Anda di halaman 1dari 57

IPS

UNIVERSITAS INDONESIA
SIMAK
SOAL DAN PEMBAHASAN
KEMAMPUAN DASAR
- MATEMATIKA DASAR
- BAHASA INDONESIA
- BAHASA INGGRIS
KEMAMPUAN IPS
- SEJARAH
- GEOGRAFI
- EKONOMI
- IPS TERPADU
KEMAMPUAN IPA
- MATEMATIKA IPA
- BIOLOGI
- FISIKA
- KIMIA
- IPA TERPADU
TAHUN 2011
IPA
DAFTAR ISI
SIMAK
UNIVERSITAS INDONESIA
2011
SOAL KEMAMPUAN DASAR ----------------------------------------- 3
PEMBAHASAN SOAL KEMAMPUAN DASAR --------------------- 13
SOAL KEMAMPUAN IPA ---------------------------------------------- 20
PEMBAHASAN SOAL KEMAMPUAN IPA -------------------------- 30
SOAL KEMAMPUAN IPS ---------------------------------------------- 41
PEMBAHASAN SOAL KEMAMPUAN IPS -------------------------- 50
3
P

1. Sebelum mengerjakan ujian, periksalah terlebih


dulu, jumlah soal dan nomor halaman yang
terdapatpadanaskahsoal.
2. Tulislah nomor peserta Anda pada lembar
jawabanditempatyangdisediakan.
3. Tulislah kode naskah soal ini, pada lembar
jawabanditempatyangdisediakan.
4. Bacalah dengan cermat setiap petunjuk yang
menjelaskancaramenjawabsoal.
5. Pikirkanlah sebaikbaiknya sebelum menjawab
tiap soal, karena setiap jawaban yang salah akan
mengakibatkan pengurangan nilai (penilaian:
benar+4,kosong0,salah1)
6. JawablahlebihdulusoalsoalyangmenurutAnda
mudah, kemudian lanjutkan dengan menjawab
soalsoal yang lebih sukar sehingga semua soal
terjawab.
7. TulislahjawabanAndapadalembarjawabanujian
yangdisediakan.
8. Untuk keperluan coretmencoret, harap meng
gunakantempatyangkosongpadanaskahsoalini
danjanganpernahmenggunakanlembarjawaban
karena akan mengakibatkan jawaban Anda tidak
dapatterbaca.
9. Selamat ujian, Anda tidak diperkenankan ber
tanya atau meminta penjelasan mengenai soal
soal yang diujikan kepada siapa pun, termasuk
kepadapengawasujian.
10. Setelah ujian selesai, Anda diharapkan tetap
duduk di tempat Anda sampai pengawas ujian
datang ke tempat Anda untuk mengumpulkan
lembarjawaban.
11. Perhatikanagarlembarjawabanujiantidakkotor,
tidakbasah,tidakterlipat,dantidaksobek.

PETUNJUKA:
Pilihsatujawabanyangpalingtepat

PETUNJUKB:
Soalterdiridari3bagian,yaituPERNYATAAN,kataSEBAB,danALASANyangdisusunberurutan.
Pilihlah:
A. Jikapernyataanbenar,alasanbenar,dankeduanyamenunjukkanhubungansebabakibat
B. Jikapernyataanbenar,alasanbenar,tetapikeduanyatidakmenunjukkanhubungansebabakibat
C. Jikapernyataanbenardanalasansalah
D. Jikapernyataansalahdanalasanbenar
E. Jikapernyataandanalasankeduanyasalah

PETUNJUKC:
Pilihlah:
A. Jika(1),(2),dan(3)yangbenar
B. Jika(1)dan(3)yangbenar
C. Jika(2)dan(4)yangbenar
D. Jikahanya(4)yangbenar
E. Jikasemuanyabenar

PETUNJUK UMUM
PETUNJUK KHUSUS
4

TES KEMAMPUAN DASAR


SIMAK UI 2011

BIDANGILMU :MATEMATIKADASAR,BAHASAINDONESIA,DANBAHASAINGGRIS
WAKTU :60MENIT
JUMLAHSOAL :60


Keterangan :MATEMATIKADASARnomor1sampaidengannomor20
BAHASAINDONESIAnomor21sampaidengannomor40
BAHASAINGGRISnomor41sampaidengannomor60

MATEMATIKA DASAR

GunakanPETUNJUKAuntukmenjawabsoalnomor
1sampainomor15!

1. Diketahui ( )

=
+
1
1
x
f x
x
dan ( ) 3 = g x x .Jumlah
semua nilai x yang mungkin sehingga
( ) ( ) ( ) ( )
= f g x g f x adalah....
A.
4
3

B.
3
4

C.
3
4

D.
4
3

E. 2

2. Jika solusi dari persamaan


5
5 7
+
=
x x
dapat
dinyatakandalambentuk
5
log5 =
a
x ,makanilai
a =.
A.
5
12

B.
5
7

C.
7
5

D.
12
7

E.
12
5


3. Diketahui
2 2
1 a b + = dan
2 2
1 c d + = .Nilai
minimumdari 2 ac bd + adalah....
A. 6
B. 5
C. 3
D. 3
E. 5

4. Diketahui
2 3 12
2 3 6 48
a b c
ab ac bc
+ + =
+ + =

makanilai a b c + + =....
A.
7
3

B.
8
3

C.
10
3

D.
22
3

E. 6

5. Jika x adalahsudutlancipdengantan
2
1
x
b
=
danmemenuhipersamaan
2 2
2sin 8sin 2cos 5 x x x = ,makanilaidari
2 sin b x = ....
A. 2 C. 2 3 E. 3 3
B. 3 D. 3 2

6. Jika
2 1
0 4
A
(
=
(

dan
3
6
B

(
=
(


maka
6
A B = .
A.
6
2 B C.
6
4 E.
14
2
B.
12
2 B D.
7
4 B

5
7. Untuksetiap , x y anggotabilanganriil
didefinisikan ( )
2
x y x y - = ,maka
( ) ( )
2 2
x y y x - adalah.
A. 0 C.
2
2x E. 4xy
B.
2 2
x y + D.
2
2y

8. Jika ( ) ( )( ) g x f f f x = dengan ( ) 0 0 f = dan


( ) ' 0 2 f = ,maka ( ) ' 0 g = .
A. 0 C.4 E.16
B. 2 D.8

9.
1
2sin
sin
0,5sin2
cos
x
x
x
x
| |

|
=
|
|
\ .
.
A. sin2x C. tan2x E. sec2x
B. cos2x D. cot2x

10. Jika ratarata 20 bilangan bulat nonnegatif


berbedaadalah20,makabilanganterbesaryang
mungkinadalah....
A. 210
B. 229
C. 230
D. 239
E. 240

11. Nilaidari
3 3
2 5 2 5 3 + + adalah.
A. 2 D.1,5
B. 1 E.2
C. 1

12. Jikadiketahuibahwa
2 2
log log 1
a b
b a + = dimana
, 0 a b > dan , 1 a b = ,makanilai a b + = ....
A.
2
1 a
a
+

B. 2 a
C. 2a
D.
2
a
E.
1
2 a +

13. Dua titik dengan


1
x a = dan
2
3 x a = di mana
0 a = , terletak pada parabola
2
y x = . Garis y
menghubungkan 2 titik tersebut. Jika garis
singgung parabola di suatu titik sejajar dengan
garis g , maka garis singgung tersebut akan
memotongsumbu y di.....
A.
2
a

C.
2
2a
E.
2
5a

B.
2
a D.
2
4a

14. Diketahuifungsi ( )
2
2 5 f x x x x = .Nilai
maksimum ( ) f x padainterval | | 5,10 adalah....
A.
9
4
C.10 E.30
B.
49
4
D.20

15. 1 3 5 7 9 11 13 15 17 ... 193 195 197 + + + + + + + + =


.
A. 3399 C.3333 E.3266
B. 3366 D.3267

16. Peluang mendapatkan satu kali jumlah angka 7


dalamtigakalipelemparanduadaduadalah....
A.
5
246
C.
25
46
E.
125
432

B.
5
36
D.
25
72

GunakanpetunjukCdalammenjawabsoalnomor17
sampai20.

17. Diketahui bahwa A, B, C adalah 3 buah titikyang


berbedayangterletakpadakurva
2
y x = dimana
garis yang menghubungkan titik A dan B sejajar
dengan sumbu x . Ketika ketiga titik dihubung
kan, akan terbentuk sebuah segitiga sikusiku
dengan luas daerah sama dengan 5. Absis titik C
adalah....
1) 2 6
2) 5
3) 2 6
4) 25

18. Akarakarpersamaankuadrat
2
6 2 1 0 x x a + = mempunyaibeda10.Yang
benarberikutiniadalah....
1) Jumlahkeduaakarnya6.
2) Hasilkeduaakarnya16.
3) Jumlahkuadratakarakarnya20.
4) Hasilkalikebalikanakarnya
1
16

19. Diberikanprogramlinierberikut:Maks
3 2 f x y = + dengankendala
4, 0, 5 20, 0 x y ax y x y y + > s + s > Jika
daerahpenyelesaiannyaberbentuksegitigasiku
sikudengansikusikupadatitikpotonggaris
6
4 x y + = dan 0 ax y = , maka titik ( ) , x y di
mana f mencapai maksimum akan memenuhi
....
1) 10 3 y x + =
2) 3 5 x y x y + =
3) 2 7 4 x y + s
4) 2 5 y x > +

20. Misalkan
1
x dan
2
x adalah akarakar dari
persamaan kuadrat
2
0 x px q + + = yang
merupakan bilangan bulat. Jika diketahui bahwa
2010 p q + = , maka akarakar persamaan
tersebutadalah....
1) 2012
2) 2010
3) 2
4) 0

BAHASA INDONESIA

GunakanPETUNJUKAuntukmenjawabsoalnomor
21sampainomor40!

21. Ni Wayan Suryathini adalah warga Kota


Denpasar.IalahirdandibesarkandiDenpasar.Ia
meneruskan studi dan bekerja di luar Bali. Ia
mengungkapkan, tidak semua pojok di kota
kelahirannya berubah. Gabungan yang tepat
untukkeempatkalimatdiatasadalah....
A. SebagaiwargakotaDenpasaryanglahirdan
dibesarkan di Denpasar, tetapi meneruskan
studi dan bekerja di luar negeri, Ni Wayan
Suryathini mengungkapkan bahwa tidak
semuapojokdikotakelahirannyaberubah.
B. NiWayanSuryathini,yanglahirdandibesar
kan di Denpasar, namun meneruskan studi
dan bekerja di luar negeri, mengungkapkan
bahwa tidak semua pojok di kota kelahiran
nyaberubah.
C. Ni Wayan Suryathini, lahir dan besar di
Denpasar dan tetap menjadi warga Kota
Denpasar, tetapi meneruskan studi dan
bekerja di luar negeri, mengungkapkan
bahwa tidak semua pojok di kota kelahir
annyaberubah.
D. Bahwa tidak semua pojok di kota
kelahirannya berubah, demikian diungkap
kanolehNiWayanSuryathini,yanglahirdan
dibesarkan di Denpasar, tetapi meneruskan
studidanbekerjadiluarnegeri.
E. NiWayanSuryathinimengungkapkanbahwa
tidak semua pojok di kota kelahirannya
berubah, meskipun ia lahir, dibesarkan, dan
menjadi warga kota Denpasar, tetapi
meneruskanstudidanbekerjadiluarnegeri.

22. Setelah enam belas berkarya di jalur musik,


kelompok musik tersebut masih tetap berkibar.
Makna berkibar sesuai dengan kutipan di atas
adalah....
A. ada
B. menjadiidola
C. berjuangkeras
D. mengudara
E. melakukanpertunjukan

23. Banyak pedagang yang menginginkan keuntung


an sebesarbesarnya, tanpa peduli kesehatan
pembeli dengan menggunakan bahan yang lebih
murah, tetapi tidak menjamin bahan tersebut
layakuntukdikonsumsi.
Kalimat di atas tidak baku; bentuk baku kalimat
tersebutadalah....
A. Banyak pedagang yang menginginkan
keuntungan besar, tetapi tanpa peduli
kesehatan pembeli, sehingga menggunakan
bahanyanglebihmurahtapitidakmenjamin
bahantersebutlayakuntukdikonsumsi.
B. Banyak pedagang yang menginginkan
keuntungan sebesarbesarnya tidak peduli
pada kesehatan pembeli, lalu menggunakan
bahan yang lebih murah tetapi tidak
menjamin bahan tersebut layak untuk
dikonsumsi.
C. Banyak pedagang yang menginginkan
keuntungan besar, tetapi tidak peduli pada
kesehatan pembeli dengan menggunakan
bahan yang lebih murah namun tidak
menjamin bahan tersebut layak untuk
dikonsumsi.
D. Banyak pedagang yang menginginkan keun
tungan besar, tetapi tidak peduli pada
kesehatan pembeli sehingga mereka meng
gunakan bahan yang lebih murah, tetapi
tidaklayakuntukdikonsumsi.
E. Banyak pedagang yang menginginkan
keuntunganbesartidakpedulipadakesehat
an pembeli sehingga menggunakan bahan
yang lebih murah, akan tetapi tidak menja
minataulayakuntukdikonsumsi.

24. Perjuangan menjadikan bahasa Inggris sebagai


bahasa nasional tidaklah mudah. Dalam
pemungutan suara banyak juga anggota Senat
yang mengingini hal lain: kemajemukan bahasa
sepertijugakemajemukanetnisitas dinegeriitu.
7
Di AS memang duduk orangorang dari pelbagai
etnisitas. Dipakai pula berbagai bahasa di sana.
Tak heran bila pernah muncul lagu kebangsaan
berbahasaSpanyol.
Kata duduk dalam konteks di atas mempunyai
makna yang sama dengan katakata berikut,
kecuali....
A. diam
B. bercokol
C. bermukim
D. menghuni
E. tinggal

25. (1) Kita sangat antusias melihat angka


pertumbuhan ekonomi kita pada triwulan II
mencapai 6,2 persen. (2) Namun, begitu melihat
kinerja perekonomian negara tetangga, terlihat
prestasikitayangmembanggakanitubukanapa
apa. (3) Pada periode yang sama, seperti dikutip
Kompas, Singapura mencapai angka pertumbuh
an 18,8 persen. (4) Sementara itu, Thailand 9,1
persen, Malaysia 8,9 persen, dan Filipina pada
triwulanImamputumbuh7,3persen.
Kalimatyangmerupakanopiniadalah.
A. kalimat(1) D. kalimat(4)
B. kalimat(2) E. semuakalimat
C. kalimat(3)

26. Kalimatkalimat merupakan kalimat yang tidak


efektif,kecuali....
A. Menurut Taufik, mengacu pada pengertian
bahwa bentuk mandala berupa garis
geometris, Candi Mendut, Pawon, dan
Borobudur yang dibangun pada satu garis
lurus.
B. Sebuah sikap hidup yang dalam kehidupan
nyatasaatiniterasamahal.
C. Kalaupun ada, kurang memberdayakan
masyarakat lokal yang sesungguhnya ber
potensimengembangkandaerah.
D. Termasuk di dalamnya kapal induk
Ticonderoga, penghancur Shelton dan
Eversole,sertapenjajahBremeton.
E. Dalamkawasanstrategisnasionalyangakan
ditataantaralaindenganpembatasantinggi
dan arsitektur bangunan baru disekitar
candi.

27. Penggunaan kata serapan yang tepat terdapat


dalamkalimat....
A. Dari aspek bahasa, kata kampanye berasal
dari bahasa Inggris, yaitu to campaign yang
berarti serangkaian aktivitas yang direnca
nakan atau suatu operasi militer (Evison
1983).
B. Sebagai penyusun buku ini kami berharap
buku ini dapat menggugah generasi muda
perempuan bahwa dalam berkeluarga
membina karir masingmasing adalah suatu
kemungkinan.
C. Dengan menerbitkan buku ini kami ingin
menyumbangkan sesuatu yang konkrit
tentang aspirasi perempuan Indonesia
sebagai manusia dan anggota masyarakat
yangsedangmembangun.
D. Penulis beranggapan bahwa praktek
perladangan, sebagai contoh, merupakan
suatu keahlian yang didasari pengalaman
tradisionaldansamasekalitidakprimitif.
E. Makin banyak lulusan sekolah menengah
atas yang berminat mendalami bidang
akuntansi.

28. Katagabungditulissecaratepatdalamkalimat...
A. Paparan radio aktif yang melewati ambang
batasberbahayabagikesehatan.
B. Pemerintah memberikan beasiswa darma
siswa bagi mahasiswa yang berasal dari
Palestina.
C. Hubungan segitiga kerap menghasilkan
kabardukacita.
D. Olah raga pada orang tua memberikan efek
relaksasi.
E. Rencana penyediaan fasilitas transportasi
kereta api super cepat terhambat masalah
dana.

29. Penggunaan tanda koma pada kalimat berikut


tidakbenar,kecuali....
A. Tak ubahnya Jakarta, jalanan Kota Boston
pun ruwet, karena tidak mudah dijelajahi
denganmobil.
B. Pada tahun 2006, untuk ketiga kalinya,
majalah Bicycling memasukkan kota ini
kedalam daftar kota terburuk di AS bagi
pesepeda.
C. Menino akhirnya memahami manfaat dari
budaya ramah sepedademi lingkungan
yaitu, mengurangi kepadatan lalu lintas dan
menyehatkanmasyarakat.
D. Kotakota, mulai dari Louisville hinga Los
Angeles, menawarkan kemudahan akses
bersepeda, dan wisatawan adalah sasaran
utamafasilitastersebut.
E. Sejumlah larangan membatasi keberadaan
sepeda di jalanan umum, sehingga
memudahkan akses ke pedalaman, atau
menggenjot naik menyusuri pesisir sepan
jangOldHighway.

8
30. Payungumunyadigunakanuntukmelindungidiri
dari hujan atau sengatan matahari. Fungsi ini
tidak berbeda jauh dari maknanya yang dalam
bahasa Inggris disebut umbrella. Umbrella
berasal dari bahasa Latin, umbra, yang berarti
melindungi. Payung juga mempunyai sinonim
lain, yaitu parasol. Hanya saja, parasol biasanya
digunakan untuk melindungi diri dari sengatan
matahari.
Topikparagrafdiatasadalah....
A. Fungsi payung sebagai alat ntuk melindungi
diridarihujandanmatahari.
B. Kata umbrella berasal dari bahasa Latin
umbra.
C. Kataumbrelladanparasolbersinonim.
D. Makna parasol berbeda makna dengan
umbrella.
E. Asalusulkatapayung.

31. Kalimatyangefektifdibawahiniadalah....
A. Madura sangat kaya akan tradisi lisan, di
antaranya ada wayang wong, ludruk,
macapat,dansyiir.
B. Syiir kadangkadang ditampilkan dengan
saronen,instrumentiuplokal.
C. Penampilan saronen dahulu sering muncul
saatorangmengantarpengantinyangdiiring
menaikikuda.
D. Syiir juga sering muncul dalam seremonial
seperti sunatan, selamatan desa, syukuran,
danlainlainnya.
E. Maksud dan tujuan dibawakannya syiiir
adalahuntuk mendekatkandirikepadaSang
Khalik.

32. (1) Manajemen kantin universitas itu juga harus


membuat suasana lebih hidup, ramai, dan tidak
panas. (2) Seperti mengadakan pagelaran seni
atau musik dan menambah kipas angin. (3) Agar
suasana lebih sejuk. (4) Sehingga tidak
menyebabkankeringatsebelummasukkedalam
kelas. (5) Apabila semua itu bisa dijalankan
denganbaikolehpihakmanajemen.(6)Mungkin
bisa membbuat mahasiswa dan staf universitas
untuk makan di kantin itu dibandingkan dengan
tempat lain. (7) Sehingga bisa meningkatkan
penjualandansuasanadikantinitupunbisalebih
ramai.
Semua kalimat dalam paragraf tersebut tidak
baku,kecuali.
A. kalimat(1)
B. kalimat(2)
C. kalimat(3)
D. kalimat(4)
E. kalimat(7)

33. Para sejarawan umumnya memiliiki pandangan


yang lebih utuh dalam melihat suatu fenomena
atau peristiwa sosial politik. Berbeda dengan
para pengamatumumnya, para sejarawan selalu
mengaitkan setiap masalah dengan peristiwa
jauh kebelakang. Merle Ricklefs, sejarawan
Australia, misalnya, membuktikan hal itu dalam
buku terbarunya, Polarising Javanese Society.
Bukuu ini merupakan karya yang sangat baik
dalam melihat gejala kebangkitan Islam di
Indonesia. Ricklefs membahas masamasa
pembentukan kesadaran Islam pada paruh
pertamaabadke19hinggaawalabadke20.
Topikparagrafdiatasadalah.
A. Pandangan sejarawan dalam melihat suatu
gejala.
B. Perbedaan pengamatan sejarawan dengan
pengamatumum.
C. Carasejarawanmenganalisismasalah.
D. Pembahasan buku baru karangan Merle
Ricklefs.
E. Pembahasan masa awal pembentukan
kesadaranIslamdiIndonesia.

34. .... penerapan kebijakan itu menyebabkan


munculnya tidak puas .... para pendukung setia
bupatiitu.
Katakata yang tepat untuk melengkapi kalimat
diatasadalah....
A. Ketidakkonsistenan;diantara
B. Ketidakkonsistenan;diantara
C. Ketidakkonsistenan;diantara
D. Ketidakkonsistenan;diantara
E. Ketidakkonsistenan;diantara

35. Pasar kerja penelitian di negeri kita cukup


banyak. Tentu saja yang dimaksud di sini adalah
penelitian terapan yang dapat digunakan untuk
meningkatkan mutu keadaan dalam masyarakat.
Penelitian ekploratoris atau jenis penelitian lain
yang bersifat teoretis juga memiliki pasar kerja,
tetapi biasanya sangat terbatas. Ada juga dana
yangdisediakanolehyayasanyangbesar,seperti
Toyota Foundation. Bahkan, tersedia dana yang
besar yang ditawarkan oleh pemerintah, seperti
sejumlah proyek yang didukung oleh Kemen
terianPendidikanNasional.Belumlagiperusaha
an atau lembaga lain yang berkepentingan
terhadap penelitian tertentu. Pada dasarnya,
pasarkerjapenelitiandiIndonesiaterbukalebar.
Gagasanpokokparagrafdiatasterdapatpada....
A. awalkalimat
B. kalimatkedua
C. awaldanakhirkalimat
D. akhirkalimat
E. semuakalimat
9
36. Fernando Alonso dari Spanyol mengangkat
tangan setelah berhasil meraih posisi pole pada
kualifikasi Sabtu, 25 September 2010, meng
ungguli Sebastian Vettel dari Jerman pada balap
mobilformulasatudiSingapura.
Gagasanutamakalimatdiatasadalah....
A. Fernando Alonso dari Spanyol mengangkatt
tangan.
B. FernandoAlonsomengangkattangan.
C. FernandoAlonsoberhasilmeraihposisipole.
D. FernandoAlonsomeraihposisipole.
E. Fernando Alonso berhasil mengungguli
SebastianVettel.

