Anda di halaman 1dari 18

KOLEKSI BAHASA PUITIS DAN FAKTA UNTUK PENULISAN }C'1,KAI\iG.

A}'I

Dim ens i D i ri

l. Generasimuda menjadi tunjang atau tonggak untuk merealisasikanWawasan 2020'

a'*al
2. Sesungguhnyasetiap individu perlu sedarbahawa dalam semua unrsanhendaklah bermula dari
seperti kata bidalan mengaji daripada alif, membilang daripata esa-

,3. Sesungguhnyatiada kejayaantanpa keiltizaman yang tin-e-ei'

4. Muda-mudi merupakanbentengpelapis yang bakal mengambil alrh rampuk kepimpinan negara


-A'ku nnrnpr menggoncang dunia ini
5. Mantan Presiden Indonesia iaitu Presiden Sukarno pernah beriula
dengan 100 peria, sebaliknya aku gagal berbuat apa-apa sekalip'r.rnaku dfte ilingi 1000 orang tua"

6. Falsafah Pendidikan Negara teiah menggariskan ernpat mekanisrne utama daiam usaha membentuk
insan yang seimbang (syumul) dan harrnonis iaitu aspek jasmani- ernosi- r'otrani dan intelek.

7. Fepatah Arab ada menyatakan otak yang cerdas ada pada badru lang sih,a-

g- Im*m al-Ghazali pemah berkata *Apabila kamu hendak mengeml wajah tihat pada cermin, tetapi
apabila kamu henclakmengenal diri bercerminlah pada wajah-

jika para
9. Masalah perrgangg$l'anmerupakan agenda yang tiada penghujrmg dan ftak berkesudahan
belia bersikap berpeluk tubrih dan memiiih pekerjaan seperti kata pepmh hidup segan nnati tak mahu.

10. Kemelut pengangguran merupakan bencana yang boleh melumpuhkan kestabilan poiitik dan
sosioekonomi negara.

11.peribatrasa ada menyebut hidup tanpa cita-cita samalah sep€rti pokok yang tida-k berbuah.

12. Sesungguhlya_tiada siapapun yang sanggup terjun ke kanealrponag&an-@ah.

l J. Sesimgguhnya setiap api yang membakar punzung rokok bererti rnernbakar usia si penghisapnya.

14. Tanpa disedari amalab rnenghisap rokok sebenarnya rnenghampirkan diri kita ke liarig kubur' \

15.Felajar sebagai golongan remaja yang sedang mencari identiti rnereka sendiri ternyata semakin l
cenderung untuk mendapatkan popularitr dan h:asa.

16"Remaja kini mempunyai kecenderunganuntuk hidilp sebagaiorang de.,vasalebih alval daripada urnur
II
seb*narmenvebabkaninereka ingin rnemiiil.j gaya iridup seperti individu yang bekerja.

Kebanyakan masalah disipiin berlaku akibat ketrdakupayaan pelajar nierryesuaikan diri dengan budaya
sekolair yang menu,nhit keoernerlangan iharu daa kesempurnaan peribadi"

1E"Dengan ben$ekaika-niitizarn ya-ngjitu dan mapae, pastirayavisi ulltuk rnelahirkan generasimuda yang
berketerampiiandan bernvawasanakan menjadi realiti, bukamya %ntasi.

19.Tanpa disipiin irnpian kita akan longlai dan terus berhecai.

Kita hendakiah meletakkan irnpian yang tinggi untuk berjaya seperti yang diungkapkan oleh nnantan
Fresiden Sukarno,"Gantunglah cita-ciiamu di bintang yang tinggi sekatripunkakimu rnencecah lurnpur'
21. Ahli falsalbh pernah mengingatkankita den"an kata-kata"Apabila kita gagal merancangrnembuktikan
kita merancanguntuk gagal"

?2. Kegiatan kokurikulum diibaratkan adik kerr:ar kepadapencapaianakademik untuk rnembolehkan para
pelajar berjayamelanjutkan pelajaranke pu-.,.ripengajiantinggi.

23. Generasihari ini akan menentukanhala tuju netara samaada menjadi lebih baik atau terus berada
pada takuk lama.

24. Golongan rernajaberperanansebagaiwira dan .erikandi yang mampu memikul tanggungjawab untuk
nremenuhiaspirasinegara menjadi negaranra_j,_.

25. Pontengsekolehbolehlah dianggapsebagai'Jena'.ah akademik" yang dilakukan oieh para pelajar.

26. Setiap indi" idu harus sedarkepentinganteknoloei maklurnat untuk menerokai khazanahilmu seperti
uaekapan-\{akiumat di Hujung Jari Anda dsn "}airassMaklumat Merentasi Dunia Tanpa Sempadan"

27. Se;iapa\an-g menguasaiilrnu telekomunikasi neca',adia mampu menguasaidunia.

18. Il-niu.jirl'ara*,an sebagaikuasa dan maklumat merupakansenjatadi garisan hadapansupayakita lebih


ber-*dia herhaJ.apandengan apa-apa cabaran yang mendatang.

:q Ahii fiJe"rl Tag''Fernahberpesan" Jika karnu mahu hidup setahuntanamlah gandum,jika kamu mahu
tllcup ;lp'u,ul nhun tanamlahpokok danjika kamu mahu hidup selarna-lamanyatanamlahjiwa
- - - --;--
- ldiL\Jd

(:''rES
)ang rica.kmengasahmindanya denganmembacaterlepasbanyak peluang dalam hidup
l-b,tr{-na:E*.+i*n r

Jl . Kerja bertmggrh lru prencurimasa dan JamesMichener pernah berkata "Jangan katakan esok apabila
hari ini d4at anda lakukan, kerana apabila hari ini anda berdalih, anda juga akan berdalih esoki

32. Bersahabatlah dengan semua orzrngsupaya semua orang bersahabat dengan anda (Socrates)

tt Kebenaranadalahsesuatuy''angsukar diterima tetapi apabila sr,i.airbiasq adalah sesuatukebahagiaan


t \laharmaGhandi)

Tidak melakukankesilapan bukanlah manusianamanya,te.,al; cariparlakesilapankita separutnya


cnenjadilebih bijaksanapada masadepan (Voltaire)

lfiaat dan kesungguhani ang tidak terhad adalahjalan muda-- r;sr seseorangitu mencapai
keja.v-aan
(CharlesSchira:

-.i Sebahagianbesarpers€n-i-ia-lr ji iunia benaula dengarrircr , Ccethe). pepatah ada men.vatakan


terlajakperahuboieh ciirl-;:. :or;a_iak
cakapburuk padanl:

: - P'-ahsia ja,:.ll iidun :eniiasabersediar-.-r-..i::,.i


kejayaanseseLlra.-.1 aeli.ia6gyang da.tang.
3errjaminDisraele:

3E :-i:ng I'angiidak menr


-r'. ai 'l:;-ciu bagaikanburung i::::: jr..:p, ipepatahFnggeris)

i9. Keikhlasanitu membenrhkanianpada kekotoran(At-junai,ra.-Baghdad)

-{0' BckasPresidenAmerilu Slarikar iohn F. Kennedy pernah br*ata ''bertanyalah


apakah sumbangan
acdakepadanegaradan bukanny'aapakahsurnbangan'egara kepada
anda,,
Dimensi Keluarga

l - Profbsor Michael Rulter dari London berkata " Rumah tang-qa;-ang porak-perandaakan mempengaruhi
peningkatanberlakunya gejala sosial dan kerosakanakhlak remaia

2. Kanak-kanakyang tidak dididik degan sempurnaakan merjadi beban dan mengancamkeselarnatan


kepada masyarakat.

