Prosiding
Seminar Kimia Bersama
Joint Seminar on Chemistry ITB-UKM
ITB-UKM Keenam
“Perkembangan Terkini Ilmu Kimia
yang Berlandaskan Kajian Sumber Alam”
05
20
I-
V
JSChem ITB-U KM
Departemen Kimia
Fakultas Matematika dan Ilmu Pengetahuan Alam
Institut Teknologi Bandung
Penyuntingan semua tulisan dalam prosiding ini dilakukah tim editor Seminar Kimia
Bersama ITB-UKM Keenam 2005
Kata Pengantar Tim Editor
Hormat kami
Tim Editor
Proceeding Seminar Bersama ITB-UKM ke-6 tahun 2005
Bandung, 12 Mei 2005
i
Daftar Isi
Daftar Isi ii
Isolasi, Pemurnian Dan Karakterisasi Katalase Dari Buah Apel (Malus Sylvestris Mill.
Kultivar Rome Beauty) sebagai Biomaterial Sensor
A. A.Istri Ratnadewi, Zulfikar, Muhammad Naqib 1
Preparation and Characterization of High Surface Area MgO and The Stability Study of
Cypermethrin
Abdul Rahim Yacob and Hanis bt Mohd Yusoff 27
Tingkah Laku Kakisan Aloi Al-Zn Dan Al-Zn-Mg Dengan Unsur Pengaktif Sn Di Dalam
Air Laut Tropika
Abdul Razak Daud, Mahdi Che Isa, Muhamad Daud, Mohd Yazid Ahmad 34
ii
Kajian Jangka Hayat Dan Penerimaan Produk Bakteri Jenis Pre-proven, Pra-bakar Serta
Thaw And Serve
Norrakiah Abdullah Sani, Abdul Salam Babji, Nurakmal Othman, Norazam Hassan,
Norhayati, Abdullah dan Nor Anisah Abdullah 53
Aktivitas Antioksidan Senyawa Fenolik Tipe Baru yang Dikatalisis oleh Enzim Laccase
A. Herry Cahyana , Siswati Setiasih, Rossi M.T, Noorlela 60
Pengaruh Temperatur dan Inhibisi oleh Natrium Nitrit dan Natrium Asetat Terhadap
Laju Korosi Spesimen Baja Karbon ASTM 106 Gr B dari Pipa Minyak Unocal
Indonesia, Co.
Achmad Rochliadi, Rifa Rachmah, Bambang Ari Wahjoedi 71
iii
Kesan Suhu Dan Tekanan Semasa Penggorengan Terhadap Ciri-ciri Pengelatinan Tepung
Beras
Salma, M.Y, Maskat, M.Y, Wan Aida, W.M. & Aminah, A. 106
Kajian Kehadiran Platinum, Palladium dan Rhodium Dalam Sampel Debu Jalan dan
Rumput Menggunakan Teknik Spektrometri Jisim Gandingan Plasma Teraruh (ICP-
MS)
Amran Ab.Majid, Hidayah Sahar , Afzana Anum Ahmad Anuar dan
Muhamad Samudi Yasir 117
Ekstraksi Enzimatis Santan Suatu Upaya Menghasilkan Minyak Kelapa dengan Kandungan
Medium Chain Triglycerides Tinggi.
Amril Latif 123
Production and Acute Toxicity Studies Of Fungal (Cunninghammela elegans 2A1) Oil
Rich In g-Linolenic Acid
Ayub Mohd Yatima , Mohd Khan Ayoba, Suriah Abd Rahmana,
Osman Hassana, Wan Mokhtar Wan Yusoffb, Aidil Abd Hamidb,
Mohd Sharizan Ahmad Shahrifuna, Syahida Maarofa 155
iv
Isolasi Dan Identifikasi Bakteri Termofilik Penghasil Enzim Lipase Dari Kompos
B. V. E. Viera, F. Madayanti dan Akhmaloka 164
Genetic Variation of Malaysian Banded Leaf Monkey Inferred from Mitochondrial DNA
Cytochrome-b Sequences
Badrul Munir Md-Zain, Vun Vui Fui1, Zainal Zahari Zainuddin, Mahani Mansor
Clyde 165
Heavy Metals Migration Beneath Unlined Waste Disposal Site At Dengkil, Selangor,
Malaysia
Abdul Rahim Samsudin, Bahaa-eldin Elwali A.Rahim , Wan Zuhairi Wan Yacob,
and Abdul Ghani Rafek 170
Pemanfaatan Zeolit Alam Sebagai Fasa Diam Kromatografi Lapis Tipis Pada Pemisahan
Hasil Ekstraksi Tar Batubara Dengan Pelarut Piridin Dan n-Heksana
Bambang Setiaji, Sri Sudiono, Sura Menda Ginting 185
Tiosianat Dan Isotiosianat Dalam Sintesis Terbitan Tiourea Tindak Balas Lama Tetapi
Produk Dan Mekanisma Baru
Bohari M. Yamin 192
Chemical Constituents from the Roots of Goniothalamus macrophyllus (Annonaceae)
Bong Pei Thing, Laily B. Din dan Nik Idris Nik Yusoff 196
Uji Toksisitas Hasil Degradasi Surfaktan Linear Alkilbenzena Sulfonat (LAS) Sebagai
Bahan Deterjen Pembersih
Budiawan, Yuni Fatisa 199
v
Pembuatan Membran Selulosa Asetat dari Pulp Abaka (Musa textilis)
C.L. Radiman dan S. Wafiroh 209
Optimasi pH dan Suhu pada Isolasi Minyak Atsiri dari Daun Nilam Pogostemon cablin
Benth dengan Fermentasi oleh Pseudomonas mendocina
Deasyana Mihardja, F. Madayanti 231
Modifikasi Pati Tapioka Dengan Asam Akrilat Dan Akrilamida Sebagai Flokulan
Endang Asijati W, Winda Puspitasari , Yanti Sabarinah S 245