37. Sepak bola tanpa batas. Ini memang hanya


sebuah slogan belaka. Akan tetapi, slogan itu
membersitkan citacita mulia bahwa sepak bola
lebih dari sekadar suatu permainan. Sepak bola
telah menjadi bagian dari keadaban publik kita.
Melalui sepak bola kita belajar menenun kain
habitus baru untuk menyelimuti dunia yang
sedang dilanda kedinginan karena kurangnya
solidaritas, minusnya religiositas, dan hampanya
sportivitas. Mudahmudahan harapan Paus
Yohanes Paulus II ketika memberkati stadion
Roma menjadi harapan kita juga, Jauhilah
kekerasan dari bola, cegahlah komersialisasi
lewat bola, dan bola hendaklah menjadi sarana
persaudaraan dan perdamaian dunia. Selamat
menikmatiPialaDunia.
Kalimat yang tepat untuk meringkas seluruh isi
paragrafdiatasadalah....
A. Sepak bola merupakan habitus baru masya
rakat dunia sekarang untuk mengurangi
solidaritas, sportivitas, religiositas manusia
yangsemakinlemah.
B. Sepak bola dapat menjadi sarana untuk
membangun solidaritas, sportivitas, persau
daraan, dan perdamaian serta tidak sekadar
merupakansaranakomersial.
C. Habitus baru sepak bola diperlukan dalam
dunia yang serba komersial dan penuh
kekerasan sehingga sepak bola harus tanpa
batas.
D. Slogan sepak bola tanpa batas mengisyarat
kan citacita baru umat manusia untuk
menjaga perdamaian dan membangun
persaudaraandanmenjauhikekerasan.
E. Kekerasan yang kerap membayangi perse
pakbolaan Indonesia menuntut kita mema
hamislogansepakbolatanpabatassehingga
terciptanyakedamaiandanpersaudaraan.

38. Munculnya bahasa Indonesia tidak tibatiba.


Awalnya parapedagang di pelabuhanpelabuhan
Nusantara menggunakan bahasa Melayu untuk
berkomunikasi. Jakarta, Pontianak, Banjarmasin,
Manado, Makassar, Ternate, dan Ambon adalah
pelabuhan tempat pedagang singgah. Di sana
berkembang bahasa Melayu dengan kekhasan
setempat: bahasa Betawi (Jakarta), bahsa
Manado(Manado),bahasaBanjar(Banjarmasin),
Melayu Makassar (Makassar), dan bahasa
Melayu Ambon (Ambon). Ketika penjajah sulit
berkomunikasi dengan penduduk setempatt,
bahasa Melayu yang digunakan. Demikian juga
untuk bahasa pengantar di sekolahsekolah yang
mereka dirikan di berbagai daerah. Jadilah
bahasa yang aslinya di daerah Riau dan Johor
(Malaysia) itu bahas pengantar kedua setelah
Belanda.
Berikutiniinformasiyangterdapatdalambacaan
diatas,kecuali....
A. Kehadiran bahasa Melayu yang dituturkan
sebagaibahasapengantartidaktibatiba.
B. Bahasa Melayu di Malaysia sama dengan
bahasabahasa Melayu di beberapa daerah
diIndonesia.
C. Jauh sebelum Indonesia merdeka, bahasa
Melayu telah menjadi bahasa pengantar di
beberapadaerah.
D. PenjajahbangsaIndonesiasudahmengguna
kanbahasaIndonesiasejakpertamadatang.
E. Bahasa Indonesia berasal dari bahasa
Melayu yang dulu berkembang di Johor dan
daerahRiau.

39. Penulisan kata yang sesuai dengan Ejaan Yang


Disenpurnakanterdapatdalamkalimat....
A. Ia akan mempertanggungjawabkan perbuat
annya.
B. Sudahsayaberitahukanmasalahitukepada
nya.
C. Kami tidak bertanggungjawab atas peristiwa
itu.
D. Tolongberitahumereka!
E. Pemberitahuanitudatangterlambat.

40. Sejalan dengan arah pelaksanaan politik luar


negeri RI serta sekaligus dalam upaya menyerap
masukan dari berbagai pemangku kepentingan,
DepartemenLuarNegeridalamtahun2010telah
melakukan berbagai kegiatan, seperti seminar,
sosialisasi,danpertemuankelompokahli,baikdi
Jakartamaupundiberbagaidaerah.
Gagasanpokokkalimatdiatasadalah....
A. ArahpelaksanaanpolitikluarnegeriRI.
B. Arah pelaksanaan politik luar negeri
Departemen Luar Negeri dan upaya menye
rapmasukandaripemangkukepentingan.
C. Kegiatan Departemen Luar negeri sejalan
denganarahpelaksanaanpolitikluarnegeri.
10
D. Departemen Luar Negeri melakukan
kegiatan.
E. Pertemuan kelompok ahli baik di Jakarta
maupaundiberbagaidaerah.

BAHASA INGGRIS
Delivering medicine to the worlds poorest people is a challenge. Hot, poor places such as Tanzania have
many microbes but microsopic health budgets. Dangerous myth deter many sick rural folk from seeking medical
help. Even if they do seek help, it is often unavailable, for they do not have the money to pay for it, and their
governmentrarelyhasthemoneytogiveittothemforfree.Becausetheycannotaffordadequatehealthcare,poor
people are sick a lot of the time. And because they are sick a lot of the time, they find it hard to put in the long
hoursofproductivelabourthatmightmakethemlesspoor.
Allhopeisnotlost,however.ArecentexperimentinTanzaniahasshownthatasmallhealthbudgetcangoa
long way, provided that the money is spent with care. With the help of a Canadian charity, the Tanzanian health
ministrysetupahealthprojectintworuraldistricts,withacombinedpopulationofabout700,000.Fiveyearsago,
annual health spending in Tanzania was abouut 8 a head. This figure included an estimate for the annual cost of
trained staff. The charity added 2 ahead to thepot, on condition that it was spent rationally. But this, the donors
meant that the amount of money spent on fighting a particular disease should reflect the burden that disease
imposedonthelocalpopulation.
Thismaysoundobvious;however,inthisregion,noonehadacluewhichdiseasescausedthemosttrouble,
sothefirsttaskwastofindout.Researchersweresentouttocarryoutadoortodoorsurvey,askingrepresentative
householdswhetheranyonehadbeenillordiedrecently,andifsowithwhatsymptoms.Theserawnuumberswere
then crunched to produce a burden of disease profile for the two districts. In other words, researchers sought to
measure how many years of life were being lost to each disease, including the damage done to families when
breadwinnersdie.
Theythencomparedtheirresultswiththeamountspentbythelocalhealthauthoritiesoneachdiseaseand
found that it bore no relation whatsoever to the harm which the disease inflicted on local people. Some diseases
werehorriblyneglected,suchasmalaria,whichaccountedfor30%oftheyearsoflifelostbutonly5%ofthehealth
budget. Other conditions, meanwhile, attracted more than their fair share of cash. Tuberculosis, which accounted
forlessthan4%ofyearsoflifelost,received22%ofthebudget.
This tiny infusion, of cash from the Canadians, in the form of an extra 2 a head, was enough to allow the
districtshealthauthoritiestomaketheirspendingreflectthediseaseburden.Theresultsofallthiswerestunning.
Infantmortalityfellby28%between1999and2000andtheproportionofchildrendyingbeforetheirfifthbirthday
droppedby14%.

GunakanPetunjukAdalammenjawabsoalnomor41
sampai60.

41. Whatcanbeinferredfromparagraph1?
A. PeopleinAfricancountriesdonotgoto
doctorsduetoperilousmyth.
B. ThebudgetforhealthinTanzaniaislowas
therearentmanydisease.
C. WhenpeopleinTanzaniaaresick,they
havenohopetorecover.
D. InTanzaniamedicaltreatmentisaccesible
forthepoor.
E. PovertyandillnessinTanzaniaarelikea
viciouscycle.

42. Themostsitabletitleforthetextis________
A. TheEffectofanAidPackagefrom
CanadianCharity
B. TheGeneralHealthConditioninTanzanian
People
C. ASurveyontheHealthConditionin
Tanzania
D. TheDifferenceaSmallIncreaseinaTiny
HealthBudgetcanMake
E. DeadlyandvirulentDiseaseFoundamong
theTanzanian

43. The term a burden of disease in paragraph 3


means________.
A. theworsediseasethemoreburden
B. therelativeeffectsofdifferentdiseaseona
society
C. adiseaseisburdensomeforthepoor
D. eachsocietyandfamilyhasitsownburden
causedbydisease
E. adiseaseaffectsnotonlythesickbutalso
thebreadwinner
11

44. Thepurposeofthewriterinwritingthisarticle
isprobablyto________.
A. showhowgenerousforeigninstitutionscan
beinhelpingothercountries
B. persuadeothercountriestocopythe
Tanzanianmodel
C. showhowthemoneyisspentismore
importantthanhowmuchisspent
D. explainthetypesofdiseasespeoplecan
findinTanzania
E. invitedonorstodonatemoneytocontries
inneedofcash
45. Whichoffollowingstatementsaboutthetextis
FALSE?
A. Theadditionalamountdonatedbythe
Canadiancharitywascarefullyspent.
B. Thebudgetallocatedforeachperson
includedthetrainingcostforthemedical
staff.
C. ThepresenceofmythinTanzaniamayhave
discouragedpeopletogotodoctors.
D. Aseriousdiseaseprobablyaffectednot
onlythepatientbutalsothefamily.
E. Theamountofbudgetallocatedtoeach
diseasedependedonnhowharmfula
diseasewas.
Recent technological advances in manned and unmanned undersea vehicles have overcome some of the
limitations of divers and diving equipment. Without a vehicle, divers often become sluggish and their mental
concentrationbecomeslimited.Becauseofunderseapressurewhichaffectedtheirspeechorgans,communication
among divers was difficult or impossible. But today, most oceanographers make observations by means of
instruments which are lowered into the ocean or from samples taken from the water. Direct observation of the
oceanflooraremadenotonlybydiversbutalsobydeepdivingsubmarines.Someofthesesubmarinescandiveto
depthsofmorethansevenmilesandcruiseatdepthsofthousandfeet.Radioequippedbuoyscanbeoperatedby
remotecontrolinordertotransmitinformationbacktolandbasedlaboratories.

GunakanPetunjukAdalammenjawabsoalnomor46
sampai47.

46. Whichofthefollowingstatementsisthemost
suitableconcludingsentenceoftheparagraph?
A. Inshort,thetechnologyinundersea
explorationshouldbeimproved.
B. Therefore,diversshouldavoidundersea
pressuretobeabletocommunicate.
C. Infact,deepdivingsubmarinesarethebest
meansforoceanographerstoconduct
underseaexploration.
D. Toconclude,itittheradiosdiversuseto
communicatethatmakestheundersea
explorationsuccessful.
E. Thus,succesfulcommunicationinthe
explorationofoceangreatlydependson
thediversandvehicles.

47. Themainideaofthepassagetellsusthe
reasonswhy________.
A. underseavehicleswerenotwellequipped
forexplorations
B. recentexplorationoftheoceanhasproved
tobesuccessful
C. hightechnologyforunderseaexploration
wasnotimplementedearlier
D. diverscouldnotcommunicatewellwith
landbasedlaboratories
E. deepdivingsubmarinescansend
informationtodiversinthelaboratories
GunakanPetunjukAdalammenjawabsoalnomor48
sampainomor55.

48. Shinta:IusedtolovegoingtoPuncakoverthe
weekend.
Luli :_______
A. IlovePuncaktoo.
B. So,wheredoyougonow?
C. Thatsgreat.Whydontwegonextweek?
D. So,youstillenjoygoingtoPuncak?
E. Whydoyoulikeitmuch?

49. Danywasextremelytiredwhenhearrived,
becausehe_______forhisflightforthreehours.
A. waited
B. waswaiting
C. hadwaited
D. hadbeenwaiting
E. hadbeenwaited

50. _______studentsstudyinginaforeigncountry
areprovidedwithinformationaboutliteracy
practicesandacademiccultureofthatcountry,
theywillfeelstrandedinthatacademic
environment.
A. As
B. Inorderto
C. Unless
D. Assoonas
E. Where

12

51. Bambang:Businesspeoplecomplainthatthereis
asharpincreaseofChineseproductfloodingthe
Indonesianmarket.
Yudi:It_______duetothelatsyearstrade
agreementbetweenIndonesiaandChina.
A. mustbe
B. hastobe
C. wouldbe
D. shouldbe
E. wouldratherbe

52. thetermrock,________ashortenedformof
rockandroll,wascoinedbyanAmerican
broadcastertoreplacerhythmandblues.
A. Itis
B. whichis
C. forwhich
D. whichitis
E. is

53. Iwouldratherhavegraduatedfromthe
UniversityofNewYorklastyear.
ThesentencemeansthatI______fromthe
UniversityofNewYorklastsyear.
A. wouldntgraduate
B. wontgraduate
C. dontgraduate
D. didntgraduate
E. haventgraduated

54. ________knownasthecountryofTinmorLeste
wasoncepartofIndonesia.
A. Thatisnow
B. Whatisnow
C. Nowis
D. Thatnow
E. Whatnow

55. Hadtherebeengoodteachingfacilitiesinthe
school,everyteacherwouldhavebeenableto
teachtheirstudentseffectively.
Fromthesentenceabove,wecanconcludethat
________.
A. teachingandlearningwillbeeffective
B. thequalityofteachingwasgood
C. therewasnodifferenceintheteaching
method
D. theteacherstaughtthestudentseffectively
E. therewerenogoodteachingfacilitiesinthe
school.

Theoptionofhomeschoolinghasbeenaroundforalongtime;____56____,untilrecentlyithadnotbeenso
popular. The idea of home schooling seems like a cureall to many parents due to the advantages this type of
education provides over traditional schools. Children who are home schooled can ____57____ many of the
problemsschoolshavebecomeknownfor.Forone,theenvironmentislessthreatening.Childrencanlearnwithout
____58____ other students, aggressive or nasty teachers, and be under the constant supervision of parents.
____59____, home schooling allows parents todictate theacademiccourse oftheirchildren. Home schooling also
allowsstudentstoproceedattheirownspeed.Ifachildisweakat____60____,aparentcanfocuslessonsonthis
skillinfavorofanotherskillthatthechildmightgrasprathereasily.

Gunakan Petunjuk A untuk menjawab soal nomor 56


sampainomor60.
56. .....
A. eventhough
B. inaddition
C. however
D. whereas
E. inotherwords
57. .....
A. encounter
B. pursue
C. ignore
D. avoid
E. break

58. .....
A. scaring
B. feared
C. fearof
D. afraidof
E. fearing

59. .....
A. Therefore
B. However
C. Thus
D. So
E. Inaddition

60. .....
A. multiplying
B. multiple
C. multiply
D. multiplication
E. multiplied

13

MATEMATIKA DASAR

1. Pembahasan
2 2
2
2
1 2
( ( ) ( ( ))
3 1 3 3
9 2 1 9 6 32
3 1 1
6 8 2 0
4 4
3 4 1 0
3 3
f g x g f x
x x
x x x x
x x
x x
b
x x x x
a
=

= + =
+ +
=

= + = = =

Jawaban:D

2. Pembahasan
5
5
7
5 5
5
5 7
5 .5 7
7 7
5 log 5
5 5
x x
x x
x
x a
+
=
=
| |
= = =
|
\ .

Jawaban:C

3. Pembahasan
2 2
2
2 2
2 2
2 2
2
2
2
2
2 2
2
1
, , , var
1
1, dim :
* , ,
2
2
1 2 1
* , ,
2
2
2 1 2 0
2
2 1 2 . 0
2 1
2
2 1 1
1
+ =

`
+ =

)
+ =
e e
= +
= +
= =
e e
= +
= +
= =

+ =

= =

I
a b
a b c d merupakan iabel
c d
yg dapat diganti x y ana
a c x dan b d y
Z ac bd
Z x y
Z
a d x dan b c y
Z ac bd
Z xy xy
Z x x Z
x
x x
x
x
x x
x
2
2
1 1
2 1 2 2
2 2
= = =
x
x x maka y

min
1 1 1 1
2 2. 2 2. 2 2
2 2 2 2
1 1
2 1 2 3
2 2
| |
= + = +
|
\ .
= = =
Z ac bd
Jawaban:C
4. Pembahasan
:
2 3 12 2 3 6 48
, 2 3
: 2 3 12 12 4
2 2 4 2
4
3 3 4
3
12 6 4 4 22
4 2
3 3 3
Kita anggap hanya punya akar tunggal
a b c dan ab ac bc
Jadi a b c
maka a b c a a a a
a b b b
a c c c
a b c
+ + = + + =
= =
+ + = + + = =
= = =
= = =
+ +
+ + = + + = =

Jawaban:D

5. Pembahasan
( )
( )( )
2
2 2
2 2
2
0
2 0
1
tan
2sin 8sin 2cos 5
2 sin ???
2sin 8sin 2 1 sin 5 0
4sin 8sin 3 0
2sin 1 2sin 3 0
1 3
sin sin ( )
2 2
30
1 1 1
tan 30 3
3
1
, 2 sin 2.3. 3
2
x
b
x x x
maka b x
x x x
x
x x
x x TM
x
b
b b
Jadi b x
=
=
=
+ =
+ =
=
= v =
=
= = =
= =

Jawaban:B

6. Pembahasan
( ) ( )
( )( ) ( ) ( )
6 5
2 1 3
;
0 4 6
.
2 1 3 12 3
4 4
0 4 6 24 6
A B
A B A AB AB
AB AB

= =

= =

= = = =

Jawaban:E

7. Pembahasan
( )
( ) ( )
2
2 2
, ???
+ =
=
x y x y
maka x y y x

PEMBAHASAN KEMAMPUAN DASAR
SELEKSI MASUK UNIVERSITAS INDONESIA 2011
14

( ) ( )
2
2 2
2
2 2 2 2
2 2
0
(


( + +

=
x y y x
x xy y y xy x
Jawaban:A

8. Pembahasan
( ) ( )
(0) 0 ; (0) 2; (0) .....
(0) (0) 0
:
( ) ( )
( ) ( ( ))
( ( )) ( ) ( )
.
( )
:
( ( ( ))) ( ( )) ( )
( ) . .
( ( )) ( )
(0) (0). (0). (0)
I I
I
I I I I
g x f o f o f x
f f g
g f o f o f
Ingat Aturan Rantai
f og x h x
h x f g x
d f g x dg x dh x
dx dg x dx
maka
d f f f x d f f x d f x
g x
d f f x d f x dx
g f f f
=
= = =
= =
=
=
=
=
=
=2.2.2 8 =

Jawaban:D

9. Pembahasan
2
2
1 2sin 1
2sin
sin sin 1 1
sin2 sin2
2 cos 2 cos
1 2sin 1 1
sin2 sin2
2 sin cos 2
x
x
x x
x x
x x
x
x x
x x
| |
| |

|
|
|
|=
|
|
| |
\ .
\ .
| |
=
|
\ .
cos2
1
sin2
2
x
x
cos2x
| |
|
|
|
|
\ .
=

Jawaban:B

10. Pembahasan
( )
20 400
19
1 19 400
2
190 400 210
Jumlah bilangan positif
p
p p
=
+ + =
+ = =

Jawaban:A

11. Pembahasan
( )
( ) ( )
( ) ( )
3
3 3 2 2
2 2
3
2 2
3
3 ....
3 3
2 5 2 5 3 2 5 2 5
3 2 5 2 5
+ =
+ = + + +
= + + + +
+ +
a b
a b a b a b ab

( ) ( )
( )
( )
( )
( )
( ) ( )
3
3 3
3
3
3 3
4 3 2 5 1 3 2 5 1
4 3 3
4 3 ; ,
4 3 3 4 0
1 0 3 4
1
1 1 4
1 1 4 0
, 1 1 3 1 3 2

+ = + + +
+ =
+ = + + =
= + =

= + = + = =

akar akar
tak rasional
a b
a b a b
a b a b misal a b p maka
p p p p
Jadi p maka a b a b

Jawaban:A

12. Pembahasan
( )
2 2
2
2
2
log log 1
1 1
log log 1 ; log ,
2 2
1 1 1
. . 1 1 2
2 2
2 1 0 1 0 1
log log 1
2
a b
a b a
a a
b a
b a misal b p maka
p p p
p
p p p p
b p b a b
maka a b a a a
+ =
+ = =
+ = + =
+ = = =
= = =
+ = + =

Jawaban:C

13. Pembahasan
( ) ( )
1 2
2
2
1
2
2
2 2 2
2
2
3
9
, , ,9
8
( ) 2
4
2 2
=

=
`
=
)
=
=

= = =
= = =
I
x a
y x
x a
y a
y a
Jadi titik titiknya a a dan a a
a
maka gradien m m y a
a
x a x a y a

( )
( )
( )
2
2
2 2 2 2
. . ( , ) 2 :
2
0
2 2
=
=
=
=
= + = + =
P G S melalui a a dan m a
y b m x a
y a a x a
titik potong sumbu y x
y a a a a a a

Jawaban:A

14. Pembahasan
f(x)=x
2
2x5|x|
fmaksimalpada[5,10]adalah....???
- Untuk[5,10]
f(x)=x
2
2x5(x)
=x
2
2x+5x
=x
2
+3x
15

5
3 0
10 7 0
B
C
A
a a
x
y
2
a
2
y x =
Jadi,fmakssaatx=5
y=2515=10

- Untuk[0,10]
f(x)=x
2
2x5x
=x
2
7x
Jadi,fmaks=10070=30

Jawaban:E

15. Pembahasan
| |
( ) ( )
2 1 6 3
197 2 1 195 6 3
99 33
1 3 5 7 9 11 13 15... 195 197 ...
:
1 3 5 7 ... 197 2 3 9 15 ... 195 ...
,
99 33
1 197 2. 3 195
2 2
99 33
.198 33.198 198. 99.33 3267
2 2
n n
U n U n
n n
n n
Maka
so
= =
= =
= =
+ + + + + =
+ + + + + + + + + =
+ + =
= = =

Jawaban:D

16. 2dadudilempar1kalimakan(s)=36
Peluangmunculjumlahdadu7padapelemparan
1x=
P(jumlah7)=
6 1
36 6
=
P(bukanjumlah7)=
5
6

Maka peluang muncul satu kali jumlah 7 pada
pelemparan3kali2buahdadu=
1 5 5 25
. . .3
6 6 6 72
| |
=
|
\ .