J. Peringkat bayi dan awal kanak-kanak ialah masapenentu bagi pembentukanraas zta,r ketranokaperibadi
setiamanusia

4- "Warga tua terasmasyarakaf'. Demikianlahsebahagianlirft bgu yang menjadilagu tema untuk


mengenangkembalijasadanpengorbananwargatua yang telah bonyakberjasa-

5- "Utamakankeluarga,semakinhari semakinsayang". Denftianhh slogandaripadaJabatanKenajrran


MasyarakatdanHal Ehwal Wanita untuk memtlentukkeluargasakimh-

6. Anak yang ditahrkan umpaseheiaikain putih danibu hpalah 1ag bertaggungiawabuntuk


mencorakkannya.

7. Kasih sayangadalahfitrah dalamdiri manusiadansewajarnyamjadi intipati kepadarumahtangga


yangbahagia-

8- Wanitabanyakmemikirkanjalan penyelesaianbertrubrmgd€nga hal rumahtangga. Sebaliknyaletaki


lebih banyakmernikirkanmasalahyangberkaitandensanurusm kerja.

9. Bilanganrilargatua yangberusia60 tahunke atasakanmeningkat7Vomenjelangtahun2010 di


Malaysia.

10.Nilai kasih sayangsemakinterhakissehinggawujudnyafenomenaanakkecil dibiarkanmenangishiba


di tepi longkangdanpengorbananayahbondadibalasdenganmerem@an merekadi rumah Seri
Kenangan.

I I ' Sepohonkayr yangmerendangdanberbuahlebatsertamanisberasaldaripadaseb{iibenihyag kecil


dandisemaidandibajai sebaiknya.

12.Keutuhaninstitusikeluargapentinguntuk menentukanhala tuju generasimasakini yang


berketerampilandan berwawasan.

13.Instilusi keluargamerupakancerucukutamadalasrpembentukanperibadiyangmulia sebelum


seseoranganakitu berhadapandengansenmganbudayaasing.

14' Itru bapaharusmengawalselia anak-anakdenganbaik agarminyak yang ditatangtidak tumpah.

15' ibu
!-agalahmerupakanguru niamayangberperananmembentuk.iiwadankerohaniananak-anakyang
bersihbak sehelaikain putih.

16' Jikagenerasimasaili tidak memandangibu bapamerekasobagairole modeldalamkeluarga,tentulah


tugasmembentuksahsiahmerekasukardicapaisepeltimenarikrambutdi dalamtepung,,u"*Uut
janganputus,tepungtidak berselerak.

I7' Imarnal-Ghazalipernahberkata" anakyangdiajar erti kasih sayangakanbelajaruntuk


menyayangi
oranglain.

18-semangattoleransi,tolong-menolongdan sediamemaafkanmenrpakanresepi
hidup berkekalanunark
kerukunanhidup rumahtangga.
19. Anak yang dilahinkanurnpamapermaa yaa: menjadi pnyeri clanperighiasrumah tangga.

20. Trend hidup umpamaenaudi dalam belul-arreiepaskanpucuk masine-masingdan hidup cara"'naf3i-


nafsi, siapa lu siapa gua?" banyak mengurxfor'gkepadakeganasanruniah tangga-

2 t. Hubunganakrab antaraahli keluarga dapatdi*-mai sekiranyamasing-masingberpegangpada slogarr


murni "Yang muda dikasihi, yang tua dihorrnr::-"

22. "S1rurgaterletak di bawah telapak kaki ibu" rnaupakan kata hikmat yang menggambarkantretapa
besanryanilai seomngibu kepadaanak-anaii

a J. Pengorbananseorangseoftingibu tiada harga1'angboleh dibayar sebagaigaiang gantinya dan


kasih ibu bak lautan yang tidak bertepi.
murnin,v-a

AA Insiit'-rsikeluargamerupakanbentengawal untuk menyelamatkanremaja daripadaterus tenggelam


dalarngelombangancamanwabak sosial.

25. Kehiarga rang harmoni pasti berupayamenjanakankejayaanyang cemerlang kepadaanak-anak.

26. Kejal"aan.jan kecemerianganibu bapa memberi motivasi dan surnber inspirasi kepadaanak-anak
iaag bani meaingkatremaja.

Ib-{tbrya $€n+akan rakan kongsi dan tempat mnding cara untuk mengembangkan bakat dan potensi
ertak-amL

tq
-c -r.ir Cice*cangririak akan putus dan carik-carik bulu ayam larna-larnabercanfumjua ialah dua
peTrbahasaMelalu yang menjelaskan bahawa hubungan rapat yang berpaksika'r pertaiian
dtrah $rlrar dileraiiran.

29. Anak-mak y'ang berjaya dan berdiri di mercu kejayaan jangan sama sekali bersikap seperti kacang
Itrpakan kulit terhadap jasa dan pengorbanan ibu bapa

30. Keluarga ialah harta dan dalara masa yang sama menjadi teman pe.nghrornsertamenyejukkan jiwa
iara.
-vang

-.; Hubmg:n keli,ra:sa\ ang i€nemskan riiai kebendaa:rsenaii-;ra:a :udah pasti gagal merencanakan
:;-; n=isgi ar".a*i-r,al.

Ib{i :cm memit"il a.mar-ahunnik mencorakkan cara pergaiiiar anak-anak berpaksikan amalan
:tnt!S i:nha-.e-

Antei-ellil atr:! :e='!llt. r.:; :ni:. inen-u-ukakan hati ibu bapanya retapi apabila sudahbesar seiaiu
iirff:d,,;.:::r ;: -;-"' :- r;:':. j, ':"- :>:.a ca;;at<iiurnpainai;r l'er,i-ireeil anak,sudahbesarmenjadi

Perseli:lftrn a!Tla,x-:
!-i- .:-rir- >r;i"l-E-mara <iansahat'air::riai s';cair menjadi perkara biasa dalam
seF::. r ;:i :';-*:;3--.!.!jt
kebi,jr:p'atl :,f=t(!ctga-nlidah acerriar.. a ;,er"igii-luga-

hiendjdili a;:ai:-rsr,-:€f-.;i-:.:rra.-i'i:i rri:i-eidan agania}::,.ir:;iah se:nasanmsihkecil ;epeni i<ata


peribahasaii:eie::; :'- -i i r.i: :rl r;bunppya.

'hyiur serand"npn :.$,a1,!a:rr :.nFiirungnya" danjari dl tangan pun tidak samapanjangnya,, dapat
Lq.a k:k-i:lcu aan.potensi dan bakat r ang aCapada anak-anakarialahberbeza.
meng-eambar'<.an

Daiam falsafah hidr:p iczurn CiEa ada i.ata hikurat yang berbrn; i " keharmonian keluarga akan
membawakenoakrn:r€-
38. Keluargapadaasasnyaialah ejenpentingpembangunan n€gra kerma daripadakeluargaterbina
masyarakatdan daripadamasyarakatterbentuklahnegara

39. Jika dulu ibu dan bapaseringdigambarkanmelayarikehidqar benamadi bawahsatubumbung,


berkongsihidup dan samamenghadapicabaran,tetapihai ini rnsalah penceraianmenghasilkan
pertambahan bilanganibu danbapatunggal.

40. PerangkaanJabatanKebajikanMasyarakatmelaporkanterd4at kira 300 hingga6fi) kes remaja


didaftarkan setiaptahundi pusatpemulihanakhlalqpusd tahnan junana dan SekolahHenry Gurney
seluruhnegara.

