekitarnya. Kadang, pembedahan lanjutan tidak diperlukan jika biopsy dengan
sayatan ini berhasil mengangkat seluruh tumor.

MASTEKTOMI

Excisional Biopsy

B. INDIKASI OPERASI MASTEKTOMI

Kanker payudara stadium dini (I,II)

Kanker payudara stadium lanjut lokal dengan persyaratan tertentu

Keganasan jaringan lunak pada payudara.

C. KONTRA INDIKASI OPERASI MASTEKTOMI

Tumor melekat dinding dada

Edema lengan

Nodul satelit yang luas

Mastitis inflamatoar

D. PERSIAPAN PERIOPERATIF MASTEKTOMI


1. Fase Preoperatif Mastektomi
Fase preoperatif dimulai ketika ada keputusan untuk dilakukan intervensi dan diakhiri
ketika pasien dikirim ke kamar operasi. Lingkup aktivitas keperawatan selama waktu
tersebut dapat mencakup penetapan pengkajian dasar pasien. Wawancara praoperatif
dan menyiapkan pasien untuk anestesi yang diberikan dalam pembedahan
a. Pengkajian :
Identitas pasien
Tanda-tanad vital
Riwayat penyakit : alergi, penyakit paru (asma, PPOM, TB paru), penggunaan narkoba,
alkoholisme, menggunakan obat seperti kortikosteroid dan obat jantung
Riwayat kesehatan keluarga : DM. Hipertensi
Status nutrisi : BB, puasa, tinggi badan
Keseimbangan cairan dan elektrolit
Ada tidaknya gigi palsu, pemakaian lensa kontak, atau cat kuku dan implan prosthesis
lainnya
Pencukuran daerha operasi
Kolaborasi dengan dokter anestesi tentang pemberian jenis anestesi dan pemakaian
obat anestesi yang akan dilakukan
Pemeriksaan penunjung : rontgen, EKG, pemeriksaan laboratorium (darah lengkap,
faal hepar, faa ginjal, masa pembekuan darah), biopsi, pemeriksaan gula darah
Informed consent
Penentuan status ASA
Diagnosa keperawatan pre operasi Mastektomi

Cemas berhubungan dengan krisis situasional

Kurang pengetahuan berhubungan dengan keterbatasan paparan

Nyeri akut berhubungan dengan agen injuri biologi


Rencana Keperawatan pre operatif Mastektomi:
DIAGNOSA KEP.
NOC
Cemas

berhubungan Setelah

dilakukan

NIC

asuhan Anxiety reduction :

dengan perubahan

keperawatan

status kesehatan

selama..... pasienmenunjukan anxiety Jelaskan


control dengan kriteria hasil:
pasien kooperatif

Tenangkan pasien
seluruh

prosedurt

tindakan

kepada

pasien

dan

Mampu mengidentifikasikan cemas perasaan yang mungkin


dengan bahasa tubuh yang tenang
Vital sign dbn

muncul

pada

saat

melakukan tindakan
Berusaha

memahami

keadaan pasien
Berikan informasi tentang
diagnosa, prognosis dan
tindakan
Mendampingi
untuk

pasien
mengurangi

kecemasan

dan

meningkatkan
kenyamanan
Dorong

pasien

zmenyampaikan

untuk
tentang

isi perasaannya
Kaji tingkat kecemasan
Dengarkan

dengan

penuh perhatian
Ciptakan

hubungan

saling percaya
Bantu

pasien

menjelaskan

keadaan

yang bisa menimbulkan


kecemasan
Bantu

pasien

untuk

mengungkapkan hal hal


yang membuat cemas
Ajarkan

pasien

teknik

relaksasi
Berikan obat obat yang
mengurangi cemas
Kurang
tentang

pengetahuan Setelah

dilakukanasuhan Teaching

penyakit, keperawatan

Dissease

selama......, Process

perawatan,pengobatan pengetahuan klien meningkat dengan- Kaji tingkat pengetahuan


kurang
paparan
kriteria hasil
klien dan keluarga tentang
terhadap informasi
Klien mampu menjelaskan kembali proses penyakit
apa yang dijelaskan
Klien

kooperative

tindakan

-Jelaskan
saat

tentang

dilakukan patofisiologi

penyakit,

tanda dan gejala serta


penyebabnya
-Sediakan informasi tentang
kondisi klien
-Berikan informasi tentang
perkembangan klien
-Diskusikan perubahan gaya
hidup

yang

diperlukan

mungkin
untuk

mencegah komplikasi di
masa yang akan datang
dan atau kontrol proses
penyakit
-Jelaskan

alasan

dilaksanakannya tindakan
atau terapi
-Gambarkan

komplikasi

yang mungkin terjadi


-Anjurkan

klien

untuk

mencegah efek samping


dari penyakit
-Gali sumber-sumber atau
dukungan yang ada
-Anjurkan
klien
untuk
melaporkan tanda dan
gejala yang muncul pada
petugas kesehatan
Nyeri akut b.d agen
Lakukan pengkajian nyeri
Setelah
dilakukan
asuhan
injuri biologi
keperawatan selama 1x pertemuan secara
komprehensif
nyeri klien berkurang dengan kriteria termasuk

lokasi,

hasil:

durasi,

karakteristik,

Nyeri terkontrol
Klien

menggunakan

frekuensi
teknik

non

farmakologi untuk mengurangi nyeri


Tanda vital dalam rentang normal

Monitor vital sign


Gunakan
komunikasi
untuk

teknik
terapeutik
mengetahui

pengalaman nyeri

Ajarkan teknik
relaksasi nafas

dalam

untuk mengurangi nyeri


2. Fase Intraoperatif Mastektomi
Fase intra operatif dimulai ketika pasien masuk atau dipindah ke instalasi bedah dan
berakhir

saat

pasien

dipindahkan

ke

ruang

pemulihan.

Aktivitas keperawatan yang dilakukan selama tahap intra operatif meliputi 4 hal, yaitu :
a. Safety Management (Pengaturan posisi pasien)
Faktor penting yang harus diperhatikan ketika mengatur posisi di ruang operasi
adalah: daerah operasi, usia, berat badan pasien, tipe anastesidan nyeri. Posisi yang
diberikan tidak boleh mengganggu sirkulasi, respirasi, tidak melakukan penekanan yang
berlebihan pada kulit dan tidak menutupi daerah atau medan operasi.
- Kesejajaran fungsional maksudnya adalah memberikan posisi yang tepat selama
operasi. Operasi yang berbeda akan membutuhkan posisi yang berbeda pula supine
- Pemajanan area pembedahan maksudnya adalah daerah mana yang akan dilakukan
tindakan

pembedahan.

Dengan

pengetahuan

tentang

hal

ini

perawat

dapat

mempersiapkan daerah operasi dengan teknik drapping


- Mempertahankan

posisi

sepanjang

prosedur

operasi

dengan tujuan untuk mempermudah proses pembedahan juga sebagai bentuk jaminan
keselamatan pasien dengan memberikan posisi fisiologis dan mencegah terjadinya
injury.
- Memasang alat grounding ke pasien
- Memberikan dukungan fisik dan psikologis pada klien untuk menenagkan pasien
selama operasi sehingga pasien kooperatif.
- Memastikan bahwa semua peralatan yang dibutuhkan telah siap seperti : cairan infus,
oksigen, jumlah spongs, jarum dan instrumen tepat.
b. Monitoring Fisiologis
- Melakukan balance cairan
- Memantau

kondisi

cardiopulmonal

meliputi

fungsi

pernafasan,

darah, frekuensi denyut jantung, saturasi oksigen, perdarahan dll.

nadi, tekanan

- Pemantauan terhadap perubahan vital sign


c.

Monitoring Psikologis

- Memberikan dukungan emosional pada pasien


- Berdiri di dekat klien dan memberikan sentuhan selama prosedur induksi
- Mengkaji status emosional klien
- Mengkomunikasikan status emosional klien kepada tim kesehatan (jika ada perubahan)
d. Pengaturan dan koordinasi Nursing Care
- Memanage keamanan fisik pasien
- Mempertahankan prinsip dan teknik asepsis
Obat-obat anestesi :
1. Obat-obat premedikasi
SA 0,001-0,002 mg/KgBB
Midazolam 0,1-0,2 mg/KgBB
Fentanyl 1-2 mcg/KgBB
Pethidin 1 mg/KgBB
2. Obat antiemetik
Ondansetron 4mg/2mL
Sotatic 10mg/2 mL
3. Obat induksi
Propofol 1,5-2,5 mg/Kg/BB
4. Obat musculorelaksan
Recorium bromide 0,5-1 mg/Kg/BB
Sucynil Colin 1 mg/KgBB
Roculax 0,5-1 mg/KgBB
5. Obat emergency
Adrenalin injeksi
Epidrin injeksi
Dexamethason injeksi

Aminophilin injeksi
6. Obat analgetik
Ketorolac 30 mg/ 1 mL
Torasix 30mg/1 mL
7. Oat antidotum
Prostigmin dan narkan
8. Cairan yang diperlukan
Kristaloid seperto ringer laktat, aquadest 25 CC untuk larutan obat, assering
Koloid seperti fimahest atau gelofusion

MASTEKTOMI

Prosedur Operasi Mastektomi


Secara singkat tekhnik operasi dari mastektomi radikal modifikasi dapat dijelaskan
sebagai berikut:
1. Penderita dalam general anaesthesia, lengan ipsilateral dengan yang dioperasi
diposisikan abduksi 900, pundak ipsilateral dengan yang dioperasi diganjal bantal tipis.
2. Desinfeksi lapangan operasi, bagian atas sampai dengan pertengahan leher, bagian
bawah sampai dengan umbilikus, bagian medial sampai pertengahan mammma
kontralateral, bagian lateral sampai dengan tepi lateral skapula. Lengan atas
didesinfeksi melingkar sampai dengan siku kemudian dibungkus dengan doek steril
dilanjutkan dengan mempersempit lapangan operasi dengan doek steril
3. Bila didapatkan ulkus pada tumor payudara, maka ulkus harus ditutup dengan kasa
steril tebal ( buick gaas) dan dijahit melingkar.

4. Dilakukan insisi (macam macam insisi adalah Stewart, Orr, Willy Meyer, Halsted, insisi
S) dimana garis insisi paling tidak berjarak 2 cm dari tepi tumor, kemudian dibuat flap.
5. Flap atas sampai dibawah klavikula, flap medial sampai parasternal ipsilateral, flap
bawah sampai inframammary fold, flap lateral sampai tepi anterior m. Latissimus dorsi
dan mengidentifikasi vasa dan. N. Thoracalis dorsalis
6. Mastektomi dimulai dari bagian medial menuju lateral sambil merawat perdarahan,
terutama cabang pembuluh darah interkostal di daerah parasternal. Pada saat sampai
pada tepi lateral m.pektoralis mayor dengan bantuan haak jaringan maamma
dilepaskan dari m. Pektoralis minor dan serratus anterior (mastektomi simpel). Pada
mastektomi radikal otot pektoralis sudah mulai
7. Diseksi aksila dimulai dengan mencari adanya pembesaran KGB aksila Level I (lateral
m. pektoralis minor), Level II (di belakang m. Pektoralis minor) dan level III ( medial m.
pektoralis minor). Diseksi jangan lebih tinggi pada daerah vasa aksilaris, karena dapat
mengakibatkan edema lengan. Vena-vena yang menuju ke jaringan mamma diligasi.
Selanjutnya mengidentifikasi vasa dan n. Thoracalis longus, dan thoracalis dorsalis,
interkostobrachialis. KGB internerural selanjutnya didiseksi dan akhirnya jaringan
mamma dan KGB aksila terlepas sebagai satu kesatuan (en bloc)
8. Lapangan operasi dicuci dengan larutan sublimat dan Nacl 0,9%.
9. Semua alat-alat yang dipakai saat operasi diganti dengan set baru, begitu juga dengan
handschoen operator, asisten dan instrumen serta doek sterilnya.
10. Evaluasi ulang sumber perdarahan
11. Dipasang 2 buah drain, drain yang besar ( redon no. 14) diletakkan dibawah vasa
aksilaris, sedang drain yang lebih kecil ( no.12) diarahkan ke medial.
12. Luka operasi ditutup lapais demi lapis
Komplikasi operasi Mastektomi
Dini :
-

pendarahan,
DIAGNOSA KEP.