Jawaban:D

17. Perhatikangambarberikut!

Koordinatmasingmasingtitik:
( )
( )
( ) ( )
( ) ( )
( )( )
( )
2 2 2
2 2
2 2 2 2
2
2 2 2 2
2 2 2 2
2 2 2 2
2
, 1, 1
, ; ,
5
. 0
. 0
0
1 0
1
1

= A
=

| | | |
=
| |

\ . \ .
+ =
+ =
= =
=

C x x a a
A a a B a a
Luas dan ABC siku sikudi C
CA CB
a x a x
a x a x
a x a x
a x a x
a x a x
TM x a

( ) ( ) ( ) ( )
( )( )
( )
( )
2 2
2 2
2 2
2 2 2 2 2
2 2 2 2 2 2
2
2 2
2 2 2 2 2
1
. 5 10 100
2
1 1 1 1 100
1 2 1 1 1 2 1 1 100
2 1 1 100
4 1 100 4 100 25
= = =
( (
+ + + =
( (

+ + + + + =
( (
+ =

( = = =

=

AC BC AC BC AC BC
a a a a a a a a
a a a a a a a a
a a a a a
a a a a a
absis C x
2
1
25 1 24
2 6

=
=
a
x
x

Jawaban:B

18. Pembahasan
}
2
1
2
1 2
2
6 2 1 0
10
10 100
+ =
= = =
= =
x
x x a
x
beda selisih x x
D
D a
a

16

y=x
x+5y=
A
B
C
x+y=4
4
4
20
x
y
( )
( )
2 2
2 2
1 2
1 2
2
2 2
1 2 1 2 1 2
1 2
4 100 36 4 2 1 100
36 8 4 100 8 60
15
2
, 6 2 1 0 6 16 0
(1) 6 ( )
(2) . 16 ( )
(3) 2 .
36 32 68 ( )
1 1 1
(4) . ( )
16
= = =
+ = =
=
+ = =
+ = =
= =
+ = +
= + =
=

D b ac a a
a a
a
Jadi x x a x x
b
x x Benar
a
c
x x Benar
a
x x x x x x
Salah
Benar
x x

Jawaban:

19. Perhatikangambarberikut!!

Diketahui:F(x,y)=3x+2y
x+y4;axy0;x+5y20;y0

makadenganujititikpojokdiperoleh:
Titikpojok F(x,y)=3x+2y
A(0,4) 3.0+2.4=8
B(2,2) 3.2+2.2=10
C(5,5) 3.5+2.5=25(maks)

1) 10 3 5 10 3.5 15 15( )
(2) 3 5 5 3.5 5.5 5 20 20( )
(3) 2 7 4 2.5 7 4.5 17 20 ( )
(4) 2 5 2.5 5 5 10 10 ( )
y x Benar
x y x y Benar
x y Benar
y x Benar
+ = + = =
+ = + = =
+ s + s s
> + > + >

Jawaban:E

20. Pembahasan
}
( )
( )
2
1
2
2
2
2
1 2
2
1 2
0
2010
:
2010 0
2010 0
0
* 2010 0 0
0 2010
* 2010 0 2010
0 2010
+ + =
+ =
+ + =

`
+ + =

)

=
+ + = =
= =
+ + = =
= =
x
x px q
x
p q
Dengan subtitusi didapat
x q x q
x px p
karena akar akarnya
harus bulat c
x q x q dengan q maka
x atau x
x px p dengan p maka
x atau x


Jawaban:C

BAHASA INDONESIA

21. Kata penghubung adalah kata yang berfungsi


menghubungkan dua kata, klausa, kalimat, atau
antar paragraf. Missal; atau, tetapi, sebab, yaitu,
bahkan, bahwa Kalimat tersebut hanya memiliki
satu subjek yaitu Ni Wayan Suryathini, sehingga
adabeberapakatayangbisadihilangkan.Sehingga
paragraf tersebut menjadi Ni Wayan Suryathini,
yang lahir dan dibesarkan di Denpasar, namun
meneruskan studi dan bekerja di luar negeri,
mengungkapkan bahwa tidak semuanya pojok di
kotakelahirannyaberubah.
Jawaban:B
22. jika ingin mencari makna kata dalam sebuah
kalimatkitaharusmengetahuikonteksdanisidari
kalimat tersebut. Dalam kalimat di atas intinya
adalah berkarya di dunia musik . Sehingga
maknakatadariberkibaradalahmenjadiidola
Jawaban:B
23. Kata baku adalah kata yang penulisan atau peng
ucapannya sesuai dengan kaidahkaidah standar
atau yang telah dibakukan. Kaidah tersebut ber
pedomanpada:
a. Pedomanejaanyangdisempurnakan
b. Tatabahasabaku,dan
c. KamusumumbahasaIndonesia
Jawaban:D
24. Jika ingin mencari makna kata dalam sebuah
kalimatkitaharusmengetahuikonteksdanisidari
kalimat tersebut. Paragraf tersebut isinya membi
17

carakan masalah kependudukan, atau tempat


tinggal seseorang. Sehingga makna kata duduk
dalamparagraftersebutadalahbermukim.
Jawaban:C
25. Opini adalah pendapat yang dikemukakan orang
lain. Sedangkan kalimat fakta adalah kalimat
menyatakan sesuatu yang benarbenar ada atau
terjadi, dapat dibuktikan kebenarannya. biasanya
kalimat fakta didukung oleh bukti bisa berupa
angka angkat, tahun, jumlah, persen dan bukti
bukti yang nyata. Dalam paragraf di atas yang
merupakan opini adalah nomer (2) ada kata
Namun dan kalimatnya tidak memuat kata
pendukungdanbukti.
Jawaban:B
26. Kalimat efektif ditandai dengan kehematan dan
ketepatan dalam penggunaan katakatanya. Dalam
opsitersebutadabeberapakesalahan,untukopsi
a. Katapada
b. Katayangdalam
c. Katayangsesungguhnya
d. Efektif
e. Katayangakandankatadengan
Jawaban:D
27. Kata serapan adalah katakata yang berasal dari
bahasa asing atau daerah yang kemudian
digunakan dalam bahasa Indonesia setelah
mendapatkan penyesuaian dalam penulisan atau
pengucapan. Dalam menentukan kata sapaan kita
perlu mengetahui asal bahasa tersebut, penulisan
yang paling mendekati bahasa aslinya itu yang
benar.
Jawaban:A
28. Kata gabung adalah kata yang berfungsi untuk
menggabungkan antarkalimat atau kata sehingga
menjadikesatuanyangutuh.Dalam
Jawaban:B
29. Fungsi tanda koma (,) adalah untuk memberikan
jeda dalam membaca kalimat. Tanda koma juga
merupakan tanda untuk menyebutkan bagian atau
macam.Dalamsoaltersebuttandakomaberfungsi
sebagaijeda.
Jawaban:B
30. Topik dalam paragraf adalah pokokpokok yang
terkandung dalam teks atau bacaan. Topik
merupakan hal paling penting untuk membuat
paragraf. Topik akan dikembangkan menjadi
sebuahgagasanutamadalamparagraf.
Jawaban:A
31. Kalimat efektif ditandai dengan kehematan dan
ketepatan dalam penggunaan katakatanya. Untuk
opsi A tidak efektif karena kata ada sudah
menunjuk macam tradisi wayang wong, ludruk,
macapatdansyair.UntukopsiBefektif.Untukopsi
Ckatadahulu.Untukopsi DkatajugauntukopsiE
katamaksuddantujuan.
Jawaban:B
32. Kata baku adalah kata yang penulisan atau peng
ucapannya sesuai dengan kaidahkaidah standar
atau yang telah dibakukan. Kaidah tersebut
berpedomanpada:
Pedomanejaanyangdisempurnakan
Tatabahasabaku,dan
KamusumumbahasaIndonesia
Jawaban:A
33. Kitaharusmengetahuiisiparagrafterlebihdahulu.
Yaitumasalahpandanganparasejarawan.Sehingga
topik dalam paragraf di atas adalah pandangan
sejarawandalammelihatsuatugejala.
Jawaban:A
34. Soal tersebut konteks penerapan kata yang tepat
adalah bagaimana penulisan imbuhan yang tepat.
Untuk frasa yang mendapat imbuhan maka
penulisannya disambung. Untuk imbuhan di yang
menunjukkan tempat penulisannya dipisah.
ketidakkonsistenandandiantara
Jawaban:D
35. Gagasan pokok, kalimat utama, ide pokok, pikiran,
pikiran utama, gagasan utama itu semua memiliki
pengertian yang sama. Ciriciri kesemuanya itu
dalam sebuah paragraf terletak di awal atau di
akhir paragraf, sifat kalimatnya umum/paling luas,
kalimatnya belum tentu sama dengan yang di
dalam paragraf, merupakan kesimpulan. Pargraf
tersebutmemilikigagasanutamadiawaldanakhir,
yaitu pasar kerja penelitian di negeri kita cukup
banyak dan pasar kerja penelitian di Indonesia
terbukalebar.
Jawaban:C
36. Gagasan utama adalah kalimat yang mengandung
idepokokparagraf. Kalimatutama biasanya ada di
awal atau di akhir paragraf. Sebelum mengetahui
kalimat utama, kita harus tahu dahulu paragraf itu
membicarakanmasalahapa/ideparagraftersebut.
Paragraf tersebut membicarakan masalah keme
nangan Alonso. Gagasan utamanya adalah
FernandoAlonsoberhasilmeraihposisipole.
Jawaban:C
18

37. Paragraf/alinea merupakan bagian dari wacana


yang merupakan satu kesatuan kalimatkalimat
penjelas. Paragraf yang baik harus memenuhi
kriteria yaitu memiliki satu ide pokok atau satu
pikiran utama dan beberapa pikiran penjelas
antarkalimat saling berkaitan/berkoherensi.
Sehinggasetiapparagrafmemilikisebuahringkasan
atauisi.Ringkasanparagraftersebutadalahsepak
bola dapat menjadi sarana untuk membangun
solidaritas, sportivitas, persaudaraan, dan per
damaian serta tidak sekedar merupakan sarana
komersial.
Jawaban:B
38. Informasi adalah berita yang kita peroleh setelah
kita membaca suatu bacaan. Untuk mencari
informasi kita perlu mengetahui terlebih dahulu isi
dari bacaan tersebut. Dalam paragraf tersebut
isinya membahas mengenai asal mula bahasa
Indonesia. Yang bukan merupakan informasi dari
bacaantersebutadalahpenjajahbangsaIndonesia
sudah menggunakan bahasa Indonesia sejak
pertamadatang.
Jawaban:D
39. Katakatabakuadalahkatakatayangpenulisannya
sudah sesuai dengan kaidah yang berlaku resmi
dalam bahasa Indonesia. Bentuk kata baku ada
yang berasal dari bahasa asing disebut unsur
serapan, yaitu katakata dari bahasa asing yang
penulisannya diadaptasikan dengan ketentuan
ketentuan dalam bahasa Indonesia. Konteks
penulisan dalam soal tersebut adalah bagaimana
penulisan kata yang berimbuhan B harusnya
beritahu, C bertanggungjawab dipisah, D harusnya
diberitahu,Epemberitahuanseharusnyadigabung
jadipemberitahuan.
Jawaban:A
40. Ide pokok/pikiran utama/gagasan utama adalah
gagasanyangmenjiwai paragraf.Cara menentukan
gagasan utama dalam paragraf adalah: merupakan
pernyataan yang paling umum,palingpenting atau
penyataan yang merupakan kesimpulan, dan
terdapat bagianbagian yang diulang pada kalimat
kalimatyanglain.
Jawaban:D


BAHASA INGGRIS

41. Paragraf pertama menjelaskan tentang kondisi


kesehatan, penyakit, dan kemiskinan yang
melanda Tanzania. Kita dapat simpulkan bahwa
kemiskinan dan penyakit di Tanzania seperti
lingkaranganas.
Jawaban:E

42. Pada paragraf pertama dijelaskan pengantar


tentang tantangan dalam menyampaikan obat
pada masyarakat di negara yang miskin, seperti
Tanzania.Disinikesehatanmasyarakatburukdan
kemisikinan dan kepercayaan mereka memper
buruk keadaan. Namun pada paragraf kedua,di
jelaskan ada harapan, sebagimana penjelasan
darisebuahekperimen.Selanjutnyaparagraftiga
sampai lima menjelaskan eksperimen ini . Jadi
dapat kita simpulkan judul yang tepat untuk
bacaan ini adalah Sebuah survei tentang
kesehatandiTanzania.
Jawaban:C

43. Kata burden of disease dapat kita pahami dari


penjelasankalimatInotherwords,researchers
sought to measure how many years of life were
being lost to each disease, including the damage
done to families when breadwinners die, yang
artinya tentang dampak relatif dari berbagai
penyakit yang berbeda yang melanda
masyarakat.
Jawaban:B

44. Teksinimenjelaskanbagaimanadenganbantuan
dari sebuah lembaga kemanusiaan pada anggar
an yang sedikit dari pemerintah Tanzania dapat
memberikan kontribusiyangsignifikanpadakon
disikesehatanmasyarakat.Padaparagrafterakhir
kita juga bisa simpulkan penulis ingin mengajak
pembaca untuk peduli dan dapat membantu
meskipunbantuansedikit.
Jawaban:E

45. Pernyataan yang tidak sesuai dengan bacaan ini


adalah the budget allocated for each person
included the training cost for the medical staff.
Pada paragraf kedua disebutkan; this figure
included an estimate for annual cost of trained
staff. Kata trained staff maksudnya staf yang
terlatih,bukandanauntukpelatihan.
Jawaban:B

46. Bacaan ini membahas bagaimana peran per


kembangan teknologi kendaraan bawah laut
berawak dan tidak berawak mengatasi keter
batasan penyelam dan peralatan menyelam.
19

Kesimpulannyaadalahkarenaadanyakomunikasi
yanglancareksplorasinyaberhasil.
Jawaban:E

47. Pada kalimat pertama dijelaskan recent


technological advances in manned and
unmanned undersea vehicles have overcome
some of limitation s of divers and diving
equipment, artinya kendala dalam mengeksplo
rasi laut tidak ada lagi,sehingga dengan bantuan
alatyangcanggiheksplorasibisaberhasil.
Jawaban:B

48. Penggunaan used to+verb 1 untuk menjelaskan


kalauaktifitasnyasudahtidakdilakukanlagi.Jadi
respon yang tepat adalah; So, where do you go
now? Kalau sudah tidak lagi ke Puncak lalu
biasanyapergikemana?
Jawaban:B
49. Ungkapan Dani was extremely tired when he
arrived adalah akibat dari menunggu
penerbanganselamatigajam.ArtinyaDanisudah
menunggu selama tiga jam karena itu ia
kelelahan. Untuk menjelaskan lamanya aktivitas
yang sudah dilakukan di masa lampau adalah
denganbentukPastPerfectContinuous.
Jawaban:D

50. As artinya karena atau ketika, in order that


artinyasupaya,unlessartinyakecualijika,assoon
as artinyasesaatsetelah,whereartinya dimana.
Kalimat ini menjelaskan bahwa karena para
siswa yang belajar di luar negeri disediakan
informasi tentang praktik literasi dan budaya
akademik dari negara tersebut. Jadi, kata yang
sesuaiadalahAsyangberartikarena.
Jawaban:A

51. Must artinya pasti atau harus, has to artinya


harus, would be artinya akan, should be artinya
seharusnya dan would rather be artinya
kecenderungannya. Kalimat ini maksudnya pasti
karenaperjajianantaraIndonesiadanChina.Jadi
katayangsesuaiadalahmustbe.
Jawaban:A

52. Clause yang ada di antara dua koma merupakan


penjelas subjek kalimat. Subjek kalimat adalah
the term rock. Yang sesuai untuk melengkapi
klausa ini adalah which is yang berarti yang
merupakanbentuksingkatdarirockandroll.
Jawaban:B

53. Penggunaan Would rather untuk pengandaian


yang tidak terjadi di masa lampau. Disebutkan I
wouldratherhavegraduatedfromtheUniversity
of New York last year jadi Penulis tidak lulus
tahunlalu.
Jawaban:D

54. Untuk melengkapi kalimat ini yang dibutuhkan


adalah Noun clause yang diawali dengan kata
Tanya what. Karena kalimatnya passive ada
sruktur kalimat to be+verb 3, sehingga yang
sesuaimelengkapiadalahwhatisnow.
Jawaban:B

55. Kalimat ini adalah ungkapan pengandaian yang


tidak tejadi. Dalm pembahasan grammar disebut
kalimat bersyarat. Artinya jika ada fasilitas yang
baik dalam pengajaran di sekolah, maka setiap
guru dapat mengajar dengan efektif. Sehingga
kondisiyangbertolakbelakangdenganungkapan
iniadalahtidakadafasilitasyangbaikdisekolah.
Jawaban:E

56. Eventhoughartinyameskipun,inadditionartinya
lagi pula, however artinya namun, whereas
artinyasementara,inotherwordsartinyadengan
katalain.Kalimatinimenjelaskantentangpilihan
homeschooling yangsudahlamaada;meskipun
demikiansampaisekaranghomeschoolingbelum
begituterkenal.
Jawaban:A

57. KalimatChildrenmanyoftheproblemsartinya
Para siswa yang ikut program home schooling
dapat.beberapa masalah yang sekolah miliki
diketahui. Kata encounter artinya menghadapi
atau mengatasi, pursue artinya mengejar, ignore
artinya mengabaikan, avoid artinya menghindari
dan break artinya merusak. Konteks bacaan ini
adalahanakanakdapatmengatasimasalah.
Jawaban:A

58. Kata yang paling tepat adalah fear of. Kata


without artinya tanpa ada untuk melengkapi
kalimat yang diawali kata without dibutuhkan
bentukkatabenda;fearof.
Jawaban:C

59. Kalimat home schooling allows parents to


dedicate the academic course bertujuan
mengutarakan opini sebelumnya tentang
keunggulan home schooling. Kata yang tepat
untukmenguatkanopini adalahInaddition,yang
artinyalagipulaataujuga.
Jawaban:E
60. Dalamkalimatiniadakataweakat.Kataweakat
ini biasanya dilengkapi dengan kata berbentuk
gerund. Gerund adalah kata kerja bentuk verb
Ing yang berfungsi sebagai kata benda. Maka
yang tepat untuk melengkapi kalimat ini adalah
multiplying.
Jawaban:A
20

TES KEMAMPUAN IPA


SIMAK UI 2011

BIDANGILMU :MATEMATIKAIPA,BIOLOGI,FISIKA,KIMIA,DANIPATERPADU
TANGGALUJIAN :3JULI2011
WAKTU :120MENIT
JUMLAHSOAL :60


Keterangan :MATEMATIKAIPA nomor1sampaidengannomor12
BIOLOGI nomor13sampaidengannomor24
FISIKA nomor25sampaidengannomor36
KIMIA nomor37sampaidengannomor48
IPATERPADU nomor49sampaidengannomor60

MATEMATIKA IPA

Gunakan Petunjuk A dalam menjawab soal nomor 1


sampainomor12.

1. Pada suatu barisan geometri dengan 1 r > ,


diketahui dua kali jumlah empat suku pertama
adalahtigakalijumlahsukugenappertama.Jika
di antara sukusuku tersebut disisipkan empat
bilangan, dengan cara: antara suku kedua dan
ketiga disisipkan satu bilangan, dan antara suku
ketiga dan keempat disisipkan tiga bilangan,
maka akan terbentuk barisan aritmatika dengan
beda r . Jumlah bilangan yang disisipkan adalah
...

A. 14 D.32
B. 24 E.42
C. 28

2.
tan tan
lim
1 (1 )tan tan
a b
a b
a a
a b
b b

=
+
....
A.
1
b
D.
1
b


B. b E.1
C. b

3. Sebuah kerucut tegak tanpa alas diletakkan


terbalik. Sebuah bola berdiameter 16 cm
dimasukkan ke dalam kerucut sehingga semua
bagian bola masuk ke dalam kerucut. Kerucut
dengan volume terkecil yang mungkin
mempunyaiukurantinggi....
A. 8 2 cm D.24cm
B. 8 3 cm E.32cm
C. 16 2 cm

4. Misalkan ( ) f x adalah suatupolinominalderajat


tiga yang akarakarnya membentuk barisan
aritmatika dengan nilai suku ketiga adalah tiga
kalinilaisukupertama;danjumlahakarakarnya
sama dengan 12. Maka sisa dari pembagian
( ...) f x + oleh
2
1 x + adalah....
A. 7 6 x D. 6 x
B. 6 x + E. 1 x +
C. 6 7 x

5. Misalkan A adalah suatu matriks 2x 2 . Jika


2
5 7 0 A A I + = maka jumlah elemenelemen
diagonalutamadarimatriks A adalah....
A. 2 D.5
B. 3 E.6
C. 4

6. Jika daerah yang dibatasi oleh sumbu y , kurva


2
y x = dan garis
2
y a = di mana 0 a = diputar
mengelilingi sumbu x volumenya sama dengan
jika daerah itu diputar mengelilingi sumbu y .
Nilaiyangmemenuhiadalah....
A.
5
8

B.
3
8

21

C.
2
5

D.
8
5

E.
5
2

7. Jika
1
sin sin
3
x y = dan
1
cos cos
2
x y = maka
nilaidari sin( ) x y + = ....
A.
12
13

B.
12
15

C.
12
17

D.
12
19

E.
12
21

8. Jikasistempersamaan
2 1 ax y b + = +
3 x y + = ,dan

2
2 2 x y a + = +
3 3 x y + =
mempunyai solusi yang sama, maka banyaknya
pasanganbilangan ( , ) a b adalah....
A. 0
B. 1
C. 2
D. 3
E. takberhingga

9. Misalkan fungsi : f R R dan : g R R


didefinisikan dengan
1
( ) 1 f x
x
= + dan
1
( ) 1 g x
x
= . Batas nilai x di mana berlaku
( )( ) ( )( ) f g x g f x < adalah....
A. 1 1 x < <
B. 1 0 x < <
C. 0 1 x < <
D. 1 x < atau 1 x >
E. 1 0 x < < atau 0 1 x < <

10. Diberikan kubus ABCD.EFGH dengan panjang


rusuk 2 cm. Titik P terletak pada rusuk FG
sehingga FP=2PG. Jika o adalah bidang irisan
kubus yang melalui titik B, D, dan P, maka luas
bidang o adalah....cm
2
.
A.
8
22
9

B.
6
22
9

C.
5
22
9

D.
3
22
9

E.
1
22
9

11. Nilainilai x , untuk


0 0
0 360 x s s yang
memenuhi sin sin2 sin3 x x x + > adalah....
A.
0 0 0 0
0 120 ,180 240 x x < < < <
B.
0 0 0 0
0 150 ,180 270 x x < < < <
C.
0 0 0 0
120 180 ,240 360 x x < < < <
D.
0 0 0 0
150 180 ,270 360 x x < < < <
E.
0 0 0 0
0 135 ,180 270 x x < < < <

12. Misalkan salah satu akar dari persamaan


2
( 5) 2 4 0 k x kx k + = bernilailebihdari2dan
salahsatuakaryangbernilaikurangdari1,maka
himpunan semua bilangan k yang memenuhi
adalah....
A. { } 5 24 k R k e < <
B. { } 5 20 k R k e < <
C. { } 15 24 k R k e < <
D. { } 15 24 k R k e < <
E. { } 24 k R k e >

BIOLOGI

Gunakan Petunjuk A dalam menjawab soal nomor


13sampainomor20.

13. Dalam suatu ekspedisi telah ditemukan


tumbuhan dengan ciriciri sebagai berikut: tidak
berkayu, berdaun menyirip, tidak berbunga,
batangroset,daunmudamenggulung.JikaAnda
22

diminta untuk menduga, tumbuhan kelompok


apakahyangAndatemukantersebut?
A. Angiospermae
B. Monoktiledonae
C. Pterydophyta
D. Bryophyta
E. Gymnospermae
14. Trenggiling (Manis Javanica) merupakan salah
satu species langka dan dilindungi di Indonesia.
Hewan yang hampir seluruh permukaan
tubuhnya ditutupi sisik tersebut merupakan
pemakan serangga. Dalam klasifikasi hewan,
trenggilingtermasukkedalamkelompok....
A. kelasReptiliakarenatubuhnyabersisik
B. kelas Insektivora karena merupakan hewan
pemakanserangga
C. kelas Mamalia karena memiliki rambut dan
menyusui
D. kelas Squamata karena tubuh ditutupi sisik
danpemakanserangga
E. subkelasMonotrematakarenaselainbersisik
jugamasihhbertelursepertiReptil.