41. Bagi ibu bapayang bijak menguruskanrumahtangg4,berihrl dm mengamalkanilmunya serta


mengubahdiri menjadilebih bailq makamerekaakansemiasahidry bahagi4 terhindardaripada
bahayadanbencanasertadiberkdi Allah-

42. Pakff Motivasi, Datuk Dr. FadzilahKamsahb€rkata* tambmg kepadakesyukuranadalahdengan


menjadikandiri sebagaipasanganterbaik dan sentiasaberusah m€ngukuhkankeluargayang dibina

43. Setiapindividu yangberumahtanggaalcan perubahannental, emosi, fizil<al,sosialdan


rohani-

44. Ibu bapaperlu berinteraksidengananak-anaksekerapmrmgkindenganmenggunakan hikmah,


di sampingmendidik merekakaedahinteraksidengancmg lain secarapositi{ bersopandan
berkesan.

45. Setiapanakwajib mentaati ibu bapatanpaperlu syard dan \yaktu.

46. Dewasaini sudahmenjadisatubudayadi seluruhduniarmtuk meraikanllari Ibu apabilatiba minggu


keduabulanMei. Sesungguhnya sayangiibu tidak hamsdijadikanbudayasetahunsekali sebaliknya
dijadikanbudayasepaqiangmasasupayaamanahmemuliakm danmemperingatiibu tercinta
dilakul€n sepanjanghayat.

47- DiEngland Hari lbu dikenali sefiffMothering Sunday.f;t i#ilk" Symikar,sejarahIIai Ibu
bqmula ryabila seorangwanita bernarnaAnna Jarvis(the motherof Mother's Day) berusehagigft
mbanu orangmiskin dalammasyarakatuya-

a8- Pemingqa in"tinlsi keluargadapatdilihat kepda maknasebenarperkataankelurga. Dalam bahasa


Arab, pahkeluuga atau'hsrah"bermaknaikatanibarat simpulankainyang salingmengikat
kukuh antra cdud€ngan yang lain.

49. Hari KeluargaAmabangsa disanbut setiapbulanJunbernrjuanmemperkasafungsi dankepentingan


keluargatermask trnggungiawabkeibubapam hendaklahdisema'rakkan agarinstitusi ini benar-benar
terjalin utuh deni melahirkanmasyarakatdannegarayang sejahtera.

50. Cabarankeluargakian bertambahdenganpeningkatanbilanganpendudukyang dijmgka meningkat


kepada29juta padatatrun2010.

51. Kepincangankeluargaakanmengundangpetbagaimasalahkepadaahlinyatermasukmemberiruang
kepadapengabaianhak dantanggungiawab.

52. Ahli psikologi Barag Colemanmentakrifkankeluargasebagaisekumpulanmanusiayang dihubungkan


melalui pe*ahwinan, keturunanatauanakangkatymg tinggal dalamsebuahrumah.

53. Betapahebatnyasebuahrumahtanggaapabilaahli-ahlinyasalingbermaafansebelumtidur setiap


malam.
Dimensi MasYarakat
padu dan sentiasabekeriasama
L Masyarakatyang progresif dan dinalnik ialah masyarakatyang bersatu
menjanakemajuan negara-

kerana pernbetung,bulat manusia


2. tvlasyarakatyang sempurnahidup dalam muafakat umpamabulat air
kerana muafakat.

rintangan derni keharmonian


3. Setiap ahli masyar.akatperlu sama-samaberikhtiar menyelesaikansebarang
bersama kerana cubit paha kanan, paha kiri terasajuga'

pecah sebiji, pecah


4. Datam konteks kejiranan, kehidupan perlu diibarat seperti telur sesangkak;
semrEmya

yang mengalaminya lebih


5. Behpa sgsah ,melihat penderitaan dan kesusahan orang lain tentulah orang
renderita kerana betapa berat tnata memandang berat lagi bahu memikulkannya'

kerana hari tak


6. IG1" perlu sedar bahawa suatu hari nanti mungkin nasib tidak menyebelahi kiia
selammya panas, untung dan malang silih berganti'

keadaan rukun
?. Int€raLsi smial yang baik antara jiran dapat melahirkan masyarakat yang hidrp dalarn
dAdnnei

t. Kcmg3frkm mennainkanponnan yang penting dalam konteks kejiranan kerana bersatu tegub' berccrai
roboh-

kesenanganhidup bak kara pepaah


9- Mq6.ak* )Feg aman dan harmoni dapat sama-samamenikrnati
bdi g4iah stma dilaPah, hati kuman sama dicecah.

10. Inregrasi 6iomt adalah kunci kemakmpran dan kesejahteraan negara

I l. Masymakat moden hari ini lebih ghairah mengejar kemewahan rvang ringgit kerana bagi mereka ada
padi semua kerjajadi, ada beras semua kerja deras. '

12. Baik sesebuahkeluarga, baiklah masyarakainya seperti kata perrlahasa jika kuat tiang, kukuhlah
bangunannya.

13. Kemakmuran sesebuahnegan mat bergantung pada kemantapan dan keutuhan hubungan dalarn
setiap lapisan masyarakal

14. Amalan bersopan santun bukan barang dagarigan yang boteh djual beti sebaliknya tercerna daripada
sif,atikhlas dan saling memberi dan menerima.

15. Masatah vandalisme yang berlaku seolah-olah menggambertan masyarakat masih belum bertamadun
sedangkankita memasulii era milenium.

16. Maruah sesuatErbangsa afiat berkait rapat dengan tingkah iaku dan =malan budaya lrrereka.

l?. Masyarakatyang ianpa ilmu akan menjadi buta dan mas;,'arakat:'ang tanpa agama adalah lurnpuh.

18. Kehidupan kita ibarar sebarangtubuh. Apabila safu daripada acsotanya sakit justeru seluruh tubuh
turut rnerasai sakil

19. Masyarakat harus hidup berhemat dan mengelakkan amalan boros dengan berpegang teguh kepada
nasihat peribahasa ingat sebelum kena jimat sebelum habis-
DimensiNegara

BidangPelancongan

l' suatudestinasipelanconganyanghebatmempunyaiikon yangdapatdihubungkaitkan


denganke'nikan
dankeistimewaan yangtidak wujuddi tempatlain.

2' Malaysiamempunyaikepelbagaian destinasipelancongan sepertipantai,pulai,makanan,kepelbagaian


kaum,hasilkraf tangan, aramsemurajadi, keienianda=n
kebudayaan.
3' MenaraKembarPetronas,Putrajayadan siberjaya,homosi JualanMega,
sertaacarasukanbertaraf
antarabangsa
sepertiFormula I dapatdijadikan imej baharudalammenyerlahkanimej
pelancongan.
4' PendudukMalaysiamewakilikaumMelayu,cin4 India,s€rdni,
ft6q (arrazrn, Bajau,Meranau,
Kayan,Murut, Dusundan Portugisyang kayadengankeunftan U.rauy"
radis;onal
-*ing_**ing.
5. "Cuti-cuti Malaysia. Cuti-cuti RehatkanMinda,'
Demikianlahlirik ringkas lagu daripadasual t-gmakmerdr
popular Siri Norhalizayang
menjadi lagu latar kempen..Cuti-cuti Malaysia".

6. Datuk Bendaharamengadapraja,
Senyumberserimendapatkurni4
Malaysiaindahpenuhpesona,
Tumpuanpelancongseluruhdunia

Pantundi atastidak dapatdinafikan kebenarannya.Banyaktempat


menrik di negaraini menjadi
turnpuanpelancong dari dalamdan dari luar negara.

7' ungkapanjauh beria-la|luasgandanganmenggalakkankita


merantauke tempatoranguntuk mencari
pengalamanbaharudalamkehidupan

8. Temparbersejaratryang wajar dilawati ialah MakamMahsuri pulalr


di Iaagkawi, Bukit Metawaridi
Kuala Selangor,LembahBujang , K;td A Famosad* B;il
st. iuur ai Melakadan pasir
Salakdi Perak.