NOC

NIC

Pola

nafas

tidak Setelah dilakukan asuhan Airway and breathing management :

efektif

keperawatan

Monitor ventilasi (jalan dan suara nafas)

berhubungan

selama..... pasienmenunjuk Lakukan management ventilasi dengan head

dengan penurunan an respiration

chin leaf / jaw trust positioning

tekanan

inspirasi control dengan kriteria hasil: Pasang

dan

ekspirasi Jalan nafas adequat

pemberian Suara nafas vesikuler


Saturasi O2 dbn
agent anastesi.
infeksi Setelah

mou

Lakukan assisted respiration


Monitor vital sign dan saturasi O2 secara period

dilakukanasuhan Infection control management

keperawatan

dengan

menunjukkan

pembedahan,

protection, enviroment, host

selama......,

Kendalikan prosedur masuk kamar opera

infection untuk pasien maupun petugas

invasif and agent control dengan

dan truma jaringan.

nafas

Monitor keakuratan fungsi ET, LMA

berhubungan

prosedur

bantu

airway/orofaringeal tube, ET, LMA

karena

Resiko

alat

kriteria hasil

Batasi jumlah personil di kamar operasi

Kendalikan sterilitas ruangan dan peralata


yang dipakai

Terkendalinya

nfection

control

Lakukan cuci tangan bedah, pemakaian j

operasi, pemakaian sarung tangan dan d

Luka dan keadaan sekitar operasi sesuai prosedur.


bersih

Resiko

cidera Setelah

berhubungan
dengan

Terapkan prosedur septik aseptik.

Lakukan penutupan luka sesuai prosedur

Kolaborasi pemberian antibiotik


Environment kontrol

dilakukanasuhan Injury control management

keperawatan

Anatomis dan imobil position

anastesi selama......menunjukkan

Pasang groundit kouter dengan benar

dan pembedahan.

injury

neuromuscular

Melakukan tindakan anastesi sesuai denga

protection dengan kriteria prosedur


hasil :
Tidak

terjadi

luka

Memasang alat bantu pernafasan sesuai denga

baru prosedur

diluar organ target

Instrument
terhitung
lengkap
sebelum
dan

sesudah operasi.
-

lesi n. Thoracalis longus wing scapula

Lesi n. Thoracalis dorsalis.

Hindari manipulasi jaringan berlebihan

Penggunaan instrument yang tepat dan benar


Perhitungan jumlah instrument sebelum da
sesudah operasi yang

Lambat : - infeksi
-

nekrosis flap

wound dehiscence

seroma

edema lengan

kontrakturkekakuan sendi bahu


Mortalitas
hampir tidak ada

Diagnosa Keperawatan intra operatis yang sering muncul

Mastektomi :

- Pola nafas tidak efektif berhubungan dengan penurunan tekanan inspirasi danekspirasi
karena pemberian agent anastesi.
- Resiko infeksi berhubungan dengan pembedahan, prosedur invasif dan truma jaringan.
- Resiko cidera berhubungan dengan anastesi dan pembedahan.

Rencana Keperawatan intra operatif Mastektomi:

MASTEKTOMI

3. Fase Post operastif Mastektomi


a. Fase pasca anesthesia.
Setelah dilakukan mastektomi, penderita dipindah ke ruang pemulihan disertai dengan
oleh ahli anesthesia dan staf profesional lainnya.
1) Mempertahankan ventilasi pulmoner.
Menghindari terjadiya obstruksi pada periode anestesi pada saluran pernafasan,
diakibatkan penyumbatan oleh lidah yang jatuh, kebelakang dan tumpukan sekret,
lendir yang terkumpul dalam faring trakea atau bronkhial ini dapat dicegah dengan
posisi

yang

tepat

dengan

posisi

miring/setengah

telungkup

dengan

kepala

ditengadahkan bila klien tidak bisa batuk dan mengeluarkan dahak atau lendir, harus
dilakukan penghisapan dengan suction.
2) Mempertahankan sirkulasi
Pada saat klien sadar, baik dan stabil, maka posisi tidur diatur semi fowler untuk
mengurangi oozing venous (keluarnya darah dari pembuluh-pembuluh darah halus)
lengan diangkat untuk meningkatkan sirkulasi dan mencegah terjadinya udema, semua
masalah ini gangguan rasa nyaman (nyeri) akibat dari sayatan luka operasi merupakan
hal yang pailing sering terjadi
3) Masalah psikologis.

Payudara merupakan alat vital seseorang ibu dan wanita, kelainan atau kehilangan
akibat operasi payudara sangat terasa oleh pasien,haknya seperti dirampas sebagai
wanita normal, ada rasa kehilangan tentang hubungannya dengan ssuami, dan
hilangnya daya tarik serta serta pengaruh terhadap anak dari segi menyusui.
4) Mobilisasi fisik.
Pada pasien pasca mastektomi perlu adanya latihan-latihan untuk mencegah atropi
otot-otot kekakuan dan kontraktur sendi bahu, untuk mencegah kelainan bentuk
(diformity) lainnya, maka latihan harus seimbang dengan menggunakan secara
bersamaan.
b. Perawatan post mastektomi
1) Pemasangan plester /hipafik
Dalam hal ini pemasangan plester pada operasi mastektomi hendaknya diperhatikan
arah tarikan-tarikan kulit (langer line) agar tidak melawan gerakkan-gerakkan alamiah,
sehingga pasien dengan rileks menggerakkan sendi bahu tanpa hambatan dan tidak
nyeri untuk itu perlu diperhatikan cara meletakkan kasa pada luka operasi dan cara
melakukan fiksasi plester pada dinding dada.
Plester medial melewati garis midsternal
Plester posterior melewati garis axillaris line/garis ketiak
Plester posterior(belakang) melewati garis axillaris posterior.
Plester superior tidak melewati clavicula
Plester inferior harus melewati lubang drain
Untuk dibawah klavicula ujug hifavik dipotong miring seperti memotong baju dan
dipasang miring dibawah ketiak sehingga tidak mengangu grakkan tangan.
2) Perawatan pada luka eksisi tumor.
Bila dikerjakan tumorektomi,pakai hipafik ukuran 10 cm yang dibuat seperti BH
sehingga menyangga payudara .
3) Klien yang dikerjakan transplantasi kulit kalau kasa penutup luka basah dengan darah
atau serum harus segera diganti, tetapi bola penutup (thiersch) tidak boleh dibuka.

4) Pemberian injeksi dan pengambilan darah.


5) Pengukuran tensi
Diagnosa keperawatan post operasi yang sering muncul
-

Mastektomi::

Resiko aspirasi berhubungan dengan status kesadaran, reflek menelan belum optimal
karena pemakaian obat anastesi

Resiko cidera berhubungan dengan tingkat kesadaran pasien

Rencana intervensi keperawatan post operasi


DIAGNOSA KEP.
NOC
Resiko
aspirasi
dilakukanasuhan
berhubungan
dengan Setelah
status kesadaran, reflek keperawatan
selama......,
menelan belum optimal
control
karena pemakaian obat menunjukkan
anastesi
dengan kriteria hasil

Airway

terkontrol

adequat
Reflek menelan efektif

Mastektomi:
NIC
Aspiration Precaution :
Monitor

tingkat

kesadaran

dan

reflek

menelan
Monitor status airway dan bebaskan airway

dan Lakukan suctioning jika perlu


Posisikan supinasi atau posisi SIM pada
operasi jalan nafas

Resiko
cidera
dilakukanasuhan Environment Management :
berhubungan
dengan Setelah
tingkat
kesadaran keperawatan
selama......, Sediakan lingkungan yang aman dan nyaman
pasien
menunjukkan risk control Posisikan tidur sesuai instruksi medis /
dengan kriteria hasil

anastesi

Pasien terbebas dari cidera Memasang side trail tempat tidur


Pasien komunikatif dan
Hindari dari perabot yang berbahaya
kooperatif
Kaji tingkat kesadaran
Dampingi selama pasien belum sadar penuh
Lindungi arah gerakan dan jangan lawan
gerakan pasien

Rangsang kesadaran pasien ke Compos


Mentis
Alat invasif terkontrol

DAFTAR PUSTAKA

Closkey ,Joane C. Mc, Gloria M. Bulechek.(1996). Nursing Interventions Classification (NIC). St.
Louis :Mosby Year-Book.
Johnson,Marion, dkk. (2000). Nursing Outcome Classifications (NOC). St. Louis :Mosby YearBook
Juall,Lynda,Carpenito

Moyet.

(2003).Buku

Saku

Diagnosis

Keperawatan

edisi

10.Jakarta:EGC
Price Sylvia, A (1994), Patofisiologi: Konsep Klinis Proses-Proses Penyakit. Jilid 2 . Edisi 4.
Jakarta. EGC
Sjamsulhidayat, R. dan Wim de Jong. 1998. Buku Ajar Imu Bedah, Edisi revisi. EGC : Jakarta.
Smeltzer, Suzanne C. and Brenda G. Bare. 2002. Buku Ajar Keperawatan Medikal Bedah :
Brunner Suddarth, Vol. 2. EGC : Jakarta.
Sjamsuhidajat. R (1997), Buku ajar Ilmu Bedah, EGC, Jakarta
Wiley dan Blacwell. (2009). Nursing Diagnoses: Definition & Classification 2009-2011,
NANDA.Singapura:Markono print Media Pte Ltd

ASKEP MASTEKTOMI
MASTEKTOMI
Mastektomi adalah pembedahan yang dilakukan untuk mengangkat payudara.di
masa lalu, mastektomi radikal dengan pengangkatan seluruh payudara merupakan
penanganan standar kanker payudara.namun kemajuan medis selama 20 tahun
terakhir ini telah memberi lebih banyak pilihan bagi wanita penderita kanker
payudara. Salah satu pilihan tersebut bernama breast-conservingtherapy ( BCT)

atau terapi penyelamatan payudara. Pilihan ini akan membawa wanita untuk dapat
memilih prosedur yang lebih mengarah pada pencapaian efektifitas penanganan.]
Pilihan pengobatan untuk kanker payudara tergantung pada tipe, ukuran, dan
lokasi tumor, juga karakteristik klinis ( derajat ). Terapi dapat termasuk intervensi
bedah

dengan/tanpa

radiasi,

kemoterapi

dan

terapi

hormone.penggunaan

transplantasi sum-sum tulang masih dalam penelitian.


Tipe mastektomi dan penanganan kanker payudara bergantung pada beberapa
factor meliputi :

Usia

Kesehatan secara menyeluruh

Status menopause

Dimensi tumor

Tahapan tumor dan seberapa luas penyebarannya

Stadium tumor dan keganasannya

Status reseptor homon tumor

Penyebaran tumor telah mencapai simpul limfe atau belum


Tipe pembedahan secara umum dikelompokkan kedalam tiga kategori :
mastektomi radikal, mastektomi total dan prosedur yang lebih terbatas ( contoh
segmental, lumpektomi ).

1. Mastektomi preventif ( preventife mastectomy) disebut juga prophylactic


mastectomy.operasi ini dapat berupa total mastektomi dengan mengangkat seluruh
payudara dan putting atau berupa subcutaneous mastectomy dimana seluruh
payudara diangkat namun putting tetap dipertahankan .
2. Mastektomi total ( sederhana ) mengangkat semua jaringan payudara tetapi semua
atau kebanyakan nodus limfe dan otot dada tetap utuh.
3. Mastektomi radikal modifikasi mengangkat seluruh payudara , beberapa atau semua
nodus limfe dan kadang-kadang otot pektoralis minor.otot dada mayor masih
utuh.Mastektomi radikal ( halsted ) adalah prosedur yang jarang dilakukan yaitu
pengangkatan seluruh payudara, kulit, otot pektoralis mayor dan minor, nodus limfe
ketiak dan kadang-kadang nodus limfe mamari internal atau supra klavikular.
4. Prosedur membatasi ( contoh : lumpektomi ) mungkin dilakukan pada pasien rawat
jalan yang hanya berupa tumor dan beberapa jaringan sekitarnya diangkat.
Lumpektomi dianggap tumor non-metastatik bila kurang dari 5 cm ukurannya yang
tidak melibatkan putting.prosedur meliputi dignostik ( menentukan tipe sel ) dan
atau pengobatan bila dikombinasi dengan terapi radiasi.

PERAWATAN PERIOPERATIF MASTEKTOMI


Pengkajian
Riwayat kesehatan mencakup suatu pengkajian tentang reaksi pasien terhadap
diagnosis dan kemampuannya untuk mengatasi situasi tersebut. Pertanyaan yang
berhubungan mencakup yang berikut :

Bagaimana pasien berespon terhadap diagnosis ?

Mekanisme koping apa yang pasien temukan paling membantu ?

Dukungan psikologis atau emosional apa yang ia gunakan ?

Apakah ada pasangan, anggota keluarga atau teman untuk membantunya dalam
membuat pilihan pengobatan ?

Bagian informasi mana yang paling penting yang pasien butuhkan ?

Apakah pasien mengalami ketidaknyamanan ?


PRA-OPERASI
Diagnose keperawatan pra operasi
Berdasarkan pada data pengkajian, diagnose keperawatan yang sering muncul
sebagai berikut :

1. Ansietas berhubungan dengan ancaman kematian, ancaman konsep diri , perubahan


gambaran diri , perubahan status kesehatan ditandai dengan :

Peningkatan tegangan ,ketakutan ,perasaan tak berdaya

Penurunan keyakinan diri

Focus pada diri sendiri, gelisah, rangsangan simpatis

Mengekspresikan masalah sehubungan dengan perubahan hidup potensial/ actual


Rencana tindakan / intervensi keperawatan

1. Yakinkan informasi pasien tentang diagnosis, harapan intervensi pembedahan, dan


terapi yang akan datang. Perhatikan adanya penolakan atau ansietas ekstrem.
R/ memberikan dasar pengetahuan perawat untuk menguatkan kebutuhan informasi
dan membantu untuk mengidentifikasi pasien dengan ansietas tinggi , dan kebutuhan
perhatian khusus.
2. Jelaskan tujuan dan persiapan untuk tes diagnostic
R/ pemahaman jelas akan prosedur dan apa yang terjadi meningkatkan perasaan
control dan mengurangi ansietas.
3. Berikan lingkungan perhatian, keterbukaan, dan penerimaan juga privasi untuk
pasien/ orang terdekat.anjurkan bahwa orang terdekat ada kapanpun diinginkan.

