Anda di halaman 1dari 16

HASIL PRAKTIKUM BIOINFORMATIKA

BIOTEKNOLOGI AKUAKULTUR

Disusun oleh:
Hemi Trifani
NIM. L1B015040

FAKULTAS PERIKANAN DAN ILMU KELAUTAN


UNIVERSITAS JENDERAL SOEDIRMAN
PURWOKERTO
2018
I. BIOINFORMATIKA

1.1. Sequence Alignment


Teknik penyelarasan sekuen merupakan salah satu bagian teknik
bioinformatika molekuler yang banyak diterapkan dalam mengidentifikasi
hubungan kekerabatan makhluk hidup. Salah satu teknik sequence alignment
adalah MSA (Multiple Sequence Alignment). MSA dapat didefinisikan sebagai
penyelarasan dari tiga atau lebih sekuen biologis (berupa protein atau asam
nukleat) dengan panjang yang sama. Hasil dari penyelarasan sekuen ini dapat
digunakan untuk menyimpulkan homologi dan hubungan evolusi antara urutan
atau sekuen yang dipelajari (Daugelaite et al., 2013).

Penyelarasan sekuen pada praktikum ini dilakukan dengan mengakses


program Clustal Omega yang dapat diakses melaui situs
https://www.ebi.ac.uk/Tools/msa/clustalo/. Sekuen yang diselaraskan merupakan
sekuen nukleotida dari gen DMRT1 (Doublesex and mab-3 related transcription
factor). Gen DMRT1 pada ikan mengkode faktor transkripsi saat determinasi seks
jantan dan berperan penting saat spermatogenesis dengan mencegah meiosis pada
spermatogonia yang belum terdiferensiasi dan memicu mitosis yang mendorong
terjadinya perkembangan spermatogonia dan meningkatkan produksi sperma ikan.
Berikut ini merupakan hasil dari MSA sekuen nukleotida pengkode gen DMRT1
pada sepuluh spesies ikan.
AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds TAAGGTCTGGTCAACTAACTACATTTTGTTGTTCTGTAAACAACATAAATTATTTGCTTA 60
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds TTACCACTTACATTTTTTACAACTTTGTGATAGGCTTACCTAAACAAACTGGCTGAAGCC 120
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds CATATAAATCTAAATGTAACCATGCTTTAAAACGCCATCCTCGCATGTTTTGTGTCTTAT 180
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GATCTATGAATTCATGAGACACATGGGGAGTCACTTTGCTTCCAGTGGGAAGAAACTGAA 240
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds CATCAGCTCCCACGCGCGCTGGAACGCACAGGTTGCTCGCGCCAAATATTTGCCTATTGT 300
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds -----------------------------------ATATTCTAAAGCAGAGGAACCGGCT 25
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------GACATATTCTAA 12
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ATCAAACCTCAGACCCCCCTCCTTATAAAAGTTTTATAATCCGCGGTCGTGTCATATTCG 360
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds -------------------------------------------------GAATATAAGCT 11

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds --------------------------GGGGATTAAGCATGTGGGAGGAAGAGCAGAGTAA 34
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ---------------------------------------------------GCAGAGTAA 9
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATCATCATCATCATCATCATCATCATCACCTGTCGGCATGAGTGAGGAGGAGCAGAGTAA 85
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCAGAAGGACCGGCCATCATCATCATCACCTGTCGGCATGAGTGAGGAAGAGCAGAGTAA 72
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds AAGCAGAAGAGGCCGACCGTCATCACCACCTGTAGGCATGAGTGAGGAAGAGCAGAGTAA 420
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds --GGAGAAGAGGCTGACCGTCATCACCACCTGTAGGCATGAGTGAGGAAGAGCAGAGTAA 58
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------ACTGTCTTCTGTCATAATGAGTGAGGAAGAGAGTAA 36
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TTCCAGCTTTCCACAGAGTTCATCACTGTCTGCTATCATAATGAGTGAGGAAGAGAGTAA 71

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ----------------------------------------------CGCTGCAGGAACCA 14
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CGGCTCGCTGTCAGTCAGGAAACCGTCCCGTATGCCCAAGTGCTCGCGCTGCAGGAACCA 94
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CGGCTCGCTGTCAGTCAGGAAACCGTCCCGTATGCCCAAGTGCTCGCGCTGCAGGAACCA 69
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds -------------------AAACCGTCTCGTATGCCGAAGTGTTCCCGTTGCAGAAACCA 41
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CGGCTCGCTGTCGGTCAGGAAGCCGTCCCGCATGCCCAAGTGCTCGCGCTGCAGGAACCA 145
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CGGCTCGCTGTCTGTCAGGAAGCCGTCCCGCATGCCCAAGTGCTCGCGCTGCAGGAACCA 132
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds CGGCTCGCTGTCCGTCAGGAAACCGTCCCGTATGCCCAAGTGCTCGCGCTGCAGAAACCA 480
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CGGCTCGCTGTCCGTCAGGAAACCGTCCCGTATGCCCAAGTGCTCGCGCTGCAGAAACCA 118
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds CGGCTCCCGGACGGTCAGGAAAGTGGCTCGGATGCCCAAGTGTTCCCGCTGCAGGAATCA 96
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CGGCTCCTTGACGGTCAGGAAAGTGGCTCGGATGCCCAAGTGCGCCCGCTGCAGGAATCA 131
** ***** ** **

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 CGGTTTTGTATCTACCCTGAAGGGACACAAGCGCTT----CTGCAGCTGGAGGGACTGTC 70
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CGGCATCGTGTCTCCACTAAAGGGCCACAAACGCTT----CTGCAACTGGAGGGAATGTC 150
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CGGCATCGTGTCTCCACTAAAGGGCCACAAACGCTTCTTTCTGCAACTGGAGGGAATGTC 129
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds TGGTTATGTGTCACCTTTGAAGGGACATAAACGATT----TTGTAACTGGAGGGATTGTC 97
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CGGCTTCGTGTCGCCGCTGAAGGGCCACAAACGCTT----CTGTAGCTGGAGAGACTGCC 201
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CGGCTTCGTGTCGCCGCTGAAGGGCCACAAACGCTT----CTGCAACTGGAGGGACTGCC 188
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds CGGATTCGTGTCTCCGCTGAAGGGCCACAAACGCTT----CTGCAACTGGAGGGACTGCC 536
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CGGATTCGTGTCTCCGCTGAAGGGCCACAAACGCTT----CTGCAACTGGAGGGACTGCC 174
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds CGGGTTCGTGTCGCCGCTGAAGGGACACAAGCGCTT----CTGTAATTGGAAGGATTGCC 152
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CGGGTTCGTGTCGCCGCTGAAGGGACACAAGCGCTT----CTGTAATTGGAAGGATTGCC 187
** ** ** * * ***** ** ** ** ** ** * **** ** ** *

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 AGTGTCCCAAATGTAAACTCATAGTGGAGAGACAGAGAGTCATGGCGGCTCAGGTTGCCC 130


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds AGTGCCAGAAATGTCGACTAATCGCTGAAAGACAGCGGGTCATGGCAGCCCAGGTGGCGT 210
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds AGTGCCAGAAATGCCGACTAATTGCTGAAAGACAGCGGGTCATGGCAGCCCAGGTGGCCT 189
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds TATGTCAGAAATGCAAATTGATCGCAGAACGGCAGAGGGTGATGGCGGCCCAGGTGGCAC 157
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AGTGTCAGAAATGCAGACTGATCGCTGAACGACAGAGGGTCATGGCAGCCCAGGTGGCGT 261
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AGTGTCAGAAATGCAGGCTGATCGCTGAACGACAGAGGGTCATGGCAGCCCAGGTGGCGT 248
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds AGTGTCAGAAATGCAGACTAATCGCTGAAAGACAGCGGGTCATGGCAGCCCAGGTGGCCT 596
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds AGTGTCAGAAATGCAGACTAATCGCTGAAAGACAGCGGGTCATGGCAGCCCAGGTGGCCT 234
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds AGTGTCAGAAATGTAGACTTATTGCGGAAAGACAGCGGGTCATGGCTGCCCAGGTGGCTT 212
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds AGTGTCAGAAATGTAGACTTATTGCGGAAAGACAGCGGGTCATGGCTGCCCAGGTGGCTT 247
** * ***** * ** * ** * *** * ** ***** ** ***** **

Left Primer : GAGACAGCAGGCTCAGGAG AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 TGCGGAGACAGCAGGCTCAGGAGGAGGAGCTGGGCATTTGGAGTCTGGGTCCTCTCCCTG 190


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATTTGCTGTCCGGTTAACCTGTCCT 270
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATTTGCTGTCCGGTTAACCTGTCCT 249
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds TCCGCAGACAGCAGGCCCAAGAGGAGGAGATGGGCATCTGCAGTCCAGTCACCTTGTCCA 217
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGCTGGGTATTTGCAGTCCGGTTAACCTGTCCG 321
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGCTGGGCATTTGCAGTCCGGTTAACCTGTCCG 308
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAAATGGGCATTTGCAGTCCGGTTAACCTGTCCG 656
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATTTGCAGTCCGGTTAACCTGTCCG 294
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds TACGAAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATCTGCAATCCTGTTAACCTGTCTG 272
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TACGAAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATCTGCAATCCTGTTAACCTGTCTG 307
* ** ** ******** ** ***** ** **** ** ** ** * * *

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 GGGCCGGGGTGATGGTGAAGAATGAACCTGGAGCCGAATGTTGTTTCACGGTGGAAGGAC 250


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GTTCAGACAGTCTTGTGAAGAACGAGGTCATGGGTGATGTGAATGTGTTTACTATCAGCT 330
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GTTCAGACAGTCTGGTGAAGAACGAGGTCATGGGTGACGTGAATGTGTTTACTATCAGCT 309
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds GCACGGAGGTCATGGTGAAGAATGAAGCCACAGGTGACAGGGCTTGCTTCTTCTCCGCAG 277
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTTCAGACACTCTGGTGAAAAACGAGGCCGTCGGTGATAATGTGTTTACTATCATCCCAG 381
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTTCAGACACCCTGGTGAAAAACGAGGCCGTCGGTGATAATGTGTTTACTATCATCTCAG 368
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GTTCAGACACTCTGGTGAAGAACGAGGTCGTGGGTGACCATGTGTTTACCATCAGCTCAG 716
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GTTCAGACACTCTGGTGAAGAACGAGGTCGTGGGTGACCATGTGTTTACCATCAGCTCAG 354
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GTTCTGACCCTCTGGTAAAGAACGAGCCAGTAGTTGATTATGTGTTTACTGTGGGCACAA 332
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GTTCTGACCCTCTGGTAAAGAACGAGCCAGTAGTTGATTATGTGTTTACTGTGGGCACAA 367
* * * * ** ** ** ** * **

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 GAAGCCAGACAT---------CTACCAGTGGACCCTCTTCTGCTGTGGCCACAGCGAGCC 301


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CCAGACCGCCATCACCCACCGCAAGCAGTGCCACCGCCTCTCCCACCAACCTAGAGAGCC 390
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CCAGACCGCCATCACCCACCGCGAGCAGTGCCACCGCCTCTCCCACCAACCTAGAGAGCC 369
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds GGGAAAAGTCTCCCCCTCTCCAAAACAACGAAGCCACATCACCCTCTGCTACAGGGAACC 337
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GGCCGCCATCACCCA---GCACCAGCAGTGCCACCGCCTCTCCCACCAACCTAGGGAATC 438
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GGCCGCCATCGCCCA---CCACCAGCAGTGCGACCGCGTCTCCCACCAACCTAGGGAATC 425
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GACCGCCATCACCCA---CCACCAGCAGCGCTACCGCCTCTCCCACTAACATAGAGAGCC 773
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GACCGCCATCACCCA---CCACCAGCAGCGCTACCGCCTCTCCCACTAACATAGAGAGCC 411
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GAGCTTCATCACCCA---CCACCACGAGTGCTCCCTCATCCCCCACTGTCCCAGGGAGTC 389
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GAGCTTCATCACCCA---CCACCACGAGTGCTCCCTCATCCCCCACTGTCCCAGGGAGTC 424
* * * * ** * ** * ** ** *

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 GCACAGTGCCATCATCCCAACCATCAGCTGGTGCTCGGGCTCATCATGATGGACAGTCAG 361


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GTTCCATGCTAGCTCTAAGCTCTGCAGTGACCAGCAGAGGGCACACTGAGGGCCCATCTG 450
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GTTCCATGCTGGCTCTAAGCTCTGCAGTGACCAGCAGAGGGCACACTGAGGGCCCATCTG 429
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds GACCCGCCATGCCGTCCAGTCCCACGTCGGCCAGCAGGGGGCACCCTGAGGGTTCATCTG 397
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCTCCATGCTGGCTCTAAGTCCTGCGGCGACCAGCAGAGGGCACACTGAGGGCACGTCTG 498
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTTCCATGCTGGCTTTAAGTCCTGCGGCGACCAGCAGAGGGCACACTGAGGGCACGTCTG 485
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GTTCCATGCTGGCTCTAAGCTCTGGAATGACCAGCAGAGGGCACACTGAGGGCCCATCTG 833
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GTTCCATGCTGGCTCTAAGCTCTGGAATGACCAGCAGAGGGCACACTGAGGGCCCATCTG 471
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GTTCCATGCTTGCTGTAAGCCCTGCAGCGACCAGCAGAGGGCACACTGAAGGCACATCTG 449
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GTTCCATGCTTGCTGTAAGCCCTGCAGCGACCAGCAGAGGGCACACTGAAGGCACATCTG 484
* * * * * * ** *** ** ** *