9' Pantaiyang in'lah di negarakita termasuklahDT*" di


Johor,pantai ranjang Aru di sabah,pantai
sanurbongdi Sarawak,PantaiTa4iangBidaradi Melaka,pantai gatu
rerengghi di pulau pinang,
Panai Port Dicksondi Negeri sembilan,Pantaicahayanuun
ai retantan, Fintai n*t u euar,g
di Terengganqpantai Teluk Cempedakdi pahang.

l0' Terdapatpulauaulau yang menmik untuk dikmungi


iaitu pulau Langkawi, pulau Tioman,pulau
Pangkor, pulau Kapas,purauperhentian,purauB&r,pulau
R"d;;;-d* fufi;o;;;:''
l1' Kita haruslahmeaguiamakanrneiancongdi negara
sendirikeranasepertikata peribahasa..hujanemas
di negeriorang,hujan batu di negeriseniiri, teiitr bait
n;g;;;-;;;diri,,.
l2' fo{akanantradisonalMelayu yang menjadidaya
tarikanpelancongiaiah rendang,sate,ternpe,rojak,
tapai,gado-gado,pasembor,lontong sambalLmis,
iliJ", cencaluk,otak-otak,kuih koei,
onde-onde,laksadan banyaklagi. "*p"v"r.,
13' LembagaPenggalakkanPelanconganMalaysia(LPPM)
akanmengambiiinisiatifmemaksimurnkan
kadarkemasukanpelancongdari luar negara"

14' syarikat penerbanganMAS dan AirAsia akan


menambahdestinasipenerbangandanpersinggahan
bagi memudahkanpelancongasingmelawatnegarainl
\!

KementerianPerdaganganDalamNegeri dn Hal Ehwal PenggunadanKementerianPerdagangan


Antarabangsaakanbekerjasamauntuk menjadikanlebih banyakbarangpsnggunadikecualikancukai
supayamenjadikanMalaysia"syurgabeli&h" terbesardi Asia Tenggara.

16. Kerajaanbercadangmemperkenalkan penggmaankad pintar danpasportserbagunabagi


menggantikan pasportsediaadadalamusahamenggalakkanlebih ramaipelurcongAsia melancong
ke Malaysia

t7- Keceperlanganindustri pelanconganMalaysiabanyakdikaitkan denganfaktor alam sekitar,sejarah


dankehxhpan.

18. KeistimewaandestinasipelanconganMalaysiayangmenggamitpelancongmenjadikanindustri ini


keduaterbesarkepadapendapatan n€gara-

19. Pengalrmn melihatkelip-kelip di jeti Kuala Sehgor padawaktu malamtelah menjadidayapenarik


kepodapelilcmg asing-

Sdcr pehcongan dijangkaterusmenjaditunjmg KeluaranDalamNegaraKasar(KDNK) dan


mbd nemulihkan kegawahnekonominegaa.

2t- Pengidra pmi png pasirnyaputih bersih,$mrmg-ganangyang menghijar4bsft yangkaya dengan


tful ih, kelrnikanbudayatradisionalyangrli, tempat-tempatb€rsejarah,sertabangunan
p#- trrgr menjadikanMalaysiapakej yang lenglap sebagaidestinasipehcongan

Nifi hcdrlo dm tuturkatayang lemah-lembutsertalayananmesrapen&duk Malaysiamampu


lgdrr sh yag tinggi kepadanegaraMalaysiarmarkterusdibmjiri pelmcong asingdanpulang
drescrfu kenanganmanisyang sukardilupatan.

myerctrcog hus d[iadikanbudayahidup masyarakatsupayamindate,lhrkaluasmerakam


knfudmsemlajadi ciptaanTuhandanti'lakmeqiadisepertikatakdibawahempurmg

24. Khazanahalamyang tersaji indahharusdipeliharasupayagenerasiakandatangdapatterusmenikmati.

25. Parapelajaryang sedangmenuntutdi luar negaraharusbertindaksebagai&sa kecil negarauntuk


negaraMalaysiasebagaidestinasipelanconganyag rrmft
mempromosikan mtuk dikunjungi-

NegaraMalaysiaperlu mencontohiregara Swizerlandyangmeqiadikm tc€e pelancongankesihatan


sebagaisumberutamak€padapertembmganindustri pelmmgn cgra

27. Hutansimpananyang t€dapd di negra ini sepertiTamm l{egre f*nompin dan Hutan
SimpananSepilokd4* m#m pehncongterpukauoleh birfu panoramaalam semulajadi.

28. Bekerjalima hari aa r smingu dapatmemberikesempatmkepadamasyarakatMalaysia


mengambilkesempatrnmereFa€la fikiran bersama-same
kclu-gFp€rgi melancong.
\l

KementerianPerdaganganDalamNegeri dn Hal Ehwal PenggunadanKementerianPerdagangan


Antarabangsaakanbekerjasamauntuk menjadikanlebih banyakbarangpsnggunadikecualikancukai
supayamenjadikanMalaysia'osyurgabeli&h" terbesardi Asia Tenggara.

16. Kerajaanbercadangmemperkenalkan penggmaankad pintar danpasportserbagunabagi


menggantikan pasportsediaadadalamusahamenggalakkanlebih ramaipelurcongAsia melancong
ke Malaysia

t7- Keceperlanganindustri pelanconganMalaysiabanyakdikaitkan denganfaktor alam sekitar,sejarah


dankehxhpan.

18. KeistimewaandestinasipelanconganMalaysiayangmenggamitpelancongmenjadikanindustri ini


keduaterbesarkepadapendapatann€gara-

19. Pengahm melihatkelip-kelip di jeti Kuala Sehgor padawaktu malamtelah menjadidayapenarik


kepedapelmcmg asing-

Sdrm pehcmgan dijangkaterusmenjaditunjmg KeluaranDalamNegaraKasar(KDNK) dan


membm nemulihkan kegawahnekonominegila.

2t. Fersilira 'lrei yangpasirnyaputih bersih,gmrmg-ganangyang menghijarl tasft yangkaya dengan


tlgd h, keunikanbudayatradisionalyangasli, tempat-tempatbersejarah,sertabangunan
ptre krgit menjadikanMalaysiapakej yang lenglap sebagaidestinasipehcongan

Nifri bcdn dm tuturkata yang lemah-lembrfsertalayananmesrapen&duk Malaysiamampu


EFfi sh yag tinggi kepadanegaraMalaysiaunarkterusdibmjiri pelmcong asingdanpulang
ldrrscrfu kenanganmanisyang sukardilupatan.

mye @ hus d[iadikanbudayahidup masyarakatsupayamindate,rhrkaluasmerakam


ker&almsemlajadi ciptaanTlfian dantidakmeqiadisepertikatakdibawahreryurmg

24. Khazanatralamyang tersaji indahharusdipeliharasupayagenerasiakandatangdapatt€rusmenikmati.

25. Parapelajaryang sedangmenuntutdi luar negaraharusbertindaksebagai&fa kecil negarauntuk


negaraMalaysiasebagaidestinasipelanconganyag rrremft mtuk dikunjungi-
mempromosikan

26. NegaraMalaysiaperlu mencontohiregara Swizerlandyangmeqidih km€e pelancongankesihatan


sebagaisumberutamak@a pertembmganindustri pelmcmgn EgrE-

27. Hutansimpananyang t€dapd di negrd ini sepertiTamm l{egrr f*nompin dan Hutan
SimpananSepilokdapa m#*m pelancongterpukauotehheirfu panoramaalam semulajadi.

28. Bekerjalima hari ae r semingu d4at memberikesempatmkepadar*syarakat Malaysia


kclu-g pcrgi melancong.
mengambilkesempat*nmerrFd€km fikiran bersama-sama
-l

Alam Sekitar

l' *Rakyat Bersih Negara Sejahtera" dan "kebersihanitu sebahagim


daripada iman . Demikianlah slogan
murni yang mendidik rakyat supaya menghargai kebersihan.