R/ waktu dan privasi diperlukan untuk memberikan dukungan, diskusi perasaan tentang
antisipasi kehilangan dan masalah lain.
4. Dorong pertanyaan dan berikan waktu untuk mengekspresikan takut. Beritahu
pasien bahwa stress sehubungan dengan kanker payudara dapat menetap selama
beberapa bulan dan perlu mencari bantuan/ dukungan
R/ memberi kesempatan untuk mengidentifikasi dan memperjelas kesalahan konsep
dan menawarkan dukungan emosi
5. Kaji tersedianya dukungan pada pasien. Berikan informasi tentang sumber komunitas
bila ada. Dorong/ berikan kunjungan seorang wanita yang telah sembuh dari
mastektomi
R/ menjadi sumber yang membantu bila pasien siap. Kelompok sebaya yang mengalami
pengalaman serupa bertindak sebagai model peran dan memberikan keyakinan
terhadap pernyataan, harapan untuk sembuh/ masa depan normal.
6. Diskusikan/ jelaskan peran rehabilitasi setalah pembedahan
R/ rehabilitasi adalah komponen terapi penting untuk memenuhi kebutuhan fisik,
sosial, emosional, dan vokasional sehingga pasien dapat mencapai tingkat fisik dan
fungsi emosi sebaik mungkin.
PASCA OPERASI
Diagnose keperawatan pasca operasi
1. Kerusakan integrasi kulit/ jaringan berhubungan dengan pengangkatan bedah kulit/
jaringan ,perubahan sirkulasi, adanya edema, drainase ,perubahan pada elastisitas
kulit, sensasi, dekstrusi jaringan ( radiasi ) ditandai dengan adanya :

Kerusakan permukaan kulit

kerusakan lapisan kulit/ jaringan subkutan

2. Nyeri akut berhubungan dengan prosedur pembedahan ,trauma jaringan , interupsi


saraf, diseksi otot. Ditandai dengan :

Keluhan kekakuan

Kebas pada area dada

Nyeri bahu/ lengan

Perubahan tonus otot

Focus pada diri sendiri

Distraksi/ melindungi bagian yang nyeri

3. Gangguan konsep diri : harga diri rendah berhubungan dengan biofisikal : prosedur
bedah yang mengubah gambaran tubuh, psikososial , masalah tentang ketertarikan
seksual ditandai dengan :

Perubahan actual pada struktur/ kontur tubuh

Menyatakan ketakutan penolakan oleh orang lain

Perubahan dalam lingkungan sosial

Perasaan negative terhadap tubuh

Selalu memikirkan tentang perubahan atau kehilangan

Tidak mau melihat tubuh

Tidak berpartisipasi dalam terapi

4. Kerusakan mobilitas fisik berhubungan dengan gangguan neuromuscular , nyeri /


ketidaknyamanan , pembentukan edema ditandai dengan :

Menolak untuk bergerak

Membatasi rentang gerak

Penurunan massa otot / kekuatan

5. Kurang pengetahuan tentang kondisi, prognosis ,dan kebutuhan pengobatan


berhubungan dengan kurang terpajan/ mengingat, salah interpretasi/ informasi
ditandai dengan :

Pertanyaan/ permintaan informasi

Pernyataan salah konsepsi

Tidak akurat mengikuti instruksi/ terjadinya komplikasi yang dapat dicegah


Tindakan / intervensi keperawatan
NDx. 1

1. Kaji balutan /luka untuk karakteristik drainase. Awasi jumlah edema , kemerahan
dan nyeri pada insisi dan lengan
R/

penggunaan

balutan

tergantung

luasnya

pembedahan

dan

tipe

penutupan

luka.drainase terjadi karena trauma prosedur dan manipulasi banyak pembuluh


darah dan limpatik pada area tersebut. Pengenalan dini adanya infeksi dapat
memampukan pengobatan dengan cepat
2. Tempatkan pada posisi semi fowler pada punggung atau sisi yang tak sakit dengan
lengan tinggi dan disokong dengan bantal
R/ membantu drainase cairan dengan gravitasi
3. Jangan

melakukan

pengukuran

tekanan

darah,

menginjeksikan

obat

memasukkan IV pada lengan yang sakit


R/ meningkatkan potensial kontriksi, infeksi dan limfedema pada sisi yang sakit

atau

4. Inspeksi donor/ sisi tandur ( bila dilakukan ) terhadap warna .pembentukan lepuh.
Perhatikan drainase dari sisi donor
R/ warna dipengaruhi adanya suplai sirkulasi .pembentukan lepuh memberikan tempat
pertumbuhan bakteri/ infeksi
5. Kosongkan drain luka secara periodic.cata jumlah dan karakteristik drainase
R/ akumulasi cairan drainase meningkatkan penyembuhan dan menurunkan kerentanan
terhadap infeksi
6. Dorong untuk menggunakan pakaian yang tidak sempit / ketat .beritahu pasien untuk
tidak menggunakan jam tangan atau perhiasan lain pada tangan yang sakit
R/ menurunkan tekanan pada jaringan yang terkena ,yang dapat memperbaiki
sirkulasi/ penyembuhan
NDx.2
1. Kaji keluhan nyeri, perhatikan lokasi, lamanya dan intensitas ( skala 0-10 ).
Perhatikan petunjuk verbal dan non- verbal
R/ membantu dalam mengidentifikasi derajat ketidaknyamanan dan kebutuhan untuk/
keefektifan analgesic. Jumlah jaringan, otot, dan system limfatik diangkat dapat
mempengaruhi jumlah nyeri yang dialami
2. Diskusikan sensasi masih adanya payudara normal
R/ memberikan keyakinan bahwa sensasi bukan imajinasi dan penghilangannya dapat
dilakukan
3. Bantu pasien menemukan posisi nyaman
R/ peninggian lengan, ukuran baju dan adanya drain mempengaruhi kemampuan pasien
untuk rileks dan istirahat secara efektif
4. Berikan tindakan kenyamanan dasar dan aktivitas terapeutik. Dorong ambulasi dini
dan penggunaan tehnik relaksasi, bimbingan imajinasi, sentuhan terapeutik
R/

meningkatkan

relaksasi,

membantu

untuk

memfokuskan

perhatian,

dapat

meningkatkan kemampuan koping


5. Tekan/ sokong dada saat latihan batuk/ napas dalam
R/ memudahkan partisipasi pada aktivitas tanpa timbul ketidaknyamanan
6. Berikan obat nyeri yang tepat pada jadwal yang teratur sebelum nyeri berat dan
sebelum aktivitas dijadwalkan
R/ mempertahankan tingkat kenyamanan dan memungkinkan pasien untuk latihan
lengan dan untuk ambulasi tanpa nyeri yang menyertai upaya tersebut
NDx.3

1. Dorong pertanyaan tentang situasi saat ini dan harapan yang akan datang.berikan
dukungan emosional bila balutan bedah diangkat
R/ kehilangan payudara menyebabkan reaksi, termasuk perasaan perubahan gambaran
diri, takut jaringan parut, dan takut reaksi pasien terhadap perubahan tubuh
2. Identifikasi masalah peran sebagai wanita, istri, ibu, wanita karir, dsb
R/ dapat menyatakan bagaimana pandangan diri pasien telah berubah

3. Dorong pasien untuk mengekspresikan perasaan missal; marah, bermusuhan dan


berduka.
R/ kehilangan bagian tubuh, hilangnya bagian tubuh, dan menerima kehilangan hasrat
seksual menambah proses kehilangan yang membutuhkan penerimaan sehingga
pasien dapat membuat rencana untuk masa depan.
4. Diskusikan tanda/ gejala depresi dengan pasien/ orang terdekat
R/ reaksi umum terhadap tipe prosedur dan kebutuhan ini dikenali dan di ukur
5. Berikan penguatan positif untuk peningkatan / perbaikan dan partisipasi perawatan
diri / program pengobatan.
R/ mendorong kelanjutan prilaku sehat
6. Kaji ulang kemungkinan untuk bedah rekonstruksi dan atau pemakaian prostetik
R/ bila mungkin, rekonstruksi memberikan sedikit penampilan tak lengkap, variasi
pada lipatan kulit dapat dilakukan untuk memudahkan proses rekonstruksi
selanjutnya.
7. Yakinkan perasaan/ masalah pasangan sehubungan dengan aspek seksual dan
memberikan informasi dan dukungan
R/ respon negative yang diarahkan pada pasien dapat secara actual menyatakan
masalah pasangan tentang rasa sedih pasien ,takut kanker/ kematian
8. Diskusikan dan rujukan ke kelompok pendukung ( bila ada ) untuk orang terdekat
R/ memberikan tempat untuk pertukaran masalah dan perasaan dengan orang lain yang
mengalami pengalaman yang sama dan mengidentifikasi cara orang terdekat dapat
memudahkan penyembuhan pasien
9. Berikan prosthesis sementara yang halus bila diindikasikan
R/ prosthesis nilon dan dakron dapat dipakai pada bra sampai insisi sembuh bila bedah
rekonstruksi tidak dilakukan pada waktu mastektomi.ini meningkatkan penerimaan
sosial dan memungkinkan pasien untuk merasa nyaman tentang gambaran tubuh pada
waktu pulang

NDx.4
1. Tinggikan lengan yang sakit sesuai indikasi.
R/ meningkatkann aliran balik vena mengurangi kemungkinan limfedema.
2. Bantu dalam aktivitas perawatan diri sesuai keperluan
R/ menghemat energy pasien dan mencegah kelelahan

3. Bantu ambulasi dan dorong memperbaiki postur


R/ pasien akan merasa tidak seimbang dan dapat memerlukan bantuan sampai terbiasa
terhadap perubahan
4. Tingkatkan latihan sesuai indikasi
R/ mencegah kekakuan sendi, meningkatkan sirkulasi dan mempertahankan tonus otot
bahu dan lengan
5. Diskusikan tipe latihan yang dilakukan dirumah untuk meningkatkan kekuatan dan
meningkatkan sirkulasi pada lengan yang sakit
R/ program latihan membutuhkan kesinambungan untuk meningkatkan fungsi optimal
sisi yang sakit
NDx.5
1. Kaji proses penyakit, prosedur pembedahan dan harapan yang akan datang
R/ memberikan pengetahuan dasar dimana pasien dapat membuat pilihan berdasarkan
informasi
2. Tunjukkan penggunaan kompres intermitten sesuai kebutuhan
R/ alat bantu pneumatic kadang-kadang membantu dalam penanganan limfedema
dengan meningkatkan sirkulasi dan aliran balik vena
3. Anjurkan pijatan lembut pada insisi yang sembuhdengan minyak
R/ merangsang sirkulasi meningkatkan elastisitas kulit dan menurunkan
ketidaknyamanan
4. Dorong pemeriksaan diri teratur pada payudara yang masihn ada
R/ mengidentifikasi perubahan jaringan payudara yang mengindikasikan adanya /
berulangnya tumor baru
5. Tekankan pentingnya evaluasi medic secara teratur
R/ pengobatan lain mungkin diperlukan sebagai terapi tambahan .berulangnya
keganasan tumor payudara juga dapat diidentifikasi dan ditangani oleh onkologis

Diposkan oleh Kanrado's di 17.31


Kirimkan Ini lewat EmailBlogThis!Berbagi ke TwitterBerbagi ke FacebookBagikan ke
Pinterest

Tidak ada komentar:


Poskan Komentar

A. Konsep Teori Tentang Penyakit

1.

Pengertian

Suatu keadaan di mana sel kehilangan kemampuannya dalam


mengendalikan kecepatan pembelahan dan pertumbuhannya. Normalnya, sel
yang mati sama dengan jumlah sel yang tumbuh. Apabila sel tersebut sudah
mengalami malignansi/ keganasan atau bersifat kanker maka sel tersebut
terus menerus membelah tanpa memperhatikan kebutuhan, sehingga
membentuk tumor atau berkembang tumbuh baru tetapi tidak semua yang
tumbuh baru itu bersifat karsinogen.(Daniele gale 1996).
Kanker payudara adalah sekelompok sel tidak normal pada payudara
yang terus tumbuh berupa ganda. Pada akhirnya sel-sel ini menjadi bentuk
bejolan di payudara. Jika benjolan kanker itu tidak dibuang atau terkontrol,
sel-sel kanker bisa menyebar (metastase) pada bagian-bagian tubuh lain.
Metastase bisa terjadi pada kelenjar getah bening (limfe) ketiak ataupun di
atas tulang belikat. Selain itu sel-sel kanker bisa bersarang di tulang, paruparu, hati, kulit, dan bawah kulit. (Erik T, 2005, hal : 39-40)

Karsinoma mammae adalah karsinoma yang berasal dari


parenkim, stroma, areola dan papilla mamma. (Lab. UPF Bedah RSDS, 1984)

2.