15. Lapisan sel mati yang terdiri atas beberapa


lapisan jaringan epidermis pada akar udara
tanamananggrekdanberfungsisebagaijaringan
penyimpananairadalah....
A. kutikula
B. trikom
C. spina
D. velamen
E. sellitosit

16. Organselyangtidakbermembranadalah....
A. badanmikro
B. peroksisom
C. lisosom
D. vakuola
E. ribosom

17. Di bawah ini adalah sebuah grafik batang yang


menggambarkan pemaparan periode gelap dan
terang. Bagian yang berwarna hitam menunjuk
kan periode gelap dan bagian yang tidak ber
warna(putih)menunjukkanperiodeterang.Ber
dasarkan grafik di bawah ini, tanaman yang
tergolong shortday plant (tanaman hari
pendek)akanberbungajika....
A.
B.
C.
D.
E.

18. Fungsidarineurogliaadalah.....
A. membantu neuron dalam mempercepat
hantaranimpuls
B. membantu neuron menyampaikan rangsang
kemis
C. memperkuat integritas sistem saraf dan
fungsimetabolisneuron
D. membantu neuron dalam pembukaan
gerbangNa
+

E. membantu neuron dalam transport kalium,


ekresi,danregenerasi

19. Fertilisasi mengaktifkan serangkain reaksi yang


memungkinkan menyatunya nukleus sel sperma
dan seltelur.Berikut adalah reaksi yang terlibat
dalamprosesfertilisasi,kecuali....
A. reaksiakromosal
B. reaksikortikal
C. reaksimetabolik
D. reaksipolispermi
E. reaksiinvaginasi

20. Suatu mikroorganisme menunjukkan pertum


buhan yang terbatas pada suhu 27
0
C. Pertum
buhanakanterlihatsangatbaikpadasuhu37
0
C.
Pada suhu 40
0
C masih terjadi pertumbuhan,
tetapi tidak ada pertumbuhan di atas suhu
tersebut. Berdasarkan suhu pertumbuhan maka
mikroorganisme tersebut masuk ke dalam
kelompok....
A. psikrofilik
B. mesofilik
C. termotoleran
D. termofilik
E. psikotoleran

Gunakan Petunjuk C dalam menjawab soal nomor


21sampainomor24.

21. Kerusakan pada berbagai bagian nefron akan


memengaruhi fungsi ginjal. Berikut ini adalah
pernyataan yang berhubungan dengan kerusak
an nefron dan gangguan yang akan ditimbulkan
padafunsiginjal,kecuali....
1) Kerusakan pada aparatus jukstaglomerulosa
akan memengaruhi laju filtrasi darah di
glomerulus sehingga akan mempengaruhi
produksiurine.
2) Kerusakan pada tubulus proksimal akan
menghasilkanurineyangsangatencer.
3) Kerusakan pada duktus pengumpul me
nyebabkanginjaltidakmampumenghasilkan
urineyangpekat.
4) Kerusakan pada lengkung Henle menyebab
kan urine tidak mengandung protein dan
gula.
23

22. Glikolisis adalah rangkaian reaksi pengubahan


molekul glukosa menjadi asam piruvat dengan
menghasilkan NADH dan ATP. Pernyataan yang
termasuksifatsifatglikolisisadalah....
1) Glikolisis dapat berlangsung secara aerob
maupunanaerob.
2) Dalamglikolisisterdapatkegiatanenzimatis.
3) ADP dan ATP berperan dalam pemindahan
fosfatdarimolekulsatukemolekullain.
4) Pelepasan air menghasilkan 2 molekul
fosfoenol piruvat yang masingmasing
memilikiikatanfosfatberenergitinggi.

23. Pernyataanyangbenarberikutiniadalah....
1) Katub atrioventikuler berfungsi mencegah
aliran darah dari bilik ke serambi selama
sistol.
2) Rangsangan parasimpatik menurunkan
frekuensidenyutjantung.
3) Katubsemilunarismencegahaliranbalikdari
aorta dan arteri pulmonalis ke bilik selama
diastol.
4) Otototot jantung bekerja dengan sendirinya
tanpakitasadari.

24. Sepasang suamiistri bertengkar memperma


salahkan salah seorang anaknya yang ber
golongan darah O, sedangkan suami istri
tersebut masingmasing bergolongan darah A
dan B. Penjelasan yang dapat Anda berikan
adalah....
1) IstriAheterozigotikdansuamiBhomozigotik
2) IstriBheterozigotikdansuamiBheterozigot
ik
3) IstriAhomozigotikdansuamiBheterozigotik
4) IstriAheterozigotikdansuamiBheterozigot
ik

FISIKA

Gunakan Petunjuk A untuk menjawab soal nomor


25sampainomor33.

25. Elektron bermuatan e bermassa m dipercepat


denganpotensial V dan menumbukpartikel lain
di udara sehingga arah kecepatan elektron
menyimpang 60
0
dari arah semula. Diketahui
konstanta Planck h . Panjang gelombang de
Brogliesetelahhamburanadalah....
A.
0,5
'
2
h
X
mcV
=
B. '
2
h
X
mcV
=
C.
0,5
'
2
h
X
mcV
=
D. '
2
h
X
mcV
=
E.
1,5
'
2
h
X
mcV
=

26.

Fluida ideal mengalir melalui pipa mendatar


dengan luas penampang Am
2
, kemudian fluida
mengalir melalui dua pipa yang luas
penampangnya lebih kecil seperti gambar di
atas. Kecepatan fluida pada pipa yang luas
penampangnya0,75Am
2
adalah....
A. 0,5m/detik
B. 2/3m/detik
C. 1,5m/detik
D. 2m/detik
E. 2,5m/detik

27. Massabalonudaradengankeranjangnyaadalah
200kg.Volumebalonudaraadalah400m
3
.Jika
temperatur udara adalah 10
0
C, maka tempera
tur minimum udara di dalam balon agar dapat
terbang adalah .... ( udara pada 10
0
C adalah
1,25kg/m
3
)
A. 159
0
C
B. 169
0
C
C. 179
0
C
D. 189
0
C
E. 199
0
C

28.

R
24

Di atas bidang berbentuk setengah lingkaran


denganpermukaankasaryangmemilikiradius1
m di letakkan bola pejal dengan radius 10 cm
bermassa 1 kg seperti pada gambar. Jika sudut
0
60 u = , kecepatan sudut bola di titik terendah
adalah... (g
2
9,8 / ) m g
A. 21,1rad/detik
B. 22,1rad/detik
C. 23,1rad/detik
D. 24,1rad/detik
E. 25,1rad/detik

29. Sebuah kabel yang panjang dialiri arus sebesar


2,5A.Sebuahelektronbergerakdidekattkabel.
Padasaatelektronberadapadajarak4,5cmdari
kabel dan bergerak dengan kecepatan 6 x 10
4

m/detikkearahkabel,besargayamedanmedan
magnetpadaelektronadalah....
A. 1,07x10
19
N
B. 1,57x10
19
N
C. 2,24x10
19
N
D. 2,47x10
19
N
E. 2,63x10
19
N

30.

Lempengkonduktormemilikikerapatanmuatan
+ dan bola konduktor bermassa m bermuatan
+qdigantungkanpadalempengtersebutdengan
benang sutra panjang l. Sudut yang terbentuk
kecilsekali,sepertitampakpadagambar.Nilaix
adalah.....
A.
0
mg l
x
q
c
o
=
B.
0
mg
x
q l
c
o
=
C.
0
q
x
mg l
o
c
=
D.
0
l
x
mg q
o
c
=
E.
0
q l
x
mg
o
c
=

31. Benda dengan mass 2 kg dalam keadaan diam


mendapat gaya

8 4 F i tj N =

. Waktu yang
dibutuhkanagarbendamencapailajukecepatan
15m/detikadalah....
A. 3detik D.4,5detik
B. 3,5detik E.5detik
C. 4detik

32. Sebuah sumber cahaya memancarkan cahaya


tampak dalam dua macam panjang gelombang
430 = nm ' 510 = nm. Sumber cahaya ini
digunakan untuk dalam interferensi celah
rangkapdenganjarakantarcelah0,025mmdan
jarak celah ke layar 1,5 m. Jarak antara kedua
cahayadiataspadapitaterangketigaadalah....
A. 1,5cm
B. 2,4cm
C. 7,7cm
D. 9,2cm
E. 17cm

33. Sebuah mikroskop terdiri dari sebuah lensa


obyektif (
1
0,5 f = cm) dan lensa okuler
(
2
2 f = cm) jarak antara kedua lensa 22 cm. Jika
jarak baca pengamat 15 cm dan ia mengamati
benda menggunakan mikroskop dengan mata
tanpa berakomodasi, maka perbesaran alat
adalah....
A. 20kali
B. 40kali
C. 102kali
D. 294kali
E. tidakbisaditemukan

Gunakan Petunjuk B dalam menjawab soal nomor


34.

34. Nilai percepatan gravitasi bumi di ekuator lebih


kecildaripadadikutub.
SEBAB
Nilai percepatan gravitasi bumi hanya di
pengaruhi oleh jarijari bumi saja di mana jari
jaridiekuatorlebihbesardaripadadikutub.

X
+q
+

25

Gunakan Petunjuk C dalam menjawab soal nomor


35sampainomor36.

35.

Grafik di atas didapat dari pengukuran arus


listrik (I) dan frekuensi (f) pada eksperimen
fotolistrik. Bila tetapan Planck h = 6,6 x 10
34
J.s,
maka....
1) Bila cahaya datang dengan frekuensi lebih
besardari5,2x10
14
Hztidakakanterjadiefek
fotolistrik.
2) Fungsikerjalogam=2,15eV.
3) Tak adaelektron yang keluar dari logam bila
panjang gelombang cahaya yang datang =
400nm.
4) Foton dengan energi 3,50 x 10
19
J tak akan
mampu mengeluarkan elektron dari per
mukaanlogam.

36. Sebuah siswa membuat alat pengukur suhu


dengan menggunakan sensor yang terbuat dari
bahan metal dan dirangkai dengan rangkaian
elektronika sehingga perubahan suhu yang
didapat merupakan konversi dari perubahan
tegangan listrik atau arus liistrik. Besaran fisika
yang dimanfaatkan dari sensor tersebut adalah
....
1) perubahannilaihambatan
2) perubahannilaitegangan
3) perubahannilaipanjang
4) perubahannilaiarus

KIMIA

Gunakan Petunjuk A dalam menjawab soal nomor


37sampainomor44.

37. Senyawa di bawah ini yang dapat dibuat jika


bromoetana direaksikan dengan kalium sianida
kemudianproduknyadireduksiadalah....
A. CH
3
CH
3

B. CH
3
CH
2
NH
2

C. CH
3
CH
2
NH
3

D. CH
3
CH
2
CH
2
NH
2

E. CH
3
CH
2
CH
2
CH
2
NH
2

38. Dalam suatu percobaan, akan disiapkan larutan


AgNO
3
0,20M.BerapakahmassapadatanAgNO
3
yang dibutuhkan untuk membuat larutan
sebanyak50mL?(ArN=14;O=16;Ag=108)
A. 0,85g
B. 1,28g
C. 1,70g
D. 2,55g
E. 5,10g

39. Contoh reaksi asam kuat dengan basa kuat


adalah reaksi antara larutan natrium hidroksida
dengan larutan asam klorida. Persamaan
reaksinyaadalahsebagaiberikut:

57 H = kJ/mol
Diketahui nilai K untuk air pada 25
0
C adalah
1.0x10
14
. Berdasarkanreaksi yang diberikan di
atas,maka..
A. NilaiKpada65
0
Cakanlebihbesardari1.0x
10
14

B. NilaiKpada65
0
Cakanlebihkecildari1.0x
10
14

C. NilaiKpada65
0
Cadalah1.0x10
14

D. NilaiKpada65
0
Cbisalebihbesarataulebih
kecilatausamadengan1.0x10
14

E. NilaiKtidakdipengaruhiolehsuhu.

40. Konstanta kenaikan titik didih untuk benzena


adalah 2,53
0
C/m. Jika titik didih benzena murni
adalah 80
0
C, berapakah titik didih larutan 5,0 g
naftalena (C
10
H
8
) dalam 100 g benzena? (Ar : C
=12;H=1)
A. 81
0
C
B. 79
0
C
C. 75
0
C
D. 0.99
0
C
E. 100,99
0
C

41. Di antara senyawasenyawa LiF, H


2
SO
4
, KO
2
,
CaC
2
, NaH, K
2
NiCl
4
, LaCl
3
, KCl, manakah yang
tidakmengandungikatankovalen?
A. LiF,H
2
SO
4

B. KCl,KO
2

C. LaCl
3,
CaC
2

D. NaH,LaCl
3

E. K
2
NiCl
4,
KCl
NaOH
(aq)
+HCl
(aq)
NaCl
(aq)
+H
2
O(I)
26

42. Perhatikan reaksi aA+bB Produk. Ketika


konsentrasi kedua reaktan, A dan B dinaikkan
dua kali lipat, laju reaksi meningkat menjadi 8
kali lipat. Namun ketika konsentrasi A dinaikkan
duakalilipatsedangkankonsentrasiBtetap,laju
reaksi meningkat menjadi dua kali lipat. Hukum
lajureaksitersebut....
A. ( )
3
V k A =
B. ( ) ( )
2
V k A B =
C. ( ) ( )
2
V k A B =
D. ( ) ( ) V k A B =
E. tidak dapat ditentukan dari percobaan di
atas

43.

Besarnya harga entalpi dari gambar tersebut


adalah....
A. E
3
E
1

B. E
3
E
2

C. E
2
E
3

D. E
1
E
2

E. E
2
E
1

44. Pada elektrolisis larutan MSO


4
yang meng
gunakan elektroda Pt dapat dihasilkan 1,035 g
logam M. Larutan hasil elektrolisis dititrasi
dengan KOH 0,2 M dan ternyata memerlukan
KOHsebanyak50ml.Daripengamataninimassa
atomrelatiflogamMadalah....
A. 103,5
B. 207
C. 118
D. 63
E. 20,7

Gunakan Petunjuk B dalam menjawab soal nomor


45.

45. Jika volume keseimbangan


2( ) 2( ) ( )
2
g g g
H I HI +
diperkecil pada suhu tetap, maka tekanan
partialH
2
danI
2
akanbertambah.
SEBAB
Komposisikeseimbangan
2( ) 2( ) ( )
2
g g g
H I HI + tidak
dipengaruhiperubahanvolume.

GunakanPetunjukCdalammenjawabsoalnomor46
sampainomor48.

46. Nylon 66 mempunyai struktur yang merupakan


pengulangandariunitdibawahini:
CO(CH
2
)
4
CONH(CH
2
)
6
NH
Jika polimer ini dibuat dari polimerisasi heksana
dioatdanheksana1,6diamin,maka....
1) reaksinyaadalahpolimerisasikondensasi
2) melepaskanmolekulNH
3

3) terbentuknyaikatanamida
4) banyakdigunakansebagaiseratsintetis

47. Senyawa berikut dapat membentuk polimer.


Polimerasi kondensasi dapat terjadi pada
monomer....
1) etilena
2) glukosa
3) vinilklorida
4) asamamino

48. Jika bromin ditambahkan karbon tetraklorida


dankemudianditambahkankaliumiodida,maka
....
1) larutanberubahdaricokelatmenjadiungu
2) timbulgasBr
2

3) KldioksidaolehBr
2

4) Br
2
direduksiolehCCl
4

IPA TERPADU

TeknologiNano

Nanosainsdannanoteknologiadalahilmudanrekayasadalampenciptaanmineral,strukturalfungsional,dan
piranti dalam skala manometer. Dalam terminologi ilmiah, nano berarti seper satu miliar (0,000000001). Satu
nanometer adalah seperseribu mikrometer, atau serpersatu juta milimeter, atau sepersatu milyar meter. Hal ini
diilustrasikan jika dianggap panjang pulau Jawa adalah satu meter, maka sebagai perbandingannya adalah bahwa
diametersebuahkelerengkirakirasamadengan10nanometer.
Teknologi nano atau nanotechnology sekarang makin pesat perkembangannya dan telah diterapkan dalam
berbagai bidang.Dalam bidang elektronik, dikembangkan piranti (device) ukuran nanometer.Dalambidang energi,
27

dikembangkanpemuatanselsuryayanglebihefisien.Begitupuladalambidangkimia,dikembangkankatalitaslebih
efisien,bateraiyangkualitasnyalebihbaik,danlainlain.Tidakketinggalandalambidangkedokteran,dikembangkan
peralatan baru pendeteksi sel kanker dengan partikel berukuran nanometer. Dalam bidang kesehatan,
dikembangkan obatobat dengan ukuran bulir beberapa nanometer sehingga dapat melarut dengan cepat dalam
tubuh dan langsung mematikan sel tersebut tanpa mengganggu selsel normal. Dalam bidang lingkungan, juga
dikembangkanpenggunaanpartikelskalananometeruntukmenghancurkanpolutanorganikdiairdanudara.
Reduksi ukuran material dalam skala nanometer menjadi begitu penting karena sifatsifat material yang
meliputi sifatsifat fisis, kimiawi, dan biologis berubah secara dramatis ketika dimensi material masuk ke skala
nanometer. Sifatsifat tersebut bergantung kepada ukuran, bentuk, kemurnian permukaan, dan topologi material.
Para ilmuwan percaya bahwa setiap sifat memiliki skala panjang kritis. Ketika dimensi material lebih kecil dari
panjang tersebut, sifat fisis yang fundamental mulai berubah. Sebagai gambaran, partikel tembaga yang memiliki
diameter 6 nm memperlihatkan kekerasan lima kali lebih besar daripada tembaga ukuran besar. Keramik yang
umumnya kita kenal mudah pecah dapat dibuat menjadi fleksibel jika ukuran bulir direduksi ke dalam orde
nanometer. Kadmium selenida (CdSe) dapat menghasilkan warna yang berbedabeda dengan hanya mengontrol
ukuranpartikel,daribiru(2nm)kemerah(8nm).

GunakanPetunjukAdalammenjawabsoalnomor49
sampainomor53.

49. Kadmium selenida (CdSe) dapat menghasilkan


warna yang berbedabeda dengan hanya
mengontrol ukuran partikel, dari biru (2nm) ke
merah (8nm). Selisih energi yang dipancarkan
dariwarnabirukemerahadalah....
A. 2,48x10
17
J
B. 7,45x10
17
J
C. 9,93x10
17
J
D. 12,41x10
17
J
E. 17,38x10
17
J

50. Pada suatu piranti nanoelektronik, sebuah


elektrondenganenergi12eVditembakkanpada
gas atom hidrogen. Panjang gelombang radiasi
yangakandipancarkanolehgastersebutadalah
....
A. 1,00x10
7
m
B. 1,01x10
7
m
C. 1.03x10
7
m
D. 2,00x10
7
m
E. 2,03x10
7
m

51. Panjang pulau Jawa diperkirakan sekitar 1000


km. Dua buah kelereng yang berdampingan
akandikelilingiolehsebuahkaret.Panjangkaret
yangdibutuhkanadalah....
A. 1cm
B. 2cm
C. 2+ t cm
D. 2+2 t cm
E. 2+3 t cm

52. Panjang pulau Jawa diperkirakan sekitar 1000


km. Sebuah kotak akan dibuat untuk
menampung tempat 20 buah kelereng. Ukuran
luas alas kotak yang akan membuat alas kotak
mempunyaidiagonalmaksimaladalah....
A. 5x4cm
B. 40x5cm
C. 200x1cm
D. 20x1cm
E. 10x2cm

53. Berikut ini adalah pernyataan yang benar


mengenaikatalis,kecuali....
A. Katalis dapat mempercepat tercapainya ke
setimbangan dengan cara menurunkan energi
aktivasi.
B. Katalis menyediakan jalur reaksi yang lebih
efisien.
C. Penambahan katalis pada suatu sistem ke
setimbangan dapat menggeser kesetimbang
antersebut.
D. Setelah reaksi selesai, katalis dapat diperoleh
kembali.
E. Katalis ikut terlibat dalam reaksi, berinteraksi
denganreaktan.

GunakanPetunjukBdalammenjawabsoalnomor54.

54. Pengembangan obatobatan dengan teknologi


nano dapat menggantikan terapi dengan sinar
(radiation therapy) dan akan mengurangi efek
terapi.
SEBAB
Dalam jangka panjang, terapi dengan memberi
sinar X pada selsel kanker memiliki efek samping
bagipasien,sepertianemiadanmutasisel.

GunakanPetunjukCdalammenjawabsoalnomor55.

55. Berikut adalah pernyataan yang salah mengenai


selselkanker....
28

1) Bentuk sel kanker lebih besar dan tidak


beraturan dibandingkan dengan bentuk sel
normal.
2) Siklusselpadakankerlebihcepatdaripadasel
normal.
3) Padasaatmitosis, benanggelondong(spindle)
pada sel kanker lebih panjang daripada sel
normal.
4) Sel kanker adalah selsel tumor yang bersifat
ganas.

FitoestrogenuntukWanitaMenopause

Wacana mengenai menopause kini semakin diminati oleh kalangan medis maupun masyarakat luas. Hal ini
dapat dipahami karena dengan meningkatnya umur harapan hidup kaum perempuan maka proporsi kelompok
wanita usia lanjut (wulan) juga mengalami peningkatan yang bermakna. Pada tahun 2010 diperkirakan akan
terdapatkaumwulan(usialebihdari60tahun)sekitarseperenamdariseluruhjumlahpendudukIndonesia(240juta
jiwa).Hampir100%darijumlahwulantelahmengalamimenopausedenganskalasertadampakmenyertainya.
Menopause adalah proses henti menstruasi (haid) akibat hilang (kekurangan) hormon estrogen. Dampak
menopause adalah semburat panas (hot flushes), sulit tidur, berkeringat di malam hari. Keadaan lain akibat
menopauseyanglebihserius,tetapiberjalansecaraperlahanadalahpenyakitkardiovaskulardankekeroposanpada
tulang(osteoporosis).
Pengobatan dan penanggulangan menopause dapat dilakukan dengan menggunakan terapi hormon
pengganti (Hormonal Replacement Therapy atau HRT). HRT pada hakikatnya adalah pemberian hormon estrogen.
Meskipun demikian, paradigma kembali ke alam (back to nature) menyebabkan banyak wulan berpaling ke
fitoestrogen, yaitu suatu bahan/substrat yang memiliki 2 gugus OH/hidroksil yang berjarak 11,0 11,5 A pada
intinya,samapersisdenganintihormonestrogen.Kacangkedelaidiketahuimengandungfitoestrogendalamjumlah
yang penting untuk pengobatan. Beberapa senyawa fitoestrogen yang diketahui banyak terdapat dalam tanaman
antaralainisoflafondanlignan.