Right Primer : GTGTGGGCTGGTAGAGGTT AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ACCTGCTGCTGGAAAGCTCTTTTTACCACTTTTACCAGCCGTCGTGCTACCCGTCCTACT 421


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds AGCTGATGGTGGATGCCTCCTATTATAACCTCTACCAGCCCACACCGTACACCTCCTACT 510
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds AGCTGATGGTGGATGCCTCCTATTATAACCTCTACCAGCCCACACCGTACACCTCCTACT 489
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ATCTGGTGGTGGATGCATCCTACTACAACTTCTACCAGCCCTCCCGCTACCCTGCCTACT 457
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ACCTGATGGTGGACGCCTCCTATTACAACCTCTACCAGCCCACACCATACTCCTCCTACT 558
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ACCTGATGGTGGATGCCTCCTATTACAACCTCTACCAGCCCACACCATACTCATCCTACT 545
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds AACTGATGGTGGATGCCTCCTATTACAACCTCTACCAGCCCACACCGTACACGTCCTACT 893
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds AACTGATGGTGGATGCCTCCTATTACAACCTCTACCAGCCCACACCGTACACGTCCTACT 531
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ACCTGATGGTTGGTCCGACCTATTACAACCTGTACCAGCCCTCACGCTACTCCTCCTACT 509
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ACCTGATGGTTGATCCGACCTATTACAACCTGTACCAGCCCTCACGCTACTCCTCCTACT 544
* *** ** * * * * ** ** * ******** * *** * ******

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ACAGCAACCTGTACAACTACCAGCAGTACCGGATGCACTCCTAC---------------- 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ATAGCAACCTGTACAACTATCAGCAATACCAGATGCCCAGTGGAAATGGCCGCCTTTCCA 570
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATAGCAACCTGTACAACTATCAGCAATACCAGATGCCCAGTGGAAATGGCCGCCTGTCCA 549
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ACAGCAACCTGTACAACTACCAGCAGTACCAGATGCCCAGCAACGAGGGTCGCCTGTCTG 517
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATAGCAACCTGTACAACTACCAGCAATACCAGATGCCTAGTGGAAATGGTCGCCTGTCCA 618
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATAGCAACCTGTACAACTACCAGCAATACCAGATGCCTAGTGGAAATGGTCGCCTGTCCA 605
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ATAGCAACCTGTACAACTACCAGCAATACCAGATGCCCAGTGGAAATGGCCGCCTGTCCA 953
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ATAGCAACTTGTACAACTACCAGCAATACCAGATGCCCAGTGGAAATGGCCGCCTGTCCA 591
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ACAGCAATCTGTACAACTATCAGCAATACCAGATGCCTACTGGAGACAGCCGCCTGTCCA 569
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ACAGCAATCTGTACAACTATCAGCAATACCAGATGCCTACTGGAGACAGCCGCCTGTCCA 604
* ***** ********** ***** **** *****

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GCCATAACGTTCCCCCCCAGTACCTCACACACTCCTACTATTCATCTTACCTGAGTCAGG 630
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GCCATAACGTCCCCCCCCAGTACCTCACACACTCCTACTATTCATCTTACCTGAGTCAGG 609
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds GCCACAGCGTGTCCCCGCAGTACCGCACGCATTCA------------------------- 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCCATAACGTGTCCCCCCAGTACCGCACACACTCCTACTATTCCTCTTACCTGAGTCAGG 678
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCCATAACGTGTCCCCCCAGTACCGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 665
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GCCATAATGTGCCCCCTCCGTACCGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 1013
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GCCATAATGTGCCCCCTCAGTACCGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 651
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GCCATAACGTGTCGCCCCAGTATTGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 629
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GCCATAACGTGTCGCCCCAGTATTGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 664

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GGATCGACACT---------GTCCCACCCAGCACCTGCCCTGAGCCCAAAGCATCAGCTT 681
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GGATCGACACT---------GTCCCACCCAGTACCTGCCCTGAGCCCAAAGCATCAGCTT 660
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GGCTCGGCACGACTGCATGTGTGCCCCCCAGCACCTGCCCTGAACCCAAAGCAGCAGCTT 738
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GGCTCGGCACGGCTGCATGTGTGCCACCCAGCACCTGCCCTGAACCCAAAGCAGCAGCTT 725
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GGATCGACACGGCTGCATGTGTCCCACCCAGCACCTGCTCTGAGCCCAAAGCAGCAGGTG 1073
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GGATCGACACGGCTGCATGTGTCCCACCCAGCACCTGCTCTGAGCCCAAAGCAGCAGCTT 711
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GGCTCGGCACGGCCGCCTGTGTCCCACCCAGTACCTGCCCTGAGCCCAAAGCAGCAGCTT 689
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GGCTCGGCACGGCCGCCTGTGTCCCACCCAGTACCTGCCCTGAGCCCAAAGCAGCAGCTT 724

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ACTCCAATGGAGCTCAAGACTCAGTGTCCATCAGCTCAATGATC-----AACACTGAGAA 736
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ACTCCAATGGAGCTCAAGACTCAGTGTCCATCAGCTCAATGATC-----AACACTGAGAA 715
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TCTCTGATGGAGCTCAAGACTCTGTGTCCATCAGCTCGATGATC-----AACACTGAGAA 793
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TCTCCGATGGAGCTCAAGACTCGGTTTCCATCAGCTCGATGATC-----AACACTGAGAA 780
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GCATTTCCTCCAGCGTGATCCTCTGCCAGCCTCTCCCTCCCCCACTCCATCATCTGGCAA 1133
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ACTCCAGTGGAGCTCAAGATTCCATC------AGCTCAATGATC-----AACACTGAGAA 760
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds TCTCTGATGGAGCACAAGACTCAAGTTTGAACACGCTGACCATC-----AGCACTGAGAA 744
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TCTCTGATGGAGCACAAGACTCAAGTTTGAACACGCTGACCATC-----AGCACTGAGAA 779

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CAGGCTGGAGTGTGAGAGCAGCTCCGAGTCCGGAACCTTCTCCGTCGACTCCGTCATAGA 796
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CAGGCTGGAGTGTGAGAGCAGCTCCGAGTCCGGAACCTTCTCCGTCGACTCCGTCATAGA 775
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CCGGCTGGAGTGTGAGAGCAGCTCAGAGTCTGGAACCTTCTCCATCAACTCCATCGTTGA 853
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGGCTGGAGTGTGAGAGCAGCTCAGAGTCTGGAACCTTCTCCATCAACTCCATCGTTGA 840
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds TGGACTAGACT--GGACGTTACTGAGGTTACCTGAGAT---------------------- 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CAAGCTTGAGTGTGAGAGCAGCTCAGAATCTGGAACCTTCTCCGTGGACTCCGTCATAGA 820
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds CAGACTGGAGTGTGAAAGCAGCTCAGAGTCTGGCACCTTTTCTGTGGAGTCCATCATAGA 804
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CAGACTGGAGTGTGAAAGCAGCTCAGAGTCTGGCACCTTTTCTGTGGAGTCCATCATAGA 839

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TGGGGCAACCAAATAAAACACCCTCACCTGCACCAACAACTTGATTTTTTTCTTTTGTTA 856
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TGGGGCAACCAAATAAAACACCCTCACCTGCACCGACAACTTGATTTTTTTCCTTTGTTA 835
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TGGGGTAACCAAATAAAAAACCCTCACCTGCACCAATCTCACATTTAATTGAATTGTTT- 912
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TGGGGTAACCAAATAAAA-AACCTCACCTGCACCAATCTCCCATCTAATTGAATTGTTG- 898
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GGGGGCGACCAAATAAAACACCCTCACCTGCACCAATCTCTCATTTTTCTGTTGAGTTG- 879
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GGGAGCGACTAAATAAAAGCTTACAACACCCCCCAAAAAAAAAA---------------- 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GGGAGCGACTAAATAAAAGCTTACAACACCCCCCAACAACAACAGCTTGAATCTTACC-- 897

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TTTGAGTTGTTTCTGTAATTTTCAACTAAAAATGTAATGATTCTGTAACCAAATCCTGCC 916
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTTGAGTTGTTTCTGTAATTTTCAACTAAAAATGTAATGATTCTGTAACCAAATCCTGCC 895
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------CTGTATTTTCAACTTATTTTTCACCTTATTGTTC-------------- 946
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------CTGTATTTTCAACTTATTTTTCATCTTATTGTTC-------------- 932
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ---------TTTCTGTAACTTTTAACTAAATGTGTAATGATTCTGTAACCAAATCCTACC 930
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ----------TTCTCAAATTGAGGTGTTTTCACCCAGTGATTCTGGTAAAAAGTTGTAAA 947

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TTATTGTTCAA--AATGTTGTTGTTGATACTGATCAGGTTGATCAATGTAGTGTTGTAAA 974
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTATTGTTCAAA-AATGTTGTTGTTGATACTGATCAGGTTGATCAATGTAGTGTTGTTAA 954
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ---------AA--CATTGTGTAGTTAACACTGATCAGGTTGACTGTTGTGGTGTTTTTCA 995
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ---------AA--TATTGTGTAGTTAACACTGATCAGGTTGACTATTGTGGTGTTTTTCA 981
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TTATTGTTCGGCATTTTTTGTAGTTAATACTGATCAGGTTGATC---------------- 974
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TCGTTG---AGCAT--TTAGTTGGTAACACTAATCAATGTATTA---------------C 987

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ACTTTGGAGGGGTAATTCTTTACGCTTTTATAGACATTG--------------CTTTTGT 1020
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ACTTTGG---GGTAATTCTTTACATTTTTATAGACATTG--------------CTTTTGT 997
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ACTTTTTTAGGGATTCTATAA-GGTTT-----------GGGT------------ATTATT 1031
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AGTTTTTAGGGGATTCTATAA-GATTTTCATAGACATTGGTT------------ATAATT 1028
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds -------AATGTGGTGTTATG-CAGCTTTGTAGTGGTAATTCTTTTAA-GATGTAATCTA 1025
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CTTTTGCATGGGGTTCTTAAA-GATTTTTATAGAAATGAGTTGTTTTAGGGAAATTTCTC 1046

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ATTAATCAGTTTCTCAGTGATGATCAGAA--------ATGCCCTTTTACTATGTTTCATA 1072
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATTAATCAGTTTCTCAGTGATGATCAAAA--------ATGCCCTTTTACTATGTTTCATA 1049
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TGCTCTTAGTTTCTCGATGATGATCAGAAATGCAGTTTACATAGATTGCCATGTTTTATA 1091
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACTTTTAGTTTCTCAGTGATTATCACAAATGCAGTTTATATAGATTGCTATGTTTCATA 1088
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds A-------GTTTCTCACTGATTATCAGAAATGCAGTTTACATAGT---TTTTGTTTCATA 1075
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds AATGAGCCTGTACACTGTAATGATGAGATATTCAGTCTATATAGT---TCATTTGCGATG 1103

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CAGTTGGATAGCTTCAGTTTGTTCACTTTGATGCTGCAGTTTTTAAAGACTAAAATGATT 1132
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CAGTTGGATAGCTTTAGTTTGTTCACTTTGATGCTGCAGTTTTTAAAGACTAAAATGATT 1109
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGTTTGATAGCTTCAGTTTGTTTACTTTGATACTGCAGTTGTTAAAGATTAAAATGAGT 1151
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAATTTGATAGCTTCAGTTTGTTTACTTTGATACTGCAGTTTTTAAAGATTAGAATGAGT 1148
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CAGTTTGATAGCTTCAGTTTGTTCACTTTGCTGCTGCAGTTTTTAAAGACTAAATTGATT 1135
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TATTGTAAAACGTTTCAT-----------------ACTGTTT----AATTAAGTTTGATT 1142

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CACTTTCACTTTCTAGCAGAACACCATTGAAAGAAATGGCAGAGCAGAACGATTTATTGT 1192
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CACTTTCACTTTCTAGCAGAACACCATTGAAAGAAATGGCAGAGCAGAACGATTTATTGT 1169
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CACTTC-ACTCCATAT----ACTATAGTGAAAGAAATGGCAGAGCACAACGATTTACTGC 1206
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CACTTCCATTCCATAT----ACTATAGTGAAAGAAATGGCAGAGCACAACGATTTATTGC 1204
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CACTTT------CCAG----CAGCTATTGAAAGAAATGGCAGAGCAGAACGATTTATTGT 1185
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CTTCTG------ATA------AAAACGTGAGACAAATCA--A-ACCATACAAACACAACT 1187