Etiologi
Etiologi kanker payudara tidak diketahui dengan pasti. Namun beberapa faktor resiko pada
pasien diduga berhubungan dengan kejadian kanker payudara, yaitu :

a.

Tinggi melebihi 170 cm


Wanita yang tingginya 170 cm mempunyai resiko terkena kanker payudara karena pertumbuhan
lebih cepat saat usia anak dan remaja membuat adanya perubahan struktur genetik (DNA) pada
sel tubuh yang diantaranya berubah ke arah sel ganas.

b. Masa reproduksi yang relatif panjang.


c.

Menarche pada usia muda dan kurang dari usia 10 tahun.

d. Wanita terlambat memasuki menopause (lebih dari usia 60 tahun)


e.

Wanita yang belum mempunyai anak


Lebih lama terpapar dengan hormon estrogen relatif lebih lama dibandingkan wanita yang sudah
punya anak.

f.

Kehamilan dan menyusui


Berkaitan erat dengan perubahan sel kelenjar payudara saat menyusui.

g. Wanita gemuk
Dengan menurunkan berat badan, level estrogen tubuh akan turun pula.
h. Preparat hormon estrogen

Penggunaan preparat selama atau lebih dari 5 tahun.


i.

Faktor genetik
Kemungkinan untuk menderita kanker payudara 2 3 x lebih besar pada wanita yang ibunya
atau saudara kandungnya menderita kanker payudara. (Erik T, 2005, hal : 43-46).

3.

Tanda dan Gejala


Pada tahap awal kanker payudara, biasanya tidak merasakan sakit atau tidak ada tanda-tandanya
sama sekali. Namun, ketika tumor semakin membesar, gejala-gejala di bawah ini mungkin
muncul (Anita, 2007).

a.

Benjolan yang tidak hilang atau permanen dan menggumpal, biasanya tidak sakit dan terasa
keras bila disentuh atau penebalan pada kulit payudara atau di sekitar ketiak.

b. Perubahan ukuran dan bentuk payudara.


c.

Kerutan pada kulit payudara.

d. Keluar cairan tidak normal dari puting susu yang berupa nanah, darah, cairan encer atau keluar
air susu pada ibu tidak hamil atau tidak sedang menyusui.
e.

4.

Pembengkakan atau adanya tarikan pada puting susu.


Patofisiologi
Kanker payudara bukan satu-satunya penyakit tapi banyak, tergantung pada jaringan
payudara yang terkena, ketergantungan estrogennya, dan usia permulaannya. Penyakit payudara
ganas sebelum menopause berbeda dari penyakit payudara ganas sesudah masa menopause

(postmenopause). Respon dan prognosis penanganannya berbeda dengan berbagai penyakit


berbahaya lainnya.
Beberapa tumor yang dikenal sebagai estrogen dependent mengandung reseptor yang
mengikat estradiol, suatu tipe ekstrogen, dan pertumbuhannya dirangsang oleh estrogen.
Reseptor ini tidak manual pada jarngan payudara normal atau dalam jaringan dengan dysplasia.
Kehadiran tumor Estrogen Receptor Assay (ERA) pada jaringan lebih tinggi dari kankerkanker payudara hormone dependent. Kanker-kanker ini memberikan respon terhadap hormone
treatment (endocrine chemotherapy, oophorectomy, atau adrenalectomy). (Smeltzer, dkk, 2002,
hal : 1589)

5.

Komplikasi

Komplikasi utama adalah metastase jaringan sekitarnya yang melalui kelenjar


limfe dan pembuluh darah ke organ-organ lain. Tempat yang sering terjadi
metastase adalah paruparu, pleura, tulang dan hati.
6.

Pemeriksaan Penunjang
Menurut Michael D, dkk (2005), hal : 15-66 pemeriksaan penunjang untuk kanker payudara
meliputi :

a.

Mammagrafi, yaitu pemeriksaan yang dapat melihat struktur internal dari payudara, hal ini
mendeteksi secara dini tumor atau kanker.

b. Ultrasonografi, biasanya digunakan untuk membedakan tumor sulit dengan kista.


c.

CT. Scan, dipergunakan untuk diagnosis metastasis carsinoma payudara pada organ lain

d. Sistologi biopsi aspirasi jarum halus

e.

Pemeriksaan hematologi, yaitu dengan cara isolasi dan menentukan sel-sel tumor pada
peredaran darah dengan sendimental dan sentrifugis darah.

7.

Penatalaksanaan
Menurut Smeltzer, dkk (2002), hal : 1596 1600 penatalaksanaan yang dapat dilakukan untuk
penderita kanker payudara meliputi :

a.

Pembedahan

1) Mastektomi parsial (eksisi tumor lokal dan penyinaran). Mulai dari lumpektomi sampai
pengangkatan segmental (pengangkatan jaringan yang luas dengan kulit yang terkena).
2) Mastektomi total dengan diseksi aksial rendah seluruh payudara, semua kelenjar limfe dilateral
otocpectoralis minor.
3) Mastektomi radikal yang dimodifikasi Seluruh payudara, semua atau sebagian besar jaringan
aksial
a) Mastektomi radikal Seluruh payudara, otot pektoralis mayor dan minor dibawahnya : seluruh isi
aksial.
b) Mastektomi radikal yang diperluas Sama seperti mastektomi radikal ditambah dengan kelenjar
limfe mamaria interna.

b. Non pembedahan
1) Penyinaran

Pada payudara dan kelenjar limfe regional yang tidak dapat direseksi pada kanker lanjut; pada
metastase tulang, metastase kelenjar limfe aksila.
2) Kemoterapi
Adjuvan sistematik setelah mastektomi; paliatif pada penyakit yang lanjut.
3) Terapi hormon dan endokrin
Kanker yang telah menyebar, memakai estrogen, androgen, antiestrogen, coferektomi
adrenalektomi hipofisektomi.
B. Konsep Teori Proses Keperawatan
Proses keperawatan merupakan suatu cara berpikir dan bertindak yang spesial (khusus)
dalam melakukan asuhan keperawatan. Dalam proses keperawatan, terdapat beberapa tindakan
yang saling berkaitan antara satu dengan yang lain yaitu: assessment (pengkajian), diagnosis
(penentuan diagnosa), perencanaan hasil (planning: outcome), perencaan intervensi (planning:
intervention), pelaksanaan (implementation) dan evaluasi (evluation) (Wilkinson, 2007)

1.

Pengkajian
Pada dasarnya tujuan pengkajian adalah mengumpulkan data objektif dan data subyektif
dari klien. Adapun data yang terkumpul mencakup klien, keluarga, masyarakat, lingkunagan,
atau kebudayaan. (mc. Forland & Mc. Farlane, 1997).
Pengkajian adalah pengumpulan data yang berhubungan dengan pasien secara sistematis,
meliputi fisik, psikologi, sosiokultural, spiritual, kognitif, kemampuan fungsional, perkembangan

ekonomi dan gaya hidup. Pengkajian mencakup data yang dikumpulkan melalui wawancara,
pengumpulan riwayat kesehatan, pemeriksaan fisik, laboratorium dan diagnostik, serta review
catatan sebelumnya.(Dongoes, 2000)
Menurut Rothrock (2000) pengkajian merupakan fase pertama dalam keperawatan yang
meliputi pengumpulan data dan organizing data. Pengumpulan data adalah alat utama pengkajian
awal pasien dan merupakan proses yang kontinyu untuk memperoleh informasi yang diperlukan
untuk memberikan asuhan keperawatan. Informasi aktual atau potensial dapat datang secara
langsung dari pasien, keluarga atau teman, rekam medik, atau tenaga kesehatan lain. Datanya
subyektif (apa yang dinyatakan klien), atau data obyektif apa yang dilihat, dicium, didengar, atau
disentuh oleh perawat.
Data diperoleh dengan wawancara, pemeriksaan fisik, atau dengan membaca laporan
(hasil rontgen, pemeriksaan laboratorium, catatan perkembangan atau konsultasi). Organisasi
data adalah pengorganisasian dan pengolahan informasi penting untuk membantu pengambilan
keputusan yang efesien.
Adapun hal-hal yang perlu diperhatikan selama pengkajian antara lain :
1) Memahami secara keseluruhan situasi yang sedang dihadapi oleh klien dengan cara
memperhatikan kondisi fisik, psikologi, emosi, sosiokultural dan spiritual yang bisa
mempengaruhi status kesehatannya.
2) Mengumpulkan semua informasi yang bersangkutan dengan masa lalu, saat ini bahkan sesuatu
yang berpotensi menjadi masalah bagi klien guna membuat suatu database yang lengkap. Data

yang terkumpul berasal dari perawat klien selama berinteraksi dan sumber yang lain. (Gordon,
1987 ; 1994)
3) Memahami bahwa klien adalah sumber informasi primer.
4) Sumber informasi sekunder meliputi anggota keluarga, orang yang berperan penting dan catatan
kesehatan klien.
Metode pengumpulan data meliputi :
1) Melakukan wawancara (anamnesa)
2) Riwayat kesehatan sekarang
3) Pemeriksaan fisik
4) Mengumpulkan data penunjang hasil laboratorium dan diagnostik lain serta catatan kesehatan
(rekam medik).

2.

Diagnosa
Diagnosa

keperawatan

adalah

analisa

data

yang

telah

dikumpulkan

untuk

mengidentifikasi, memfokuskan dan mengatasi kebutuhan spesifik pasien serta respon terhadap
masalah aktual dan resiko tinggi.(Dongoes, 2000)
The North American Nursing Diagnosis Association(NANDA, 1992) mendefinisikan
diagnosa keperawatan semacam keputusan klinik yang mencakup klien, keluarga, dan respon
komunitas terhadap sesuatu yang berpotensi sebagai masalah kesehatan dalam kehidupannya.

Dalam membuat diagnosa keperawatan dibutuhkan ketrampilan klinik yang baik,


mencakup proses diagnosa keperawatan dan perumusan dalam pembuatan pernyataan
keperawatan. Tipe diagnosa nanda ada tiga yaitu :
1) diagnosa keperawatan aktual adalah proses respon manusia saat ini terhadap kondisi kesehatan
atau proses kehidupan yang didukung oleh sekelompok batasan karakteristik (tanda dan gejala)
dan termasuk faktor yang berhubungan (etiologi) yang mempunyai konstribusi terhadap
perkembangan atau pemeliharaan kesehatan.
2) Diagnosa keperawatan resiko adalah menunjukkan respon manusia yang dapat timbul pada
seseorang atau kelompok yang rentan dan ditunjang dengan faktor resiko yang memberi
konstribusi pada peningkatan kesehatan.
3) Diagnosa keperawatan kesejahteraan, adalah menguraikan respon manusia terhadap tingkat
kesehatan pada individu atau kelompok yang mempunyai potensi peningkatan derajat kesehatan
lebih tinggi.

3.

Perencanaan
Perencanaan adalah proses dua bagian yaitu :
Pertama : identifikasi tujuan dan hasil yang diinginkan dari pasien untuk memperbaiki masalah
kesehatan atau kebutuhan yang telah dikaji, hasil yang diharapkan harus spesifik, realistik, dapat
diukur, menunjukkan kerangka waktu yang pasti, mempertimbangkan keinginan dan sumber
pasien.

Kedua : Pemilihan intervensi keperawatan yang tepat untuk membantu pasien dalam mencapai
hasil yang diharapkan. (Dongoes, 2000)
a. NOC (Nursing Outcomes Classification)
NOC adalah istilah standar untuk menggambarkan outcomes pasien.
Pengertian NOC: An outcome is an individual, family or community state, behavior, or perception, that
is measured along a continuum in response to nursing intervention (Moorhead, Johnson &
Maas, 2004, p. 25)
NOC (2004) terdiri dari 330 outcomes yang terbagi dalam tujuh domains (Moorhead, Johnson &
Maas, 2004):

1) Functional health
2) physiological health
3) psychosocial health
4) health knowledge and behavior
5) family health
6) perceived health
7)

community health

Component of NOC (Moorhead, Johnson & Maas, 2004)


1) Label: the broadly state

2) A definition: concrete, observable, behaviors and states that can be used to evaluate patient
status
3) List of indicators
4) Measurement scale: a five-point measurement scale is used to evaluate patient staus on each
indicator
Cara menggunakan NOC adalah dengan membandingkan nilai status dari
setiap indicator sebelum dan setelah dilakukan intervensi

Contoh penulisan NOC:


Aggression self control
140110 Identify when angry (5: consistently demonstrated)
Penulisan secara tradisional
Kontrol diri terhadap agresi, ditandai dengan kemampuan mengidentifikasi kapan saat marah
(ditunjukkan secara konsisten)
b. NIC (Nursing Intervention Classification)
NIC merupakan klasifikasi intervensi keperawatan yang dibuat untuk menyeragamkan bahasa
intervensi yang dilakukan oleh perawat.
NIC edisi ke empat terdiri dari 514 intervention dan edisi ke lima (2008) terdiri dari 542 aktifitas
(mempunyai sekitar 12000 aktifitas) (Bulechek, Butcher, & Dochterman, 2008)
Domain of NIC (Bulechek, Butcher, & Dochterman, 2008)

1) Basic physiological
2) Complex physiological
3) Behavior
4) Safety
5) Family
6) Health system
7) Community

Komponen NIC, setiap NIC terdiri dari


1) Label
2) Definisi
3) Aktifitas
Cara menggunakan NIC adalah dengan memilih aktifitas yang tepat untuk mencapai outcome
yang diharapkan.