GunakanPetunjukAdalammenjawabsoalnomor56
sampainomor58.
56. Sebagai salah satu analogi mekanisme dari
fenomenasemburatpanasdanberkeringatpada
malamhari,saatkumanmasukkedalamtubuh,
secara otomatis hipotalamus akan mengatur
pengatur suhu pada tubuh menjadi lebih tinggi.
Pada kondisi ini, tubuh menjadi tempat yang
tidak nyaman bagi kuman. Misalnya, setelah
hipotalamus menaikkan suhu dari 37
0
C menjadi
38,9
0
C maka kita akan menggigil. Mengapa
demikian?
A. Tubuh kita menyerap panas dari luar tubuh
sehinggamenggigilkepanasan.
B. Lingkungan luar memberikan kontribusi panas
kepadatubuh.
C. Tubuh kita memproduksi panas dan pada saat
bersamaanmengeluarkanpanas.
D. Lingkungan luar memberikan aliran panas
kepadatubuh.
E. Lingkungan luar memberikan aliran dingin
kepadatubuh.

57. Disebutkan bahwa kacang kedelai mengandung


fitoestrogen dalam bentuk isoflavon yang
khasiatnya mirip dengan estrogen pada tubuh
manusia. Kemungkinan senyawa isoflavon
tersebut pada sel kacang kedelai disimpan di
dalam....
A. ribosom
B. retikulumendoplasma
C. vakuola
D. lisosom
E. mikrotubulus

58. Pada tahun 2010, di negara X diperkirakan


terdapat kaum wulan sebanyak 2 kali kaum
wulan di Indonesia. Di negara tersebut, untuk
setiap 8 orang terdapat 1 orang yang berasal
dari kaum wulan. Jumlah populasi di negara
tersebut tidak termasuk kategori wulan adalah
....
A. 80
B. 420
C. 480
D. 560
E. 640

GunakanPetunjukBdalammenjawabsoalnomor59.

59. Sebagai salah satu pengobatan, HRT adalah


salahsatupengobatantanpaefeksamping.
SEBAB
Hormonbersifatmencegahbukanmengobati.

29

GunakanPetunjukCdalammenjawabsoalnomor60.

60. Salah satu kemiripan fitoestrogen dengan


hormon estrogen adalah adanya 2 gugus
hidroksil (OH) yang berjarak 11 11,5 pada
intinya. Adanya gugus hidroksil ini memungkin
kanterjadinya....
1) kepolaran
2) ikatanhidrogen
3) pembentukananiondalamsuasanabasa
4) pembentukankationdalamsuasanabasa
30

r
8
t8
8
PEMBAHASAN TES KEMAMPUAN IPA
SIMAK UI 2011

MATEMATIKA IPA

1. Pembahasan:
( )
( )
| | | |
4 2 4
2 3
2 3
4 2 4
2 3 4
2
. : 1 2 3
:
: . ...
3 7
3 7
2 3
2 3 7 3 7
8 22 6 24 2 2 ;
:
: 2
2 2 2 2
B Geo r dan S U U
BG a ar ar ar
BA a ar ar ar
a a b a b a b
b r
a a r a r a r
S U U
a a r a r a r a r a r
a r a r a r a r b r
BG a a a a
BA a a
a a maka a b dan r
Jadi jumlah bilan
> = +
+ + + +
+ + +
= + + + +
+ + +
= +
+ + + + + + = + + +
+ = + = = =
= = = =
3 5 6 7
:
2 4 5 6 4 17
8 34 42
gan yang disisipkan
U U U U
a b a b a b a b a b
= + + +
= + + + + + + + = +
= + =

Jawaban:E

2. Pembahasan:
| |
( )
( )
tan tan tan
lim lim
1 1 tan .tan
a b a b
b a b a b
b
a b a
a b
b


= =
| |
+
|
\ .

Jawaban:C

3. Pembahasan:
Perhatikangambarberikut!!!

( )
( ) ( )
( )
( ) ( )
( ) ( )
2
2
3
I
kerucut 2
2
2 3
I
4
2
2
1 1 8t
Volumekerucut r t .t
3 3 t 8
64t 1
V maks/min V 0
3
t 8
3.64t t 8 64t .2 t 8
1
V 0 0
3
t 8
64t t 8 3 t 8 t.2 0
64t t 8 t 24 0
t 0 t 8 t 24
| |
= t = t
|

\ .
= t =

(

= t = (
(

= (

=
= v = v =

Jawaban:D

4. Pembahasan:
2
2
2
( ) ( )( ( ))( ( 2 ))
2 3
2 2
( ) ( )( 2 )( 3 )
6 12 2
( ) ( 2)( 4)( 6)
( 7): 1 ....
( 7) ( 5)( 3)( 1)
( 7) ( 5)( 4 3)
( 5)( 1 4 3)
( 5)(4 2)
4 22 10
f x x a x a b x a b
a b a
b a a b
f x x a x a x a
a a
f x x x x
f x x sisa
f x x x x
f x x x x
sisa x x
x x
x x
= + +
+ =
= =
=
= =
=
+ +
+ = + + +
+ = + + +
= + + +
= + +
= + +
4 22 10 22 6 x x = + + = +

Jawaban:

5. Pembahasan:
( ) ( )( )
( ) ( ) ( )
( )
2
2
2
2
5 7 0
7 0 0 0
5
0 7 0 0
....???
5 0
5 0
0 5
a b a b a b
A A
c d c d c d
Jika A A I
a bc ab bd a b
c d
ac dc bc d
Jumlah diagonal utama a d
ab bd b
b a d
b atau a d
= =
+ =
| | + +
+ =
|
+ +
\ .
= + =
+ =
+ =
= + =

Jawaban:D

31

t
Q
2 2
D
P
B
2
2
3
2
13
3
2
2
3
a a
x
y
2
y a =
2
y x =
6. Pembahasan:
Perhatikangambarberikut!!!

( )
2
4 4 4 5 5 5
0
5
2
2 4
0
5 4
1 1
0
5 5
4
5
1 1
0
2 2
4 1 5
5 2 8
a
x
a
y
x y
a
V a x dx a x x a a
a
a
V y dy y a
karena V V maka
a a a
t t t
t
t t t
t t
( (
= = =
( (

=
(
= = =
(

=
= =
}
}

Jawaban:A

7. Pembahasan:
( )
( )
( )
( )
( )
( )( )
2 2
2 2
1
sin sin
3
1
cos cos
2
sin ....
1
sin 2sin sin sin
9
1
cos 2cos cos cos
4
1 1
1 2cos 1
9 4
13
2 2cos
36
13 59
2cos 2
36 36
59
cos
72
1
sin sin cos cos
6
sin cos sin
x y
Dikuadratkan
x y
x y
x x y y
x x y y
x y
x y
x y
x y
x y x y
x x x

=

)
+ =
+ =
+ = +
+ = +
=
= =
=
=

1
cos cos sin sin cos
6
y x y y y + =

1
sin cos sin cos sin( )
6
1 1 1
sin2 sin2 sin( )
2 2 6
1 1
.2sin( )cos( ) sin( )
2 6
59 1
sin( ). sin( )
72 6
13 1 1 72 12
sin( ) sin( ) .
72 6 6 13 13
x x y y x y
x y x y
x y x y x y
x y x y
x y x y
+ + =
+ + =
+ + =
+ + =
+ = + = =

Jawaban:A

8. Pembahasan:
}
2 2
3
3 3
2 0
0
2
3
* 2 1
3 1
* 2 2 6 2
2 5
2
2 7
2 ( , )
x y
x y
y
y
ada
x
ax y b
a b
x y a a
a b
a
a b
Ada pasangan bilangan a b
+ =
+ =
=
=

`
=
)
+ = +
= +
+ = + = +
= =
=
= =

Jawaban:C

9. Pembahasan:
( )( )
( )( )
2 2
2
1 1
( ) 1 ( ) 1
( ) ( )
1 1
1 1 1 1
1 1
1 1
1 1
0 0
1 1 1 1
2
0
1 1
f x dan g x
x x
f og x go f x
x x
x x
x x
x x x x x x
x x x x
x
x x
= + =
<
+ < + <
+
+
+ +
+ < <
+ +
<
+

Jawaban:E

10. Pembahasan:
PerhatikantrapesiumPQDBberikut!!!

32

2
2
3
4 16 52 1 2
4 4 52 13
3 9 9 3 3
2 2
13 2 11
3 3
1
.
2
1 8 2 8
2 11 22
2 3 3 9
QG
BP
t
Luas jumlah sisi sejajar x tinggi
=
| |
= + = + = = =
|
\ .
= =
=
= =

Jawaban:A

11. Pembahasan:
( )
( )
( )( )
2
sin sin2 sin 3
sin sin3 sin2 0
2cos2 sin 2sin cos 0
2sin cos2 cos 0
2sin 2cos 1 cos 0
2sin 2cos 1 cos 1 0
1
* sin 0 * cos * cos 1
2
0,180,360 120,240 0,360
x x x
x x x
x x x x
x x x
x x x
x x x
x x x
x x x
+ >
+ >
+ >
+ >
+ + >
>
= = =
= = =

Gambargarisbilangan:

Jawaban:A

12. Pembahasan:
( )
( )( )
2 2
1 2
2
2
2 4
5 2 4 0 0
5 5
min : 2 1
2 1 0 3 2 0
2 4
0
5 5
2
: 3 15
5
4
2 6
5
,6 15
k k
k x kx k x x
k k
Batas paling imum x dan x
x x x k
k k
x x
k k
k
didapat k dan
k
k
k
k
Jadi k

| |
+ = + =
|

\ .
= =
= + =

| |
~ + =
|

\ .
= =

= =

< <

Jawaban:

BIOLOGI

13. Ciriciri yang paling mudah menunjukkan


tumbuhan paku adalah ditemukannya daun
muda yang menggulung. Hal ini merupakan ciri
khasdariPterydophyta.
Jawaban:C

14. Trenggiling (Manis javanica syn. Paramanis


javanica)adalahwakildarikelasmammaliaordo
Pholidota yang masih ditemukan di Asia
Tenggara. Hewan ini memakan serangga dan
terutama semut dan rayap. Trenggiling hidup di
hutan hujan tropis dataran rendah. Trenggiling
kadang juga dikenal sebagai anteater. Bentuk
tubuhnya memanjang, dengan lidah yang dapat
dijulurkan hingga sepertiga panjang tubuhnya
untuk mencari semut di sarangnya. Rambutnya
termodifikasimenjadisemacamsisikbesaryang
tersusun membentuk perisai berlapis sebagai
alatperlindungandiri.
Jawaban:C
15. Kutikula adalah lapisan bukan sel yang berada
di atas lapisan epidermis, dapat berupa
permukaan yang halus, kasar, bergelombang,
atauberalur.
Trikomata(rambutrambut) membantu proses
penyarapan air dan mencegah terjadinya
penguapanyangberlebihan.
Spina(duri) Spina palsu(emergensia) contohnya
pada duri mawar, spina asli contohnya pada
batangtanamanbougenvil.
Velamen merupakan lapisan sel mati di bagian
dalam jaringan epidermis pada akar gantung
(akar udara) tumbuhan anggrek. Fungsi
Velamensebagaialatpenyimpanair.
Sellitositadalahselyangdindingnyamengalami
penebalansecarasentripetal.
Jawaban:D

0
0
0
120
0
180
0
240
0
360
++++ ++++
33

16. Organelterdiridariduajenis:
a. organel bermembran, ialah strukturstruktur
subselyangmempunyaisistemmembrannya
tersendiri.Organelinimerupakankomponen
tetap pada sel dan mengandung enzim yang
memainkan peranan dalam aktiviti
metabolisme. Contoh: alat Golgi, retikulum
endoplasma,mitokondriadanlisosom.
b. Organel tak bermembran ialah komponen
sitoplasma yang mempunyai struktur dan
fungsi yang berlainan daripada organel
bermembran dan rangkuman. Ia tidak
mempunyai sistem membrannya yang
tersendiri dan tidak ikut serta secara
langsung dalam aktiviti metabolisma sel.
Contoh: mikrotubul (badan mikro), filamen
sitoplasma,mikrofilamendansetriol.
Jawaban:A

17. Tanaman yang digolongkan tanaman hari


pendek (short day) adalah tanaman yang baru
berbunga apabila periode gelap lebih lama/
panjang dari kritisnya, sehingga pada grafik
ditunjukkan warna gelap yang lebih panjang
daripadawarnaterang.
Jawaban:B

18. Neuroglia adalah merupakan tempat suplai


nutrisi dan proteksi pada neuron. Neuroglia
merupakan unsur seluler dari susunan saraf
yangtidakmenghantarkansistemsaraf.
Jawaban:C

19. Reaksiyangterlibatdalamfertilisasiadalah
1. reaksiakrosom:aktivasispermatozoondise
babkan oleh interaksi sperma dengan mole
kulzonapelucida
2. reaksi kortikal : serangkaian perubahan di
zonabagianluar(korteks)sitoplasmasel
3. reaksimetabolik:terjadiakibatpeningkatan
tajamkonsentrasiCa
++
dalamsitosol
4. reaksipolispermi:spermayangmasuklebih
dari satu terjadi reaksi penolakan (Blocking
System), dimana tidak memungkinkan ter
jadinyapolispermi
Invaginasi adalah masuknya bagian usus ke
usus, sehingga bukan termasuk reaksi yang
terjadipadafertilisasi.
Jawaban:E

20. Berdasarkan sifatnya terhadap suhu, mikroor


ganismeterbagimenjadi
a. psikrofilik dapat hidup optimal pada suhu
15Cdandapatbertahanpadasuhudibawah
0C,
b. mesofilik dapat hidup pada kisaran suhu 15
45C.
c. termofilikhiduppadakisaransuhu4070C,
d. hipertemofilik merupakan yang arkea yang
palingtahanpanaskarenadapathiduppada
suhulebihdari65C.
menurut soal mikroorganisme hidup pada
kisaran27
o
C40
o
C
Jawaban:B

21. 1. Pernyataan benar : Aparatus jukstaglomerulus


adalah titik pertemuan antara arteriol aferen dan
bagianpertamatubulusdistal.Melaluiapparatus
juksteglomerulus, tubulus nefron mampu
memantau laju perpindahan cairan didalam
nyadanmenyesuaikanGFR(LajuFiltrasiGlo
merulus) keseperlunya. Mekanisme umpan
balik tubuleglomerulus ini dimulai oleh tu
bulus untuk membantu setiap nefron me
ngatur kecepatan filtrasi melalui glomerulus
masingmasing sehingga akan mempenga
ruhiproduksiurin.
2. Pernyataan benar Kerusakan pada tubulus
proksimal menyebabkan polyuria, yaitu urin
yang dikeluarkan amat banyak dan encer
akibat kemampuan reabsorbsi oleh nefron
sangatrendah
3. Pernyataan benar Cairan dari beberapa
nefron mengalir ke dalam suatu saluran
pengumpul (duktus kolektivus). Di dalam
duktus kolektivus, cairan terus melewati
ginjal sebagai cairan yang pekat, atau jika
masih encer, maka air akan diserap dari air
kemih dan dikembalikan ke dalam darah,
sehingga air kemih menjadi lebih pekat.
Apabila terjadi kerusakan pada ductus
kolektivusmakaairkencingsangatencer.
4. Pernyataansalah:Lengkunghenleberfungsi
reabsorbsi bahanbahan dari cairan tubulus
dansekresibahanbahankedalamcairantu
bulus, sehingga hasil reabsorbsi urin primer
masihterdapatproteindanglukosa.
Jawaban:D

22. 1.Pernyataansalah:
Terjadi pemecahan glukosa dengan bantuan
enzimyangterjadi
secaraanaerobik
2.Pernyataanbenar:
Dalam glikolisis terdapat kegiatan enzimatis
dan AdenosineTrifosfat (ATP) serta Adeno
sineDifosfat(ADP)
3.Pernyataanbenar:
ADP dan ATP berperan dalam pemindahan
fosfatdarimolekulsatukemolekullainnya.
34

4.Pernyataanbenar:
Dengan pertolongan enzim enolase dan ion
ion Mg
++
, maka asam 2fosfofogliserat
melepaskan H
2
O dan menjadi asam2
fosfoenolpiruvat.
Pernyataan 2,3 dan 4 yang benar. Oleh karena
yang sesuai perintah soal maka jawaban yang
benar2dan4
Jawaban:C

23. (1) Pernyataan benar : Katup atrioventrikuler


memungkinkan darah mengalir dari masing
masing atrium ke ventrikel pada waktu
diastole ventrikel, serta mencegah aliran
balikkeatriumpadasaatsistolventrikel.
(2) Pernyataan benar : rangsangan parasim
patikkejantungakanmengakibatkandenyut
nadi menjadi lambat atau frekuensi denyut
jantungmenu
(3) Pernyataan benar: Katup semilunar me
mungkinkan darah mengalir dari masing
masing ventrikel ke arteri pulmonalis atau
aorta selama sistol ventrikel, dan mencegah
aliran balik ke ventrikel sewaktu diastole
ventrikel.
(4) Pernyataan benar: Otot jantung bekerja di
luarkehendak(involunter)
Jawaban:E

24. P(istri)I
A
I
O
xI
B
I
O
(suami)
GI
A
,I
O
I
B
,I
O

F I
A
I
B
(AB)
I
A
I
O
(A)
I
B
I
O
(B)
I
O
I
O
(O)
Keturunan yang dihasilkan terdapat golongan
darah0,halinidiperolehdariistriAheterozigot)
dansuamiBheterozigot)
Jawaban:D

FISIKA

25.PanjangGelombangdeBroglie
muatanelektron,e
bedapotensial,V
sudut,=60,konstantaPlanck=h
Dalamhalini,momentumawalsamadengan
momentumakhir,sehinggapanjanggelombang
deBrogliesetelahhamburanadalah:
2 cos
0,5
2 cos60
2
awal akhir
k
o
P P
mE P
h h
meV
meV
u

=
=
= =

Jawaban:C

26.PrinsipKontinuitaspadaFluidaDinamis

Dalamhalini,berlakudebityangmasuksama
dengandebityangkeluar,makakecepatanfluida
padapipayangluaspenampangnya0,75Am
2

adalah:
1 2 3
1 2 3
3 3
2 0,5 3 0,75
2
0,5 0,75 m/s
3
Q Q Q
Av Av Av
A A A v
v v
= +
= +
= +
= =

Jawaban:B

27.GasIdeal
m=200kg,V=400m
3
,T
1
=10C=283K
massajenisudara,=1,25kg/m
3
Syaratterangkat:
3
. .
200
0,5 kg/m
400
A
u
u
W F
mg g V
m
V

=
=
= = =

Denganpersamaangasideal,suhuminimum
udaradidalambalonagardapatterbang
adalah:
PV nRT
PM RT
=
=

Suhuberbandingterbalikdenganmassa
jenisnya,yaitu:
1 2
2 1
2
2
1,25
707,5 424,5
0,5 283
o
T
T
T
T K C

=
= = =

Jawaban:
1
3
2
35

28.HukumKekekalanEnergiMekanik
Perhatikangambarberikut:

Jarijari(R)=1m,massa(m)=1kg.Dalamhalini
berlaku,hukumkekekalanenergimekanikpada
posisi1dan2,yaitu:

1 2
2 2
1 1 2
1 1
2 2
m m
E E
mgh mv I mgh
m
e
=
= + +
1
2
g h m A =
2 2
1 2
2 5
R m e +
2 2
2 2 2 2
2 2
2
2
5
7
2 9,8 0,4
5
25,1rad/s
R
g h R R
I
e
e e
e
e
A = +
=
=

Jawaban:E

29.GayaMedanMagnet
I=2,5A,v=6.10
4
m/s,
a=4,5cm=4,5.10m
2

Ingatbesarnyakuatmedanmagnetpadakawat
lurus:
0
2
i
B
a

t
=
Sehinggabesargayamedanmagnetpada
elektron
0
7
19 4 19
2
2
4 .10 .2,5
.1,6.10 . 6.10 1,07.10 N
2 .4,5.10
F Bqv
I
q v
a

t
t
t

=
=
= =

Jawaban:A
30.GayaListrik

Bolakonduktorbermassam,bermuatan+q.
Karena ( ) 0 kecil u ~

sin tan
.
.
o
o
x F
W
q
qE q
x x x
m g m g mg
u u
c o
c
=
=
o

= = =

Jawaban:E

31.HukumNewtondanKinematikaGerakLurus
Gaya,
( )

8 4 F i tj N = ,v
t
=15m/s
Persamaanpercepatandapatditentukandari
HukumNewton,yaitu:

8 4

4 2
2
F i tj
a i tj
m

= = =

Maka,waktuyangdibutuhkanagarbenda
mencapailajukecepatan15m/sadalah:
( )
2
2
2 2 4

0 4 2

4

15 4
15 16 3 sekon
t o
t
t
v v adt
v i tj dt
v ti t j
ti t j
t t t
= +
= +
=
=
= =
}
}

Jawaban:A

32.InterferensiCelahGanda
=430nm=4,3.10
7
m,=510nm=4,3.10
7
m,
jarakantarcelah,d=0,025mm=2,5.10
5
m
jarakcelahkelayar,L=1,5m
Makajarakantarakeduacahayadiataspadapita
terangketigaadalah:

( )
( )
' '
7
5
2
1
( )
2
1 1,5
5,1 4,3 10 (6)
2 2,5 10
1,44 10 m
1,44 cm 1,5 cm
L
P P Bilangan genap
d

=
=

=
= =

Catatan: untuk syarat terang, bilangan genap


dimulai dari 0 untuk terang pusat, 2 untuk
perang pertama, dan seterusnya. Dalam soal
initerangketigayaitubilangangenapnya6.
Jawaban:A

33.AlatOptik:Mikroskop
f
ob
=f
1
=0,5cm
f
ok
=f
2
=2cm
jarakkedualensa=d=22cm
X
+q
+

F
w
0,1m
1
2
0,9m
=1m

R
36

Sn=15cm
Besarnyaperbesaranmikroskop(pengamatan
tanpaakomodasi):
'
ob n
tot
ob ok
s s
M
s f
=

- TrikSuperCepat(tanpamencari
'
ob
s ),
makaperbesaranmikroskopnya:
ob n
ob ob ok
f s
M
s f f
=


- Menentukanjarakbayanganlensaobjektif
(
'
ob
s ):
' '
2
22 2 20 cm
ob ok ob
d s f s d f = + = = =
- Jarakbendadarilensaobjektif(s
ob
):

'
1
1 1 1
1 1
0,5 20
40 1 39 20
cm
20 20 20 39
ob ob
ob
s f s
s
=
=
= = =

- Perbesarannya:
'
2
20 15
292,5 kali
20
2
39
ob n
tot
ob
tot
s s
M
s f
M
=
= =

Jawaban:

34.PercepatanGravitasi
Besarnyapercepatangravitasibumi:
2 2
1 GM
g g
R R
= ~

Besarnya gaya gravitasi dipengaruhi oleh posisi


benda itu terhadap pusat bumi (R) yaitu
berbanding terbalik dengan kuadrat jaraknya.
Jarak kutub sampai pusat bumi lebih pendek dari
jaraktempatlaindipermukaanbumi,sehinggadi
kutub besarnya gaya gravitasi paling besar. Dan
di ekuator lebih kecil, karena jarak di ekuator ke
pusatbumilebihbesar.
Pernyataanbenar.