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CACACATCCGTTCATGCTCTAAATTACTGTCATTGGCCTAATAGATAATCTAACTTCCTT 1252
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CACATATCTGTTCATGCTCAATATTGCTGTCATTGGTCTAATAGATAATCTAACTTCCTT 1229
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CACATATCAGTTGAAGCTCAGTATTGCTGTCATTGGCCTAATGAATAAGCTAACTTCTTT 1266
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CATATATTTGTTGAAGCTCAGTATTGCTGTCATTGGCCTAATGGATAAGCTAACTTCTTT 1264
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CACGTATCGGTTCAAGCTCAATATCGCTGTCATTGGCCTAATGGATAATCTAACTTGTTT 1245
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TCAGCAGTGCAGACAGCTTAGTAGTGCTGTCACTGGTCTAATGGATAATCTAACTTCTTT 1247

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TCCATGACCTTCATGCTGCAGACTATATAGGGGCTTCTCCAGCATC-------------- 1298
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TCCATGACCTTCATGCTGCAGACTATATAGGGGCTTCTCCAGCGTC-------------- 1275
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CCA-TGACCTTCAAGACACAAAGTATATGAGCTCTTCTCCAGCATCTCTA---------T 1316
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CCA-TGACCCTCAAGACGCAAAGTATATGAGCTCTTCTCCAGCATCTCTA---------C 1314
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CCA-TGACCTTCATGCTGCAGACTCTATGAGGGCTTCTCCA-------------GCATCT 1291
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CTA-CGACCTTCATGATCAGAGCTTCTCAGGAATCATCACAGACTTGTGCTGTAAGCTGT 1306

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds -----TCCATAGTGTTGTGCGGGACAGTTGGGTCAGAAGAGATACTATTAAATTATGCTT 1353
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds -----TCCATAGTGTTGTGCGGGACATTTGGGTCAGAAGAGATACTATTAAATTATGCTT 1330
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ACTGTTGTGTTGTAGGCTGTGGGACATTTGGGTTTGAAGAGATACTATTAAATTATGCTT 1376
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AGTGTTGTGTTGTAGGCTGTGGGACAGTTGGGTTAGAAGAGATACTATTAAATTATGCTT 1374
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CCACAGTGTC------GTGCGGGACAGTTGGGTTAGAAGAGATACTATTAAATTATGCTT 1345
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GCAGAGGAGGGTGGGGTTAGTATGCAGGTAGAGAGGAAGAGATACTATTAAATTATGC-- 1364

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CAATCTCACAGCGAACGGCTTGTTTATTTATGGCCATCACTAAAGGACATCATTTAACTT 1413
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CAATCTCACAGCGAACGGCTTGTTTATTTATGGCCATCACTAAAGGACATCATTTAACTT 1390
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAATCTCACAGTGAACGGCTTATTTATTTATGGCCATCACTAAAGGACATCATTTAACTT 1436
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAATCTCACAGTGAACGGCTTATTTATTTATGGCCATCACTAAAGGACATCATTTAACTT 1434
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CAATCTCACAGCGAACGGCTTGTTTATTTATGGCCATCGCTAAAGGACATCATTTAACTT 1405
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds -----CTCAATCTCACAGCTTGTTTATTTATGGCCATCGCCAAAGGACATCATTTAACTT 1419

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TTGATGATTTGCATCAACCCTGTTCCTGTGCATGATCCAGCTAATGTGCAGTGCTCTTCT 1473
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTGATGATTTGCATCAACCCTGTTCCTGTGCATGATCCAGCTAATGTGCAGTGCTCTTCT 1450
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TTGATGATTTGCATCAACCCTGTTCCTATGCATGATCCAGCTAATGTTCAGTGCTCTTCC 1496
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CTGATGATTTGCATCTACCCTGTTCCTATGCATGATCCGGCTAATGTTCAGTACTCTTCC 1494
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TTGATGATTTGCATCAACCCTGTTCCTGTGCACGATCCAGCTAATGTGCAGTGCTCTTCT 1465
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TTGATGATTTGCATCCACCCTGTTCCTACCCATGATCCAGCTAATATGCTGCACTGTTCT 1479

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GAGCTTTCTT-TGTATAATGTGAAGCTCTGCCCTTGATTTTAATGGTCTT---GGCACAG 1529
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GAGCTTTCTT-TGTATAATGTGAAGCTCTGCCCTTGATTTTAATGGTCTT---GGCACAG 1506
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCATTTTCTT-TGTATAATATGAAGCTGTGCCCTTGATTTTAATGGTGTTGTTGGCACAG 1555
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTATTTTCTT-TGTATAATATGAAGCTGTGCCCTTGATTTTAATGGTG---TTGGCACAG 1550
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GAGCTTTCTT-TGTATAATATGAAGCTGTGCCCTTGATTTTAATGGTGTT---GGCACAG 1521
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GAGCTTTCTCTTGTGTAATGTCAAGCTGTGCCCTTGATTTTAATAGTGTT---TGCACAG 1536

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ATAGTGTCCTCAGTCAAGTCACAAACAGAGGAGAAAAGGGACACAAAACTTCGCCTTACA 1589
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATAGTGTCCTCAGTCAAGTCACAAACAGAGGAGAAAAGGGACACAAAACTTCGCCTTACA 1566
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATAATGTCCTCAGTCAAGTCACGAATAAATGGTAAAGGAGAAGAGGGACACAAAACTTTC 1615
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATAGTGTCCTCAGTCAAGTCACGAATAAAAGGTAAAGGAGAAGAGGGACACAAAACTTTG 1610
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ATAGCGTCCTCAGTCAAGTCACAAACAGAGGAGAAGGGAAAGA--------CAAAACT-T 1572
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GGACTGTCCTAAGGTCATGAATAAATCGTAAAAGAGGGGAAAC--------AAAACTTTT 1588

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GACATTTGTTATGACGGTACATTTAACTACAAATGATGTATCTTGATCTGAT------CT 1643
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GACGTTTGTTATGACGGTACATTTAACTACAAATGATGTATCTTGATCTGATTGAAATGA 1626
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds --T--TTCCTTGTAAGCTCAGTTTGTTGCAGAC------------AT-TTGTTATGACAG 1658
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TCT--TTCCTTTTAAGCTCAGTTTGTTGCAGAC------------AT-TTT---TGACAG 1652
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TCT--TTCCTTTTAGGTTATGTTAAATGTATTA------------GGCTGATTGAAATGA 1618
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ACT--GTCTGTTTAGCTTACTGTTCATTACAGA------------ATCTGTTTGTGACGC 1634

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GCCATGTGTTG---TTTAATCTGATTTTTAATTTTTTTATTATAGTGGCTGGCCCTTTAA 1700
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GCCATATGTTG---TTTAATCTGATTTTTAATTTTTTTATTATAGTGGCTGGCCCTTTAA 1683
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACATTTAACTAAAAATTAAACTATATTTCGT-TTTTTAGATCTGATAAAAACAAG-GCA 1716
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACAGTTAACTAAAAATGAAACAATTTTTCAG-TTTTTAGATCTGATAAAAACGAG-CCA 1710
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GCCATATGTTAATATGTAATCTGATTTTTACA-TTTTTATTATAGTGGATGGCGCTTTAT 1677
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TGCATTT--AAATGT-TAATGCCAATTAGTAG-TTTCTAGGGCATCTGATAGAAATTAGC 1690

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TATGCTTTGACAATCAGTATATCTTATTTACTTGTATACACCTCACTATTAATAGATAAC 1760
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TATGCTTCGACAATCAGTATATCTTATTTACTTGTGTACACCTCACTATTAATAGATAAC 1743
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTGTGATCTAT-------------------------------------TTTTTTACA--- 1736
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TATCCATGTTAAATGCATTTTTTTTCTAAGTGTGATCTGATTTTTACATTTTATTAT--- 1767
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TATGCTTCGACAATCGGTATATCTTTTGCACT-TATTTACTTACTT-------------- 1722
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TTTATATGGT--ATGTGTTCATTTTTTAAAGATGATCTGATATGTT-------------- 1734

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TAGCAGAGAGGTGAATTAATTTTATTAGAATTTTTTCCTAAAAATGAATGTAAAATGTAA 1820
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TAGCAGAGACGTGAATTAATTTTATTAGAATTTTTTCCCAAAAATGAATGTAAAATGTAA 1803
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ----------TTTTATTGTTATTATTATTATATTATAGTCGATGGCCAATTAAAATGAAT 1786
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ----------TATTATTATTATTATTATTATAGTGGAGGGGCCAATTAAAATGAATCAAT 1817
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ---------------------------ATCTTGCAGAGA--CAAATTAATTTTGTTCT-- 1751
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ---------------------------TTATATTTTATG--GAATCATCTTTAATTGT-- 1763

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TTACCTTTATGCATTTCCATTTTGTGATTTTTGTACTATTTTGTTAG---ACTAACAGTT 1877
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTACCTTTATGCATTTCCATTTTGTGATTTTTGTATCATTTTGTTAG---ACTACAAATG 1860
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGTCTGAGGGCCATTTAATATGCTTGCATCTGT-ATTTCTTTTGCACTTACATAGAAGT 1845
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGTCTGAGGGCCATTTAATATGCTTACATCTGT-ATTTGTTTTGCACTTACATAGAAGT 1876
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ---AAAAACCAATGTAAAATGTCATTATTTTGATGCATTTTTGTGCAATGACTAACAGTT 1808
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ---CCTTTACATGTTTAAATTTTAA-----TATTAAGATTTTATACATTGAATACGCACT 1815

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CACGGTTTGATTAATTTGTTCATTTGTTTTCCAGAC----AAGTGCATTGTGGATGTGCT 1933
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATGTATCTTGATCTGATTGAAATGAGCCATATGTTGTTTAATCTGATTTTTAATTTTTTT 1920
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TAGTAGT--AATAAGTAGCTAACTGAGACTT----------------------------- 1874
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGTATT--AATAAGTAGCTCACTGAGACTT----------------------------- 1905
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CACAGTTTGATTGATTTGTTCATTTGTTTTC----------------------------- 1839
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TAAAAATAAAATAAATTACTAAA------------------------------------- 1838

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CTTGTC--CTCTGACACCATGATGT--TACAAATATATTTGT--ATTAGTGTTATGATTA 1987
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATTATAGTGGCTGGCCCTTTAATATGCTTCGACAATCAGTATATCTTATTTACTTGTGTA 1980
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------AA----ATGAATAGCCTTTTTCT------A 1894
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------AA----ATGAATAGCTTTTTTCT------A 1925
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------CA----GACG---TGTTAATTTA------C 1856
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------AA----GATT---TTTTCCTGTT------G 1855

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TAAAGCAATGCAATTGTTAATTTGCAATCGTTGTGTGTTTATATGCTCTCATGTTCAGTG 2047
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CACCTCACTATTAATAGATAACTAGCAGAGACGTGAATT--------------------- 2019
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AAAATGAAT----GTAAA---------GAATGTGCGTACTGTATATTCTAATGTTAAACA 1941
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AAAATGAAT----GTAAAATGTTGTAAGAATGTGCATACTGTATGTTCTAATATTAAACA 1981
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CCACTGTAT----TTTGCCGGTGGCGTGGATGTGCTCT---------------------- 1890
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CTTATAAGC----TT------TTGAAACGCTGTTAATC---------------------- 1883

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GAAATAAAATCATTATTGATGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA--------- 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds -----AATTTTATTAGAATTTTTTCCCAAAAATGAATGTAAAATGTAATTACCTTTATGC 2074
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTGATTTTGTG------CAATTTTGTTAGA--------CCAACAGTTCACAGTTTGATTC 1987
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTGATTTTATA------CAATTTTGTTAGA--------CCAACAGTTCACAGTTTGATTC 2027
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds -----------------------TGTCCT---------CCGACACCATAATG-------- 1910
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds -----------------------AGTTCA---------ACAAAAAAAAAAAA-------- 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATTTCCATTTTGTGATTTTTGTATCATTTTGTTAGACTAACAGTTCACGGTTTGAT-TCA 2133
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATTTGTTTT-CCAGAT-----------------------------GCTGGTTTTGTGTAT 2017
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATTTGTTAA-TTTGTTTTTT-------------C-------AGATGCTGGTTTTGTGTAA 2066
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 1910
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTTGTTCATTTATTTTCCAGACAAGTGCATTGTGGATGTGCTCTTGTCCTCTGACACCAT 2193
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds A----------------------------------------------------------- 2018
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AACTTTACTGTATTTT------------ACTCATGATGTGGTGA--GCTCTTGTTCACTG 2112
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 1910
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GATGTTACAAATATTTGTATTAGTGTTATGATTATAAAGCAATGCAAATGCTAATTTGCA 2253
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ----ACTTACTGAAGTTTTTTATTGTTACGATTGTAAAATAACACAAAAGCTAATTTGCA 2074
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATGTTACAAATAATTTTTTTTATTGTTACGATTGTAAAACAATACAAAAGCTAATTTGCA 2172
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ----TTACAAATATTTGTATTATTGTTGTGATTATAAAGCAATGCAAAAGCTAATTTGCA 1966
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATCGTTGTGTGTTTATATGCTCTCATGTTCAGTGAATAAAATC--ATTATTGATGACTGA 2311
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ---ATCCTGTGTTTATATGCTCTCATGTTCAGTGGAAATAAAATAATTATTGATGACTGA 2131
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ---ATCGTGTGTTTATATGCTCTCATGTTCAGTGGAAATAAAATCATTATTGATGAAAAA 2229
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ATCGTTGTATGTTTATATGCTCTCATGTTCAGTGGAAATAAAATCATTATTGATCAAAAA 2026
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CATATAAAAAAAAAAAA------- 2328
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CTTTCAAAAAAAAAAAAAAAAAAA 2155
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AAAAAAAAAAAAAA---------- 2243
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds AAAAAAAAAAAAAA---------- 2040
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------ 1903