4.

Implementasi
Menurut Dongoes (2000), Implementasi adalah melakukan tindakan dan mendokumentasikan
proses keperawatan sesuai dengan rencana keperawatan.
Menurut (Wilkinson, 2007) Hal-hal yang dilakukan dalam implementasi yang bisa dilakukan
oleh perawat terdiri dari:

1) Do (melakukan), implementasi pelaksanaan kegiatan dibagi dalam beberapa kriteria yaitu:


a) Dependent interventions: dilaksanakan dengan mengikuti order dari pemberi perawatan
kesehatan lain
b) Collaborative (interdependent): interventions yang dilaksanakan dengan professional kesehatan
yang lain
c) Independent (autonomous) intervention: intervensi dilakukan dengan melakukan nursing
orders dan sering juga sering juga digabungkan dengan order dari medis
2) Delegate (mendelegasikan): pelaksanaan order bisa didelegasikan hanya saja ada beberapa
tanggung jawab yang perlu dicermati oleh pemberi delegasi yaitu apakah tugas tersebut tepat
untuk didelegasikan, apakah komunikasi tepat dilakukan dan apakah ada supervisi atau
pengecekan kerja
3) Record (mencatat), pencatatan bisa dilakukan dengan berbagai format tergantung pilihan dari
setiap institusi

5.

Evaluasi
Evaluasi mengacu kepada penilaian, tahapan, dan perbaikan. Pada tahap ini perawat
menemukan penyebab mengapa suatu proses keperawatan dapat berhasil atau gagal (AlfaroLeFevre, 1994).
Kegiatan dalam fase evaluasi meliput evaluasi patient outcomes dan nursing process.
Evaluasi patient outcomes dilakukan dengan mereview indicator outcome. Evaluasi nursing

proses dilakukan dengan mereview fase assessment, diagnosis, planning: outcome, nursing order
dan implementation (Wilkinson, 2007)
Menurut Dongoes (2000), Evaluasi merupakan penentu kemajuan pasien terhadap
pencapaian hasil yang diharapkan dan respon terhadap keefektifan intervensi keperawatan.
Kemudian mengganti rencana perawatan jika diperlukan kelima tahapan tersebut adalah saling
berhubungan dan tidak bisa dipisah-pisahkan. Tahap-tahap ini secara bersama-sama membentuk
lingkaran pemikiran dan tindakan yang kontinyu.
C. Konsep Teori Tentang Asuhan Keperawatan Pada Kanker Payudara

1.

Pengkajian

1) Data biografi /biodata


Meliputi identitas klien dan identitas penanggung antara lain : nama, umur,
jenis kelamin, agama, pendidikan, pekerjaan dan alamat.
2) Riwayat keluhan utama.
Riwayat keluhan utama meliputi : adanya benjolan yang menekan payudara,
adanya ulkus, kulit berwarna merah dan mengeras, bengkak, nyeri.
3) Riwayat kesehatan masa lalu
Apakah pasien pernah mengalami penyakit yang sama sebelumnya.
Apakah ada keluarga yang menderita penyakit yang sama .

4) Pengkajian fisik meliputi :

Keadaan umum
Tingkah laku
BB dan TB
Pengkajian head to toe

5) Pemeriksaan laboratorium :
Pemeriksaan darah hemoglobin biasanya menurun, leukosit meningkat,
trombosit

meningkat

jika

ada

penyebaran

ureum

dan

kreatinin.

Pemeriksaan urine, diperiksa apakah ureum dan kreatinin meningkat.


6) Tes diagnostik yang biasa dilakukan pada penderita carsinoma mammae
adalah

sinar

X,

ultrasonografi,

xerora

diagrafi,

diaphanografi

dan

pemeriksaan reseptor hormon.


7) Pengkajian pola kebiasaan hidup sehari-hari meliputi :
a) Nutrisi
Kebiasaan makan, frekuensi makan, nafsu makan, makanan pantangan,
makanan yang disukai, banyaknya minum. Dikaji riwayat sebelum dan
sesudah masuk RS.

b) Eliminasi
Kebiasaan BAB / BAK, frekuensi, warna, konsistensi, sebelum dan sesudah
masuk RS.
c) Istirahat dan tidur
Kebiasaan tidur, lamanya tidur dalam sehari sebelum dan sesudah sakit.
d) Personal hygiene
a.

Frekuensi mandi dan menggosok gigi dalam sehari

b.

Frekuensi mencuci rambut dalam seminggu

c.

Dikaji sebelum dan pada saat di RS

8) Identifikasi masalah psikologis, sosial dan spritual :


a) Status psikologis
Emosi biasanya cepat tersinggung, marah, cemas, pasien berharap cepat
sembuh, merasa asing tinggal di RS, merasa rendah diri, mekanisme koping
yang negatif.
b) Status social
Merasa terasing dengan akibat klien kurang berinteraksi dengan masyarakat
lain.

c) Kegiatan keagamaan
Klien mengatakan kegiatan shalat 5 waktu berkurang.

9) Klasifikasi Data
Data pengkajian :
a) Data subyektif
Data yang diperoleh langsung dari klien dan keluarga, mencakup hal-hal
sebagai berikut : klien mengatakan nyeri pada payudara, sesak dan batuk,
nafsu makan menurun, kebutuhan sehari-hari dilayani di tempat tidur,
harapan klien cepat sembuh, lemah, riwayat menikah, riwayat keluarga.
b) Data obyektif
Data yang dilihat langsung atau melalui pengkajian fisik atau penunjang
meliputi : asimetris payudara kiri dan kanan, nyeri tekan pada payudara, hasil
pemeriksaan laboratorium dan diagnostik.
10) Analisa Data
Merupakan proses intelektual yang merupakan kemampuan pengembangan
daya pikir yang berdasarkan ilmiah, pengetahuan yang sama dengan masalah
yang didapat pada klien.
2.

Diagnosa

1) Nyeri berhubungan dengan adanya penekanan massa tumor.


2) Gangguan mobilitas fisik berhubungan dengan imobilisasi lengan/bahu.
3) Kecemasan berhubungan dengan perubahan gambaran tubuh.
4) Gangguan harga diri berhubungan dengan kecacatan bedah

5) Resiko infeksi berhubungan dengan luka operasi.


6) Kurangnya pengetahuan tentang kondisi, prognosis, dan serta pengobatan penyakitnya
berhubungan dengan kurangnya informasi.
7) Gangguan pemenuhan kebutuhan nutrisi berhubungan dengan intake tidak adekuat.

3.

Perencanaan

Perencanaan

keperawatan

adalah

pengembangan

dari

pencatatan

perencanaan perawatan untuk memenuhi kebutuhan klien yang telah


diketahui.
Pada perencanaan meliputi tujuan dengan kriteria hasil, intervensi, rasional,
implementasi dan evaluasi.
1) Gangguan rasa nyaman nyeri berhubungan dengan adanya penekanan massa
tumor
Ditandai dengan :
DS : Klien mengeluh nyeri pada sekitar payudara sebelah kiri menjalar ke
kanan.
DO : Klien nampak meringis, Klien nampak sesak, Nampak luka di verban
pada payudara sebelah kiri
Tujuan : Nyeri teratasi.
Kriteria Hasil :
a) Klien mengatakan nyeri berkurang atau hilang

b) Nyeri tekan tidak ada


c) Ekspresi wajah tenang
d) Luka sembuh dengan baik
Intervensi :
a) Kaji karakteristik nyeri, skala nyeri, sifat nyeri, lokasi dan penyebaran.
Rasional : Untuk mengetahui sejauhmana perkembangan rasa nyeri yang
dirasakan oleh klien sehingga dapat dijadikan sebagai acuan untuk intervensi
selanjutnya.
b) Beri

posisi

yang

menyenangkan.

Rasional

Dapat

mempengaruhi

kemampuan klien untuk rileks/istirahat secara efektif dan dapat mengurangi


nyeri.
c) Anjurkan teknik relaksasi napas dalam. Rasional : Relaksasi napas dalam
dapat mengurangi rasa nyeri dan memperlancar sirkulasi O2 ke seluruh
jaringan.
d) Ukur tanda-tanda vital Rasional : Peningkatan tanda-tanda vital dapat
menjadi acuan adanya peningkatan nyeri.
e) Penatalaksanaan pemberian analgetik Rasional : Analgetik dapat memblok
rangsangan nyeri sehingga dapat nyeri tidak dipersepsikan.
2) Gangguan mobilitas fisik berhubungan dengan imobilisasi lengan/bahu.
Ditandai dengan :

DS : Klien mengeluh sakit jika lengan digerakkan., Klien mengeluh badan


terasa lemah. Klien tidak mau banyak bergerak.
DO : Klien tampak takut bergerak.
Tujuan : Klien dapat beraktivitas
Kriteria Hasil :
a) Klien dapat beraktivitas sehari hari.
b) Peningkatan kekuatan bagi tubuh yang sakit.
Intervensi :
3) Kecemasan berhubungan dengan perubahan gambaran tubuh.
Ditandai dengan :
DS : Klien mengatakan takut ditolak oleh orang lain. Ekspresi wajah tampak
murung. Tidak mau melihat tubuhnya.
DO : Klien tampak takut melihat anggota tubuhnya.
Tujuan : Kecemasan dapat berkurang.
Kriteria Hasil :
a) Klien tampak tenang
b) Mau berpartisipasi dalam program terapi
Intervensi :

a) Dorong klien untuk mengekspresikan perasaannya. Rasional : Proses


kehilangan bagian tubuh membutuhkan penerimaan, sehingga pasien dapat
membuat rencana untuk masa depannya.
b) Diskusikan tanda dan gejala depresi. Rasional : Reaksi umum terhadap tipe
prosedur dan kebutuhan dapat dikenali dan diukur.
c) Diskusikan kemungkinan untuk bedah rekonstruksi atau pemakaian
prostetik. Rasional : Rekonstruksi memberikan sedikit penampilan yang
lengkap, mendekati normal.

4) Gangguan harga diri berhubungan dengan kecacatan bedah


Ditandai dengan :
DS : Klien mengatakan malu dengan keadaan dirinya
DO : Klien jarang bicara dengan pasien lain, Klien nampak murung.
Tujuan : Klien dapat menerima keadaan dirinya.
Kriteria Hasil :
a) Klien tidak malu dengan keadaan dirinya.
b) Klien dapat menerima efek pembedahan.
Intervensi :

a) Diskusikan dengan klien atau orang terdekat respon klien terhadap


penyakitnya. Rasional : membantu dalam memastikan masalah untuk
memulai proses pemecahan masalah
b) Tinjau ulang efek pembedahan Rasional : bimbingan antisipasi dapat
membantu pasien memulai proses adaptasi.
c) Berikan dukungan emosi klien. Rasional : klien bisa menerima keadaan
dirinya.
d) Anjurkan

keluarga

klien

untuk

selalu

mendampingi

klien.

Rasional : klien dapat merasa masih ada orang yang memperhatikannya.


5) Resiko infeksi berhubungan dengan luka operasi
Ditandai dengan :
DS : Klien mengeluh nyeri pada daerah sekitar operasi.
DO : Adanya balutan pada luka operasi, Terpasang drainase, Warna drainase
merah muda
Tujuan : Tidak terjadi infeksi.
Kriteria Hasil :
a) Tidak ada tanda tanda infeksi.
b) Luka dapat sembuh dengan sempurna.
Intervensi :

a) Kaji adanya tanda tanda infeksi. Rasional : Untuk mengetahui secara dini
adanya tanda tanda infeksi sehingga dapat segera diberikan tindakan yang
tepat.
b) Lakukan pencucian tangan sebelum dan sesudah prosedur tindakan.
Rasional : Menghindari resiko penyebaran kuman penyebab infeksi.
c) Lakukan prosedur invasif secara aseptik dan antiseptik. Rasional : Untuk
menghindari kontaminasi dengan kuman penyebab infeksi.
d) Penatalaksanaan

pemberian

antibiotik.

Rasional

Menghambat

perkembangan kuman sehingga tidak terjadi proses infeksi.