Nilai percepatan gravitasi bumi dipengaruhi oleh


massadanjarijarinya.
Alasansalah.
Jawaban:C

35.EfekFotolistrik
h=6,6.10
34
Js
f
0
=5,2.10
14
Hz
1. Jikacahayadatangdenganfrekuensilebih
besardari5,2.10
14
Hz(f>f
0
)akanterjadi
efekfotolistrik.
Makadalamsoalpernyataan1salah.
2. Fungsikerjalogam:
0
34 14
19
6,6.10 . 5,2.10
3,432.10 J
W hf

=
=
=

Ingat,1eV=1,6.10
19
,maka:
19
19
19
3,432.10 J
3,432.10
2,145 eV 2,15 eV
1,6 . 10
W

=
= = =

Pernyataan(2)benar

3.=4.10
7
m,
Frekuensinya:
8
15 14
7
3. 10
0,75. 10 7,5. 10 Hz
4 . 10
c
f


= = = =
Adaelektronyangkeluardarilogam.
Makadalamsoalpernyataan(3)salah.

4. Energi untuk mengeluarkan elektron harus


lebih besar dari 3,432 . 10
19
J. Sehingga
energi 3,50 . 10
19
dapat mengeluarkan
elektrondaripermukaanlogam.
Pernyataan(4)benar.
Pernyataan(2)dan(4)benar

Jawaban:C

36.HubunganTegangandanArusListrik
Besaran fisika yang dimanfaatkan dari sensor
adalah perubahan nilai hambatan dan
panjangnya.
Suhu memengaruhi besarnya hambatan listrik
maupunpanjangnya.
Pernyataan(1)dan(3)benar
Jawaban:B

37

KIMIA

37. KonsepIkatanKimia
Reaksiantarabromoetanadengankaliumsianida
merupakanreaksisubtitusiBrolehionCN.
CH
3
CH
2
Br +KCN CH
3
CH
2
Br KBr +
ProdukreaksidiatasdireduksidenganH
2
.Reaksi
reduksi disebut juga reaksi hidrogenasi yaitu
reaksiadisidenganhidrogen,sehingga:
CH
3
CH
2
CN + H
2
CH
3
CH
2
CH
2
NH
2 2

Jadisenyawatersebutadalah
CH
3
CH
2
CH
2
NH
2

Jawaban:D

38. KonsepStoikiometri
MollarutanAgNO
3
:
MolAgNO
3
=MAgNO
3
xVAgNO
3

=0,20Mx50.10
3
L
=10
2
M
JadimassaAgNO
3
=molAgNO
3
xMrAgNO
3

=10
2
molx170g/mol
=1,70gram
Jawaban:C
39. KonsepAsamBasa
Nilai Kw tidak dipengaruhi oleh suhu, sehingga
nilainyatetap10
14
.
Jawaban:E

40. KonsepSifatKoligatifLarutan
Diketahui:Kbbenzena=2,53
o
C/m
T
o
bbenzena=80
o
C
Massanaftalena=5gram
Mrnaftalena=128gram/mol
Ditanya:Titikdidih(Tb)larutan=.
Jawab:
Tb=Kb.m
=2,53.
5g 1000
x
128g/mol 100

=0,99
o
C
Jadi,titikdidihlarutanadalah
Tb=T
o
b+Tb
=80
o
C+0,99
o
C
=81
o
C
Jawaban:A

41. KonsepIkatanKimia
Ikatan kovalen adalah ikatan antara unsur non
logam dengan unsur nonlogam sehingga senya
wa yang tidak mengandung ikatan kovalen ada
lah K
2
NiCl
4
dan KCl karena ikatannya berupa
ikatanionikyaituikatanyangterjadiantaraatom
logamdengannonlogam.
Jawaban:E

42. KonsepLajuReaksi
Persamaanlajureaksidimisalkan:
V=k[A]
x
[B]
y

Dariketerangan2
konsentrasiAdinaikkanduakalilipatsedangkan
konsentrasi B tetap, laju reaksi meningkat dua
kalilipat.
V=k[A]
x
[B]
y

2=k[2]
x
[1]
y

2=k.2
x
x=1
Dariketerangan1
konsentrasi kedua reaktan dinaikkan dua kali
lipat, laju reaksi meningkat menjadi delapan kali
lipat.
V=k[A]
x
[B]
y

8=k[2]
1
[2]
y

4=k2
y

y=2
Jadi, persamaan laju reaksinya adalah
v=k[A][B]
2

Jawaban:C

43. KonsepTermokimia
Diketahuigambarberikut:

Darigambartersebut,besarnyahargaentalpi
E=E
produk
E
reaktan

=E
1
E
2
Jawaban:D

R
E
1
E
2
E
3
E
n
e
r
g
i

(
E
)
38

44. KonsepStoikiometri
Diketahui:massalogamM=1,035gram
MKOH=0,2M
VKOH=50mL
Ditanya:MrlogamM=
Jawab:
MollogamM=molKOH
=M.V
=0,2M.50.10
3
L
=10
2
mol
2
gram 1,035gram
MrlogamM= 103,5gram/mol
mol 10

= =
Jawaban:A

45. KonsepKesetimbanganKimia
Pernyataan:salah
Jika volume kesetimbangan H
2(g)
+ I
2(g)
2HI
(g)

diperkecilpadasuhutetap,makatekananpartial
H
2
danI
2
akantetap.
Alasan:benar
Komposisi kesetimbangan H
2(g)
+ I
2(g)
2HI
(g)

tidakdipengaruhiperubahanvolume.
Jawaban:D

46. KonsepMakromelekuldanLipid
Nylon 66 dibuat dari polimerisasi heksanadioat
dan1,6diaminmaka:
1. Reaksinyaadalahpolimerisasikondensasi.
Reaksi pembentukan polimer melalui reaksi
kondensasi terjadi apabila polimer berasal
dari dua monomer menghasilkan reaksi
samping berupa molekul sederhana seperti
H
2
O,NH
3
danHCl.
(Pernyataan1benar).
2. Reaksi polimerisasi nylon 66 melepaskan
molekulH
2
Odanmembentukikatanamida.
(pernyataan 2 salah dan pernyataan 3
benar).

3. Plastik yang bersifat sangat kuat dan halus


ini banyak digunakan untuk pakaian,
peralatan rumah tangga serta peralatan
laboratorium.
(pernyataan4salah).
Jawaban:B

47. KonsepMakromolekuldanLipid
Polimerisasi kondensasi terjadi pada monomer
asamaminomembentukprotein.
(pernyataan4benar)
Monomer etilenan, glukosa dan vinilkllorida
membentukpolimermelaluireaksiadisi.
(pernyataan1,2,dan3salah)
Jawaban:D

48. KonsepIkatanKimia
Jika bromin ditambahkan karbon tetraklorida
dankemudianditambahkan kaliumiodida, maka
reaksi yang terjadi adalah bromin mengoksidasi
kaliumiodida.Dalamsistemperiodik,Brterletak
pada periode lebih atas daripada ion I sehingga
Br mampu mendesak ion I dan membentuk se
nyawa KBr serta gas iodin. Adanya gas iodin di
tunjukkan oleh perubahan larutan yang ber
warnacokelatmenjadiungu.
(pernyataan1dan3benar)
Jawaban:B

IPA TERPADU

49. KonsepTingkatEnergi
Diketahui:
biru
=2nm=2x10
9
m

merah
=8nm=2x10
9
m
h =6,6x10
34
Js
c =3x10
8
m/s
Ditanya:selisihenergiyangdipancarkan?
Jawab:
34 8
17
biru
9
34 8
17
merah
9
c 6,6x10 x3x10
E =h = =9,9x10 J
2x10
c 6,6x10 x3x10
E =h = =2,45x10 J
8x10

Selisih energi yang dipancarkan dari warna biru


kemerahadalah7,45x10
16
J.
Jawaban:B
50. KonsepTingkatEnergi
Diketahui:E=12eV
h=6,6x10
34
Js
c=3x10
8
m/s
1eV=1,6x10
19
J
Ditanya: Panjang gelombang radiasi yang
dipancarkan?
Jawab:
39

34 8
7
19
c
E=h
c 6,6x10 x3x10
=h = =1,03x10 m
E 12x1,6x10


Jadi panjang gelombang radiasi yang akan di
pancarkanolehgashidrogensebesar1,03x10
7
m.
Jawaban:C
51. KonsepLingkaran
Jika diketahui dua buah kelereng yang
berdampinganakandikelilingiolehsebuahkaret,
makadapatdiilustrasikansebagaiberikut.

Jadipanjangkaretyangdibutuhkanadalah.
p=4.Jarijarilingkaran+2xkelilinglingkaran
=4r+kelilinglingkaran
=4r+2r
=2r(4+2)
Jikadimisalkanjarijarilingkaran(r)=
1
cm
4
,
makapanjangkaretyangdibutuhkan2+cm.
Jawaban:C

52. KonsepBangunRuang
Dimisalkan masingmasing kelereng memiiki
volume sebesar 10 cm
3
, maka Volume kotak
sama dengan volume kelereng yaitu 200 cm
3
.
Diagonal maksimal dapat dihitung dengan
persamaanberikut.
d
2
=p
2
+l
2
+t
2

Ukuran alas kotak yang mempunyai diagonal


maksimal adalah jawaban C dengan p = 200, l =
1,dant=1.
d
2
=200
2
+1
2
+1
2
=400cm
Jawaban:C
53. KonsepLajuReaksi
Katalis merupakan suatu zat yang berfungsi
untuk mempercepat terjadinya suatu reaksi.
Kalis terlibat dalam reaksi berinteraksi dengan
reaktanakantetapidihasilkankembalipadahasil
reaksi sehingga katalis tidak memengaruhi
pergeseran kesetimbangan. Dengan kata lain,
katalisdapatmempercepattercapainyakesetim
bangan, tetapi tidak dapat mengubah komposisi
zatzatdalamkesetimbangan.
Jawaban:C

54. KonsepNanoteknologidanSinarX
Pengembangan obatobatan dengan nanotek
nologidapatmenggantikanterapidengansinarX
danakanmengurangiefekterapi.Terapidengan
member sinar X pada selsel kanker memiliki
efek samping seperti lemas, mual dan mentah,
gangguanpencernaan, sariawan, rambut rontok,
efek pada darah (anemia), kulit kering. Pada
jangka panjang akan menyebabkan anemia dan
mutasisel.
Jawaban:A

55. KonsepSel
Sel kanker memiliki bentuk yang lebih besar dan
tidak beraturan dibandingkan dengan bentuk sel
normal. Siklus pada sel kanker lebih cepat
daripada sel normal. Pada saat mitosis, spindle
pada sel kanker lebih panjang daripada sel
normal.
Jawaban:D

56. KonsepTermokimia
Ketika kuman masuk ke dalam tubuh, secara
otomatis hipotalamus akan mengatur pengatur
pada tubuh menjadi lebih tinggi. Setelah suhu
tubuh naik maka kita akan menggigil. Hal ini
dikarenakanadanyaaliranpanasdarilingkungan
menuju tubuh kita sehingga suhu lingkungan
turun dan akan menjadi dingin (reaksi endo
term).
Jawaban:D

57. Konsep
Tempat untuk menyimpan metabolit sekunder
yang salah satunya berupa isoflavon adalah
vakuola.
Jawaban:C

58. KonsepPeluang
Diketahui:
kaumwulan=2xkaumwulandiIndonesia
=2x40orag=80orang
Tiap8orangterdapat1kaumwulan
Ditanya:jumlahkaumnonwulan=.
Jawab:
Jumlahpenduduktotal=8xjumlahkaumwulan
=8x80orang
=640orang
Jadipenduduknonwulan
penduduktotalkaumwulan=(64080)orang
=560orang
Jawaban:D

59. KonsepHormon
Hormon pengganti (HRT) yang digunakan pada
penderita menopause bersifat mencegah bukan
mengobati. HRT merupakan pengobatan yang
tetapmemberikanefeksamping.
(pernyataansalah,alasanbenar)
Jawaban:D

. .
r r
40

60. KonsepIkatanKimia
Adanya gugus hidroksil memungkinkan terjadi
nya ikatan hidrogen dan pada suasana basa ion
OH

akan bereaksi dengan kation sehingga pada


suasanabasaakanterbentuksuatukation.
Jawaban:C
41
TES KEMAMPUAN IPS
SIMAK UI 2011

BIDANGILMU :EKONOMI,SEJARAH,GEOGRAFI,IPSTERPADU
WAKTU :60MENIT
JUMLAHSOAL :60


Keterangan :EKONOMI nomor1sampaidengannomor15
SEJARAH nomor16sampaidengannomor30
GEOGRAFI nomor31sampaidengannomor45
IPSTERPADU nomor46sampaidengan60

EKONOMI

Gunakan Petunjuk A untuk menjawab soal nomor 1


sampainomor11.

1. Dalam melakukan produksi barang akan terjadi


law of diminishing marginal return pada saat
setelah....
A. Produktotalmencapaimaksimum
B. Biayaperunitmencapaiminimum
C. Produkmarginalmencapaimaksimum
D. Penggunaaninputsudahmaksimum
E. Produkrataratamaksimum

2. Yang dimaksud dengan marginal propensity to


consumeadalah....
A. Kecenderungan untuk terus menambah
konsumsi
B. Tambahan konsumsi karena adanya pening
katanpendapatan
C. Peningkatan konsumsi yang dilakukan oleh
masyarakat
D. Perubahan kebutuhan yang dikonsumsi
masyarakat
E. Kecenderunganuntukmeningkatkankonsumsi
karenakebutuhanmeningkat

3. Yang dimaksud dengan keseimbangan konsumen


adalahjika....
A. Kurva penawaran berpotongan dengan kurva
permintaan
B. Terbentukhargakeseimbangandipasar
C. Kurva indiferensi berpotongan dengan budget
line
D. Kurva indiferensi bersinggungan dengan
budgetline
E. Kurvaindiferensisamadenganbudgetline

4. Dalam kehidupan seharihari, Anda menjumpai


atau bahkan menggunakan berbagai macam
merekproduksabunmandisepertiLux,Dove,dan
Lifebuoy. Adanya berbagai merek tersebut
merupakancontohdari....
A. Pasarpersaingansempurna
B. Pasaroligopoli
C. Pasarmonopoli
D. Pasarmonopsoni
E. Pasarpersainganmonopolistik

5. BarangXmemilikielastisitassilangnegatifdengan
barang Y. Ini berarti kedua barang tersebut
bersifat....
A. substitusi
B. inferior
C. normal
D. giffen
E. komplementer

6. Perbedaan utama antara akun biaya yang masih


harus dibyar dan biaya dibayar di muka adalah
bahwabebandibayardimuka....
A. telah terjadi dan biaya yang harus dibayar
belumterjadi
B. belum terjadi dan biaya yang masih harus
dibayartelahterjadi
C. telah dicatat dan biaya yang harus dibayar
belumterjadi
D. belum dicatat dan biaya yang masih harus
dibayartelahterjadi
E. telah diakui namun dicatat dan biaya yang
masih harus dibayar belum diakui tetapi telah
dicatat
42

7. Kapankah sebuah kurva permintaan uang akan


bergeserkekanan?
A. Ketikaterjadipenurunanpendapatan.
B. Ketika bank sentral menambah jumlah uang
beredar.
C. Penurunantingkatsukubunga.
D. Ketika bank sentral mengurangi jumlah uang
beredar.
E. Tidaksatupunjawabandiatasyangbenar.

8. Suatuasettetapyangdiperolehtanggal1Juli
2009memilikihargaperolehan
Rp220.000.000,00;nilaisisaRp20.000.000,00;
masamanfaatdiperkirakan5tahun.Dengan
asumsimetodepenyusutangarislurus,besarnya
akumulasipenyusutanpada31Desember2010
adalah....
A. Rp40.000.000,00
B. Rp44.000.000,00
C. Rp60.000.000,00
D. Rp66.000.000,00
E. Rp80.000.000,00

9. Berikutadalahciriefisiensialokatif,kecuali....
A. Titik alokasi berada di kurva production
posibilityoffrontier
B. Mencapai kondisi di mana benefit marginal
samadenganbiayamarginal
C. Jumlahalokasibarangyangseimbang
D. Tidak dapat menambah satu barang tanpa
mengurangibaranglain
E. Selisih antara manfaat total dan biaya total
terbesar

10. Dalam perekonomian tertutup, diketahui fungsi


konsumsi 10 0,8 C Y . Jika ada peningkatan
investasiotonomsebesarRp50juta,pendapatan
masyarakatakanmeningkatsebesar....
A. Rp50juta
B. Rp200juta
C. Rp250juta
D. Rp300juta
E. Rp400juta

11. Berikut ini adalah neraca saldo setelah penyusut


anperusahaanAbadiJaya:
Perlengkapan :Rp5.200.000,00
Pendapatan :Rp20.000.000,00
BebanAsuransi :Rp1.000.000,00
AkumulasiDepresiasi :Rp6.000.000,00
BebanPerlengkapan :Rp5.000.000,00
BebanDepresiasi :Rp2.000.000,00
AsuransiDibayardiMuka :Rp11.000.000,00

Lababersihuntukperiodetersebutadalah....
A. Rp800.000,00
B. Rp1.000.000,00
C. Rp6.800.000,00
D. Rp10.000.000,00
E. Rp12.000.000,00

GunakanPetunjukBuntukMenjawabsoalnomor12.

12. Salah satu tujuan pembangunan ekonomi adalah


terciptanya penurunan jumlah penduduk di
bawah garis kemiskinan dan pemerataan
pendapatan.
SEBAB
Semakin jauh jarak garis Kurva Lorenz dari garis
pemerataan sempurna, semakin timpang distri
busipendapatansebuahnegara,dansebaliknya.

Gunakan Petunjuk C untuk Menjawab soal nomor 13


sampai15.

13. Inflasi merupakan fenomena ekonomi yang


terjadiapabila....
1) Hargabahanpokokmeningkat
2) Hargainputperusahaanmeninngkat
3) Upahsecarakeseluruhanmeningkat
4) Hargasecarakeseluruhanmeningkat

14. Pernyataan di bawah ini yang tepat menjelaskan


konsepkurvaindiferensiadalah....
1) Kurva indiferensi adalah formula untuk meng
gambarkan perubahan tingkat kepuasan sese
orang atas konsumsi barang atau sekelompok
barangtertentu.
2) Pada tingkat kepuasan tertentu, utilitas sese
orangdigambarkanolehkurvaindiferensi.
3) Kurva indiferensi bukan bagian dari fungsi
utilitas.
4) Kombinasi konsumsi dua macam barang pada
sebuahkurvaindiferensimenghasilkantingkat
kepuasanyangsama.

15. Tanggal1Februari2011,dijualbarangdagang
sehargaRp5.000.000,00dengansyaratpembayar
an2/10;n/30.Tanggal4Februari2011,diterima
kembalibarangyangdikirimtanggal2011karena
tidaksesuaidenganpesananseharga
Rp500.000,00.Tanggal10Februari2011,diterima
pembayaranatasbarangyangdijualtanggal1
Februari2011.
Transaksi tanggal 10 Februari 2011 mengakibat
kan....
1) KasbertambahRp4.410.000,00
43

2) Memberi potongan pembayaran sebesar


Rp100.000,00
3) PiutangberkurangRp4.500.000,00
4) KekuranganpendapatanRp500.000,00

SEJARAH

GunakanPetunjukAdalammenjawabsoalnomor16
sampai23.

16. Pada akhir abad ke16 Belanda memulai pelayar


ankeTimur.Informasitentangpetajalurpelayar
anPortugisdibuatolehseorangBelandabernama
....
A. WillemJanszoon
B. JacobvanHeemskerk
C. JacobvanNeck
D. JanHughenvanLinschoten
E. OlivervanNoort

17. Pada tahun 1904, Dewi Sartika mendirikan


sekolah bagi kaum wanita. Sekolah ini terus
berkembangdiwilayahJawaBaratdanjumlahnya
mencapai 50% dari seluruh jumlah sekolah di
wilayah Pasundan waktu itu. Sekolah tersebut
adalah....
A. KeutamaanPutri
B. KeutamaanIstri
C. Keutamaanwanita
D. Istriutama
E. SekolahPutri

18. Salah satu faktor penyebab terjadinya Perang


DuniaIadalah....
A. dimulainya politik agresif oleh Perdana
Menteri Jerman Otto von Bismark padatahun
1890
B. persaingan di wilayah Balkan antara Austria,
Rusia,Italia,danTurki.
C. jatuhnyapemerintahmonarkidiPerancis
D. adanya pakta pertahanan antara Austria dan
Jermanpadatahun1902
E. kegagalanInggrisdalammengalahkanPrusia

19. MasyarakatJawaabadXIVtelahmengenaltradisi
menabung. Hal ini terkait dengan banyaknya
tabungan berbentuk binatang atau manusia yang
terbuat dari tanah liat. Masyarakat Jawa yang
telahmengenaltradisitersebut....
A. masyarakatdiKediri
B. masyarakatdiSingasari
C. masyarakatdiMataram
D. masyarakatdiYogyakarta
E. masyarakatdiTrowulan

20. Pada zaman Mesolitikum yang berlangsung pada


kalaHolosen,perkembangankebudayaannyaber
langsung lebih cepat daripada zaman Batu Tua
atau Paleolitikum. Hal ini disebabkan antara lain
oleh....
A. beragamnya alat yang dipergunakan oleh
manusia purba untuk membantu kehidupan
nyaterbuatdaribatuyangtelahhalus
B. berkembangnya teknologi perundagian dalam
pembuatanperalatandaribatu
C. perkembangan kemampuan otak pendukung
kebudayaaninisehinggaalatalatyangdihasil
kansudahlebihberagam
D. pendukung kebudayaan ini telah mengenal
teknologi
E. manusiapendukungnyaadalahHomoSapiens,
makhlukyanglebihcerdasdaripendahulunya

21. Salahsatufungsipentingdarigerakanmasyarakat
sipil yang berkembang seiring dengan Reformasi
1998 di Indonesia adalah memberikan advokasi,
artinya....
A. menolakkesewenangwenangannegara
B. menengahikonfliksosial
C. memberikan pandangan atau nasihat hukum
kepadamasyarakat
D. memperluasruangpublik
E. mengembangkan nilai toleransi dan persama
an

22. Pada awal perundingan antara Indonesia dan


Belanda yang dimulai bulan Februari 1946, Wakil
Gubernur Jenderal H.J. van Mook menyampaikan
pernyataan politik pemerintah Belanda yang isi
pokoknyaadalahsebagaiberikutkecuali,....
A. Pinjaman Belanda sebelum 8 Maret 1942
menjaditanggunganpemerintahRI.
B. Indonesia akan dijadikan negara persemak
muran berbentuk federasi yang memiliki
pemerintahsendiridalamlingkunganKerajaan
Nederland.
C. Masalah dalam negeri diurus oleh Indonesia,
sedangkan masalah luar negeri diurus oleh
pemerintahanBelanda.
44

D. Sebelum terbentuknya persemakmuran akan


dibentuk pemerintah peralihan selama
sepuluhtahun.
E. Indonesia akan dimasukkan sebagai anggota
PBB.

23. Sejak tahun 1875, kolonialisme dan kekuasaan


InggrisdiMesirsemakinkuatkarena....
A. Raja Muda Ismail menjual sebagian besar
saham Terusan Suez kepada Perdana Menteri
Inggris.
B. Perlawanan bersenjata rakyat Mesir melemah
denganditangkapnyasejumlahpemimpinper
lawanan.
C. Sebagian pemimpin perlawanan bersedia
melakukan negosiasi damai dengan pihak
Inggris.
D. Terjadi perpecahan dalam tubuh pemimpin
perlawanandiMesir.
E. Kelompok Islam tradisional menolak berga
bungdengankelompokperlawanannasionalis
Mesir.