Pembahasan

Seperti yang telah diuraikan sebelumnya, bahwa teknik MSA dapat menghasilkan
output yang berguna untuk menyimpulkan homologi dan hubungan evolusi antara
urutan atau sekuen yang dipelajari, sehingga dapat diketahui hubungan
kekerabatan antar spesies berdasarkan karakteristik gen yang dimiliki. Hasil
penyelarasan yang telah diterapkan, menghasilkan deretan sekuen nukleotida gen
DMRT1 pada 10 spesies ikan yang disejajarkan dalam panjang basa sama dan
diketahui urutan sekuen dengan tingkat kemiripan yang tinggi. Dalam hal ini, strip
garis sejajar pada suatu barisan sekuen gen tiap spesies, menandakan bahwa pada
urutan basa tersebut, tidak terdapat nukleotida sehingga direpresentasikan dengan
tanda (-). Menurut Hidayat dan Pancoro (2006), tanda (-) dikenal sebagai gap.
Gap dapat terjadi sebagai akibat adanya insersi atau delesi nukleotida.

Adapun, keberadaan tanda (*) di bawah sekuen yang disejajarkan, menandakan


bahwa terdapat tingkat kemiripan yang tinggi dari ke-10 spesies jika dilihat dari
urutan nukleotidanya. Dengan kata lain, pada urutan basa kesekian, tanda bintang
menunjukkan bahwa ke-10 jenis ikan yang disejajarkan memiliki urutan
nukleotida yang hampir sama, atau bahkan sama. Jika dilihat dari keberadaan
tanda (*) pada sekuen yang tersejajarkan, nukleotida gen DMRT1 pada ke-10 ikan
terlihat mulai menunjukkan kemiripan karakteristik dimulai pada urutan basa ke
480-953. Sebaliknya, urutan basa nukleotida di awal dan di akhir alignment
menunjukkan kosongnya sekuen nukleotida pada beberapa spesies ikan.

Setelah menerapkan alignment sequencing dengan teknik MSA, hasil dari


sekuen nukleotida dapat digunakan untuk mengetahui homologi spesies dengan
mencari tahu hubungan kekerabatannya menggunakan program Clustal Omega
yang dapat diakses melalui situs https://www.ebi.ac.uk/Tools/msa/clustalo/. Hasil
identifikasi selain berbentuk sekuen yang disejajarkan, juga dapat diakses dalam
bentuk matriks tabel kesamaan identitas sehingga lebih memudahkan pembacaan
hasil MSA. Berikut ini merupakan tabel matriks identifikasi hasil MSA gen
DMRT1 pada 10 spesies ikan berbeda :

Tabel 1. Matriks identifikasi sekuen gen DMRT 1 pada 10 spesies ikan


PERSEN KESAMAAN

NO KODE NUKLEOTIDA
Spe Me
sies Tn Gr Gc Aj Ca Cc Ci a Ma Pd

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain- 100 62. 62. 65.3 64. 64. 64. 64.5 65. 65.
1 Tn
containing_transcription_factor_DMRT1__dmrt1 .00 80 80 8 30 30 52 2 38 59

62. 100 92. 68.6 74. 73. 80. 81.3 76. 65.
2 JQ413415.1_Gobiocypris_rarus_dmrt1__dmrt1__mRNA__complete_cds Gr
80 .00 56 6 10 61 88 0 70 65

AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab- 62. 92. 100 69.2 74. 72. 81. 80.8 77. 65.
3 Gc
3_related_transcription_factor_1__complete_cds 80 56 .00 0 21 89 99 6 96 34

KX987992.1_Anguilla_japonica_double-sex_and_mab- 65. 68. 69. 100. 72. 72. 71. 71.9 69. 69.
4 Aj
3_related_transcription_factor_1__Dmrt1__mRNA__partial_cds 38 66 20 00 13 86 77 5 22 03

KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1- 64. 74. 74. 72.1 100 92. 80. 77.2 80. 66.
5 Ca
2__Dmrt1-2__mRNA__complete_cds 30 10 21 3 .00 00 58 8 19 59

KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2__Dmrt1- 64. 73. 72. 72.8 92. 100 81. 78.3 80. 67.
6 Cc
2__mRNA__complete_cds 30 61 89 6 00 .00 86 6 52 06

64. 80. 81. 71.7 80. 81. 100 91.4 76. 74.
7 MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA__complete_cds Ci
52 88 99 7 58 86 .00 6 28 72

KF713505.1_Megalobrama_amblycephala_dsx_and_mab- Me 64. 81. 80. 71.9 77. 78. 91. 100. 80. 67.
8
3_related_transcription_factor_1__Dmrt1__mRNA__complete_cds a 52 30 86 5 28 36 46 00 05 01

65. 76. 77. 69.2 80. 80. 76. 80.0 100 98.
9 KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA__complete_cds Ma
38 70 96 2 19 52 28 5 .00 82

65. 65. 65. 69.0 66. 67. 74. 67.0 98. 100
10 KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds Pd
59 65 34 3 59 06 72 1 82 .00

Penggunaan tabel matriks ini akan memudahkan identifikasi persentase kemiripan


ciri genetik antar spesies. Berdasarkan tabel tersebut, dapat diketahui bahwa
persentase kemiripan gen DMRT1 antar spesies tertinggi ditemukan pada spesies
Gnathopogon caerulescens dan Gobiocypris rarus, dengan nilai sebesar 92,56%.
Hal ini menunjukkan terdapat banyak kemiripan dalam susunan nukleotida
pengkode gen DMRT1 pada kedua spesies tersebut. Adapun, nilai persentase
kemiripan terendah terlihat pada spesies Tetraodon nigriviridis dan Gobiocypris
rarus, dengan persentase kemiripan sebesar 62,80%.
1.2. Phylogenetic Tree
Filogenetik merupakan sebuah cabang ilmu yang mempelajari mengenai
bagaimana keterhubungan organisme satu dengan yang lainnya dilihat dari sifat
yang diturunkan pada organisme pada generasi selanjutnya (Mirabella, 2012).
Berikut ini merupakan pohon filogenetik yang menggambarkan hubungan
kekerabatan antara 10 spesies ikan, yang diolah dari sekuen nukleotida hasil
penyelarasan sekuen (MSA).

Gambar 1. Pohon filogenetik nukleotida


Berdasarkan hasil yang diperoleh, dapat diketahui bahwa spesies Gobiocypris
rarus dan Gnathopogon caerulescens memiliki kekerabatan terdekat secara
filogenetik, dilihat dari ruas percabangan dimana kedua spesies tersebut berada
pada ranting yang sama (memiliki karakter monofiletik yang sama), dengan nilai
kekerabatan sebesar 1. Kelompok spesies yang memiliki karakteristik serupa juga
terlihat antara Megalobrama ambycephala dengan Chanodichthys illishaeformis
dengan nilai kekerabatan mencapai 0,97. Antara kelompok spesies Gobiocypris
rarus dan Gnathopogon caerulescens dengan Megalobrama ambycephala dan
Chanodichthys illishaeformis, terletak pada dahan yang sama dengan nilai
kekerabatan mencapai 0,9. Kedua kelompok spesies ini memiliki hubungan
kekerabatan dengan kelompok ikan air tawar Carassius auratus dan Cyprinus
carpio (monofiletik dengan nilai 0,96), dengan nilai kekerabatan antara 3
kelompok spesies ini sebesar 0,82. Selanjutnya, spesies Misgurmus
angullicaudatus yang memiliki kesamaan monofiletik sebesar 0.99 dengan
Paramisgurmus dabryanus, terletak pada dahan yang berbeda dengan 3 kelompok
spesies sebelumnya. Spesies Anguilla japonica, memiliki kedekatan dengan 4
kelompok spesies sebelumnya namun terletak pada dahan berbeda dengan nilai
kekerabatan mencapai 0,94. Adapun, spesies Tetraodon nigriviridis memiliki
perbedaan diantara spesies lain, dimana spesies ini terletak di dahan terluar pada
pohon filogenetik.
1.3. Desain Primer
Tabel 2. Desain Primer gen DMRT1 hasil pengolahan program Oligoanalyzer
(sekuen nukleotida/protein)

Panjang Tm GC Self- Hetero-


Primer Sekuen Hairpin
Produk (oC) (%) dimer dimer

ΔG = 1.52
Tm = -8.8

DMRT1
5'- AGA ATG
Tetraodon ΔG = - ΔG = -
AAC CTG GAG 20 56.3 50
nigriviridis 3.61 6.68
CCG AA -3'
(Left Primer)

ΔG = 1.86
Tm = -17.4

ΔG = 1.95
Tm = -27.6

DMRT1
5'- GTT GCT
Tetraodon ΔG = - ΔG = -
GTA GTA GGA 20 56.5 55
nigriviridis 3.61 6.68
CGG GT -3
(Right Primer)
ΔG = 0.26
Tm = 20.9
ΔG = 0.39
Tm = 20.8

ΔG = 1.1
Tm = 5.2

Tabel 3. Desain Primer gen DMRT1 hasil pengolahan program Oligoanalyzer


(sekuen nukleotida hasil MSA)

Panjang Tm GC Self- Hetero-


Primer Sekuen Hairpin
Produk (oC) (%) dimer dimer
DMRT1
Tetraodon
nigriviridis
(Left Primer)

5'- GAG ACA ΔG = -0.06


Tm = 25.7 ΔG = - ΔG = -
GCA GGC TCA 19 63.2 57.5
4.74 6.69
GGA G -3'

ΔG = 0.24
Tm = 21.2
ΔG = 0.85
Tm = 5.4
DMRT1
Tetraodon
nigriviridis
(Right
Primer)

ΔG = 0.39
Tm = 18.8

5'- GTG TGG


ΔG = - ΔG = -
GCT GGT AGA 19 57.9 56.9
3.61 6.68
GGT T -3'

ΔG = 0.45
Tm = 15.1

ΔG = 0.77
Tm = 8.1
ΔG = 1.11
Tm = -14.3

Primer yang diperoleh pada dua tabel diatas, berasal dari hasil pengolahan
dengan fitur FASTA dari kode protein, dan primer yang diperoleh dari hasil
penyelarasan dengan teknik MSA. Kedua pasang primer tersebut sekuennya
terlebih dahulu diperoleh menggunakan program Primer , yang selanjutnya diolah
untuk dianalisis dalam program Oligoanalyzer untuk dicari nilai GC content,
melting temperature, juga mengetahui bentuk-bentuk dan sifat dari molekul self-
dimer, hetero-dimer maupun hairpin beserta nilai ΔG dan melting temperature
setiap monomer tersebut . Primer yang dihasilkan (Primer gen DMRT1)
merupakan set primer spesifik yang akan menginisiasi amplifikasi dari gen
Doublesex mab-3 related transcription factor.
DAFTAR PUSTAKA

Daugelaite, J., Aisling O. D., Roy D. S., 2013. An Overview of Multiple


Sequence Alignments and Cloud Computing in Bioinformatics. ISRN
Biomathematics 10 (11) : 1-2.

Hidayat, T., Adi P., 2006. Sistematika dan Filogenetika Molekuler.


http://file.upi.edu/jurn.pend._biologi/. Diakses pada6 Desember 2018.

https://www.ebi.ac.uk/Tools/msa/clustalo/

Koressaar T and Remm M. Enhancements and modifications of primer design


program Primer3. Bioinformatics 23(10):1289-91.

Mirabella, F. M., 2012. Pendekatan Pohon dalam Filogenetik. Diskrit : Bandung.