6) Kurangnya pengetahuan tentang kondisi, prognosis, dan serta pengobatan
penyakitnya berhubungan dengan kurangnya informasi.
Ditandai dengan :
DS : Klien sering menanyakan tentang penyakitnya.
DO : Ekspresi wajah murung/bingung.
Tujuan : Klien mengerti tentang penyakitnya.
Kriteria Hasil :
a) Klien tidak menanyakan tentang penyakitnya.
b) Klien dapat memahami tentang proses penyakitnya dan pengobatannya.
Intervensi :

a) Jelaskan tentang proses penyakit, prosedur pembedahan dan harapan yang


akan datang. Rasional : Memberikan pengetahuan dasar, dimana pasien dapat
membuat pilihan berdasarkan informasi, dan dapat berpartisipasi dalam
program terapi.
b) Diskusikan perlunya keseimbangan kesehatan, nutrisi, makanan dan
pemasukan cairan yang adekuat. Rasional : Memberikan nutrisi yang optimal
dan mempertahankan volume sirkulasi untuk mengingatkan regenerasi
jaringan atau proses penyembuhan.
c) Anjurkan untuk banyak beristirahat dan membatasi aktifitas yang berat.
Rasional : Mencegah membatasi kelelahan, meningkatkan penyembuhan, dan
meningkatkan perasaan sehat.
d) Dorong pemeriksaan diri sendiri secara teratur pada payudara yang masih
ada. Anjurkan untuk Mammografi. Rasional : Mengidentifikasi perubahan
jaringan payudara yang mengindikasikan terjadinya / berulangnya tumor
baru.
7) Gangguan pemenuhan kebutuhan nutrisi berhubungan dengan intake yang
tidak adekuat
Ditandai dengan :
DS : Klien mengeluh nafsu makan menurun, Klien mengeluh lemah.

DO :Setengah porsi makan tidak dihabiskan, Klien nampak lemah, Nampak


terpasang cairan infus 32 tetes/menit, Hb 10,7 gr %.
Tujuan : kebutuhan nutrisi terpenuhi
Kriteria Hasil :
a) Nafsu makan meningkat
b) Klien tidak lemah
c) Hb normal (12 14 gr/dl)
Intervensi :
a) Kaji pola makan klien Rasional : Untuk mengetahui kebutuhan nutrisi klien
dan merupakan asupan dalam tindakan selanjutnya.
b) Anjurkan klien untuk makan dalam porsi kecil tapi sering Rasional : dapat
mengurangi rasa kebosanan dan memenuhi kebutuhan nutrisi sedikit demi
sedikit.
c) Anjurkan klien untuk menjaga kebersihan mulut dan gigi. Rasional : agar
menambah nafsu makan pada waktu makan.
d) Anjurkan untuk banyak makan sayuran yang berwarna hijau. Rasional :
sayuran yang berwarna hijau banyak mengandung zat besi penambah tenaga.
e) Libatkan keluarga dalam pemenuhan nutrisi klien Rasional : partisipasi
keluarga dpat meningkatkan asupan nutrisi untuk kebutuhan energi.
4. Implementasi

Merupakan pelaksanaan perencanaan keperawatan oleh perawat dan klien. Hal-hal yang
harus diperhatikan ketika melakukan implementasi keperawatan adalah intervensi dilaksanakan
sesuai dengan rencana setelah dilakukan validasi, penguasaan keterampilan interpersonal,
intelektual dan teknikal, intervensi harus dilakukan dengan efisien pada situasi yang tepat,
keamanan fisik dan psikollogi dilindungi dan didokumentasi keperawatan berupa pencatatan dan
pelaporan (La Ode Jumadi Gaffar, Skp. Pengantar Keperawatan Profesional : 65-66)

5. Evaluasi
Tahapan evaluasi menentukan kemajuan pasien terhadap pencapaian hasil yang
diinginkan dan respons pasien terhadap dan keefektifan intervensi keperawatan kemudian
mengganti rencana perawatan jika diperlukan. Tahap akhir dari proses keperawatan perawat
mengevaluasi kemampuan pasien ke arah pencapaian hasil.

D. Pathways Kanker Payudara


Wanita yang belum punya anak
Menarche usia muda kurang dar
Preparat hormon estrogen
Masa reproduksi panjang
Faktor genetik
Er
Terpapar hormon estrogen lama
Riwayat kanker pada keluarga
Penggunaan preparat lebih dari 5 tahun

Infeksi virus
Berfungsinya onkogen
Gangg. Mekanisme pengendalian
Mutasi gen pengendalian pertumbuhan tumor supresor
Perubahan parenkhim sel payudara / mammae
Ggn. harga diri

Jinak (epidermoid, sel besar adeno carsinoma) kohesif, pertumbuhan cepat


Ganas, kanker (sel kecil/ OAT cell) kurang kohesif, pertumbuhan lambat
Kurang pengetahuan
cemas
Penekanan reseptor pada parenkhim payudara, prostaglanin, serotonin, bradikinin
Kompetisi pemakaian nutrisi, rangsangan organ viseral
Metastase hematogen/ lan
Respon neuroendokrin
Multiorgan failure sepsis

Peningkatan suhu tubuh


maladaptasi
Syok sepsis
nyeri
Morbiditas & mortalitas
Resiko infeksi
Gangguan nutrisi
Kelemahan/ intoleran
Ggn. Mobilitas fisik

Gambar 1: Pathways keperawatan dengan kanker payudara


modifikasi (Erik T, 2005, hal : 43-46, Smeltzer, dkk, 2002, hal : 1589)

BAB III
TINJAUAN KASUS
A. Pengkajian
I.

Identitas diri klien


Nama pasien

: Ny S

Umur

: 41 Th

Pendidikan

: SD

Pekerjaan

: IRT

Agama

: Islam

Alamat

: sengerang, soplasari

No. RM

: 273723

Diagnosa medis

: Ca mammae

Tgl masuk RS

: 18 Mei 2011

Tgl Pengkajian

: 23 Mei 2011

II. Keluhan utama


Ibu mengatakan perutnya kembung, mual, tidak mau makan, sejak tadi pagi, payudara sebelah
kiri membesar, dan terasa sakit.
III. Riwayat penyakit sekarang
Pasien datang dengan kondisi lemah, tidak mau makan sejak tadi pagi, pusing, mual, payudara
sebelah membesar dan terasa sakit.

IV. Pemeriksaan tanda-tanda vital


Tekanan darah

: 140/80 mmHg

Nadi

: 84x/ menit

Suhu

: 370C

respirasi

: 26x/menit

V. Pengkajian tiga belas Domain Nanda


1. Health promotion
DS

: Klien mengatakan sebelumnya tidak pernah masuk rumah sakit, klien mengatakan belum
paham tentang penyakitnya dan bertanya kenapa nyeri dan cepat membesar

DO

: Keadaan umum sedang, kesadaran komposmentis, klien tampak meringis, terpasang infus.

2. Nutrisi
DS

: Klien mengatakan setiap hari makan nasi, sayur dan lauk dengan minum air putih, terakhir
makanan yang dimakan adalah makanan yang diberikan dari Rumah Sakit, pasien mengaku
nafsu makannya kurang baik dan terasa mual, biasanya pasien makan tiga kali dalam sehari dan
minum tujuh gelas.

DO

: Klien badannya agak kurus, warna kulit sawo matang, gerakan ekstremitas atas dan bawah
cepat kembali, kondisi kulit lembab, rambut tumbuh merata.

3. Eliminasi
DS

: klien mengatakan BAB terakhir kemarin sore, dan saat BAB terasa sakit, tetapi setelah
diberikan obat bisa lebih baik dan terakhir BAK tadi pagi.

DO

: Urine berwarna kuning jernih, tidak terpasang DC

4. Aktivitas/ Istirahat
DS

: Pasien mengatakan tidur malam mulai pukul 19.30 WIB 05.00 WIB. Pasien mengatakan tidak
bisa beraktivitas seperti biasa karena sakit dan terpasang infus.

DO

: Tingkat ketergantungan klien pada level 3 (Di bantu orang lain). Nadi teraba teratur 84 x/menit,
nafas terdengar pendek apabila sakit bertambah.

5. Persepsi/ kognisi
DS

: Klien mengatakan tidak ada masalah dengan panca indra, pasien mengatakan bahwa saat ini
sedang sakit dan harus kuat menghadapi sakit yang dideritanya.

DO

: Orientasi (waktu, tempat dan orang) baik, panca indra baik, kesadaran composmentis,
menggunakan bahasa jawa dan bahasa indonesia, kalimat mudah dimengerti.

6. Persepsi diri
DS

: Klien mengatakan penyakit yang dideritanya sangat berpengaruh terhadap hidupnya dan
terancam kehilangan anggota tubuh sehingga tidak bisa beraktifitas sehari-hari secara maksimal,
klien mengatakan juga merasa malu dan rendah diridengan keadaannya.

DO

: Ada kontak mata, klien gelisah dan tampak cemas sekali mengeluarkan air mata.

7. Peranan hubungan
DS

: Klien mengatakan dirumah sebagai ibu rumah tangga, klien sering mengikuti acara keagamaan
dan juga bila waktu luang klien ngobrol-ngobrol dengan tetangga sekitarnya.

DO

: Hubungan keluarga dan klien tampak baik, tampak selaluklien didampingi oleh keluarga dan
anak-anaknya.

8. Seksualitas
DS

: Klien mengatakan menstruasi setiap sebulan sekali, pasien tidak pernah mengalami masalah
serius dengan menstruasinya. Klien biasa menggunakan alat kontasepsi oral (pil).

DO

:-

9. Toleransi koping
DS

: klien mengatakan sangat cemas dengan keadaan dirinya sekarang. Klien merasa dirinya tidak
berharga dan hanya menyusahkan keluarga klien, klen mengatakan keluarga sangat mendukung
kesembuhannya.

DO

: kontak mata kurang, saat diajak bicara tampak gelisah dan bingung, sedih tampak pasrah, dan
sekali pasien tampak berdoa.

10. Prinsif hidup


DS

: Pasien mengatakan agamanya islam, klien mengatakan sakit sekarang adalah cobaan agar bisa
berbenah diri, pasien akan berusaha semaksimal mungkin melawan cobaan yang deberikannya.

DO

: Kontak mata kurang, terlihat pasien pasrah dan berdoa.

11. Keselamatan
DS

: Klien mengatakan tidak mempunyai alergi makanan atau obat.

DO

: Suhu : 370C, terpasang infus RL 20 tpm, dan sekali D5% 16 tpm.

12. Kenyamanan
DS

: Klien mengatakan merasa ada yang mengganjal pada payudaranya bagian kiri, terasa nyeri,
nyeri sering muncul dengan lama 5-8 menit. Pasien mengatakan skala nyeri 4, merasa mual,
nyeri tetap terasa seperti tertusuk tusuk.

DO

: tampak gelisah, kurang konsentrasi tampak meringis dan nampak nafas pendek terengah-engah,
kadang-kadang mual.

13. Pertumbuhan/ perkembangan


DS

:-

DO

:-

VI. Riwayat penanganan


A. Penanganan yang diberikan di Instalasi rawat Darurat (IRD)
DS

: Tidak ada nafsu makan, perut kembung, nyeri pada payudara kiri.

DO

: Ku sedang, kesadaran komposmentis, GCS E4 V3 M4, Suhu 38 0C, tekanan darah 140/80
mmHg, terapi : injeksi dolac 1 ampul, ranitidin 1 ampul, infus D5%

B. Penanganan yang diberikan dibangsal


Terapi : Injeksi ranitidin 2x1 ampul, ceftriaxone 2x1gr, dolac 2x1 ampul, infus RL 20 tpm, D5%
16 tpm, rencana operasi tunggu hasil
Hasil Pemeriksaan Laboraturium
Tanggal

: 18 Mei 2011
Tabel 1. Hasil pemeriksaan laboratorium pada Ny. S dengan kanker payudara.

Jenis pemeriksaan

Hasil

GDS

Angka normal

69,2 mg%

60 120 mg%

BT

CT

Urine

13,8 mg%

10 50mg%

Creatinin

0,6 mg%

0,7 1,1mg%

Hematologi

Ginjal

Tanggal

:23 Mei 2011


Tabel 2. Hasil pemeriksaan laboratorium pada Ny. S dengan kanker payudara
Jenis pemeriksaan
Hasil
Angka normal

HB
13,4 gr%

12 18 gr%
Leukosit
9800 /m3
4300 11.400/m3
KGD/BBS
28/50
Eos

Bas

Stab

Seg

Limp

Mon

58

38

2
Kimia darah

SGOT
16 /I
5 37 /I

SGPT
51 /I
5 41 /I
Ginjal
Urea
20,6 mg/dl
10 50 mg/dl

Hemogram

nfeksi Ca

Palpasi Ca

Creatinin
0,7 mg/dl
0,7 1,1 mg/dl

Glukosa
105,6 mg/dl
60 120 mg/dl

: tampak benjolan sebesar bola tenis, berbenjol-benjol 20x10x10 cm, papila retraksi
: NT (+)

(-)\(-)

(-)/(-)

VII.ANALISA DATA
Tabel 3. Analisa Data pada Ny. S dengan Kanker Payudara
No
1.