2. Kemusnahanalammsekitardisebabkansikapkerakusanmanusiayang
sehinggasanggupmenggadaikan v gtlairah
! mengejarkebendaan
nilai-nilai kemanusiaan

Hasil kajian membuktikan pokok sejumlah500,000pokok dapatmenyerap6,500


habukatausatutan metrik -peyPman tan metrik
habuksetiapZ7 pokok.

4' Hasil kajian menunjulkan bahawakawasanseluas40 meterpssqli


ditarnm d€nganpokok rendang
dapatmengeluarkancukupoksigenrmtukpernafasu r"o*r,i ro.o*i.

5' Di Malaysiq pengurusan hutanmapanbrjunryp*Sp 20jdah€khratar6l peratusdaripada


negaraini diliputi hutanhujannopika termasuk5 juta hercarhirtan
siryman kekai.
6' Manusiatidak sewajarnyamenyeksa,menganiayaataumemusnahh
mr;hht alamsemata-mata
untuk memuaskanego dannafsu.

7' Hargailahkhazanahalam yangmerupakmkurniaanTuhanyang


ti"da bilga bmdingnya walaupun
kekayaanduniamenjadiganti.

8' Secarapurat4 Malaysiame,nerimatabutanhujan tahnnansekiEr


3,0fi) milimaer. Jadinegaraini
dianggapmewahsumberair-dansebagai y"t, aru- memastikankemewahan
ini berkekalanzupayanasi! kita tidak-menj"lu
"t -"ouffiGg
J"p*i k t"rk mari ketaparan,itik di air mati
kehausan,suatumasananti. "vLE

9' EnvironmentFile, oxford New York medaryi puratap€,qggunaan


air setiapindividu ialah11peratus
bagi kegunaanmencucuidm nandi, 2+Nbagpryt""o""fz"z.
urgi lHin basuh, l4&bagiminuman
dan memasah lo%bagimembasuhsayuro*
ri.t*"t** irr-"ii* sz untuk kegiatanberkebunrran
mencucikereta
- .*:,r
r' l0' DewanBmdaaya Kuala Lumpur dilaportan memperuntukkan
RMl0 juta setahunbagi kerja
penyelerggraan sunpi di ibukota tepoti-.*t"oftk;;;p"h
sarapyang dibuangke sungai-
I l' Jabaa Pengairandan Saliran(JPS)memerluh juta bagi membaikpulih 35 muarasungai
150bahg sungaidi seluruhn€garayangmengha@i \Ivtl0o dan
masatanJenoapan.
12' Kilang perindustrianyang-mengeluarkan
gaspmar akanmemerangkaphabainframerahsehingga
menyebabkanberlakunyakesanrunah hijau seFusnya
meningkatkansuhudunia
13' Peningkatansuhudunia akanmenyebabkanglasier
di Kutub utara mencairlalu meningkatkanaras
laut' Banjiryang berlaku di Negerachina din B-elad;;l"fri"u
daripadakeadaanini.
14' Bahanbuangansepertiplastilq bekaskacadan
besiburuk mengambilmasamelebihi 15tahununtuk
reput.

15' Di Jepun'pingganmangkuk"plastik" yang diperb'at


daripadabahanpertanianakanmengurangkan
sampahsarapkeranamudahreput.

16' Di Malaysi4 sebuahloji rawatanterrral telah


dibina di Broga selangoruntuk melupuskansisa
bertoksiksebelumsisaitu dibuang.

17' sesungguhnyaalam sarwajagatyang dicipta


kesejahteraan i"i {"1+ anugerahTuhanyang tinggi nilainya untuk
hidup manuiiJoan manrroi. ruin. B;.d.Jd;iil uJuuituanugerahtersebuidiperkosa.
r:
i BidangPendidikan

I l. KementerianPelajaranmeletakkansasaftrn60elopelajaraliran sainsdanteknologi bagi menampung


juruterasebanyak20,000menjelangWawasan2020.
keperluan

2' BahasaInggerisialah bahasaantarabangsa


bahasapelancongarL
yang merangkumibalnsaperdagangarq
bahasapenyelidikandan bahasahiburan-
bahasaindustri,

3. Malaysiaharusmembuatlonjakandan anjakanpamdigmauntuk mencapain€garamaju dalambidang


pendidikan. Jika tidak, masyarakatnegaraini akangagalbersaingdi peringkarantara"bangsa
dan
tersingkirdi pentasketamadunanduniasejagar.

4- PenubuhanPusatInternetDesaadalahlangkahbersepaduantaraagensiarvamrtanswastauntuk
memastikanrakyatdi semuakawasanmendapatfaedahdaripadaprrkernbanganteknologimaklumat.

5. Pembacaan
ialah ejenpembangunan
yangpaling sesuaidan berkesanr-uh.* rtiemalkan.

6. Alam pendidikanmerupakanntahapterpentingdalampedalananhidry indir*fu rmtukmenjadi insan


kamil.

7. "Maklumat di hujungjari andadankuasamaklumatmerentasidrmir


@a sempadan,,.Demikianlah
antaraungkapanyang seringberlegardalamkehidupanmasaini.

8. Guru ialah insanpenyuluhalamdan menjadiobor untuk menyinai insan@pgsamenyatakan


segala
kebenaran.

9. FalsafahPendidikanNegaratelahmenggariskanernpatmekanisneutamadalamusahamernbenfirk
insanyang seimbang(syumul) danharmonisiaitu aspekjaqrvrani,emosi,rohanidan intelek.

10.Dalamera globalisasidral kemajuanpesatnegarapadawakurini, kemampuanuntuk menguasai


4an
berkomunikasidalampelbagaibahasamerupakansatukelebihanyangculup istimewabali
memperkayapembangunanmodal insan..

1l' KementerianPelajaran-bercadang
memperkenalkan tiga bahasaantarabangsa
kepadapelajar sekolah
berasramapenuhiaitu bahasaKorea,bahasaRussiadin bahasasepanyol.

12.KemampuanEn MahadzirLokmanbertuturdenganfasihdalambahasaInggeris,
bahasaperancis,
bahasaSepanyolselainbahasaMelayu menyebabkanbeliau dilantik sebagFpengacara
pelbagal
persidanganperingkatantarabangsa.

13.PerdanaMenteri,Datuk SeriNajib Tun Razakpernahberkata* kemahiranberfutur


dalampelbagai
bahasayang adanilai ekonomiberupayamembintu negaramewujudkansatujalinan hubgigan
dengancarayangmudah',

14.Menwul satupenerbitanbgrj_udul
Etbnologue:I-anguagesof theWorld,terdapat6"9i2bahasa
masihdigunakandi seluruhdunia. TerdapatenanTbahLa rasmiyarg digunakandalam
setiap
persidangan
duniaialahbahasaInggeris,Ferancis,Russia,cina, sepanyoldan,Arab.

15' Sekolahbukanpenjaradanbukankem tentera. Sekolahialah ternpatyangsubur


' untuk menyemai
ilmu danbudi melaluiguruyangpenuhdedikasi.

16' Generasimudahari ini ialahgenerasiyangmembesardi depantelevisyen,


telinga dihibur dan
didendangkancorongradio danmenatapkepelbagaianrancanganrnediayangpinyai
dayatarikan
yangkuat kuat.
17' IPTS ialah pusatpengajianntilik penuhpihakswastayang ditubuhkan
di bawahAkia pendidikan
swastayangtelahdiluluskanolehparlimenMalaysii daiamtahunt997.

l8' Di-negaraini terdapathampir700 buahIPTS


lar,g telahhdiluluskanpenubuhannya oleh Kementerian
Pelajaran-Antaranyq Kolej Stamford,Kolej sunway,Kolej DamanJara
utama, kolej Segi,
Kolej Nilai, Kolej PTPL,Kolej cosmopoin{universitirettg*uran Malaysia,
universiti Multimedia
danUniversiti lndustri Selangor.