Untergasser A, Cutcutache I, Koressaar T, Ye J, Faircloth BC, Remm M and


Rozen SG. Primer3--new capabilities and interfaces. Nucleic Acids Res.
2012 Aug 1;40(15): 115.
LAMPIRAN

Lampiran 1. Sekuen nukleotida gen DMRT1


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds TAAGGTCTGGTCAACTAACTACATTTTGTTGTTCTGTAAACAACATAAATTATTTGCTTA 60
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds TTACCACTTACATTTTTTACAACTTTGTGATAGGCTTACCTAAACAAACTGGCTGAAGCC 120
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds CATATAAATCTAAATGTAACCATGCTTTAAAACGCCATCCTCGCATGTTTTGTGTCTTAT 180
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GATCTATGAATTCATGAGACACATGGGGAGTCACTTTGCTTCCAGTGGGAAGAAACTGAA 240
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------------------ 0
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds CATCAGCTCCCACGCGCGCTGGAACGCACAGGTTGCTCGCGCCAAATATTTGCCTATTGT 300
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 0

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ------------------------------------------------------------ 0
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds -----------------------------------ATATTCTAAAGCAGAGGAACCGGCT 25
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------------------------GACATATTCTAA 12
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ATCAAACCTCAGACCCCCCTCCTTATAAAAGTTTTATAATCCGCGGTCGTGTCATATTCG 360
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 0
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds -------------------------------------------------GAATATAAGCT 11

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 0
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds --------------------------GGGGATTAAGCATGTGGGAGGAAGAGCAGAGTAA 34
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ---------------------------------------------------GCAGAGTAA 9
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 0
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATCATCATCATCATCATCATCATCATCACCTGTCGGCATGAGTGAGGAGGAGCAGAGTAA 85
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCAGAAGGACCGGCCATCATCATCATCACCTGTCGGCATGAGTGAGGAAGAGCAGAGTAA 72
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds AAGCAGAAGAGGCCGACCGTCATCACCACCTGTAGGCATGAGTGAGGAAGAGCAGAGTAA 420
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds --GGAGAAGAGGCTGACCGTCATCACCACCTGTAGGCATGAGTGAGGAAGAGCAGAGTAA 58
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------ACTGTCTTCTGTCATAATGAGTGAGGAAGAGAGTAA 36
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TTCCAGCTTTCCACAGAGTTCATCACTGTCTGCTATCATAATGAGTGAGGAAGAGAGTAA 71

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ----------------------------------------------CGCTGCAGGAACCA 14
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CGGCTCGCTGTCAGTCAGGAAACCGTCCCGTATGCCCAAGTGCTCGCGCTGCAGGAACCA 94
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CGGCTCGCTGTCAGTCAGGAAACCGTCCCGTATGCCCAAGTGCTCGCGCTGCAGGAACCA 69
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds -------------------AAACCGTCTCGTATGCCGAAGTGTTCCCGTTGCAGAAACCA 41
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CGGCTCGCTGTCGGTCAGGAAGCCGTCCCGCATGCCCAAGTGCTCGCGCTGCAGGAACCA 145
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CGGCTCGCTGTCTGTCAGGAAGCCGTCCCGCATGCCCAAGTGCTCGCGCTGCAGGAACCA 132
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds CGGCTCGCTGTCCGTCAGGAAACCGTCCCGTATGCCCAAGTGCTCGCGCTGCAGAAACCA 480
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CGGCTCGCTGTCCGTCAGGAAACCGTCCCGTATGCCCAAGTGCTCGCGCTGCAGAAACCA 118
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds CGGCTCCCGGACGGTCAGGAAAGTGGCTCGGATGCCCAAGTGTTCCCGCTGCAGGAATCA 96
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CGGCTCCTTGACGGTCAGGAAAGTGGCTCGGATGCCCAAGTGCGCCCGCTGCAGGAATCA 131
** ***** ** **

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 CGGTTTTGTATCTACCCTGAAGGGACACAAGCGCTT----CTGCAGCTGGAGGGACTGTC 70
JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CGGCATCGTGTCTCCACTAAAGGGCCACAAACGCTT----CTGCAACTGGAGGGAATGTC 150
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CGGCATCGTGTCTCCACTAAAGGGCCACAAACGCTTCTTTCTGCAACTGGAGGGAATGTC 129
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds TGGTTATGTGTCACCTTTGAAGGGACATAAACGATT----TTGTAACTGGAGGGATTGTC 97
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CGGCTTCGTGTCGCCGCTGAAGGGCCACAAACGCTT----CTGTAGCTGGAGAGACTGCC 201
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CGGCTTCGTGTCGCCGCTGAAGGGCCACAAACGCTT----CTGCAACTGGAGGGACTGCC 188
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds CGGATTCGTGTCTCCGCTGAAGGGCCACAAACGCTT----CTGCAACTGGAGGGACTGCC 536
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CGGATTCGTGTCTCCGCTGAAGGGCCACAAACGCTT----CTGCAACTGGAGGGACTGCC 174
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds CGGGTTCGTGTCGCCGCTGAAGGGACACAAGCGCTT----CTGTAATTGGAAGGATTGCC 152
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CGGGTTCGTGTCGCCGCTGAAGGGACACAAGCGCTT----CTGTAATTGGAAGGATTGCC 187
** ** ** * * ***** ** ** ** ** ** * **** ** ** *

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 AGTGTCCCAAATGTAAACTCATAGTGGAGAGACAGAGAGTCATGGCGGCTCAGGTTGCCC 130


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds AGTGCCAGAAATGTCGACTAATCGCTGAAAGACAGCGGGTCATGGCAGCCCAGGTGGCGT 210
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds AGTGCCAGAAATGCCGACTAATTGCTGAAAGACAGCGGGTCATGGCAGCCCAGGTGGCCT 189
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds TATGTCAGAAATGCAAATTGATCGCAGAACGGCAGAGGGTGATGGCGGCCCAGGTGGCAC 157
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AGTGTCAGAAATGCAGACTGATCGCTGAACGACAGAGGGTCATGGCAGCCCAGGTGGCGT 261
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AGTGTCAGAAATGCAGGCTGATCGCTGAACGACAGAGGGTCATGGCAGCCCAGGTGGCGT 248
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds AGTGTCAGAAATGCAGACTAATCGCTGAAAGACAGCGGGTCATGGCAGCCCAGGTGGCCT 596
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds AGTGTCAGAAATGCAGACTAATCGCTGAAAGACAGCGGGTCATGGCAGCCCAGGTGGCCT 234
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds AGTGTCAGAAATGTAGACTTATTGCGGAAAGACAGCGGGTCATGGCTGCCCAGGTGGCTT 212
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds AGTGTCAGAAATGTAGACTTATTGCGGAAAGACAGCGGGTCATGGCTGCCCAGGTGGCTT 247
** * ***** * ** * ** * *** * ** ***** ** ***** **

Left Primer : GAGACAGCAGGCTCAGGAG AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 TGCGGAGACAGCAGGCTCAGGAGGAGGAGCTGGGCATTTGGAGTCTGGGTCCTCTCCCTG 190


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATTTGCTGTCCGGTTAACCTGTCCT 270
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATTTGCTGTCCGGTTAACCTGTCCT 249
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds TCCGCAGACAGCAGGCCCAAGAGGAGGAGATGGGCATCTGCAGTCCAGTCACCTTGTCCA 217
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGCTGGGTATTTGCAGTCCGGTTAACCTGTCCG 321
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGCTGGGCATTTGCAGTCCGGTTAACCTGTCCG 308
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAAATGGGCATTTGCAGTCCGGTTAACCTGTCCG 656
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TACGGAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATTTGCAGTCCGGTTAACCTGTCCG 294
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds TACGAAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATCTGCAATCCTGTTAACCTGTCTG 272
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TACGAAGGCAGCAGGCCCAGGAGGAAGAGATGGGCATCTGCAATCCTGTTAACCTGTCTG 307
* ** ** ******** ** ***** ** **** ** ** ** * * *

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 GGGCCGGGGTGATGGTGAAGAATGAACCTGGAGCCGAATGTTGTTTCACGGTGGAAGGAC 250


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GTTCAGACAGTCTTGTGAAGAACGAGGTCATGGGTGATGTGAATGTGTTTACTATCAGCT 330
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GTTCAGACAGTCTGGTGAAGAACGAGGTCATGGGTGACGTGAATGTGTTTACTATCAGCT 309
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds GCACGGAGGTCATGGTGAAGAATGAAGCCACAGGTGACAGGGCTTGCTTCTTCTCCGCAG 277
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTTCAGACACTCTGGTGAAAAACGAGGCCGTCGGTGATAATGTGTTTACTATCATCCCAG 381
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTTCAGACACCCTGGTGAAAAACGAGGCCGTCGGTGATAATGTGTTTACTATCATCTCAG 368
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GTTCAGACACTCTGGTGAAGAACGAGGTCGTGGGTGACCATGTGTTTACCATCAGCTCAG 716
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GTTCAGACACTCTGGTGAAGAACGAGGTCGTGGGTGACCATGTGTTTACCATCAGCTCAG 354
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GTTCTGACCCTCTGGTAAAGAACGAGCCAGTAGTTGATTATGTGTTTACTGTGGGCACAA 332
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GTTCTGACCCTCTGGTAAAGAACGAGCCAGTAGTTGATTATGTGTTTACTGTGGGCACAA 367
* * * * ** ** ** ** * **

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 GAAGCCAGACAT---------CTACCAGTGGACCCTCTTCTGCTGTGGCCACAGCGAGCC 301


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CCAGACCGCCATCACCCACCGCAAGCAGTGCCACCGCCTCTCCCACCAACCTAGAGAGCC 390
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CCAGACCGCCATCACCCACCGCGAGCAGTGCCACCGCCTCTCCCACCAACCTAGAGAGCC 369
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds GGGAAAAGTCTCCCCCTCTCCAAAACAACGAAGCCACATCACCCTCTGCTACAGGGAACC 337
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GGCCGCCATCACCCA---GCACCAGCAGTGCCACCGCCTCTCCCACCAACCTAGGGAATC 438
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GGCCGCCATCGCCCA---CCACCAGCAGTGCGACCGCGTCTCCCACCAACCTAGGGAATC 425
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GACCGCCATCACCCA---CCACCAGCAGCGCTACCGCCTCTCCCACTAACATAGAGAGCC 773
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GACCGCCATCACCCA---CCACCAGCAGCGCTACCGCCTCTCCCACTAACATAGAGAGCC 411
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GAGCTTCATCACCCA---CCACCACGAGTGCTCCCTCATCCCCCACTGTCCCAGGGAGTC 389
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GAGCTTCATCACCCA---CCACCACGAGTGCTCCCTCATCCCCCACTGTCCCAGGGAGTC 424
* * * * ** * ** * ** ** *

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 GCACAGTGCCATCATCCCAACCATCAGCTGGTGCTCGGGCTCATCATGATGGACAGTCAG 361


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GTTCCATGCTAGCTCTAAGCTCTGCAGTGACCAGCAGAGGGCACACTGAGGGCCCATCTG 450
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GTTCCATGCTGGCTCTAAGCTCTGCAGTGACCAGCAGAGGGCACACTGAGGGCCCATCTG 429
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds GACCCGCCATGCCGTCCAGTCCCACGTCGGCCAGCAGGGGGCACCCTGAGGGTTCATCTG 397
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCTCCATGCTGGCTCTAAGTCCTGCGGCGACCAGCAGAGGGCACACTGAGGGCACGTCTG 498
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTTCCATGCTGGCTTTAAGTCCTGCGGCGACCAGCAGAGGGCACACTGAGGGCACGTCTG 485
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GTTCCATGCTGGCTCTAAGCTCTGGAATGACCAGCAGAGGGCACACTGAGGGCCCATCTG 833
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GTTCCATGCTGGCTCTAAGCTCTGGAATGACCAGCAGAGGGCACACTGAGGGCCCATCTG 471
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GTTCCATGCTTGCTGTAAGCCCTGCAGCGACCAGCAGAGGGCACACTGAAGGCACATCTG 449
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GTTCCATGCTTGCTGTAAGCCCTGCAGCGACCAGCAGAGGGCACACTGAAGGCACATCTG 484
* * * * * * ** *** ** ** *

Right Primer : GTGTGGGCTGGTAGAGGTT AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ACCTGCTGCTGGAAAGCTCTTTTTACCACTTTTACCAGCCGTCGTGCTACCCGTCCTACT 421


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds AGCTGATGGTGGATGCCTCCTATTATAACCTCTACCAGCCCACACCGTACACCTCCTACT 510
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds AGCTGATGGTGGATGCCTCCTATTATAACCTCTACCAGCCCACACCGTACACCTCCTACT 489
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ATCTGGTGGTGGATGCATCCTACTACAACTTCTACCAGCCCTCCCGCTACCCTGCCTACT 457
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ACCTGATGGTGGACGCCTCCTATTACAACCTCTACCAGCCCACACCATACTCCTCCTACT 558
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ACCTGATGGTGGATGCCTCCTATTACAACCTCTACCAGCCCACACCATACTCATCCTACT 545
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds AACTGATGGTGGATGCCTCCTATTACAACCTCTACCAGCCCACACCGTACACGTCCTACT 893
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds AACTGATGGTGGATGCCTCCTATTACAACCTCTACCAGCCCACACCGTACACGTCCTACT 531
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ACCTGATGGTTGGTCCGACCTATTACAACCTGTACCAGCCCTCACGCTACTCCTCCTACT 509
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ACCTGATGGTTGATCCGACCTATTACAACCTGTACCAGCCCTCACGCTACTCCTCCTACT 544
* *** ** * * * * ** ** * ******** * *** * ******