Data
Etologi
DS : Pasien mengatakan nyeri Agen injuri : kimia
pada payudara sebelah ( proses tumor).
kiri, nyeri berasa antara
5-8
menit,
seperti

Masalah
Nyeri akut

tertusuk-tusuk,
tetap.
DO

2.

nyeri

: Massa berdiameter
20x10x10 Cm keluar
keringan dingin, nyeri
level 5, nadi 86x/menit,
respirasi
24x/menit,
tekanan darah 140/80
mmhg

DS : Pasien mengatakan sangat Status kesehatan


khawatir
tentang
penyakitnya dan takut
apabila terjadi sampai
yang membahayakan.

Cemas

DO : Pasien tampak cemas,


bingung,
menunduk
sambul menangis.

3.

: Pasien mengatakan malu Kerusakan fungsional


dengan keadaan dirinya,
mrasa tidak berguna
karena keadaanya dan
perubahan pada dirinya.

Harga diri rendah

DO : Bingung, tampak cemas dan


tampak malu.

B. Prioritas masalah
1. Nyeri akut berhubungan dengan agen injuri, kimia (proses tumor) ditandai dengan pasien
mengatakan nyeri pada payudara sebelah kiri, nyeri terasa antara 5-8 menit. Nyeri seperti
ditusuk-tusuk dan daerahnya tetap.massa berdiameter 20x10x10 mmHg

2. Cemas berhubungan dengan status kesehatan ditandai dengan pasien mengatakan snagat
khawatir tentang penyakitnya dan takut apabila terjadi yang membahayakan. Pasien tampak
cemas, bingung dan menangis.
3. Harga diri rendah kronis, berhubungan dengan kerusakan fungsional ditandai dengan pasien
mengatakan malu dengan keadaan dirinya, merasa tidak berguna karena keadaannya dan
perubahan pada dirinya, bingung tampak cemas, tampak malu.
C. PERENCANAAN
Nama pasien

: Ny S

Ruang

:14

Dx

: Ca Mammae

No. Rm

: 273723

Alamat

: sengerong, septosari
Tabel 4. Perencanaan Keperawatan pada Ny. S dengan Kanker Payudara

No
1
1.

Hari/ Tgl/ Jam

Diagnosa
keperawatan

NOC

2
3
4
Senin, 23 Mei Nyeri akut
Setelah dilakukan tindakan
2011
berhubungan
keperawatan selama 3x24 jam
dengan agen injuri
pasien menunjukkan
kimia (Proses
1) Melaporkan nyeri sudah terkontrol
tumor).
2) Menggunakan analgetik sesuai
dengan kebutuhan (4)
3) Menggunakan metode non
analgetik untuk mengurangi nyeri
(4)
4) Melaporkan nyeri sudah terkontrol
5) Mengenali gejala-gejala nyeri (4)

NIC

5
1) Menejemen nyeri
2) Observasi reaksi nonv
dari ketidaknyamanan
3) Ajarkan tentang teknik
farmakologi
4) Berikan analgetik u
mengurangi nyeri
5) Tingkatkan istirahat
6) Kurangi faktor prespita

Cemas berhubungan
Setelah dilakukan tindakan
dengan status kesehatan keperawatan 3x24 jam pasien 1)
menunjukkan:
1) Monitor intensitas kecemasan 2)
(4)
2) Menggunakan strategi koping 3)
efektif (4)
3) Menggunakan teknik relaksasi
untuk menurunkan kecemasan 4)
(4)
4) Mempertahankan penampilan 5)
peran (4)
5) Menggunakan sport sosial yang
memungkinkan (4)

Pengurangan cemas
Gunakan pendekatan ya
menenangkan
Pahami perspektif pasie
terhadap situasi setres
Temani pasien untuk
memberikan keamanan
mengurangi takut
Identifikasi tingkat
kecemasan
Instruksikan pasien
menggunakan teknik
relaksasi

Harga
diri
rendah Setelah dilakukan tindakan Berbicara dengan pasien
berhubungan
dengan keperawatan selama 3x24 jam dengan lambat dan suar
kerusakan fungsional
pasien menunjukkan
yang jelas
1) Body image (4)
1) Memberikan
2) Sensory function (3)
reinforcementpositif ke
3) Memelihara kontak dengan pasien
sumber komunitas yang tepat2) Instruksikan keluarga u
(4)
mensport pasien
4) Mengenal kejadian (4)
3) Memberikan arti hidup
5) Kemampuan
untuk berguna bagi pasien.
memvalidasi diri
6) Penilaian diri yang akurat

D. CATATAN PERKEMBANGAN

Catatan Perkembangan hari I


Tabel 5. Catatan Perkembangan hari I pada Ny. S dengan Kanker Payudara.
No

1.

Hari/ Tgl/

Diagnosa

jam
keperawatan
Rabu, 25 Nyeri akut
Mei 2011
berhubungan
07.30 WIB dengan injuri
kimia (proses
tumor)

Implementasi

Evaluasi

08.30 WIB : memberikan


S : Pasien mengatakan nyeri mulai
analgetik
berkurang
09.00 WIB : mengajarkan teknikO : KU baik, analgetik, dulcolax 1
relaksasi nafas dalam
ampil, infus RL 20 tpm, TD 120/
11.00 WIB : melakukan
mmHg, Nadi 82x/menit, respirasi
pemeriksaan tanda-tanda vital
menit.
A : Maslah teratasi sebagian dengan
kriteria hasil mempu mengenal n
(4)
P : lanjutkan intervensi
1) Kolaborasi terapi
2) Teknik nafas dalam

Cemas
berhubungan
dengan status
kesehatan

08.20 WIB : Menganjurkan


S : Pasien mengaku cemas dan
keluarga agar selalu
keadaan dirinya memburuk
mendampingi pasien
O : Klien tampak gelisah, KU sedan
11.30 WIB : Memotivasi pasien
bingung, kurang konsentrasi.
agar yakin dengan tindakan
A : masalah belum teratasi
medis yang diberikan
P : Lanjutkan intervensi
12.00 WIB :
1) Menggunakan strategi koping
Menanyakan penyebab
affektif
kecemasan pasien
2) Mempertahankan penampilan pe
Harga diri rendah 08.30 WIB : memberikan
S : Pasien mengatakn bahwa dir
berhubungan
dukungan bahwa klien sangat
sudah tidak ada gunanya
dengan kerusakan berarti bagi keluarga
O : Bingung kurang konsentrasi , ce
fungsional
10.00 WIB :
A : Masalah belum teratasi
Menginstruksikan keluarga agar P : lanjutkan intervensi
mensport klien
1) Body image
2) Penilaian diri yang akurat
Catatan Perkembangan Hari Ke II
Tabel 6. Catatan Perkembangan hari ke-II pada Ny. S dengan Kanker Payudara.
No

Hari/ Tgl/

Diagnosa

jam

keperawatan

Implementasi

Evaluasi

1.

Kamis, 26
Mei 2011
01.00 WIB

Nyeri akut
berhubungan dengan
injuri kimia (proses
tumor)

Cemas berhubungan
dengan status
kesehatan

Harga diri rendah


berhubungan dengan
kerusakan fungsional

08.30 WIB : memberikanS : pasien mengatakan nyeri m


terapi nyeri
berkurang
10.00 WIB :
O : KU sedang, tampak senang
mengevaluasi teknik
kesadaran komposmentis.
relaksasi nafas dalam
A : Masalah teratasi sebagian
11.00 WIB : mengurangi P : lanjutkan intervensi
faktor penyebab nyeri
08.30 WIB : motivasi S : pasien mengatakan cemas sudah m
pasien agar tidak cemas
bisa dikurangi
10.00 WIB : mengajarkanO : Pasien tampak bisa berkonsentra
teknik relaksasi nafas
gelisah berkurang, nadi 82x/meni
dalam
A : masalah teratasi sebagian
12,00 WIB :
P : motivasi klien, kesehatan klien da
mendampingi klien dan
keluarga
memotivasi
Lanjutkan intervensi .

08.30 WIB : Motivasi S : Klien mengatakan dirinya


klien agartidak takut
berharga
09.30 WIB : ajarkan pada
O : KU sedang, kesadaran composme
keluarga
tampak gelisah , Nadi 82x/menit
10.00 Wib evaluasi klien masalah belum teratasi
dengan keluarga bahwaP : lanjutkan intervensi.
klien sangat berarti

Catatan Perkembangan Hari Ke III


Tabel 7. Catatan Perkembangan hari ke-III pada Ny. S dengan Kanker Payudara.
No

1.

Hari/ Tgl/
jam
Kamis, 26
Mei 2011
08.00
WIB

Diagnosa
Keperawatan
Nyeri akut
berhubungan
dengan injuri
kimia (proses
tumor)

Implementasi

Evaluasi

08.30 WIB : memberikan terapiS : Pasien mengatakan nyeri sudah m


analgetik
berkurang
09.00 WIB : mengevaluasi
O : KU baik, analgetik dulcola
teknik relaksasi nafas dalam
ampul, infus Rl 20 tpm, TD 11
10.30 WIB : mengurangi
mmHg Nadi 80x/menit resp
kebisingan agar nyeri berkurang 22x/menit.
11.40 WIB : melakukan
A : Masalah teratasi sebagian

pemeriksaan tanda-tanda vital


P : lanjutkan intervensi
Cemas
berhubungan
dengan perubahan
status kesehatan
Harga diri rendah
berhubungan
dengan kerusakan
fungsional

08.20 WIB : mengurangi faktor


S : Pasien mengatakan sudah mulai
penyebab cemas
tenang
09.00 WIB : mengajarkan O : KU sedang gelisah berkurang, resp
teknik relaksasi nafas panjang
24x/menit, nadi 84x/menit
11.00 WIB : memotivasi klien
A : Masalah teratasi sebagian
dan keluarga
P : Lanjutkan intervensi
08.40 WIB : Memotivasi klien
S : klien mengatakan hidupnya seka
bahwaklien sangat berarti.
sudah mulai berarti
10.00 WIB : memberikan O : KU sedang banyak kontak mata
penkes kepada keluarga agar
konsentrasi
memberikan semangat kepada
A : masalah teratasi sebagian
klien
P : lanjutkan intervensi
13.00 WIB :
Mengevaluasi keluarga agar
mensport klien

BAB IV
PEMBAHASAN
Asuhan keperawatan pada Ny. S dengan Kanker Payudara dilaksanakan selama tiga
hari. Kasus ini diperoleh melalui tahap proses kepeawatan yang melalui lima tahap yaitu
Pengkajian, Diagnosa Keperawatan, Perencanaan, Implementasi dan Evaluasi. Dimana proses
keperawatan merupakan metode ilmiah yang digunakan secara sistematis untuk mengkaji dan
mendiagnosa status kesehatan klien, menentukan intervensi, melaksanakan dan melakukan
evaluasi hasil asuhan keperawatan.
Pembahasan dilakukan untuk melakukan analisa secara ilmiah terhadapa asuhan
keperawatan yang dilaksanakan, serta menentukan kesenjangan antara teori dan fakta yang ada
sehingga tercermin suatu analisa antara pengalaman belajar dan teori yang ada dengan aplikasi
yang nyata pada saat studi kasus.
A. Pembahasan Pengkajian
Pengkajian dilakukan pada hari Senin tanggal 23 Mei 2011 jam 09.30 WIB di Bangsal
Cempaka RSUD Wonosari. Data diperoleh penulis setelah melakukan wawancara dengan pasien
secara langsung dan melakukan wawancara tambahan kepada anak pasien, data yang lainnya
diperoleh dari status pasien dan perawat yang dinas di bangsal Cempaka. Data yang sifatnya
obyektif

ditemukan

penulis

melalui

observasi

dan

pemeriksaan

langsung

dengan

pasien. Terdapat data pasien mengatakan Saya sebelumnya belum pernah mengalami sakit

seperti ini dan bila ditekan terasa sakit pada payudara sebelah kiri dan payudara cepat membesar.
Rasa takut pun timbul.
1. Domain 1: Health Promotion
Pada domain ini di jelaskan dari riwayat penyakit. Pasien belum pernah mengalami sakit seperti
ini sebelumnya, dengan umurnya sekarang klien termasuk belum terlalu tua, pasien sudah sedikit
mengerti dengan penyakit yang di deritanya sekarang. Sehinga dalam pengkanjian domain ini
tidak ditemukan kesenjangan data.
2. Domain 2 : Nutrition
Dalam domain ini dikatakan bahwa pasien tidak ada masalah dalam nutrisinya.dilihat dari
keseharian pasien makan 3x sehari. Sehingga intake yang masuk cukup dalam memenuhi
kebutuhan nutrisi pasien. Walaupun pasien tidak menggunakan suplemen makanan dalam
memenuhi kebutuhan nutrisinya, nafsu makannya pun tidak mengalami perubahan. Sehingga
dalam pengkajian domain ini tidak di temukan kesenjangan data.
3. Domain 3: Eleminasi
Dalam domain ini dikatakan bahwa, pasien tidak mengalami kesulitan dalam BAB ataupun
BAK. Yang ditandai dengan pasien tidak menggunakan alat bantu untuk melakukan eleminasi.
Sehingga dalam pengkajian domain ini tidak ditemukan kesenjangan data.
4. Domain 4: Aktivity/Rest
Dalam domain ini, di temukan data yang menunjukan bahwa, dalam kemampuan untuk makan,
mandi, bepakaian, berhias, BAB dan BAK dilakukan dengan bantuan dari keluarga. Dalam