19' KewujudanIPTS yangrancakbagaicendawan- urmbuhselepashujantetahmembukapeluangseluas-


luaskepadaparapelajaruntukmelanjutkanpel4iaran.

20' Aktiviti kokurikulum berbentuklatihansukandanpermainandapatmelahirkan


pelajaryang
r ' sihat
sepertikxa peribahasaotak yang cerdasdatang&ripada badanyang sihat

2l' PersahrmIbu BapadanGuru (PIBG) telahditubuhkandi semuasekolah


di negaraini semenjaktahun
1973.

22. SekolahselamatyangdiperkenarkanolehKementerianpelajarandapat
ditahiftan sebagaisuatu
persetimm sekolahyang selamatyangwarganyatidak merrdapatgangguan
fuipadu *iou-**u
pihak sarrraadadi dalammahupundi luar.

23' MembacaJmbaan Ilmu seringdilaungkanoleh parapanimpin kita


denganhrapan rakyat akan
t€rhka bdi rmhrkmembacapelbagaibahanyangbafaedah.^

24- orq un+ra dahulupernahmengungkapkmtuntutlahilmu sampaidi negara


china
Z5- Ircrm yag menjadiperkaralumrahpadaabad-!e-21ini harusdiperguna
dengansebaiknya
kcraa terdaA makhmat yangtidak terpemanaibanyaknya.

anakga! ranq belajardi sekolahrendahhari ili adalahsebahagian


daripadajutaan generasimuda
yangbakal menjadiisi masyarakatsatulagi revolusi aunia-temoToliiuer
atauduniatanpasempadan.
Gry menunjulftanteladan
!* {an8 baik kepadaparapelajardanjangan
J--< menjadiseperfikata
peribahasasepertiketammenyuruh anatnyaUe4atanbetul. "

90 peratuspencapaian dan l0 peratuspenglibatandalamaktiviti kokrnikulum sebagai


t4:*it
prasyaratuntuk memasuki IPTA mula dikuatkuasakanolehKementerianpelajaranmulai tahrin
zooz.
Guru berperananpentingmendidft parapelajardenganmenjgtiken
diri merekasebagaimodel dan
ikutan- Janganjadi see€rtito perranasaguru lrcncingb*di,i,
r.ncing berlari.
-,nia
Sasterawan NegaraDatuk shahnonAhmadpernahmengungkapkan *Saseraitu
cerminmasyarakaf,.
Pengorbanan
danjasa gum-ry
F*it"i danpatut dihargaikeranameka dapatdiumpamakanlilin
yangsanggupmembakandiri demi renermgi oranglain.
G.lru pgrlu mempamerkansikap rrementingkanbudayailmu kerana
dalamsebuahhadisada
dinyatakan"Jikalau hendakkebabagiaanau"ia, tundlah ilnrg jikalau
hendakkebahagiaanakhirat
tuntutlahilmu danjikaMak tuntutlahihnu-
Bidang Kesihatan

l. Sebanyak200 jenis makanansegeraseperti mi segera,minuman bergas,gula-gul4 coklat dan burger


dilaporkan menjadi punca pelbagai penyakit kritikal di Malaysia

2 Pewamayang sering digunakan dalam makanansegeraialah Blue VRS (menyebabkanbarah, lelah,


muntah dan alergi), Orange GGN (menyebabkan bmah), Ponceau 4R (menyebabkan barah, bengkak
tisu, alergi dan lelah), Amaranth (menyebabkanbarah, lahir cacat), Green S (menyebabkanbarah)

3. Perasamonosodium glutamate yang digunakan dalam perencahmi segerajuga berbahayakepada


kesihatan.

4. Tabung Kanak-kanak PertubuhanBangsa-bangsaBersatu (LJNICEF) rnenjelaskanbahawa kematian


65,000 kanak-kanakdi Teluk Parsi berumur lima tahun ke bawah pada tahun 1985 akibat mengambil
makanansnek dan minuman.ingan.

5. Kacang soya menjadi sumber protein yang unggul kerana dapat membekalkansembilan asid amino
dan beberapajenis vitamin seperti vitamin B, K, E, zink dan kalsium.

6. Menurut pakar perubatan San Francisco Amerika Syarika! amalan memakan makanan segera boleh
menyebabkan saluran darah tersumbat dan sakit jantung. Kentang goreng rlan pizza mengandungi
lemak beroksida yang boleh merosakkan tisu dan genetik dalam darah.

7. Menurut Daniel Goleman dalam bukunya Emotional Intelligence - seseonmgyang mengalami


gangguan emosi, kesedihan dan kebimbangan yang berterusan akan mudah menghadapi risiko
sakitjantung, sakit kepala dan ulser peptik.

8. Kira-kira 3,000 rakyat Malaysia yang berumur lebih 40 tahun mati setiap tahun akibat sakit janrung
Dari segijantrna,TTYolelaY.t,23Yoperempuan. 65% berpuncadaripadamerokok.

9. Kerajaantelah melancarkanDasar Kesihatan Remaja Kebangsaanpada Jrm 1998 untuk melahirkan


remaja sihat dan bebas daripada ancaman-_kpsihatan.

10. 80% penyakit berpunca daripada makanan.

I I . Amalan senamandapat mengurangkan risiko penyakit jantung dan darah tinggi. peribahasa ada
menyatakan mencegah lebih baik daripada mengubati.

12. Penyakit JE atau JapaneseEncephilitis merebak kerana kawasan sekitar kandang khinzir yang
kotor. Kesannya berprrluh-puluh orang penternak khinzir terkorban di Kampung Nipah dan
Kampung Pelanduk di Negeri Sembilan.

13.80% lelaki rakyat Malaysia ialah perokok.

14. Setiapbatangrokok mempunyai 4,000 jenis bahankimia termasuk nikotin. kadmium. arsenit.tar.
dan karbon monoksida.

15. Amalan menjamu seleradi restoran makanansegerasudahmenjadi fenomenabiasa masyarakat


Malaysia pada masa ini. Antara jenama yang tidak asing lagi ialah A & W, Kentucty EiieA
Chicken, McDonald's, PizzaHut, Grandy's, Shakey's Pizza,Sugar Bun, Starbuck dan sebagainya.

16. Otakyang cerdasdatang daripadabadanyang sihat

l7 . 20% daripadapenduduk Malaysia menghadapimasalahkegemukan dan l}%terdiri daripadapelajar


sekolahrendah danSYopelajar sekolah menengah.
daripada harta kekayaan'
18. Kata para pujangga kesihatan lebih berharga

19. Kataorangtua-tuasediakanpayungs-ebglum'[ujan.olehyangdemikian,kitaharusmengamalkan
fizikal atau mental'
kehidupan yang sempurnutu*u adi dari segi

menjagakebersihan makanandan persekitaranselarasdengan


20. Masyarakatharus sedar akan pentingnya
sloganNegara Bersih Rakyat Sihat'

Dr' Sallehudin Abu Bakar menjelaskanbahawa "Amalan


2l. Pegawai PerubatanKementerian Kesihatan lebih murah
pencegahanuurun Juiu U"rt dari segimeingkatkan kesihatan malah kosnya
"r*
berbandingdenganrawatan'

22.KajiartDiabetesKebangsaanmendapati50Towanitatidakmelakukansenamandenganmemberialasan
tidak memPunYaimasa'
ini boleh
50 tahun' tulangnya lebih cepat reput dan keadaan
23. Kebiasaan oarng yang berumur melebihi
membarra maut-
diatasi
perlu diambil agar penyakit-penyakit berbahaya dapat
l-t- t-angkah 1"angproaktif dan pragmatik
hin$a akar umbi.
dua peringkat iaitu peringkat pengetahuan
t-i. lv{enunr pakar kesihatan, ilmu kesihatan terbahagi kepada
Om peringkat amalan.