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ACAGCAACCTGTACAACTACCAGCAGTACCGGATGCACTCCTAC---------------- 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ATAGCAACCTGTACAACTATCAGCAATACCAGATGCCCAGTGGAAATGGCCGCCTTTCCA 570
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATAGCAACCTGTACAACTATCAGCAATACCAGATGCCCAGTGGAAATGGCCGCCTGTCCA 549
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ACAGCAACCTGTACAACTACCAGCAGTACCAGATGCCCAGCAACGAGGGTCGCCTGTCTG 517
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATAGCAACCTGTACAACTACCAGCAATACCAGATGCCTAGTGGAAATGGTCGCCTGTCCA 618
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATAGCAACCTGTACAACTACCAGCAATACCAGATGCCTAGTGGAAATGGTCGCCTGTCCA 605
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ATAGCAACCTGTACAACTACCAGCAATACCAGATGCCCAGTGGAAATGGCCGCCTGTCCA 953
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ATAGCAACTTGTACAACTACCAGCAATACCAGATGCCCAGTGGAAATGGCCGCCTGTCCA 591
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ACAGCAATCTGTACAACTATCAGCAATACCAGATGCCTACTGGAGACAGCCGCCTGTCCA 569
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ACAGCAATCTGTACAACTATCAGCAATACCAGATGCCTACTGGAGACAGCCGCCTGTCCA 604
* ***** ********** ***** **** *****

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GCCATAACGTTCCCCCCCAGTACCTCACACACTCCTACTATTCATCTTACCTGAGTCAGG 630
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GCCATAACGTCCCCCCCCAGTACCTCACACACTCCTACTATTCATCTTACCTGAGTCAGG 609
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds GCCACAGCGTGTCCCCGCAGTACCGCACGCATTCA------------------------- 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCCATAACGTGTCCCCCCAGTACCGCACACACTCCTACTATTCCTCTTACCTGAGTCAGG 678
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCCATAACGTGTCCCCCCAGTACCGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 665
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GCCATAATGTGCCCCCTCCGTACCGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 1013
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GCCATAATGTGCCCCCTCAGTACCGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 651
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GCCATAACGTGTCGCCCCAGTATTGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 629
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GCCATAACGTGTCGCCCCAGTATTGCACACACTCCTACTATTCATCTTACCTGAGTCAGG 664

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GGATCGACACT---------GTCCCACCCAGCACCTGCCCTGAGCCCAAAGCATCAGCTT 681
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GGATCGACACT---------GTCCCACCCAGTACCTGCCCTGAGCCCAAAGCATCAGCTT 660
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GGCTCGGCACGACTGCATGTGTGCCCCCCAGCACCTGCCCTGAACCCAAAGCAGCAGCTT 738
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GGCTCGGCACGGCTGCATGTGTGCCACCCAGCACCTGCCCTGAACCCAAAGCAGCAGCTT 725
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GGATCGACACGGCTGCATGTGTCCCACCCAGCACCTGCTCTGAGCCCAAAGCAGCAGGTG 1073
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GGATCGACACGGCTGCATGTGTCCCACCCAGCACCTGCTCTGAGCCCAAAGCAGCAGCTT 711
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GGCTCGGCACGGCCGCCTGTGTCCCACCCAGTACCTGCCCTGAGCCCAAAGCAGCAGCTT 689
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GGCTCGGCACGGCCGCCTGTGTCCCACCCAGTACCTGCCCTGAGCCCAAAGCAGCAGCTT 724

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ACTCCAATGGAGCTCAAGACTCAGTGTCCATCAGCTCAATGATC-----AACACTGAGAA 736
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ACTCCAATGGAGCTCAAGACTCAGTGTCCATCAGCTCAATGATC-----AACACTGAGAA 715
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TCTCTGATGGAGCTCAAGACTCTGTGTCCATCAGCTCGATGATC-----AACACTGAGAA 793
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TCTCCGATGGAGCTCAAGACTCGGTTTCCATCAGCTCGATGATC-----AACACTGAGAA 780
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds GCATTTCCTCCAGCGTGATCCTCTGCCAGCCTCTCCCTCCCCCACTCCATCATCTGGCAA 1133
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ACTCCAGTGGAGCTCAAGATTCCATC------AGCTCAATGATC-----AACACTGAGAA 760
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds TCTCTGATGGAGCACAAGACTCAAGTTTGAACACGCTGACCATC-----AGCACTGAGAA 744
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TCTCTGATGGAGCACAAGACTCAAGTTTGAACACGCTGACCATC-----AGCACTGAGAA 779

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CAGGCTGGAGTGTGAGAGCAGCTCCGAGTCCGGAACCTTCTCCGTCGACTCCGTCATAGA 796
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CAGGCTGGAGTGTGAGAGCAGCTCCGAGTCCGGAACCTTCTCCGTCGACTCCGTCATAGA 775
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CCGGCTGGAGTGTGAGAGCAGCTCAGAGTCTGGAACCTTCTCCATCAACTCCATCGTTGA 853
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGGCTGGAGTGTGAGAGCAGCTCAGAGTCTGGAACCTTCTCCATCAACTCCATCGTTGA 840
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds TGGACTAGACT--GGACGTTACTGAGGTTACCTGAGAT---------------------- 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CAAGCTTGAGTGTGAGAGCAGCTCAGAATCTGGAACCTTCTCCGTGGACTCCGTCATAGA 820
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds CAGACTGGAGTGTGAAAGCAGCTCAGAGTCTGGCACCTTTTCTGTGGAGTCCATCATAGA 804
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CAGACTGGAGTGTGAAAGCAGCTCAGAGTCTGGCACCTTTTCTGTGGAGTCCATCATAGA 839

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TGGGGCAACCAAATAAAACACCCTCACCTGCACCAACAACTTGATTTTTTTCTTTTGTTA 856
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TGGGGCAACCAAATAAAACACCCTCACCTGCACCGACAACTTGATTTTTTTCCTTTGTTA 835
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TGGGGTAACCAAATAAAAAACCCTCACCTGCACCAATCTCACATTTAATTGAATTGTTT- 912
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TGGGGTAACCAAATAAAA-AACCTCACCTGCACCAATCTCCCATCTAATTGAATTGTTG- 898
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GGGGGCGACCAAATAAAACACCCTCACCTGCACCAATCTCTCATTTTTCTGTTGAGTTG- 879
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds GGGAGCGACTAAATAAAAGCTTACAACACCCCCCAAAAAAAAAA---------------- 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GGGAGCGACTAAATAAAAGCTTACAACACCCCCCAACAACAACAGCTTGAATCTTACC-- 897

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TTTGAGTTGTTTCTGTAATTTTCAACTAAAAATGTAATGATTCTGTAACCAAATCCTGCC 916
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTTGAGTTGTTTCTGTAATTTTCAACTAAAAATGTAATGATTCTGTAACCAAATCCTGCC 895
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------CTGTATTTTCAACTTATTTTTCACCTTATTGTTC-------------- 946
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------CTGTATTTTCAACTTATTTTTCATCTTATTGTTC-------------- 932
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ---------TTTCTGTAACTTTTAACTAAATGTGTAATGATTCTGTAACCAAATCCTACC 930
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ----------TTCTCAAATTGAGGTGTTTTCACCCAGTGATTCTGGTAAAAAGTTGTAAA 947

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TTATTGTTCAA--AATGTTGTTGTTGATACTGATCAGGTTGATCAATGTAGTGTTGTAAA 974
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTATTGTTCAAA-AATGTTGTTGTTGATACTGATCAGGTTGATCAATGTAGTGTTGTTAA 954
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ---------AA--CATTGTGTAGTTAACACTGATCAGGTTGACTGTTGTGGTGTTTTTCA 995
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ---------AA--TATTGTGTAGTTAACACTGATCAGGTTGACTATTGTGGTGTTTTTCA 981
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TTATTGTTCGGCATTTTTTGTAGTTAATACTGATCAGGTTGATC---------------- 974
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TCGTTG---AGCAT--TTAGTTGGTAACACTAATCAATGTATTA---------------C 987

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ACTTTGGAGGGGTAATTCTTTACGCTTTTATAGACATTG--------------CTTTTGT 1020
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ACTTTGG---GGTAATTCTTTACATTTTTATAGACATTG--------------CTTTTGT 997
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ACTTTTTTAGGGATTCTATAA-GGTTT-----------GGGT------------ATTATT 1031
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AGTTTTTAGGGGATTCTATAA-GATTTTCATAGACATTGGTT------------ATAATT 1028
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds -------AATGTGGTGTTATG-CAGCTTTGTAGTGGTAATTCTTTTAA-GATGTAATCTA 1025
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CTTTTGCATGGGGTTCTTAAA-GATTTTTATAGAAATGAGTTGTTTTAGGGAAATTTCTC 1046

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ATTAATCAGTTTCTCAGTGATGATCAGAA--------ATGCCCTTTTACTATGTTTCATA 1072
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATTAATCAGTTTCTCAGTGATGATCAAAA--------ATGCCCTTTTACTATGTTTCATA 1049
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TGCTCTTAGTTTCTCGATGATGATCAGAAATGCAGTTTACATAGATTGCCATGTTTTATA 1091
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACTTTTAGTTTCTCAGTGATTATCACAAATGCAGTTTATATAGATTGCTATGTTTCATA 1088
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds A-------GTTTCTCACTGATTATCAGAAATGCAGTTTACATAGT---TTTTGTTTCATA 1075
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds AATGAGCCTGTACACTGTAATGATGAGATATTCAGTCTATATAGT---TCATTTGCGATG 1103

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CAGTTGGATAGCTTCAGTTTGTTCACTTTGATGCTGCAGTTTTTAAAGACTAAAATGATT 1132
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CAGTTGGATAGCTTTAGTTTGTTCACTTTGATGCTGCAGTTTTTAAAGACTAAAATGATT 1109
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGTTTGATAGCTTCAGTTTGTTTACTTTGATACTGCAGTTGTTAAAGATTAAAATGAGT 1151
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAATTTGATAGCTTCAGTTTGTTTACTTTGATACTGCAGTTTTTAAAGATTAGAATGAGT 1148
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CAGTTTGATAGCTTCAGTTTGTTCACTTTGCTGCTGCAGTTTTTAAAGACTAAATTGATT 1135
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TATTGTAAAACGTTTCAT-----------------ACTGTTT----AATTAAGTTTGATT 1142

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CACTTTCACTTTCTAGCAGAACACCATTGAAAGAAATGGCAGAGCAGAACGATTTATTGT 1192
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CACTTTCACTTTCTAGCAGAACACCATTGAAAGAAATGGCAGAGCAGAACGATTTATTGT 1169
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CACTTC-ACTCCATAT----ACTATAGTGAAAGAAATGGCAGAGCACAACGATTTACTGC 1206
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CACTTCCATTCCATAT----ACTATAGTGAAAGAAATGGCAGAGCACAACGATTTATTGC 1204
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CACTTT------CCAG----CAGCTATTGAAAGAAATGGCAGAGCAGAACGATTTATTGT 1185
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CTTCTG------ATA------AAAACGTGAGACAAATCA--A-ACCATACAAACACAACT 1187

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CACACATCCGTTCATGCTCTAAATTACTGTCATTGGCCTAATAGATAATCTAACTTCCTT 1252
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CACATATCTGTTCATGCTCAATATTGCTGTCATTGGTCTAATAGATAATCTAACTTCCTT 1229
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CACATATCAGTTGAAGCTCAGTATTGCTGTCATTGGCCTAATGAATAAGCTAACTTCTTT 1266
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CATATATTTGTTGAAGCTCAGTATTGCTGTCATTGGCCTAATGGATAAGCTAACTTCTTT 1264
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CACGTATCGGTTCAAGCTCAATATCGCTGTCATTGGCCTAATGGATAATCTAACTTGTTT 1245
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TCAGCAGTGCAGACAGCTTAGTAGTGCTGTCACTGGTCTAATGGATAATCTAACTTCTTT 1247

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TCCATGACCTTCATGCTGCAGACTATATAGGGGCTTCTCCAGCATC-------------- 1298
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TCCATGACCTTCATGCTGCAGACTATATAGGGGCTTCTCCAGCGTC-------------- 1275
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CCA-TGACCTTCAAGACACAAAGTATATGAGCTCTTCTCCAGCATCTCTA---------T 1316
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CCA-TGACCCTCAAGACGCAAAGTATATGAGCTCTTCTCCAGCATCTCTA---------C 1314
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CCA-TGACCTTCATGCTGCAGACTCTATGAGGGCTTCTCCA-------------GCATCT 1291
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CTA-CGACCTTCATGATCAGAGCTTCTCAGGAATCATCACAGACTTGTGCTGTAAGCTGT 1306