GunakanPetunjukBdalammenjawabsoalnomor24
sampai27.

24. Depresi Besar di tahun 1930an berdampak pada


AmerikaSerikatsecarakeseluruhan,tetapisektor
pertanianlah yang paling tepukul. Roosevelt
selaku Presiden memperkenalkan program New
Deal.
SEBAB
New Deal dirancang untuk mendorong sektor
industri dan memberikan bantuan kepada peng
anggur dengan mengadakan skema proyek
berskalabesar.

25. Pada masa Mesir kuno, status wanita dalam


masyarakat mendapat tempat yang kurang
terhormat.
SEBAB
Wanita pada masa masyarakat Mesir kuno dapat
hidupsecaraMandiri.

26. Bencana kelaparan yang terjadi di Demak (1843)


dan Grobogan (1849) merupakan dampak dari
pelaksanaantanampaksa.
SEBAB
Demak dan Grobogan merupakan daerah yang
paling gigih mengadakan perlawanan menentang
pelaksanaanTanamPaksa.

27. Pemerintah Orde Lama dan Orde Baru pernah


melakukan penyederhanaan jumlah partaipartai
politik yang ada di Indonesia. Pada masa Orde
Lamajumlahpartaipolitikdibatasihanyamenjadi
lima, sementara pada masa Orde Baru partai
politikhanyadibatasimenjaditigasaja.
SEBAB
PemerintahOrdeLamadanOrdeBarumenyadari
bahwajumlahpartaiyangbanyaktidakmenjamin
adanyastabilitaspemerintahandanmenghambat
pembangunan.

GunakanPetunjukCdalammenjawabsoalnomor28
sampainomor30.

28. Para pejabat Dinasti Han diajarkan menghormati


ajaranSangFilsufAgungCina,KongHuCu.Ajaran
yang harus dipahami oleh pejabatpejabat dinasti
Hanterkaitdengan....
1) bagaimana memperlakukan orang tua dengan
baik
2) bagaimana memperlakukan kaum jompo
denganbaik
3) bagaimana menghormati orang lain dengan
baik
4) bagaimana menghormati raja dengan
bijaksana

29. Pada dasarnya agenda pemerintahan B.J. Habibie


berorientasi kepada peningkatan hak asasi
manusiasepertiterlihatdalam...
1) pembebasan tahanan politik yang semula
dituduhsubversif
2) pembentukan tim pencari fakta untuk
menyelidikikasuskekerasandankorbanhilang
3) pemulihankebebasanpers
4) pelaksanaanreferendummasalahTimorTimur

30. Dampak yang ditimbulkan setelah penyerangan


IsraelatasLibanonpadatahun1982adalah....
1) memburuknyahubunganIsraeldanMesir
2) tidak adanya lagi dukungan dari Amerika
serikat terhadap Israel dalam perundingan
denganpihakArab
3) jatuhnya banyak korban di kamp pengungsian
wargaPalestinadiBeirut
4) makinmeningkatnyaserangangerilyawanPLO
kewilayahyangdidudukiIsrael

45

GEOGRAFI

Gunakan Petunjuk A untuk menjawab soal nomor 31


samapainomor35.

31. Pada hakikatnya analisis keruangan adalahh


analisis geografi yang menitikberatkan beberapa
unsurgeografi,yaitu....
A. desa (rural), peralihan (suburban), dan
perkotaan(urban)
B. ruang (space), tempat (site), dan lokasi
(location)
C. mengelompok (clustered), random, dan
seragam(uniform)
D. waktu (time), jarak (distance), dan analisis
(analysis)
E. jarak (distance), kaitan (interaction), dan
gerakan(movement)

32. Fluktuasi suhu di Eropa relatif tinggi, terutama


fluktuasi antara suhu minimum absolut dan
maksimum absolut. Faktor penyebab fluktuasi
tersebutadalah....
A. ketinggiandanlereng
B. letaklintangdanbujur
C. letaklintangdanpengaruhdaratan/lautan
D. letakbujurbaratdanbentangalam
E. ketinggiandiatasdandibawahpermukaanair
laut

33. Unsurunsur dalam proses difusi keruangan abu


vulkanikGunungMerapi,yaitu....
A. areadanwaktu,itemyangdidifusikan,tempat
asal,tujuan,danjalurperpindahan
B. penduduk, gerakan, tempat tujuan, dan
tempatasal
C. jarak, kaitan, gerakan, tempat tujuan, dan
tempatasal
D. ruang, tempat, lokasi, waktu, dan item yang
didifusikan
E. penduduk, jarak, gerakan, jalur perpindahan,
tempatasal,dantempattujuan

34. Perhatikanpernyataandibawahini:
1. Memperluaspemasaranproduk
2. Menambah dan memperluas lapangan
pekerjaan
3. Mencariupahburuhyanglebihmurah
4. Alihteknologidarinegaramaju
5. Menambahpendapatandarisektorpajak
6. Mengurangitingkatpolusidinegaramaju
Dari pernyataan di atas yang termasuk alasan
relokasiindustriadalah....
A. 1,2,dan3
B. 1,2,dan5
C. 1,3,dan6
D. 2,4,dan5
E. 4,5,dan6

35. SebagianbesarpendudukAmerikautaratinggaldi
wilayah perkotaan. Keadaan penduduk kotakota
dipantaitimurdibandingkandenganpantaibarat
memperlihatkan....
A. Kepadatan penduduk pantai barat dan timur
sama.
B. Jumlah penduduk pantai barat dan timur
sama.
C. Penduduk pantai barat lebih padat dibanding
pantaitimur.
D. Penduduk pantai timur lebih padat dibanding
pantaibarat.
E. Mata pencaharian penduduk pantai timur
nelayan, sedangkan mata pencaharian pantai
baratpedagang.

GunakanPetunjukBdalammenjawabsoalnomor36
sampaisoalnomor40.

36. Aplikasi citra multispektral untuk pemetaan


mineralogi telah banyak dilakukan di daerah
subtropis, di mana tutupan vegetasinya sangat
lebat.
SEBAB
Tutupan vegetasi dapat dijadikan indikator
keberadaanmineraltertentu.

37. Datatitik,garis,danareayangdiperolehdariGPS
(Global Positioning System) adalah jenis data
raster.
SEBAB
Data dari GPS dapat diolah menjadi sumber
informasibagipembuatanpetadigital.

38. ZonadepresidiJawamemperlihatkankenampak
anbentukmukabumiyangberbedadenganzona
depresidiSumatra.
SEBAB
Cekungan di Jawa terdiri atas rangkaian pegu
nungan vulkanik muda, sedangkan cekungan di
SumateramerupakanjalurpatahanSemangko.

39. Kesuburan tanah dan ketinggian tempat merupa


kanfaktorpembatasdalambudidayapertaniandi
daerahtropis.
SEBAB
Ketinggian tempat bukan faktor pembatas
kesuburantanah.

40. Bila foto udara dibandingkan dengan skala yang


sama, maka detail kenampakan yang ada di foto
46

udara lebih lengkap daripada yang terdapat di


peta.
SEBAB
Seluruh kenampakan di muka bumi dapat
digambarkandalampeta.

GunakanPetunjukCdalammenjawabsoalnomor41
sampainomor45.

41. Kondisi iklim yang berpengaruh sehingga lahan


garam di Pamekasan (Madura) menghasilkan
garamyanglebihbaikdibandingkandenganlahan
garamdi Rembang (Jawa Tengah) dan Indramayu
(JawaBarat)adalah....
1) Evapotranspirasi di Indramayu lebih tinggi
daripadaevapotranspirasidiPamekasan.
2) Musim kemarau di Pamekasan lebih lama
daripadamusimkemaraudiRembang.
3) Curah hujan di Pamekasan lebih rendah
daripada curah hujan di Rembang dan
Indramayu.
4) Kelembaban udara di Pamekasan lebih tinggi
daripadakelembabandiIndramayu.

42. Dalam sebuah waduk, produksi ikan dalam


keramba jaring apung berkurang. Hal ini disebab
kanoleh....
1) terlalubanyakkeramba
2) pencemaranair
3) sedimentasi
4) terlalubanyaknyaecenggondok

43. Laut Kuning di Cina, airnya berwarna kuning


karena....
1) Airlautnyamengandungbutiranbutirantanah
lossyangberwarnakuning.
2) Airlautnyamengandungbutiranbutirantanah
alluvialyanggberwarnakuning.
3) TerbawaolehairSungaiHuangHodidaratan
CinamelaluigurunGobi.
4) Terbawa oleh air Sungai Mekong di daratan
CinamelaluiGurunGobi.

44. Selama bulan Mei hingga Juni 2010, suhu


permukaan laut (SPL) di perairan Indonesia barat
mencapai 29
o
30
o
C, jauh lebih tinggi dari SPL di
Samudra Pasifik dan Samudra Hindia. Kondisi
sepertiiniakanmengakibatkan....
1) Suhu udara di Sumatra dan Jawa cenderung
lebihtinggidarikondisinormal.
2) Kelembaban udara di Jawa, Kalimantan, dan
Sumatracenderungtinggi.
3) Tekanan udara di Indonesia bagian barat
cenderunglebihrendahdarikondisinormal.
4) CurahhujandiJawa,Kalimantan,danSumatra
cenderungtinggi.

45. Indikator yang dapat digunakan untuk mengkaji


bahwa gejala perubahan iklim sedang berlang
sungsekaranginiadalah....
1) variabilitascurahhujan
2) frekuensibadaisiklontropis
3) penyimpangansuhuudaraekstrem
4) penyusutanlapisansaljudikutub

IPS TERPADU

Pemerintahtelahmenerbitkankebijakanmoratoriumhutan.Kebijakaninimerupakanbagiandarikomitmen
Indonesia yang diberikan kepada Norwegia melalui letter of intent (LoI). Komitmen ini diimingimingi hadiah
pinjamanberbungkushibahsenilai1miliardolarUS.
Moratorium ini merupakan salah satu upaya untuk mengurangi laju deforestasi sehingga pengusaha tidak
perlu takut karena masih ada tanah terlantar seluas 40 juta hektare di seluruh Indonesia untuk dimanfaatkan.
Kemenhut berupaya mengurangi laju deforestasi hingga mencapai 200 ribu hektare hinggan2011 dengan
menerapkanprogramdeforestasiterencana.
Menurut Greenomics Indonesia, nilai komitmen Norwegia tidaklah berarti. Greenomics Indonesia menilai
mestinya kesepakatan tersebut harus memasukkan nilai kontribusi kehutanan pada PDB (Produk Domestik Bruto).
Pada Semester I2010, kontribusi sektor kehutanan Indonesia terhadap PDB mencapai Rp92,78 triliun. Bahkan,
sepanjang 2009, kontribusi sektor kehutanan mencapai Rp186,2 triliun. Nilai itu 20 kali lipat komitmen Norwegia.
NilaikomitmenNorwegiajelastelahmempermurahnilaihutanIndonesia.
Komitmen ini telah membelenggu sektor kehutanan. Oleh karena itu, tidak logis jika dengan komitmen
Norwegia,yangmaksimal1miliarUS,ruanglingkupyangdiaturdalamLoIterlaluluas.Komitmenituterlalumurah,
bahkan pencairannya pun tidak jelas. Pemerintah semestinya meninjau kebijakan tersebut agar tidak menjadi
kebijakankontraproduktifterhadappengembangansektorkehutanan.

47

GunakanPetunjukAdalammenjawabsoalnomor46
sampainomorr48.

46. Kebijakanpemerintahpadabacaanadalah....
A. bersifatnonspasial
B. penghentiansementaraekplorasihutan
C. mendapatkandanapengelolaanhutan
D. berorientasipadaperspektifspasialekologis
E. berhubungan dengan sumberdaya materi dan
hayati

47. Kebijakan yang ditandatangani oleh pemerintah


Indonesia akan berdampak terhadap nilai PDB
Indonesia, seperti yang dinyatakan oleh kalimat
terakhirbacaandiataskarena....
A. memperlambatlajudeforestasi
B. nilai kompensasi yang tidak seimbang dengan
kontribusisektorkehutananterhadapPDB
C. pencairankompensasiyangtidakjelas
D. ruanglingkupyangdiaturterlaluluas
E. semuabenar

48. Misalkansebuahlahanterlantarseluas1/(20juta)
luastanahterlantaryangadadiseluruhIndonesia
akan dimanfaatkan untuk tempat wisata. Pada
tiga sisi lahan terlantar tersebut akan diberi
pagar. Jika diasumsikan lahan berbentuk persegi
panjang, maka panjang pagar (dalam meter)
minimumyangdibutuhkanadalah....
A. 100
B. 200
C. 300
D. 400
E. 500

GunakanPetunjukBdalammenjawabsoalnomor49
sampaidengan50.

49. Hal yang dikemukakan kalimat terakhir alinea


pertama bacaan di atas akan dicatat sebagai
komponenuntukmenambahnilaiPDB
SEBAB
Salah satu cara untuk mengukur PDB adalah
denganpendekatanpendapatan(income).

50. LoI yang ditandatangani Indonesia dan Norwegia


terkait dengan kesepakatan untuk bersamasama
menghadapi tantangan perubahan iklim melalui
kerjasama pengurangan emisi gas rumah kaca
dariperusakanhutan(REDD+)
SEBAB
Indonesia merupakan negara yang memiliki
kerusakanhutanterbesardidunia.

Diketinggiansekitar11001200meterdiataspermukaanlaut(mdpl),duadesamendapatrejeki.Keduadesa
itu adalah desa Serang dan Kutabawa, kecamatan Karangrejo, Purbalingga, Jawa Tengah. Betapa tidak, panenan
cabaiyangharganyamelambungtinggimembuatparapetanimenanggukuntung.Taksedikitdarimerekaberubah
ekonominya,mulaimembelimobilbahkansampaimampuketanahsuciuntuknaikhaji.
Duabulanterakhir,hargacabaitinggi.DitingkatpetanihargatertinggiRp23.000,00perkg,tetapikinimulai
turunmenjadiRp15.000,00perkg.SatupohonmembutuhkanbiayapemeliharaansampaipanenRp5.000,00.Satu
pohon menghasilkan 1 kg cabai sementara ada petani yang memiliki 8.000 pohon, seperti Sobari. Bagi Sobari,
memperoleh keuntungan cukup besar memang baru tahun ini. Dari hasil keuntungannya itu, dia membeli mobil
niaga.
Petani cabai lainnya, Daryono, sudah tercatat sebagai calon haji yang akan berangkat tidak lama lagi. Ia
menanam pohon cabai seluas 1 hektare. Tahun ini menjadi tahun yang penuh rejeki bagi warga desa Serang dan
Kutabawa. Sebab pada umumnya harga cabai merah besar tahun lalu paling tinggi hanya Rp10.000,00 per kg,
bahkanterendahnyabisamencapaiRp2.000,00perkg.

GunakanPetunjukAdalammenjawabsoalnomor51
sampainomor52.

51. Kondisi yang digambarkan pada bacaan di atas


terjadikarena....
A. kurvapermintaanbergeserkekanan
B. kurvapenawaranbergeserkekanan
C. kurvapermintaanbergeserkekiri
D. kurvapenawaranbergeserkekiri
E. kurvapermintaandanpenawaranbergeserke
kanan

52. Berdasarkan bacaan di atas, total keuntungan


yang diperoleh Pak Sobari dari hasil penjualan
cabai dari pohon miliknya jika dia mendapatkan
hargatertinggiadalah....
A. 80jutarupiah
B. 96jutarupiah
C. 120jutarupiah
D. 144jutarupiah
E. 184jutarupiah

48

GunakanPetunjukBdalammenjawabsoalnomor53
sampainomor54.

53. Faktor suhu merupakan salah satu penentuan


kesesuaian kedua desa dalam melakukan budi
dayatanamancabai.
SEBAB
Petani kecamatan Karangrejo bekerja dalam
suasanaiklimsubtropik.

54. Lingkungan fisik kecamatan Karangrejo telah


dapatmengubahgayahidupparapetanicabai.
SEBAB
LingkunganfisikkecamatanKarangrejoberpenga
ruhpadakenaikanhargacabai.

GunakanPetunjukCdalammenjawabsoalnomor55.

55. Pada alinea satu naskah di atas disebutkan salah


satu provinsi di Jawa. Pada masa revolusi di
daerah ini terjadi pergolakan tiga daerah. Daerah
tersebutantaralainadalah....
1) Tegal
2) Solo
3) Pemalang
4) Salatiga

Banjirbesartelahmemaksa92.700orangdievakuasidaritempattinggalmerekadikotapelabuhanDandong,
di bagian utara Cina. Hal ini akibat dari hhujan lebat yang menyebabkan Sungai Yalu meluap. Hujan yang masih
berlanjutkemungkinandapatmerendamkotayangberbatasandenganKoreaUtaratersebutdanmenjadiancaman
banjirsusulanyanglebihhebat.
Sebelumnya, air bah telah menjebol tanggul pembatas antara sungai dan kawasan zona pembangunan
ekonomidiDandongyangmembanjiridaerahsekitarnya.Tinggipermukaanairtelahturun100cmmeskipuntetap
harusdalamstatuswaspadatinggi.HujanyangsangatlebatdanluapanairdariSungaiYalutelahmenyapusejumlah
rumah, gedung publik, dan perkebunan di lebih dari lima desa di dekat Sinuiju, kota di seberang Dandong. Sungai
YalumerupakansalahsatusungaiutamayangmemisahkanCinadenganKoreaUtara.
Sekitar 5250 orang telah dievakuasi di mana dua pertiganya adalah anakanak dan perempuan dewasa,
sisanyalakilaki.Beberapawargabahkanmendakiataprumahataupemukiman.SebagianbesarperdaganganKorea
Utaradengandunialuarmelaluikotainidanberperansentraldalammerobekisolasisertablokadesecaraekonomi
negara komunis tersebut. Banjir dalam beberapa tahun terakhir telah merusak tanaman pangan dan makin
menjerumuskan Korea Utara dalam kemiskinan serta meningkatkan ketergantungannya pada bantuan makanan
komunitasinternasional.
BagiCina,banjirdiDandongmerupakanbencanabanjirterburukdalamsatudekadeterakhir.Banjirdisertai
longsor akibat hujan lebat telah mengakibatkan sejumlah warga tertimbun di barat Cina dan tercatat setidaknya
lebihdari2.500orangtewas.

GunakanPetunjukAdalammenjawabsoalnomor56
sampaisoalnomor57.

56. Korea Utara merupakan negara yang berideologi


komunis. Salah seorang presidennya pernah
menerima gelar kehormatan Honoris Causa dari
sebuah universitas di Indonesia, yaitu universitas
....
A. GadjahMada
B. Diponegoro
C. Airlangga
D. Padjajaran
E. Indonesia

57. Diketahuiratarataumuranakanakyangberhasil
dievakuasi adalah 14 tahun dan ratarata umur
perempuan dewasa adalah 50 tahun. Misalkan
perbandingan banyaknya anakanak dan perem
puan dewasa adalah 2:1. Jika ratarata umur
orang yang berhasil dievakuasi adalah 35 tahun,
maka ratarata umur lakilaki dewasa yang
berhasildievakuasiadalah....
A. 26tahun
B. 45tahun
C. 50tahun
D. 53tahun
E. 62tahun

GunakanPetunjukBdalammenjawabsoalnomor58
sampaiinomor59.

58. Bencana alam seperti yang terjadi di negara yang


dimaksud pada bacaan di atas akan mengakibat
kankurvapenawaranagregatbergeserkekiri.
SEBAB
Bencana alam dan tingkat pendapatan masyara
kat adalah faktor yang dapat mengakibatkan
bergesernyakurvapenawaranagregat.

49

59. Luapan air Sungai Yalu atau Amnok sering mem


bawabencanabagimasyarakatdisekitarnya.
SEBAB
BencanatersebutmembuatKoreaUtaraterpaksa
bergantung pada Korea Selatan dan Amerika
Serikat.

GunakanPetunjukCdalammenjawabsoalnomor60.

60. Bila bencana alamseperti diuraikanpada peta, di


bagian legendanya akan diperlihatkan simbol
simbol....
1) titik
2) garis
3) area
4) batang

50





EKONOMI

1. Lawofdiminishingmarginalreturnadalahkondisi
di mana posisi tambahan faktor produksi mulai
menurunkan tambahan pendapatan sehingga
kondisi ini terjadi setelah produk marginal men
capaimaksimum.
Jawaban:C

2. MPC adalah hasrat batas untuk mengkonsumsi


yaitutambahan konsumsi karena adanya pening
katan pendapatan. MPC adalah pecahan positif
misalnya 0,8 berarti setiap pertambahan
pendapatan 100.000 akan berakibat kenaikan
konsumsi80.000.
Jawaban:B

3. Keseimbangan konsumen adalah jika kurva


indiferens menyinggung garis anggaran belanja
atau kemiringan garis anggaran sama dengan
kemiringan kurva indiferens. Pada satu garis
anggaran (budget line) terdapat beberapa kurva
indiferens. Konsumen tidak dapat mencapai
kurva indiferens yang terletak di atas garis
anggaranbelanja.
Jawaban:D

4. Suatu pasar yang bercirikan sebuah perusahaan


mengeluarkan suatu produk di mana produk
tersebut diberi merek bermacammacam sesuai
dengan segmentasinya merupakan ciri pasar
persainganmonopolistik
Jawaban:E

5. Elastisitassilangadalahkepekaanjumlahpermin
taan suatu barang terhadap perubahan harga
barang lainnya yang berhubungan. Apabila
barangbarang itu adalah barang substitusi satu
sama lain maka elastisitas silangnya positif.
Sedangkan apabila barangbarang itu komple
menter satu sama lain maka elastisitas silangnya
negatif.
Jawaban:E

6. Akun biaya yang masih harus dibayar adalah


termasuk akun utang lancar di mana beban ini
telah diakui namun belum dicatat. Sedangkan
akun beban dibayar di muka belum diakui tetapi
telahdicatat.
Jawaban:E

7. Sebuah kurva permintaan uang akan bergeser ke


kananjika:
- Meningkatnya pendapatan masyarakat
nasionaldanproduknasional
- KetikaBankSentralmenambahjumlahuang
beredar
Jawaban:B

8. Hargaperolehan =Rp220.000.000,00
Nilaisisa =Rp20.000.000,00
Umurekonomis =5tahun
Metodepenyusutangarislurus
HargaPerolehannilaisisa
Umurekonomis
220.000.00020.000.000=40.000.000pertahun
5
Ditanya akumulasi penyusutan per 31 Desember
2010.Padahalpembelianasettanggal1Juli2009.
Berarti pada tanggal 31 Desember 2010 telah
berumur 1 tahun 6 bulan (Juli 2009 samapi
Desember 2010) berarti akumulasi pada 31
Desember2010sebesar:
1,5x40.000.000=60.000.000
Jawaban:C

9. Efisiensi alokatif dapat dicapai apabila dengan


syaratsetiapbarangsamadenganbiayamarginal
untuk barang tersebut. Untuk setiap kegiatan
produksiharusdilakukanhinggamencapaikeada
andimanahargasamadenganbiayamarginal.
Jawaban:E

10. Diketahui :C=10+0,8Y


Smeningkatmenjadi50.
Ditanya :Y?
Jawab :
C =10+0,8Y
S =a+(1b)Y
PEMBAHASAN KEMAMPUAN IPS
SELEKSI MASUK UNIVERSITAS INDONESIA 2011
51

S =10+0,2Y
50 =10+0,2Y
60 =0,2Y
Y =300
Jawaban:E

11. Lababersih=pendapatanbebanbeban
Pendapatan =20.000.000
B.asuransi =(1.000.000)
B.perlengkapan =(5.000.000)
B.depresiasi =(2.000.000)
Lababersih =12.000.000
Jawaban:E

12. Pernyataan1Benar
Pembangunann ekonomi adalah kenaikan GNP
dalam jangka panjang disertai dengan perubahan
strukturkearahyanglebihbaikdanmemerhatikan
pemerataanpendpatan.Penurunan jumlah pendu
duk di bawah garis kemiskinan dan pemerataan
pendapatan merupakan salah satu indikator
keberhasilanpembangunanekonomi.
Pernyataan2Benar
Kurva Lorenz menggambarkan distribusi kumulatif
pendapatan nasional di kalangan lapisanlapisan
penduduk. Kurva Lorenz yang semakin dekat ke
diagonal (semakin lurus) menyiratkan distribusi
pendapatan nasional semakin merata. Sebaliknya
semakin jauh dari diagonal (semakin lengkung)
maka mencerminkan keadaan yang semakin
timpang.
Pernyataan 1 dan 2 benar tetapi tidak
menunjukkanhubungansebabakibat
Jawaban:B

13. Inflasi merupakan kondisi di mana secara umum


harga meningkat dan dalam jangka waktu terten
tu.
Dari pernyataan (1), (2), (3), dan (4) yang sesuai
dengandefinisiinflasiadalahno(4)
Jawaban:D

14. Konsepkurvaindiferensiasi
(1) formula untuk menggambarkan perubahan
tingkat kepuasan seseorang atas konsumsi
barang atau sekelompok barang tertentu
merupakanfungsiutilitas(Salah).