pemenuhan istirahat tidur, klien biasanya tidur 7 8 jam sehari. Pasien jarang bisa tidur kalau
siang hari tapi malam hari pasien bisa tidur dengan baik.
5. Domain 5: Perception cognition
Di domain ini menunjukan bahwa dalam dalam hal pengecapan, pendengaran, dan penglihatan
masih baik, tidak ada masalah dalam hal ini. Namun tedapat rasa nyeri yang timbul dari
payudara, yang terletak dari sebelah kiri. yang menunjukan derajat nyerinya 4. Sehingga dalam
pengkajian domain ini, tidak di temukan kesenjangan data.
6. Doamin 6 : Self-Perceotion
Dalam doamain ini, ditemukan data yang menunjukaan bahwa, pasien menyadari dirinya sakit,
dan butuh dukungan dari keluarga dan orang-orang terdekatnya, seperti suami dan anaknya.
Namun rasa cemas pasien pun timbul karena mengingat keadaannya seperti sekarang. Selain itu
pasien juga merasa sakitnya sangat berpengaruh terhadap hidupnya dan terancam kehilangan
anggota tubuhnya, malu juga akan dirasakan pasien dengan keadaan yang dialami. Yang ditandai
dengan tampak gelisah, kontak mata kurang, murung, minder dan menangis. Sehingga dalam
domain ini ditemukan kesenjangan data yaitu harga diri rendah berhubungan dengan kerusakan
fungsional.
7. Domain 7: Peran dan Hubungan
Dalam domain ini menunjukan adanya peran dan hubungan yang cukup baik antara pasien
dengan keluarga dan Pasien-pasien yang lainnya.dan pasien pun merasa puas dengan peranya

sebagai seorang istri dan seorang ibu. dari hasil pengkajian diatas menunjukan tidak adanya
kesenjangan data
8. Domain 8 : Seksualitas
Dalam domain ini menunjukan, pasien tidak ada kecemasan terhadap sex. pasien menggunakan
KB Pil sebagai alat kontrasepsinya. Pasien sudah mempunyai anak 2. pasien merupakan seorang
istri dan seorang ibu, sehingga dalam pengkajian dalam domain ini tidak ditemukan kesenjangan
data.
9. Domain 9 : Coping/stress tolerance
Dalam pengkajian yang telah dilakukan dalam domain ini, dimana pasien menunjukan rasa takut
dengan keadaannya dan merasa dirinya tidak berarti. sehingga dalam domain ini menunjukan
adanya data senjang yaitu cemas berhubungan dengan status kesehatan.
10. Domain 10 : Prinsip Hidup
Di dalam domain ini menunjukan bahwa, pasien menganut agama islam, dan pasien yakin,
Tuhan pasti akan memberi jalan terbaik pada dirinya. Dan pasien akan berusaha melawan
cobaan tersebut. Sehingga dalam domain ini tidak ditemukannya kesenjangan data.
11. Domain 11: Safety/Protektion
Dalam domain ini tidak ditemukannya kesenjangan data, hal ini menunjukan pasien tidak adanya
luka, lecet, dan tidak adanya tanda gejala infeksi pada infus.
12. Domain 12: Kenyaman

Dalam domain ini menunjukan, adanya ketidaknyamanan pada pasien, diman pasien merasa
sakit pada payudara di sebelah kiri, dengan skala 4.nyeri tetap. Yang di tandai dengan wajah
pasien terlihat meringis menahan sakit, gelisah, dan kurang konsentrasi. Sehingga dalam domain
ini menunjukan adanya kesenjangan data yaitu nyeri akut berhubungnan dengan agen injuri
kimia.
13. Domain 13: pertumbuhan dan Perkembangan
Dalam domain ini tidak dilakukan pengkajian
Dengan melakukan pengkajian penulis menyimpulkan adanya faktor pendukung dan
penghambat,antara lain :
1. Faktor Pendukung
a.

Pasien dan keluarga koperatif dan bersedia menjawab semua pertanyaan penulis

b. Adanya rekam medis atau status klien yang membantu penulis dalam melengkapi data.
2. Faktor penghambat
a.

Penulis kesulitan dalam memahami teori NANDA.

B. Pembahasan Diagnosa Keperawatan


Setelah data terkumpul, kemudian dilakukan analisa untuk menemukan masalah klien, dan
selanjutnya merumuskan diagnosa keperawatan pada Ny. S dan didapatkan tiga diagnosa
keperawatan. Pembahasan perbandingan antara diagnosa keperawatan dalam dengan kasus pada
Ny.S adalah sebagai berikut.
Diagnosa yang muncul pada Ny S yang sesuai teori adalah :

4. Nyeri akut
Pasien mengatakan nyeri pada payudara sebelah kiri, nyeri terasa antara 5-8 menit. Nyeri seperti
ditusuk-tusuk, dengan skala nyeri 4.
5. Cemas
Pasien mengatakan sangat khawatir tentang penyakitnya dan takut apabila terjadi yang
membahayakan. Pasien tampak cemas, bingung dan menangis.
6. Harga diri rendah kronis,
pasien mengatakan malu dengan keadaan dirinya, merasa tidak berguna karena keadaannya dan
perubahan pada dirinya, tampak bingung tampak cemas, tampak malu.
C. Pembahasan Perencanaan Keperawatan
Tahap

perencanaan

asuhan

keperawatan

meliputi

penentuan

prioritas

masalah,

menentukan tujuan dan menentukan rencana tindakan keperawatan. Penulis menggunakan


kebutuhan dasar manusia menurut Hierarki Maslow dan masalah yang mengancam kehidupan
atau keselamatan.
Perencanaan diagnosa keperawatan yang di susun penulis pada pasien Ny S sesuai dengan
NANDA (2005-2006). Prioritas yang akan dicapai adalah :
1. Nyeri akut berhubungan dengan agen injuri, kimia (proses tumor), penulis merencanakan 3x24
jam, tingkat nyeri dapat diturunkan atau di hilangkan, dengan indikator yang di capai
:melaporkan bahwa nyeri sudah berkurang, Melaporkan nyeri sudah terkontrol, menggunakan
analgetik sesuai dengan kebutuhan, menggunakan metode non analgetik untuk mengurangi

nyeri, melaporkan nyeri sudah terkontrol, mengenali gejala-gejala nyeri. Didalam perencanaan
penulis sudah merencanakan tindakan yang akan diambil antara lain : Manejemen nyeri,,
observasi reaksi nonverbal dari ketidaknyamanan, ajarkan tentang teknik non farmakologi,
berikan analgetik untuk mengurangi nyeri, tingkatkan istirahat.
2. Cemas berhubungan dengan status kesehatan penulis merencanakan 3x24 jam, tingkat nyeri
dapat diturunkan atau di hilangkan, dengan indikator yang di capai : Monitor intensitas
kecemasan, menggunakan strategi koping efektif, menggunakan teknik relaksasi untuk
menurunkan kecemasan, mempertahankan penampilan peran, menggunakan sport sosial yang
memungkinkan. Didalam perencanaan penulis sudah merencanakan tindakan yang akan diambil
antara lain : Pengurangan cemas, Gunakan pendekatan yang menenangkan, Pahami perspektif
pasien terhadap situasi setres, Temani pasien untuk memberikan keamanan dan mengurangi
takut, Identifikasi tingkat kecemasan. Instruksikan pasien menggunakan teknik relaksasi
3. Harga diri rendah kronis, berhubungan dengan kerusakan fungsional 3x24 jam, tingkat nyeri
dapat diturunkan atau di hilangkan, dengan indikator yang di capai : Body image, Sensory
function, Memelihara kontak dengan sumber komunitas yang tepat, Mengenal kejadian,
Kemampuan untuk memvalidasi diri, Penilaian diri yang akurat Didalam perencanaan penulis
sudah merencanakan tindakan yang akan diambil antara lain : Berbicara dengan pasien dengan
lambat dan suara yang jelas, Memberikan reinforcement positif kepada pasien, Instruksikan
keluarga untuk mensuport pasien , Memberikan arti hidup dan berguna bagi pasien.
D. Pembahasan Implementasi

Asuhan keperawatan pada Ny S dilakukan selama 3x24 jam mulai tanggal 23 Mei sampai 26
Mei 2011 di Bangsal Cempaka RSUD Wonosari.
Pelaksanaan tindakan yang telah dilakukan pada dasarnya telah sesuai dengan rencana
keperawatan yang telah di buat pada setiap diagnosa keperawatan dan secara garis besar
pelaksanaannya sudah sesuai dengan wewenang dan tanggung jawab. Penambahan dan
pengurangan tindakan yang dilaksankan penulis menyesuaikan dengan kondisi pasien. Penulis
juga melibatkan keluarga di dalam pelaksanaan tindakan keperawatan pada pasien dengan
harapan keluarga dapat merawat pasien secara mandiri.
Adapun pembahasan Implementasi adalah sebagai berikut :
1. Nyeri Akut berhubungan dengan agen injuri kimia. penulis melakukan implementasi seperti
mengkaji lokasi nyeri, karakteristik nyeri dan kualitas, mengajarkan tehnik non farmakologi
seperti menarik nafas dalam, menganjurkan meningkatakan istirahat. Semua rencana
keperawatan dalam teori dilaksanakan oleh penulis.
2. Cemas berhubungan dengan status kesehatan penulis melakukan implementasi seperti menemani
pasien untuk memberikan keamanan dan mengurangi takut, mengidentifikasi tingkat kecemasan.
menginstruksikan pasien menggunakan teknik relaksasi, memahami perspektif pasien terhadap
situasi setres
3. Harga diri rendah kronis, berhubungan dengan kerusakan fungsional penulis melakukan
implementasi seperti Memberikan reinforcement positif kepada pasien, menginstruksikan
keluarga untuk mensuport pasien , Memberikan arti hidup dan berguna bagi pasien.

E. EVALUASI
Dalam hal ini penulis menggunakan evaluasi prosses dan evaluasi hasil, dimana evaluasi proses
mengacu pada setiap tindakan keperawatan yang telah dilaksanakan pada pasien, sedangkan
evaluasi hasil mengacu pada tujuan dan indikator yang telah ditetapakn dalam perencanaan yang
dapat memperhatikan keberhasilan dari keperawaratan yang telah di laksanakan.
Hasil evaluasi dan penatalaksanaan asuhan keperawatan pada Ny S dengan Kanker
Payudara selama 3x24 jam dari tanggal 23 Mei sampai 26 Mei 2011 adalah sebagai berikut :
Masalah teratasi sebagian :
1. Nyeri akut berhubungan dengan agen injuri kimia.
Masalah ini teratassi sebagian karena setelah dilakukan tindakan keperawatan selama 3x24 jam
pasien mengatakan rasa nyeri sudah mulai berkurang setelah melakukan tehnik relaksasi.
2. Cemas berhubungan dengan status kesehatan.
Masalah ini teratassi sebagian karena setelah dilakukan tindakan keperawatan selama 3x24 jam
pasien mengatakan sudah bisa merasa tenang setelah mendapatkan motivasi dari keluarga.
3. Harga diri rendah kronis, berhubungan dengan kerusakan fungsional.
Masalah ini teratassi sebagian karena setelah dilakukan tindakan keperawatan selama 3x24 jam
pasien mengatakan hidupnya sekarang sudah mulai berarti setelah mendapatkan support dari
keluarga dan petugas kesehatan.

BAB V
PENUTUP
A. KESIMPULAN
Setelah melakukan asuhan keperawatan pada Ny S dengan Kanker Payudara selama 3
hari dari tanggal 23 Mei sampai 26 Mei 2011, penulis mendapatkan pengalaman yang nyata
tentang perawatan pasien dengan Kanker Payudara di Bangsal Cempaka RSUD Wonosari.
Pengkajian yang dilakukan meliputi pengkajian biologis, psikologis, sosial, spiritual.
Dalam melakukan pengkajian penulis tidak mengalami hambatan yang berarti karena pasien dan
keluarganya kooperatif sehingga pasien mau mengungkapkan masalah yang dihadapi saat itu.
Diagnosa ynag muncul pada asuhan keperawatan ini adalah Nyeri akut behubungan dengan agen
injuri kimia; Cemas behubungan dengan statusn kesehatan; Harga Diri Rendah Kronis
berhubungan dengan kerusakan fungsional. Penulisan rencana keperawatan masing- masing
diagnosa berdasrakan teori dan sesuai dengan kondisi pasein.
Pelaksanaan keperawawatan pada Ny S dengan Kanker Payudara. Evaluasi dari asuhan
keperawatan ini, dari 3 diagnosa yang muncul 3 diagnosa teratasi sebagian.