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds -----TCCATAGTGTTGTGCGGGACAGTTGGGTCAGAAGAGATACTATTAAATTATGCTT 1353
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds -----TCCATAGTGTTGTGCGGGACATTTGGGTCAGAAGAGATACTATTAAATTATGCTT 1330
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ACTGTTGTGTTGTAGGCTGTGGGACATTTGGGTTTGAAGAGATACTATTAAATTATGCTT 1376
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AGTGTTGTGTTGTAGGCTGTGGGACAGTTGGGTTAGAAGAGATACTATTAAATTATGCTT 1374
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CCACAGTGTC------GTGCGGGACAGTTGGGTTAGAAGAGATACTATTAAATTATGCTT 1345
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GCAGAGGAGGGTGGGGTTAGTATGCAGGTAGAGAGGAAGAGATACTATTAAATTATGC-- 1364

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CAATCTCACAGCGAACGGCTTGTTTATTTATGGCCATCACTAAAGGACATCATTTAACTT 1413
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CAATCTCACAGCGAACGGCTTGTTTATTTATGGCCATCACTAAAGGACATCATTTAACTT 1390
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAATCTCACAGTGAACGGCTTATTTATTTATGGCCATCACTAAAGGACATCATTTAACTT 1436
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAATCTCACAGTGAACGGCTTATTTATTTATGGCCATCACTAAAGGACATCATTTAACTT 1434
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CAATCTCACAGCGAACGGCTTGTTTATTTATGGCCATCGCTAAAGGACATCATTTAACTT 1405
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds -----CTCAATCTCACAGCTTGTTTATTTATGGCCATCGCCAAAGGACATCATTTAACTT 1419

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TTGATGATTTGCATCAACCCTGTTCCTGTGCATGATCCAGCTAATGTGCAGTGCTCTTCT 1473
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTGATGATTTGCATCAACCCTGTTCCTGTGCATGATCCAGCTAATGTGCAGTGCTCTTCT 1450
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TTGATGATTTGCATCAACCCTGTTCCTATGCATGATCCAGCTAATGTTCAGTGCTCTTCC 1496
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CTGATGATTTGCATCTACCCTGTTCCTATGCATGATCCGGCTAATGTTCAGTACTCTTCC 1494
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TTGATGATTTGCATCAACCCTGTTCCTGTGCACGATCCAGCTAATGTGCAGTGCTCTTCT 1465
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TTGATGATTTGCATCCACCCTGTTCCTACCCATGATCCAGCTAATATGCTGCACTGTTCT 1479

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GAGCTTTCTT-TGTATAATGTGAAGCTCTGCCCTTGATTTTAATGGTCTT---GGCACAG 1529
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GAGCTTTCTT-TGTATAATGTGAAGCTCTGCCCTTGATTTTAATGGTCTT---GGCACAG 1506
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GCATTTTCTT-TGTATAATATGAAGCTGTGCCCTTGATTTTAATGGTGTTGTTGGCACAG 1555
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTATTTTCTT-TGTATAATATGAAGCTGTGCCCTTGATTTTAATGGTG---TTGGCACAG 1550
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GAGCTTTCTT-TGTATAATATGAAGCTGTGCCCTTGATTTTAATGGTGTT---GGCACAG 1521
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GAGCTTTCTCTTGTGTAATGTCAAGCTGTGCCCTTGATTTTAATAGTGTT---TGCACAG 1536

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ATAGTGTCCTCAGTCAAGTCACAAACAGAGGAGAAAAGGGACACAAAACTTCGCCTTACA 1589
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATAGTGTCCTCAGTCAAGTCACAAACAGAGGAGAAAAGGGACACAAAACTTCGCCTTACA 1566
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATAATGTCCTCAGTCAAGTCACGAATAAATGGTAAAGGAGAAGAGGGACACAAAACTTTC 1615
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATAGTGTCCTCAGTCAAGTCACGAATAAAAGGTAAAGGAGAAGAGGGACACAAAACTTTG 1610
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ATAGCGTCCTCAGTCAAGTCACAAACAGAGGAGAAGGGAAAGA--------CAAAACT-T 1572
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds GGACTGTCCTAAGGTCATGAATAAATCGTAAAAGAGGGGAAAC--------AAAACTTTT 1588

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GACATTTGTTATGACGGTACATTTAACTACAAATGATGTATCTTGATCTGAT------CT 1643
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GACGTTTGTTATGACGGTACATTTAACTACAAATGATGTATCTTGATCTGATTGAAATGA 1626
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds --T--TTCCTTGTAAGCTCAGTTTGTTGCAGAC------------AT-TTGTTATGACAG 1658
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TCT--TTCCTTTTAAGCTCAGTTTGTTGCAGAC------------AT-TTT---TGACAG 1652
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TCT--TTCCTTTTAGGTTATGTTAAATGTATTA------------GGCTGATTGAAATGA 1618
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ACT--GTCTGTTTAGCTTACTGTTCATTACAGA------------ATCTGTTTGTGACGC 1634

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GCCATGTGTTG---TTTAATCTGATTTTTAATTTTTTTATTATAGTGGCTGGCCCTTTAA 1700
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GCCATATGTTG---TTTAATCTGATTTTTAATTTTTTTATTATAGTGGCTGGCCCTTTAA 1683
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACATTTAACTAAAAATTAAACTATATTTCGT-TTTTTAGATCTGATAAAAACAAG-GCA 1716
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TACAGTTAACTAAAAATGAAACAATTTTTCAG-TTTTTAGATCTGATAAAAACGAG-CCA 1710
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds GCCATATGTTAATATGTAATCTGATTTTTACA-TTTTTATTATAGTGGATGGCGCTTTAT 1677
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TGCATTT--AAATGT-TAATGCCAATTAGTAG-TTTCTAGGGCATCTGATAGAAATTAGC 1690

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TATGCTTTGACAATCAGTATATCTTATTTACTTGTATACACCTCACTATTAATAGATAAC 1760
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TATGCTTCGACAATCAGTATATCTTATTTACTTGTGTACACCTCACTATTAATAGATAAC 1743
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTGTGATCTAT-------------------------------------TTTTTTACA--- 1736
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TATCCATGTTAAATGCATTTTTTTTCTAAGTGTGATCTGATTTTTACATTTTATTAT--- 1767
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds TATGCTTCGACAATCGGTATATCTTTTGCACT-TATTTACTTACTT-------------- 1722
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TTTATATGGT--ATGTGTTCATTTTTTAAAGATGATCTGATATGTT-------------- 1734

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TAGCAGAGAGGTGAATTAATTTTATTAGAATTTTTTCCTAAAAATGAATGTAAAATGTAA 1820
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TAGCAGAGACGTGAATTAATTTTATTAGAATTTTTTCCCAAAAATGAATGTAAAATGTAA 1803
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ----------TTTTATTGTTATTATTATTATATTATAGTCGATGGCCAATTAAAATGAAT 1786
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ----------TATTATTATTATTATTATTATAGTGGAGGGGCCAATTAAAATGAATCAAT 1817
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ---------------------------ATCTTGCAGAGA--CAAATTAATTTTGTTCT-- 1751
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ---------------------------TTATATTTTATG--GAATCATCTTTAATTGT-- 1763

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TTACCTTTATGCATTTCCATTTTGTGATTTTTGTACTATTTTGTTAG---ACTAACAGTT 1877
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTACCTTTATGCATTTCCATTTTGTGATTTTTGTATCATTTTGTTAG---ACTACAAATG 1860
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGTCTGAGGGCCATTTAATATGCTTGCATCTGT-ATTTCTTTTGCACTTACATAGAAGT 1845
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGTCTGAGGGCCATTTAATATGCTTACATCTGT-ATTTGTTTTGCACTTACATAGAAGT 1876
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ---AAAAACCAATGTAAAATGTCATTATTTTGATGCATTTTTGTGCAATGACTAACAGTT 1808
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ---CCTTTACATGTTTAAATTTTAA-----TATTAAGATTTTATACATTGAATACGCACT 1815

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CACGGTTTGATTAATTTGTTCATTTGTTTTCCAGAC----AAGTGCATTGTGGATGTGCT 1933
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATGTATCTTGATCTGATTGAAATGAGCCATATGTTGTTTAATCTGATTTTTAATTTTTTT 1920
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds TAGTAGT--AATAAGTAGCTAACTGAGACTT----------------------------- 1874
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CAGTATT--AATAAGTAGCTCACTGAGACTT----------------------------- 1905
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CACAGTTTGATTGATTTGTTCATTTGTTTTC----------------------------- 1839
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds TAAAAATAAAATAAATTACTAAA------------------------------------- 1838

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds CTTGTC--CTCTGACACCATGATGT--TACAAATATATTTGT--ATTAGTGTTATGATTA 1987
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATTATAGTGGCTGGCCCTTTAATATGCTTCGACAATCAGTATATCTTATTTACTTGTGTA 1980
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------AA----ATGAATAGCCTTTTTCT------A 1894
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ------------------------------AA----ATGAATAGCTTTTTTCT------A 1925
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------CA----GACG---TGTTAATTTA------C 1856
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------AA----GATT---TTTTCCTGTT------G 1855

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds TAAAGCAATGCAATTGTTAATTTGCAATCGTTGTGTGTTTATATGCTCTCATGTTCAGTG 2047
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CACCTCACTATTAATAGATAACTAGCAGAGACGTGAATT--------------------- 2019
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AAAATGAAT----GTAAA---------GAATGTGCGTACTGTATATTCTAATGTTAAACA 1941
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AAAATGAAT----GTAAAATGTTGTAAGAATGTGCATACTGTATGTTCTAATATTAAACA 1981
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds CCACTGTAT----TTTGCCGGTGGCGTGGATGTGCTCT---------------------- 1890
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds CTTATAAGC----TT------TTGAAACGCTGTTAATC---------------------- 1883

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds GAAATAAAATCATTATTGATGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA--------- 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds -----AATTTTATTAGAATTTTTTCCCAAAAATGAATGTAAAATGTAATTACCTTTATGC 2074
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTGATTTTGTG------CAATTTTGTTAGA--------CCAACAGTTCACAGTTTGATTC 1987
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds GTGATTTTATA------CAATTTTGTTAGA--------CCAACAGTTCACAGTTTGATTC 2027
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds -----------------------TGTCCT---------CCGACACCATAATG-------- 1910
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds -----------------------AGTTCA---------ACAAAAAAAAAAAA-------- 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATTTCCATTTTGTGATTTTTGTATCATTTTGTTAGACTAACAGTTCACGGTTTGAT-TCA 2133
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATTTGTTTT-CCAGAT-----------------------------GCTGGTTTTGTGTAT 2017
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATTTGTTAA-TTTGTTTTTT-------------C-------AGATGCTGGTTTTGTGTAA 2066
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 1910
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds TTTGTTCATTTATTTTCCAGACAAGTGCATTGTGGATGTGCTCTTGTCCTCTGACACCAT 2193
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds A----------------------------------------------------------- 2018
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AACTTTACTGTATTTT------------ACTCATGATGTGGTGA--GCTCTTGTTCACTG 2112
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 1910
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds GATGTTACAAATATTTGTATTAGTGTTATGATTATAAAGCAATGCAAATGCTAATTTGCA 2253
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ----ACTTACTGAAGTTTTTTATTGTTACGATTGTAAAATAACACAAAAGCTAATTTGCA 2074
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ATGTTACAAATAATTTTTTTTATTGTTACGATTGTAAAACAATACAAAAGCTAATTTGCA 2172
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ----TTACAAATATTTGTATTATTGTTGTGATTATAAAGCAATGCAAAAGCTAATTTGCA 1966
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------------------------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------------------------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds ATCGTTGTGTGTTTATATGCTCTCATGTTCAGTGAATAAAATC--ATTATTGATGACTGA 2311
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------------------------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ---ATCCTGTGTTTATATGCTCTCATGTTCAGTGGAAATAAAATAATTATTGATGACTGA 2131
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds ---ATCGTGTGTTTATATGCTCTCATGTTCAGTGGAAATAAAATCATTATTGATGAAAAA 2229
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------------------------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds ATCGTTGTATGTTTATATGCTCTCATGTTCAGTGGAAATAAAATCATTATTGATCAAAAA 2026
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------------------------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------------------------------------------ 1903

AJ295040.1_Tetraodon_nigroviridis_partial_mRNA_DM_domain-containing_transcription_factor_DMRT1_(dmrt1 ------------------------ 465