16.trfasalahkesiharandarisegimental,emosi,sosiafjasmanidanfizikalbolehmenggugatkeharmonian
kearnananhiduP masYarakat'

kit4 tetapi penyakit berbahaya boleh meranapkan


27- Api kebakaran sekadar merosakkan harta benda
t"madrn bangsa-
diri dan janganlah sudah terantuk baru
28- Kita tidak boleh memandang enteng terhadap kesihatan
hendak tengadah.
dengan ancamanpelbagai
menuju era modenisasi, rakyat kita tidak terus alpa
-29. Dalam kerancakan masyarakal
t; penyakit berbJuyu y-g uoleh menjejaskan kesejahteraan

walaupun menerima persaingan dan asakan


30. Perubatan tradisional masih mampu bertatran
perkembangan drastik perubatan moden'

akupuntur dan ubat-ubatan sinseh sejak berkunm-


31. Masyarakat Cina terkenal dengan kaedah rawatan
kurun lamanYa.

l1 yang dialami selepasmakan makananyang tercemar' sama


32. Keracunanmakanan ialah suatu peny-akit
adayangtercemarotehbahankimi4logam,mik'oo'gu',ismaataupunfumbuhanberacun.

l Penyakityangdihidapiadalahdaripadaperbuatanatautabiumanusiaitusendiri.
'

I'l
penyakit ]ang tidak pernahkita dengar seperti
3 +. Gaya hidup moden turut mengundangkemunculan
stress.imsomnia dan sebagainl'a-

500 hing-ea600 milileter peluh sehari' Orang


35. Dalam keadaanbiasa kita mengeluarkankira-kira
dewasa memerlukan 8 hingga 12 gelas air sehari'

I 36. Nyamuk sudah menjadi sinonim dengan ancaman


penyakit berjangkit seperti demam malaria' dan

I demam denggi'
daripada harta kekayaan'
18. Kata para pujangga kesihatan lebih berharga

19. Kataorangtua-tuasediakanpayungsgbglum.[ujan.olehyangdemikian'kitaharusmengamalkan
fizikal atau mental'
kehidupan yang sempurnutu*u adi dari segi

menjagakebersihan makanandan persekitaranselarasdengan


20. Masyarakatharus sedar akan pentingnya
sloganNegara Bersih Rakyat Sihat'

Dr' Sallehudin Abu Bakar menjelaskanbahawa "Amalan


2l. Pegawai PerubatanKementerian Kesihatan lebih murah
pencegahanuurun Ju;u U"rt dari segimeingkatkan kesihatan malah kosnya
"r*
berbandingdenganrawatan'

22.KajianDiabetesKebangsaanmendapati50Towanitatidakmelakukansenamandenganmemberialasan
tidak memPunYaimasa'
ini boleh
50 tahun' tulangnya lebih cepat reput dan keadaan
23. Kebiasaan oarng yang berumur melebihi
membarta mauL
diatasi
perlu diambil agar penyakit-penyakit berbahaya dapat
l-t- t-angkah 1"angproaktif dan pragmatik
hing€a akar umbi.
dua peringkat iaitu peringkat pengetahuan
t-i. Menunr pakar kesihatan, ilmu kesihatan terbahagi kepada
Om peringkat amalan.

sosial jasmani dan fizikal boleh menggugat keharmonian


16. il{asa]ah kesiharan dari segi mental, emosi,
kearnananhiduP masYarakat'

krta' tetapi penyakit berbahaya boleh meranapkan


27. Api kebakaran sekadar merosalkan harta benda
tamadmbangsa-
diri dan janganlah sudah terantuk baru
28- Kita tidak boleh memandang enteng terhadap kesihatan
hendak tengadah.
dengan ancaman pelbagai
menuju era modenisasi, rakyat kita tidak terus alpa
-29. Dalam kerancakan masyarakal
t; penyakit berbJuyu yuog uoleh menjejaskan kesejahteraan

walaupun menerima persaingan dan asakan


30. Perubatan tradisional masih mampu bertatran
perkembangan drastik perubatan moden'

3l.MasyarakatCinaterkenaldengankaedahrawatanakupunturdanubar-ubatansinsehsejakberkurun-
kurun lamanYa.

1i
I
yang dialami selepasmakan makananyang tercemar' sama
32. Keracunanmakanan ialah suatu pen-vakit
adayangtercemarolehbahankimi4logam,mik'oo'gu',ismaaraupunfumbuhanberacun.

. Penyakityangdihidapiadalahdaripadaperbuatanatautabiarmanusiaitusendiri.

I
penyakit ]ang tidak pernahkita dengar seperti
3 +. Gaya hidup moden turut mengundangkemunculan
stress.imsomnia dan sebagain-va

500 hingga 600 milileter peluh sehari' orang

I l
35. Dalam keadaanbiasa, kita mengeluarkankira-kira
dewasamemerlukan 8 hingga 12 gelas air sehari'

36. Nyamuk sudah menjadi sinonim dengan ancaman


penyakit berjangkit seperti demam malaria' dan
demam denggi.

\
Bidang Ekonomi dan KePenggunaan

l.MenurutPertubuhanPenggunaAntarabangsa(lco),parap€nggunamempunyaihak-hakasasitertentu
paXalan'kesihatandan pendidikan
*uf*un,'pi*mahan'
iaitu hak mendapatkeperluan asasseperti
sesuatubarangan'
U"tt""fi i serta maklumat yang tepat tentang
sebelumkena jimat
berjimat cermat seperti kata peribahasaingat
2. Penggunaharus bijak berbelanja dan
sebelumhabis-

3- Penggunaankadkreditsecaratidakterkawa|mengundangSeseorzrngitudibebankandenganhutang
keliling pinggang.

4. Keghairahanmembeli-belahterutamapadamusimperayaansebenuT{udiruntunolehhawanafsu
ditam periUatrasakalau ikut hati
yang akhirnya jatuh k. l;il k;;p; *p"til;;;lrngkapkan
mati. kalau ikut rasa binasa'

5.Sikappenjuatyangsengajamenaikkanhargabaranganpadamusimperayaanbo|ehdianggap
menangguk di air keruh'

6.Masyarakatharusmempunyaijati|ilyalg.Suatuntukmengekanghar*anafsukebendaandan
padahari mendatang'
memikirkan kemungkinan y*g Uukutterjadi
akhir akan menyukarkan orang ramai mengawal
7. Kecenderungan membeli-belah pada saat-saat
mata kerana banyak benda yang hendak dibeli'
perbelanjaan dan mereka menladi rarnbang
sftap sediakan payung sebelum hujan'
g. Sebagai pengguna, sepatutnya kita merancang dan mengamalkan
penawaran
harga barang akan naik apabila permintaanmelebihi
9. Teori ekonomi menjelaskan bahawa tenag. tanah) dengan harga yang
input fseperti modal
barang iuito p"oguruiru p"ri.r*"-p"rorJn
teUitr mahal untuk mengeluarkan bekalan tambahan'
kempen
d4n penyelidikan untuk Pengguna' M Marimuthu'
10. Menurut Presiden Persatuan Pendidikan
1975'
Leli baranganbuatantempatan sejak tahun
melalui
sdn Bh4 60 o/owarga kota membeli barangan
I l - Manunrt kajian Taylor Nelso Store Malaysia
lntemeL
oleh kuasa
ekonomi bebas iaitu harga barangan ditetapkan
12. Negara Malaysia mengamalkan sistern tangan dan
a*.n"t-ioO* dan kerajaan hanya boleh camp'r
pasaranberd**d;"";;;"
barangan kawalan dan berlaku kes menyorok barangan'
i"rti"a"t:if."
-"fiUif.*
Syarikat dan Jermanmempunyai budaya suka
13. Rakyat di negara seperti Jepun,Korea, Amerika
menabungYang sangattinggi'