(2) Pada tingkat kepuasan tertentu, utilitas


seseorang digambarkan oleh kurva
indiferensiasi.(Benar)
(3) Kurva Indiferensiasi bukan bagian dari fungsi
utilitas(Salah)
(4) Kombinasikonsumsiduamacambarangpada
sebuah kurva indiferensiasi menghasilkan
tingkatkepuasanyangsama(Benar)
Pernyataan2dan4benar.
Jawaban:C

15. Jurnalumum
(DalamRibuan)

Tgl No
Bukti
Keterangan R
e
f
Debet Kredit
12 Piutang
dagang
5.000
Penjualan 5.000

42 Retur
penjualan
danPH
500
Piutang
dagang
500

10
2
Potongan
penjualan
90
Kas 4.410
Piutang
dagang
4.500

(1) KasbertambahRp4.410.000,00(Benar)
(2) MemberipotonganpembayaransebesarRp
100.000,00(SalahseharusnyaRp90.000,00)
(3) PiutangberkurangRp4.500.000,00(Benar)
(4) KekuranganpendapatanRp500.000,00(Salah
karenajumlahitumerupakanreturpenjualan
padatanggal4Februari2011)
Jawaban:B
52

SEJARAH

16. Jan Huygen van Linschoten, salah seorang Belanda


yang pernah bekerja pada Portugis pada 1595
menerbitkan buku itinerario Oost ofte Portugaels
Indien (Pedoman Perjalanan ke Timur atau Hindia
Portugis)yangmemuatberbagaipetadandeskripsi
rinci mengenai jalur pelayaran yang dilakukan
Portugis ke Hindia Timur, lengkap dengan segala
permasalahannya. Berkat van Linschoten inilah
Belanda akhirnya mengetahui banyak persoalan
yang dihadapi Portugis di Wilayah baru tersebut
danjugarahasiakapalsertajalurpelayarannya.
Jawaban:D

17. Kautamaan Istri didirikan pada 1913 di Tasikma


laya. Perkumpulan ini berkembang di Sumedang,
Cianjur,Ciamis,danCicurug.TokohKautamaanIstri
yangterkenaladalahRadenDewiSartika.
Jawaban:B

18. Pembunuhan Archduke Franz Ferdinand dianggap


sebagai alasan perang Dunia I, penyebab sebenar
nya terletak pada ketidakseimbangan politik di
Eropa. Kompleksitas penyebab Perang Dunia I
sangat tinggi, beberapa penyebab dapat terdaftar
sebagai berikut:Dominasi Militer, Aliansi yang
rumit,danHambatanperdagangan
Jawaban:D

19. Bukti persepsi masyarakat Jawa abad ke14


terhadap uang/tabungan tergambarkan dalam
wujud celengan babi dengan lubang di punggung
nya untuk memasukkan uang logam. Hubungan
antara figur babi dengan wadah uang sangat jelas;
dalambahasa Jawadanbahasa Indonesia, kata
'celengan' dapat berarti wadah tepat menyimpan
uang atau menabung. Sedangkan akar katanya
sendiri 'celeng' yang berarti babi hutan. Wadah
uangdalambentuklainjugaditemukan.
Jawaban:E

20. Teknologidankebudayaanlebihberkembangpada
masa mesolitikum dibanding dengan pada masa
paleolitikum.
Jawaban:D

21. Advokasi berarti segenap aktivitas pengerahan


sumber daya yang ada untuk membela, memaju
kan, bahkan mengubah tatanan untuk mencapai
tujuan yang lebih baik sesuai keadaan yang
diharapkan. Advokasi dapat berupa upaya hukum
formal(litigasi)maupundiluarjalurhukumformal
(nonlitigasi).
Jawaban:C

22. Pernyataan yang disampaikan van Mook pada 10


Februari 1946 dalam perundingan dengan Syahrir
danSirArchibaldClarkKeermengulangpernyataan
politikyangdisampaikanratuBelanda,yakni:
Indonesia akan dijadikan negara perse
makmuran dalam lingkup kerajaan
Belanda;
Masalah dalam negeri diurus oleh
Indonesia sedangkan masalah luar ngeri
diurusBelanda;
Sebelum terbentuknya persemakmuran
akan dibentuk pemerintahan peralihan
selama10tahun;
Dan Indonesia akan dimasukkan sebagai
anggotaPBB.
Jawaban:C

23. PengaruhkekuasaanInggrisdiMesirsemakinkuat
sejaktahun1875karenapadawaktuiturajamuda
IsmailmenjualsebagianbesarsahamTerusanSuez
milikMesirkepadaInggris.AkibatkebijakanInggris
dan Perancis yang turut campur tangan dalam
pemerintahan rakyat Mesir merasa dirugikan
sehinggamenimbulkangerakannasionalismeuntuk
menentang imperialisme barat yang ditandai
denganmunculnyapemberontakanArabiPasha.
Jawaban:A

24. New Deal adalah program yang dilakukan


Rooseveltsemasakrisisekonomi1930.Programini
mengubah kebiasaan ekonomi pasar bebas yang
diterapkan di negaranegara liberal. Negara ikut
campur dalam kebijakan ekonomi secara lebih
dalam penyelesaian krisis ekonomi 1930 yang
dialamiAmerikaSerikat.
Jawaban:B

25. Perempuan pada masa Mesir kuno memiliki status


yang lumayan tinggi. Dia bisa menikmati hak yang
sah untuk memiliki dan mewarisi. Selain
Hatshepsut, ada beberapa firaun yang berjenis
kelamin perempuan, di antaranya Khentkaues,
Sobekneferu, Neferneferuaten dan Nitocris. Pada
masamasa akhir pemerintahan Mesir kuno juga
adafiraunperempuanyangbernamaCleopatra.
Jawaban:A

53

26. BahayakelaparanterjadididaerahCirebon(1843),
Demak(1849),danGrobogan(1850).Daerahpaling
gigih melawan tanam paksa adalah Karesidenan
Bagelan (sekitar Purworejo) terbukti dengan
banyaknyaperlawananrakyatmasatanampaksa.
Jawaban:E

27. Pemerintah Orde Lama tidak membatasi jumlah


partai politik. Pembatasan partai politik terjadi
masaOrdeBaru.
Jawaban:D

28. Kong Fu Tse mengacu pada ajaran Taoisme yang


mengharuskanadanyakeselarasandalam kehidup
an bermasyarakat. Kong Fu Tse memusatkan
ajarannya pada kehidupan seharihari, dan
keluarga adalah inti dari masyarakat. Keselarasan
hidupdalamkeluargabisadirasakansaatorangtua
menyayangi anak, anak menghormati orang tua,
lakilaki sebagai kepala keluarga, perempuan
sebagai pengurus rumah tangga. Pemikiran ini
diterapkanpadasistempemerintahandimanaraja
harus menyayangi rakyatnya begitu pula rakyat
harustaatkepadaraja.
Jawaban:A

29. Semua hal itu dilakukan oleh pemerintahan


Habibie. Pembebasan tahanan politik, pembentuk
an TPF, pemulihan kebebasan pers, dan
referendumTimorTimur.
Jawaban:E

30. Semua hal itu merupakan dampak lanjutan dari


serangan Israel ke Lebanon 1982. Gerak pasukan
Israel tidak tertahankan tapi PLO terus bertempur,
tekanan dari AS terhadap Israel, jatuhnya banyak
korban, dan memburuknya hubungan Israel
denganMesir.
Jawaban:E


GEOGRAFI

31. Analisis lokasi dalam geografi menitikberatkan


pada tiga unsur dalam geografi, yaitu jarak
(distance), kaitan (interaction), dan gerakan
(movement). Pada hakikatnya analisis keruangan
adalah analisis lokasi yang menitikberatkan tiga
unsur geografi, yaitu jarak (distance), kaitan
(interaction),dangerakan(movement).
Jawaban:E

32. Fluktuasi suhu udara di permukaan bumi dapat


dibedakanmenjadi3pola,yaitu:
Polakhatulistiwa
Fluktuasi temperatur tahunan di daerah
khatulistiwa kecil, lebih kecil daripada
fluktuasi temperatur harian. Fluktuasi
khatulistiwa mempunyai dua minimum
dan dua maksimum, yaitu saat matahari
beradadiatassuatudaerahdanpadasaat
beradadigarisbalik.
Poladaerahsedang
Fluktuasitemperaturtahunandidaerahini
besar, lebih besar daripada fluktuasi
temperaturharian.Dalampolainiadasatu
maksimumdansatuminimum.
Poladaerahkutub
Fluktuasi temperatur tahunan di wilayah
kutub sangat besar. Pola ini hanya
mempunyai satu maksimum dan satu
minimum.
Eropa merupakan daerah yang terletak di pola
daerah sedang, sehingga fluktuasi suhu di Eropa
relatif tinggi, terutama fluktuasi antara suhu
minimum absolut danmaksimum absolut. Faktor
penyebab fluktuasi tersebut adalah letak lintang
danpengaruhdaratan/lautan.Fluktuasitempera
tur akan lebih besar jika suatu daerah terletak di
tengah benua dan akan lebih kecil jika
berdekatandenganlaut.
Jawaban:C

33. Unsurunsur dalam proses difusi keruangan abu


vulkanik Gunung Merapi, yaitu ruang, tempat,
lokasi,waktu,danitemyangdidifusikan.
Jawaban:D

34. Relokasi Industri adalah perpindahan atau


pemindahan lokasi industri dari negara maju ke
negara berkembang. Negara maju yang biasanya
melakukan relokasi industri adalah seperti
Amerika Serikat / USA, Jerman, Jepang, Prancis,
Korea, dan sebagainya. Negara yang menerima
relokasi industri adalah Cina, India, Indonesia,
Thailand, Vietnam, Malaysia, Meksiko, dan lain
lain. Beberapa alasan dari adanya relokasi
industriyaitu:
Memperluaspemasaranproduk
Mencariupahburuhyanglebihmurah
Mengurangi tingkat polusi di negara
maju
Jawaban:C

54

35. Sebagian besar penduduk Amerika Utara tinggal


di wilayah perkotaan. Keadaan penduduk kota
kota di pantai timur dibandingkan dengan pantai
baratmemperlihatkanbahwapendudukdipantai
timur lebih padat dibanding penduduk pantai
barat.
Jawaban:D

36. Pernyataanpertamasalah
Pernyataankeduabenar
Tutupan vegetasi dapat dijadikan indikator bagi
keberadaanmineraltertentu.
Jawaban:D

37. Pernyataanpertamasalah
Datatitik,garis,danareayangdiperolehdariGPS
(Global Positioning System) adalah jenis data
vektor.
Pernyataankeduabenar
Data dari GPS dapat diolah menjadi sumber
informasibagipembuatanpetadigital.
Jawaban:D

38. Pernyataanpertamabenar
ZonadepresidiJawamemperlihatkankenampak
anbentukmukabumiyangberbedadenganzona
depresidiSumatra.
Pernyataankeduabenardanberhubungan
Cekungan di Jawa terdiri atas rangkaian pegu
nungan vulkanik muda, sedangkan cekungan di
SumatraberupajalurpatahanSemangko.
Jawaban:A

39. Pernyataanpertamabenar
Kesuburantanahdanketinggiantempatmerupa
kanfaktorpembatasdalambudidayapertaniandi
daerah tropis. Ada tanaman yang cocok
dikembangkan di dataran tinggi serta ada pula
berbagai jenis tanaman yang justru cocok
dikembangkan di daerah dataran rendah yang
subur.
Pernyataan kedua benar tetapi tidak berhubung
an.
Ketinggian tempat bukan merupakan faktor
pembataskesuburantanah.
Jawaban:B

40. Pernyataanpertamabenar
Bila foto udara dibandingkan dengan peta pada
skala yang sama, maka detail kenampakan yang
ada dalam foto udara lebih lengkap daripada
yangterdapatdipeta.
Pernyataankeduasalah
Jawaban:C

41. Adapun beberapa syarat kondisi iklim untuk


pengembanganindustrigaramyaitu:
Evaporasitinggi
Kecepatandanarahangin>5m/detik
Suhuudaralebihdari32C
Penyinaranmatahari100%
Kelembabanudara<50%H
Curah hujan rendah dan hari hujan
kurang
Kondisi iklim yang berpengaruh sehingga lahan
garam di Pamekasan (Madura) menghasilkan
garam yang lebih baik dibandingkan dengan
lahan garam di Rembang (Jawa Tengah) dan
Indramayu(JawaBarat)yaitu:
Evapotranspirasi di Indramayu lebih
tinggi daripada evapotranspirasi di
Pamekasan.
Musim kemarau di Pamekasan lebih
lama dari pada musim kemarau di
Rembang
Curah hujan di Pamekasan lebih rendah
daripada curah hujan Rembang dan
Indramayu.
Jawaban:A

42. Dalam sebuah waduk, produksi ikan dalam


kerambajaringapungberkurang.Halinidisebab
kankarenabeberapahal,yaitudiantaranya:
Terlalubanyaknyakeramba
Pencemaranair
Sedimentasi
Terlalubanyaknyaecenggondok
Jawaban:E

43. Laut Kuning di Cina, airnya berwarna kuning, hal


inikarenadisebabkanolehbeberapahal,yaitu:
Air lautnya mengandung butiranbutiran
tanahlossyangberwarnakuning
Terbawa oleh air Sungai Hoang Ho di
daratanCinamelaluiGurunGobi
Jawaban:B

44. Selama bulan Mei hingga Juni 2010, suhu


permukaan laut (SPL) DI PERAIRAN Indonesia
barat mencapai 2930C, jauh lebih tinggi dari
SPL di Samudra Pasifik dan Samudra Hindia.
Kondisiinimengakibatkan:
Suhu udara di Sumatra dan Jawa
cenderung lebih tinggi dari kondisi
normal.
Kelembaban udara di Jawa, Kalimantan,
danSumatracenderungtinggi
TekananudaradiIndonesiabagianbarat
cenderung lebih rendah dari kondisi
normal
55

Curah hujan di Jawa, Kalimantan, dan


Sumatracenderungtinggi
Jawaban:E

45. Indikator yang dapat digunakan untuk mengkaji


bahwa gejala perubahan iklim sedang berlang
sungsekaranginiyaitudiantaranya:
Variabilitascurahhujan
Frekuensibadaisiklontropis
Penyimpangansuhuudaraekstrem
Penyusutanlapisansaljudikutub
Jawaban:E

IPS TERPADU

46. Kebijakan pemerintah pada bacaan adalah ber


orientasipadaperspektifspasialekologis.
Jawaban:D

47. Kebijakan yang ditandatangani oleh pemerintah


Indonesia akan berdampak terhadap nilai PDB
Indonesia, seperti yang dinyatakan oleh kalimat
terakhir bacaan karena nilai kompensasi yang
tidak seimbang dengan kontribusi sektor
kehutananterhadapPDB.
Jawaban:B

48. Diketahui:
LuastanahterlantardiseluruhIndonesia
=40jutahektar
Lahan yang akan dimanfaatkan untuk
tempat wisata =1/20 juta hektar dari
luastanahterlantardiseluruhIndonesia
Pada tiga sisi lahan terlantar akan diberi
pagar
Lahanberbentukpersegipanjang
Ditanya : panjang pagar minimum (dalam meter)
yangdibutuhkan?
Dijawab:
Luaslahanuntuktempatwisata
1
= x40.000.000 = 2
20.000.000
2
jadi luas lahan untuk tempat wisata = 2hektar = 20.000m
luas persegi panjang = pxl
20.000 = pxl
maka bisa diasumsikan panjang = 200m dan lebar = 100m
sehingga pagar yang dibutuhkan adalah 400 m

Jadi, panjang pagar minimum yang dibutuhkan


adalah400m.
Jawaban:D

49. Pernyataanpertamasalah
Pernyataankeduabenar
Salah satu cara untuk mengukur PDB adalah
denganpendekatanpendapatan.

Jawaban:D

50. Pernyataanpertamabenar
Lol yang ditandatangani Indonesia dan Norwegia
terkaitdengankesepakatanuntukbersamasama
menghadapi tantangan perubahan iklim melalui
kerjasama pengurangan emisi gas rumah kaca
dariperusahaanhutan(REDD+).
Pernyataankeduabenardanberhubungan
Indonesia merupakan negara yang memiliki
kerusakanhutanterbesardidunia.
Jawaban:A

51. Kondisi yang digambarkan pada bacaan di atas


terjadi karena kurva penawaran bergeser ke kiri.
Kurva penawaran bergeser ke kiri artinya jumlah
penawarannya mengalami penurunan karena
disebabkanolehkenaikanharga.
Jawaban:D

52. Diketahui :
Hargatertinggicabai:RP.23.000/kg
Jumlahpohoncabai :8000pohon
1pohonmenghasilkan1kgcabai
Biayapemeliharaan :5.000/pohon
Ditanya : keuntungan Pak Sobari jika dijual
denganhargatertinggi?
Dijawab :
Pendapatankotor = 8.000x23.000 = 184.000.00
Biayapemeliharaan= 5.000x8.000 = 40.000.000
Pendapatanbersih= pendapatankotor biaya pemeliharaan
= 184.000.000 40.000.000 = 144.000.000

56

Berdasarkan bacaan di atas, total keuntungan


yang diperoleh Pak Sobari dari hasil penjualan
cabai dari pohon miliknya jika dia mendapatkan
hargatertinggiadalahRP.144.000.000
Jawaban:D

53. Pernyataanpertamabenar
Faktor suhu merupakan salah satu penentu
kesesuaian kedua desa dalam melakukan budi
dayatanamancabai.Karenapadadasarnyasetiap
jenis tanaman tertentu itu mempunyai syarat
tumbuh,demikianjugadengancabai.Jikakondisi
iklim tempat budidaya cabai tidak sesuai dengan
syarat tumbuh cabai, maka tanaman cabai tidak
dapattumbuhdenganbaik.
Pernyataan kedua benar tetapi tidak
berhubungan
Petani Desa Karangreja bekerja dalam suasana
iklim subtropik, hal ini dapat dilihat dari
ketinggiandaerahtersebutyangberapadisekitar
1.1001.200meterdiataspermukaanlaut(mdpl).
Jawaban:B

54. Pernyataanpertamabenar
Lingkungan fisik Kecamatan Karangreja telah
dapat mengubah gaya hidup para petani cabai.
Kondisi ketinggian desanya yang sesuai dengan
syarat tumbuh tanaman cabai telah memberi
keuntungan bagi para petani, terutama saat
harga cabai melambung tinggi. Para petani mulai
dapat membeli mobil bahkan ada yang naik haji
darihasilpanencabai.
Pernyataankeduasalah
Jawaban:C

55. Pada alenia satu naskah di atas disebutkan salah


satu provinsi di Jawa. Pada masa revolusi di
daerahiniterjadipergolakantigadaerah.Daerah
tersebutantaralainyaitu:
Tegal
Pemalang
Jawaban:B

56. Korea Utara merupakan suatu negara yang


berideologi komunis. Salah seorang presidennya
pernah menerima gelar kehormatan Honoris
Causa dari sebuah universitas di Indonesia, yaitu
UniversitasIndonesia.
Jawaban:E

57. Diketahui:
Ratarata umur anakanak yang
dievakuasi=14tahun
Ratarataumurperempuandewasayang
dievakuasi=50tahun
Perbandingan banyaknya ankanak dan
perempuandewasa=2:1
Ratarata umur orang yang dievakuasi =
35tahun
2/3 orang yang dievakuasi terdiri dari
anakanak dan perempuan dewasa, dan
1/3terdiridarilakilakidewasa.
Ditanya : ratarata umur lakilaki dewasa yang
berhasildievakuasi?
Dijawab:
Rata rata umur anak danperempuan dewasa
(14x2) + (50x1) 78
= = 26 tahun
3 3
Rata rata umur yang dievakuasi
2 1
.26 + .x = 35
3 3
52 + x = 105
x = 105 52
x = 53 tahun

Jadi,ratarataumurlakilakidewasayangberhasil
dievakuasiadalah53tahun.
Jawaban:D

58. Pernyataanpertamabenar
Bencanaalamsepertiyangterjadidinegarayang
dimaksud pada bacaan di atas akan mengakibat
kan kurva penawaran agregat bergeser ke kiri.
Artinya penawaran barang dan jasa yang
diproduksi perusahaan di negara tersebut akan
mengalamipenurunan.
Pernyataankeduasalah
Jawaban:C

59. Pernyataanpertamabenar
Luapan air sungai Yalu atau Amnok sering mem
bawabencanabagimasyarakatdisekitarnya.
Pernyataan kedua benar tetapi tidak
berhubungan
BencanatersebutmembuatKoreaUtaraterpaksa
tergantung pada Korea Selatan dan Amerika
Serikat. Karena bencana tersebut telah merusak
tanaman pangan dan meningkatkan angka
kemiskinandiKoreaUtara.
Jawaban:B

57

60. Bila bencana alam seperti diuraikan pada bacaan


digambarkan pada peta, di bagian legendanya
akandiperlihatkansimbolsimbol,diantaranya:
Simbol titik, contoh : kota, ibu kota ,
gunung
Simbol garis, contoh :sungai, jalan, rel,
danbataswilayah
Simbol area, contoh : danau, rawa,
gurun.
Jawaban:A