JQ413415.1_Gobiocypris_rarus_dmrt1_(dmrt1)_mRNA,_complete_cds ------------------------ 2098
AB739060.1_Gnathopogon_caerulescens_Dmrt1_mRNA_for_doublesex_and_mab-3_related_transcription_factor_1,_complete_cds CATATAAAAAAAAAAAA------- 2328
KX987992.1_Anguilla_japonica_double-sex_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_partial_cds ------------------------ 552
KF713497.1_Carassius_auratus_auratus_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds CTTTCAAAAAAAAAAAAAAAAAAA 2155
KF713499.1_Cyprinus_carpio_dsx_and_mab-3_related_transcription_factor_1-2_(Dmrt1-2)_mRNA,_complete_cds AAAAAAAAAAAAAA---------- 2243
MG860531.1_Chanodichthys_ilishaeformis_DMRT1_mRNA,_complete_cds ------------------------ 1169
KF713505.1_Megalobrama_amblycephala_dsx_and_mab-3_related_transcription_factor_1_(Dmrt1)_mRNA,_complete_cds AAAAAAAAAAAAAA---------- 2040
KY913799.1_Misgurnus_anguillicaudatus_Dmrt1a4_mRNA,_complete_cds ------------------------ 848
KY913791.1_Paramisgurnus_dabryanus_Dmrt1a1_mRNA,_complete_cds ------------------------ 1903

Lampiran 2. Sekuen protein gen DMRT1


>AHF72540.1 dsx and mab-3 related transcription factor 1-2 [Carassius auratus auratus] MSEEEQSNGSLSVRKPSRMPKCSRCRNHGFVSPLKGHKRFCSWRDCQCQKCRLIAERQRVMAAQVALRRQ
QAQEEELGICSPVNLSGSDTLVKNEAVGDNVFTIIPGPPSPSTSSATASPTNLGNRSMLALSPAATSRGH TEGTSDLMVDASYYNLYQPTPYSSYYSNLYNYQQYQMPSGNGRLSSHNVSPQYRTHSYYSSYLSQGLGTT
ACVPPSTCPEPKAAAFSDGAQDSVSISSMINTENRLECESSSESGTFSINSIVDGVTK

>AHF72542.1 dsx and mab-3 related transcription factor 1-2 [Cyprinus carpio] MSEEEQSNGSLSVRKPSRMPKCSRCRNHGFVSPLKGHKRFCNWRDCQCQKCRLIAERQRVMAAQVALRRQ
QAQEEELGICSPVNLSGSDTLVKNEAVGDNVFTIISGPPSPTTSSATASPTNLGNRSMLALSPAATSRGH TEGTSDLMVDASYYNLYQPTPYSSYYSNLYNYQQYQMPSGNGRLSSHNVSPQYRTHSYYSSYLSQGLGTA
ACVPPSTCPEPKAAAFSDGAQDSVSISSMINTENRLECESSSESGTFSINSIVDGVTK

>AHF72546.1 dsx and mab-3 related transcription factor 1 [Megalobrama amblycephala] MSEEEQSNGSLSVRKPSRMPKCSRCRNHGFVSPLKGHKRFCNWRDCQCQKCRLIAERQRVMAAQVALRRQ
QAQEEEMGICSPVNLSGSDTLVKNEVVGDHVFTISSGPPSPTTSSATASPTNIESRSMLALSSGMTSRGH TEGPSELMVDASYYNLYQPTPYTSYYSNLYNYQQYQMPSGNGRLSSHNVPPQYRTHSYYSSYLSQGIDTA
ACVPPSTCSEPKAAAYSSGAQDSISSMINTENKLECESSSESGTFSVDSVIEGATK

>AFA45126.1 dmrt1 [Gobiocypris rarus] MWEEEQSNGSLSVRKPSRMPKCSRCRNHGIVSPLKGHKRFCNWRECQCQKCRLIAERQRVMAAQVALRRQ


QAQEEEMGICCPVNLSCSDSLVKNEVMGDVNVFTISSRPPSPTASSATASPTNLESRSMLALSSAVTSRG HTEGPSELMVDASYYNLYQPTPYTSYYSNLYNYQQYQMPSGNGRLSSHNVPPQYLTHSYYSSYLSQGIDT
VPPSTCPEPKASAYSNGAQDSVSISSMINTENRLECESSSESGTFSVDSVIDGATK

>BAM37631.1 doublesex and mab-3 related transcription factor 1 [Gnathopogon caerulescens] MAAQVALRRQQAQEEEMGICCPVNLSCSDSLVKNEVMGDVNVFTISSRPPSPTASSATASPTNLESRSML
ALSSAVTSRGHTEGPSELMVDASYYNLYQPTPYTSYYSNLYNYQQYQMPSGNGRLSSHNVPPQYLTHSYY SSYLSQGIDTVPPSTCPEPKASAYSNGAQDSVSISSMINTENRLECESSSESGTFSVDSVIDGATK

>AVX33665.1 DMRT1 [Chanodichthys ilishaeformis] MSEEEQSNGSLSVRKPSRMPKCSRCRNHGFVSPLKGHKRFCNWRDCQCQKCRLIAERQRVMAAQVALRRQ


QAQEEEMGICSPVNLSGSDTLVKNEVVGDHVFTISSGPPSPTTSSATASPTNIESRSMLALSSGMTSRGH TEGPSELMVDASYYNLYQPTPYTSYYSNLYNYQQYQMPSGNGRLSSHNVPPPYRTHSYYSSYLSQGIDTA
ACVPPSTCSEPKAAGGISSSVILCQPLPPPLHHLAMD

>AVP74250.1 Dmrt1a4 [Misgurnus anguillicaudatus] MSEEESNGSRTVRKVARMPKCSRCRNHGFVSPLKGHKRFCNWKDCQCQKCRLIAERQRVMAAQVALRRQQ


AQEEEMGICNPVNLSGSDPLVKNEPVVDYVFTVGTRASSPTTTSAPSSPTVPGSRSMLAVSPAATSRGHT EGTSDLMVGPTYYNLYQPSRYSSYYSNLYNYQQYQMPTGDSRLSSHNVSPQYCTHSYYSSYLSQGLGTAA
CVPPSTCPEPKAAAFSDGAQDSSLNTLTISTENRLECESSSESGTFSVESIIEGATK

>AVP74242.1 Dmrt1a1 [Paramisgurnus dabryanus] MSEEESNGSLTVRKVARMPKCARCRNHGFVSPLKGHKRFCNWKDCQCQKCRLIAERQRVMAAQVALRRQQ


AQEEEMGICNPVNLSGSDPLVKNEPVVDYVFTVGTRASSPTTTSAPSSPTVPGSRSMLAVSPAATSRGHT EGTSDLMVDPTYYNLYQPSRYSSYYSNLYNYQQYQMPTGDSRLSSHNVSPQYCTHSYYSSYLSQGLGTAA
CVPPSTCPEPKAAAFSDGAQDSSLNTLTISTENRLECESSSESGTFSVESIIEGATK

>ASV71764.1 double-sex and mab-3 related transcription factor 1, partial [Anguilla japonica] KPSRMPKCSRCRNHGYVSPLKGHKRFCNWRDCLCQKCKLIAERQRVMAAQVALRRQQAQEEEMGICSPVT
LSSTEVMVKNEATGDRACFFSAGEKSPPLQNNEATSPSATGNRPAMPSSPTSASRGHPEGSSDLVVDASY YNFYQPSRYPAYYSNLYNYQQYQMPSNEGRLSGHSVSPQYRTHS

>CAC42783.1 DM domain-containing transcription factor DMRT1, partial [Tetraodon nigroviridis] RCRNHGFVSTLKGHKRFCSWRDCQCPKCKLIVERQRVMAAQVALRRQQAQEEELGIWSLGPLPGAGVMVK


NEPGAECCFTVEGRSQTSTSGPSSAVATASRTVPSSQPSAGARAHHDGQSDLLLESSFYHFYQPSCYPSY YSNLYNYQQYRMHSY

Lampiran 3. Hasil desain primer pada Primer3 yang sudah ditandai left primer
dan right primernya serta sudah dituliskan nilai tm nya
Using 1-based sequence positions
OLIGO start len tm gc% any_th 3'_th hairpin seq
LEFT PRIMER 209 20 59.02 50.00 0.00 0.00 0.00 AGAATGAACCTGGAGCCGAA
RIGHT PRIMER 429 20 59.11 55.00 0.00 0.00 0.00 GTTGCTGTAGTAGGACGGGT
SEQUENCE SIZE: 465
INCLUDED REGION SIZE: 465

PRODUCT SIZE: 221, PAIR ANY_TH COMPL: 0.00, PAIR 3'_TH COMPL: 0.00

1 CGCTGCAGGAACCACGGTTTTGTATCTACCCTGAAGGGACACAAGCGCTTCTGCAGCTGG

61 AGGGACTGTCAGTGTCCCAAATGTAAACTCATAGTGGAGAGACAGAGAGTCATGGCGGCT

121 CAGGTTGCCCTGCGGAGACAGCAGGCTCAGGAGGAGGAGCTGGGCATTTGGAGTCTGGGT

181 CCTCTCCCTGGGGCCGGGGTGATGGTGAAGAATGAACCTGGAGCCGAATGTTGTTTCACG
>>>>>>>>>>>>>>>>>>>>

241 GTGGAAGGACGAAGCCAGACATCTACCAGTGGACCCTCTTCTGCTGTGGCCACAGCGAGC

301 CGCACAGTGCCATCATCCCAACCATCAGCTGGTGCTCGGGCTCATCATGATGGACAGTCA

361 GACCTGCTGCTGGAAAGCTCTTTTTACCACTTTTACCAGCCGTCGTGCTACCCGTCCTAC
<<<<<<<<<<<

421 TACAGCAACCTGTACAACTACCAGCAGTACCGGATGCACTCCTAC
<<<<<<<<<

KEYS (in order of precedence):


>>>>>> left primer
<<<<<< right primer

ADDITIONAL OLIGOS
start len tm gc% any_th 3'_th hairpin seq

1 LEFT PRIMER 214 20 59.20 55.00 0.00 0.00 0.00 GAACCTGGAGCCGAATGTTG


RIGHT PRIMER 426 20 59.33 60.00 0.00 0.00 0.00 GCTGTAGTAGGACGGGTAGC
PRODUCT SIZE: 213, PAIR ANY_TH COMPL: 0.00, PAIR 3'_TH COMPL: 0.00

2 LEFT PRIMER 254 20 58.80 55.00 18.40 0.00 0.00 GCCAGACATCTACCAGTGGA


RIGHT PRIMER 407 20 59.49 55.00 0.00 0.00 0.00 CACGACGGCTGGTAAAAGTG
PRODUCT SIZE: 154, PAIR ANY_TH COMPL: 3.10, PAIR 3'_TH COMPL: 2.99

3 LEFT PRIMER 157 20 60.03 55.00 0.00 0.00 0.00 GAGCTGGGCATTTGGAGTCT


RIGHT PRIMER 326 20 58.96 55.00 0.00 0.00 0.00 GATGGTTGGGATGATGGCAC
PRODUCT SIZE: 170, PAIR ANY_TH COMPL: 0.00, PAIR 3'_TH COMPL: 0.00

4 LEFT PRIMER 217 20 58.75 50.00 0.00 0.00 0.00 CCTGGAGCCGAATGTTGTTT


RIGHT PRIMER 445 21 59.20 52.38 0.00 0.00 0.00
GCTGGTAGTTGTACAGGTTGC
PRODUCT SIZE: 229, PAIR ANY_TH COMPL: 0.00, PAIR 3'_TH COMPL: 0.00

Statistics
con too in in not no tm tm high high high
high
sid many tar excl ok bad GC too too any_th 3'_th hair- poly
end
ered Ns get reg reg GC% clamp low high compl compl pin X
stab ok
Left 2190 0 0 0 0 181 0 452 812 0 0 43 4
0 698
Right 2119 0 0 0 0 191 0 394 775 0 0 27 19
0 713

Lampiran 4. Hasil desain primer pada oligoanalyzer yang sudah ditandai left
primer dan right primernya serta sudah dituliskan nilai tm nya
LEFT PRIMER
PRIMER PICKING RESULTS FOR

Template masking not selected


No mispriming library specified
Using 1-based sequence positions
OLIGO start len tm gc% any_th 3'_th hairpin seq
LEFT_PRIMER 1 19 59.48 63.16 7.17 0.00 0.00 GAGACAGCAGGCTCAGGAG
SEQUENCE SIZE: 21
INCLUDED REGION SIZE: 21

1 GAGACAGCAGGCTCAGGAGGA
>>>>>>>>>>>>>>>>>>>

KEYS (in order of precedence):


>>>>>> left primer

RIGHT PRIMER
PRIMER PICKING RESULTS FOR

Template masking not selected


No mispriming library specified
Using 1-based sequence positions
OLIGO start len tm gc% any_th 3'_th hairpin seq
RIGHT_PRIMER 19 19 58.93 57.89 0.00 0.00 0.00 GTGTGGGCTGGTAGAGGTT
SEQUENCE SIZE: 21
INCLUDED REGION SIZE: 21

1 AACCTCTACCAGCCCACACCG
<<<<<<<<<<<<<<<<<<<

KEYS (in order of precedence):


<<<<<< right primer
Lampiran 5. Selfdimer, hairpint dan heterodimer