yang kita miliki menjadi bentenguntuk mengawal


14. Biarlah nilai dan peganganmensyukuri apa-apa
tabiat kita Yang suka berbelanja'
sepenuhnyakerana tiada
bahawa purata 5}Yob:tlnt yang dibeli tidak digunakan
-- Kaj ian mendapati
I 5.
untuk perhiasan-
p".un"*gun ,"u"tu- pf*i.riu" dan sebahagianhanl'a digunakan

membebankanhidup rakyat yang kais pagi makan


16. Tekananhidup yang semakin meningkat akan
pagi, kais Petangmakan Petang'

penggerakkepada sektor ekonomi dan kenaikan


17. Minyak merupakanbahan asasyang menjadi nadi
sellor ekonomi negara.
hariaminyak akan memberi kesan langsung terhadapp
r
Bidang Pengarg$fu KeselamatanJalan Raya \

l. Kerajaanjs![*eatan Pelan KeselamatanJalan Raya Malaysia untuk mengurangkankematian


di jalan r4'e tffi penunggangmotosikal.

2. progrr ffi Keselamatan Jalan Raya diajarkan kepada murid tahun satu sekolah menengah
muhituil.

3. perffiHg Motor terutamapelumba haram kini semakin ganasdan agresifjika aktiviti mereka
trfiff;&lang oleh sesiapasahaja"hatta orang kenamaansekalipun-

+- FurNq--sriah yang seimbang perlu diterapkan kepada pemandu baham agar mereka tidak
!#tff di jalan raya atau pencetus kemalangan maut.

S, ffr16fu oleh Majlis KeselamatanJalan Raya mendapati 600/okemalanganjalan raya


rcng motosikal yang berusia ant^ra l7 hingga 30 tahun.

6- ffit6}t1n Sedunia (!VHO) mendapati bahawa kematian akibat kecelakaanjalan raya


rfflrylketiga iaitu selepaspenyakit jantung dan tekanan.

T- 3fr,lqndiban, kesengsaraan,kesakitan dan kerugian akibatkemalanganjalanraya dianggap


H ff3i rrt51* Malaysia, seolah-olah satu fenomena-

t- frgp bi-bti di jalan raya merupakan slogan yang sering berkumandang di media massa khasnya
dcffi 4abila menjelangnya musim perayaan'

9- prepmih h'us senfiasa mengambil sikap berhati-hati semasamemandu di jalan raya kerana
nnllngridzk berto-

10.Jmgm bialm kepulanganberhariraya di kampungdisambutdengantangisanorangyangtersayang.

11.AmalkanlahperitahasaMelayuyarg berbunyiingat_lebelumkerq jiqqr! sebelumhabisdan sesal


dahulu pendapatan, sesal kemudian tidak berguna lagi.

12. JabatanPengangkutan Jalan (JPJ) mendapati nisbah kenderaan denganjumlah penduduk negara ini
ialah setiap dua orang rakyat Malaysia mempunyai sebuahkenderaan.

13. Pelumba haram boleh dikenakan hukuman di bawah Seksyen 279 Kanun Keseksaan iaitu hukuman
penjara penjara enam hrh dm deoda RM2,0O0 atau kedua-dua sekali.

14. Pihak polis mendapati s€masapehmrba-pelumba haram ditahan, kebanyakan mereka berada dalam
keadaan khayal dengar perama ti<lak teratur dan mata mereka j"ga berair.

15. Kebanyakanpemandudi ialm raya pada masa ini sudahhilang nilai-nilai kemanusiaanseperti
sikap sabar, bertolak msr dan bertremah tinggi.

16. Masalah kesesakanjahr raya terutama di bandar-bandar besar sebenarnyaberpunca daripada


pemandu yang bersftry bagai enau di dalam belukar melepaskan pucuk masing-masing.

17. Kempen KeselamatanJalan Raya harus dijalankan sepanjangmasa dan bukar sekadarhangat-hangat
tahi ayam atau melepaskan batuk di tangga iaitu tertumpa pada musim perayaan sahaja

18. Janganjadikan jalan raya di Malaysia sebagai gelanggang maut

19. Pihak berkuasa tempatan perlu benikap prihatin terhadap keadaanjalan rayayangada dan jangan
bersikap sudah terantuk baru tengadah iaitu baru hendak bertindak apabila berlaku kemalangan maut.

*,
18. Kitar semulaadalahprosesyang melibatka 3R iaitu'?educe", reusedanrecyle" (kurangkan,guna
semuladankitar semula)ke atasbaranganpng bolehdikitar semulaseperti kertas,kaca"aluminium,
logamdanplastik.

19. Moto atauslogan"fikir dulu sebelumbuangl mempunyaimaksudtersirat iaitu memintakita


memastikanhanyasampahyangtidak bolehdigunakanlagi dibuangmanakalasampahyang boleh
digunakandikitar semula.

20. KempenKitar Semulamula dilancarkanpadatahun 1993oleh KementerianPerumahandan Kerajaan


Tempatan.

21. Hasil kajian mendapatisetiappendudukmenghsilkan 1.5kilogram sampahsetiaphari atausecara


purata15,000tan sampahdihasilkanseharidi seluruhnegaraMalaysia

22. W;lrrrggakini30PihakBerkuasaTempatan(PBf) telahmengedarkansebanyak2,400tong kitar


semuladi selunthnegar:L

23. Hum mah hijau di Malaysiamerupakankhazanahalamsemulajadi yangtertuadi duniayang telah


mcnjangfrauusiamelebihi 100juta tahun.

24. H1;1mmalr hijau negaraini dianggarkanmemprmyailebih 8,000spesiestumbuhanberbungadengan


?,650+eskx adalahterdiri daripadapokok.

25- Penebmgmpokok tanpakawalan akanmenimbulkanmasalahhakisan,tanahnrntuh,pencemaran


sq!i, twrjir lumpurdan peningkatansuhusetempal

26. Dimgartm ?5/o daipadaubat-ubatmodendiambil daripadasumberhutan-

27. Ifai Brmi nula dirayakanpadatatrun1970dandisambutsetrap22 April. Tujuannyaadalahuntuk


menyedarkan duniabahawahanyaplanetBumi inilah satu-satunyatempatkediamanyang
harus dip€rtahankm supayaterusmenjaditempatyang sihatdan untuk
selesa diwaisi generasiakan
datangturun-temunm.

28. Jagalahsungaisepenuhjiwa, jagalahlaut dan lautansepenuhjiwa keranahidrp ataumatinyakawasan


di tangankita selakukhalifah di mukabumi ini.
lautanbumi ini terletaksepenuhnya

29. PengarahProgramAlam SekitarPernrbuhanBangsa-bangsa B€rsatu(tlNEP) pernahberkata"Kita ada


smpi tr*api mengpa kita memilih untuk
pelbagaiteknologiuntuk memulih dan menyelamaflcan
membunuhsungaiini?"

30. Lautanialah sumberkehidrrym da meliputi 706/odaripadapemukamhmi. Daripadajumlahitq


97.2oAterdiri daripadaair lart (air masin) 2.2o/oterdinfuipada ais danglasierdffi0.7% air tawar
(sungai,tasik dan air bawahtunah)

Manusiaharussedarbqa hidp ffi€ka bergantungpadadm smula jadi dan sepatutnyaberterima


kasihdan memanja*m kesyrftrran kepadamahaPenciptaalaskharrnah alamyang dianugerahkan.

kemanusiaandanmahumenjadi
Manusiahari ini telah bertirulakmelampauibatas-batas
"sr-lperspesies" iaitu mahuberkrnsake atasapa-apasahajayang adadi mukabumi ini.