Anda di halaman 1dari 4

Soal Sistemperkemihan

DisusunUntukMemenuhiTugas Mata KuliahKeperawatan


oleh:
Ahmad Ridwan J

142310101163

EndahWidayanti

152310101327

Nirwana Anjarratih Kusuma

152310101351

KEMENTERIAN RISET DAN TEKNOLOGI DAN PENDIDIKAN TINGGI


UNIVERSITAS JEMBER
PROGRAM STUDI ILMU KEPERAWATAN
Alamat: Jl. Kalimantan No.37 Kampus Bumi Tegal Boto Jember
Telp./Fax (0331) 323450 Jember

SOAL SISTEM PERKEMIHAN


1. Seorangkliendenganriwayat

GGA

datangkeklinikdengankeluhanmual,

muntah,

nafsumakanmenurun. Dari hasilpengkajian di dapatkan TD: 140/80 mmHg N: 88x


/menit

S:36,8C

turgor

kulitmenurunterdapat

pitting

oedem

di

keduaekstremitasbawah. Masalahkeperawatanprioritas yang munculpadaklien di


atasadalah.
a. Kekurangancairan
b. Resikoinfeksi

c. Gangguannutrisi: kurangdarikebutuhan
d. Peningkatansuhutubuh
e. Gangguan rasa nyaman: Nyeri
Jawaban: C
Penjelasan:
padaklien
GGA
terjadigangguanpadasekresi

protein

sehinggaterjadisindromurinaria yang menyebabkangangguanpadakeseimbanganasambasa

yang

memicupeningkatanasamlambungdanmenyebabkan

padakliensehingganafsumakandan

intake

nausea-vomitus

nutrisipadaklienmenurun,

dandapatditarikmasalahkeperawatangangguannutrsikurangdarikebutuhan.
2. Tn. D dirawat di ruangbedah RSUD dr. HaryotoLumajangdengandiagnosamedis:
Urothialisisdantelahdijadwalkanoperasipengangkatanbatuginjalpadatanggal

27

September 2015. Klienmengeluhnyeriseperti di tusuk-tusuk di pinggangkiri yang


bertambahsaatklienbergerakdandirasakanterutamapadapagihari.
hasilpemeriksaandidapatkan

TD:130/70

mmHg

S:36,5C

Dari
RR:20x/menit

HR:

88x/menit. Dari hasil USG didapatkansebesar 2mm di saluran ureterkiri.


Masalahkeperawatn yang munculpadaklien di atasadalah..
a. Gangguan rasa nyaman: Nyeri
b. Gangguaneliminasi urine
c. Ansietas
d. Kelebihan volume cairan
e. Kerusakanitegritaskulit
Jawaban: A
Penjelasan: adanyabantuginjal di saluran ureter menyebabkanpeningkatan peristaltic
ureter

sehinggaterjadicederajaringan/iritasipada

menyebabkanadanyaperadangan

ureter
local

sehinggarangsanganterhadapreseptornyerimeningkatmenyebabkanpelepasanhistamin,
bradikinindanneurotransmiterperangsangnyerilainnyasehinggadidapatkankeluhannyeri
padaklien.
3. Tn. F dirawat di ruanginterna RSU SoebandidengandiagnosaGagalginjalkronik,
dariData Obyektifyang didapatdariklien di dapati TD:150/100mmHg S: 36,8C
RR:24x/menitN:84x/menit

terdapat

pitting

oedemapadapresacraldan

pretibial,

terdapatbunyinapas (Cracles), BBawal MRS 57kg dansaatpengkajian 58kg, distensi


vena jugular. Dari data obyektif Tn. F di dapatimasalahkeperawatan
a. Gangguan rasa nyaman: Nyeri
b. Gangguaneliminasi urine
c. Ansietas
d. Kelebihan volume cairan
e. Kerusakanitegritaskulit
Jawaban: D

Penjelasan:

padaklien

GGK

terjadiretensi

meningkatmenyebabkantekanankapilerdan

Na

volume

sehingga

total

CES

interstisialnaikdan

preload

meningkatberpengaruhpadapeningkatanbebanjantungsehinggaterjadihipertrofipadaven
trikeldanpayahjantungkirimenyebabkanpenurunan

COP

sehinggaalirandarahkeginjalmenurunbegitupundengan

RAA

menyebabkanpeningkatanretensi

Na

dan

H20

meningkatdanterjadioedempadaektremitas, gangguanpadapernapasandanpeningkatan
BB

yang

disebabkankarenapenumpukancairan,

sehinggadapatditarikmasalahkeperawatanKelebihan Volume cairan


4. Seorangklien,
Tn.Dberusia

56

tahundatangkepoliurologidengankeluhanseringberkemihterutamapadamalamhari,
sulitdalammemulaidanmenghentikansaatberkemihdisertaiadanya rasa nyeri, dan air
kemih yang tetapmenetesmeskipun proses berkemihtelahselesaisejak 3 minggu yang
lalu.

Dari

hasilpemeriksaanretaltoucherdidapatkanadanya

menonjolkedalam

lumen

rectum.

2cm

prostat

Masalahkeperawatan

yang
yang

didapatidarikeluhanklientersebutadalah.
a. Gangguan rasa nyaman: Nyeri
b. Gangguaneliminasi urine
c. Ansietas
d. Kelebihan volume cairan
e. Kerusakanitegritaskulit
Jawaban: B
Sejalandenganpertambahanumur,
kelenjarprostatakanmengalamihiperplasia,
jikaprostatmembesarakanmeluaskeatas

(bladder),

dalammempersempitsaluranuretraprostaticadanmenyumbataliran

di
urine.

Keadaaninidapatmeningkatkantekananintravesikal.Sebagaikompensasiterhadaptahana
nuretraprostatika,

makaotot

detrusor

danbuli-

buliberkontraksilebihkuatuntukdapatmemompa urine keluar.Kontraksi yang terusmenerusmenyebabkanperubahananatomidaribuli-buliberupa :Hipertropiotot detrusor,


trabekulasi,

terbentuknyaselula,

buli.Sehinggaterjadipeningkatanfrekuensiberkemih

sekuladandifertikelbulidank

mengeluhkanadanyakesulitandalammengontrolkeluarnya urine saatberkemih.


5. Ny.
Y
datangkeklinikdengankeluhandemamsejak
3
hari

lien
yang

laludisertainyeridanterasapanassaatberkemih,
klienmengatakanselamainimembasuhkemaluandaribelakangkedepan.

Dari

pemeriksaandidapatkan TD: 120/70 N: 80x/menit S:38,6 RR:24x/menit. Dari


hasilpengkajian di atasdidapatimasalahkeperawatanpadaklienyaitu

a.
b.
c.
d.
e.

Gangguan rasa nyaman: Nyeri


Gangguaneliminasi urine
Peningkatansuhutubuh
Kurangpengetahuan
Kerusakanitegritaskulit
Jawaban: D
Padaklien
yang

mengalamiInfeksiSaluranKemih(ISK)

kebnyakantidakmengetahuitentangpenyebabdantandagejalasehinggamenjagakebersiha
ndirikurangdiperhatikanapalagidibagiankelamin.Sehinggarentangsekalimengalamipen
yakitInfeksiSaluranKemih (ISK).