Biological activities of thiophene-hydrazone and the zinc (II) complexes tested on human
normal and cancer cell lines
Endom Ismail, Hapipah Mohd Ali, and Bohari M. Yamin 259
vi
Preparation and Structural Features of Tetraethylene Glycol (EO4) and Pentaethylene
Glycol (EO5) with Neodymium(III) in the presence of Picrate Anion
Muhammad I. Saleh, Eny Kusrini, Rohana Adnan, Bahruddin Saad,
Abdussalam Salhin, Bohari M. Yamin 263
Isolasi Dan Uji Kemampuan Lipolitik Bakteri Isolat Bak Biologis Pabrik Penyamakan Kulit
Evi Susanti, Fariati, Utami Sri Hastuti 283
Pemanfaatan Limbah Padat Pabrik Penyamakan Kulit Sebagai Pupuk Lengkap Organik yang
Potensial
Fariati, Yudhi Utomo, Evi Susanti, Nugrahaningsih 306
Perubahan Citarasa Dan Nilai Nutrisi Keju Tahu Dengan Penambahan Beberapa Intermediet
Metabolit Dan Kapang
F. Madayanti, Lengga Priani, Nurul Qomariah, Hesti Lina, Akhmaloka 309
Assesment of River Water Quality Status By Using a New Developed Water Quiality
Index System
M. A. Fulazzaky and B. Machbub 320
vii
Pengaruh Dosis Iradiasi Pada Khitosan Sebagai Bahan Penginduksi Pertumbuhan Tanaman Cabe
(CacinumAnnum)
Gatot Trimulyadi R, Kadariah, Anik Sunarni, Isni Marlianti dan Dian Iramani 328
Taburan Pb, Cr dan Cu dalam batuan syal Formasi Mahang dan hasil luluhawanya di
kawasan Sungai Merbok, Kedah
Habibah HJ Jamil, Wan Fuad Wan Hassan & Mohamad MD Tan 338
Penambahan Pati Pada Hasil Oksidasi LLDPE dengan Menggunakan Pipet Eppendorf
Hasnah Muin 368
Elektrode Kawat Terlapis Perak/Perak Iodat Sebagai Elektrode Selektif Ion Iodat
Hendyk Krisna Dani, Ani Mulyasuryani, Wiwit Nurhayati, Sri Hidayati 373
Pengaturan Sifat Hidrophilik dan Hidrophobik Membran Silika MCM-41 dan MCM-48
Hens Saputra, Anwar Mustafa dan Mochamad Rosjidi 380
Isolation and Identification of Non Polar Com[ounds from Stem Bark of Saccopetalum
horsfieldii Benn
Hery Suwito, Mulyadi Tanjung, Alfinda Novi Kristanti, Mamik M Q 387
Elektroda Pasta Karbon yang Dimodifikasi dengan Xilenol Oranye untuk Analisis Timbal
Indra Noviandri, Francisca N. Liman 401
viii
Analisis Struktur Hasil Kopolimerisasi dari Monomer b-Butirolakton dan d-Valerolakton
dengan Katalisis Aluminoksan
I. M. Arcana, B. Tanajaya, B. Anwar, C.L. Radiman, dan M.A. Sulfikar 402
Asalan Batuan Serpentinit Di Sepanjang Sempadan Jalur Tengah Dan Jalur Barat
Semenanjung Malaysia
Ibrahim Abdullah & Jatmika Setiawan 415
Effect of food plants on the development, reproduction and feeding behavior of Spodoptera
exigua L. and Plutella xylostella L.
Idris, A.B., Selvi, C., Emelia. O. and Leong, C.K. 431
Kesan Rawatan Permukaan Gentian Aramid Terhadap Sifat Mekanik Komposit Getah Asli
yang Diperkuat Gentian Aramid
Ishak Ahmad, Chen Kee Cheong 453
A Comparison of Two SPE Cartridges Use for the Extraction of Fluroxypyr from Soil
Ismail B. S, Tan Y. A. and Halimah Muhammad 459
Electric Field Enhancement Effect dalam TiO2 Fotoelektrokatalisis: Prinsip Kerja, Konsekuensi
Desain Reaktor, dan Usulan Novel Photoelectrocatalytic Reactor
Jarnuzi Gunlazuardi, Hedi Surahman, Slamet 477
ix
Fabrikasi Elektroda Karbon Pasta Yang Dimodifikasi (EKPM) dengan Kaliks(6)aren:
Perilaku Siklik Voltametri dan Aplikasinya Untuk Penentuan Ion Hg++
Jarnuzi Gunlazuardi, Rahmat Wibowo, Zaenal Awaludin ;
Ros Kusuma Dewi , dan Cuk Imawan 478
Perbandingan Produk Bakeri Dibakar Terus Dengan Produk Bakeri Sejukbeku Serta Dibakar
Abdul Salam Babji, Norrakiah Abdullah Sani dan Khairul Faizal Pa’ee 504
Dua Senyawa Oligomer Reaveratrol Dari Kulit Batang Shorea Parvifolia Dyer.
(DIPTEROCARPACEAE)
Kholifatu Rosyidah, Yana M. Syah, Sjamsul A. Achmad, Euis H. Hakim,
Lukman Makmur, Lia D. Juliawati, Laily B. Din, Jalifah Latip,
Ikram M. Said 508
Total flows contribution of the Tasik Chini feeder rivers and its significant water level,
Pahang, Malaysia
Muhammad Barzani Gasim, Mohd. Shuhaimi Othman and Tan Choon Chek 543
x
Profil Konsentrasi Oxygen Axial Dalam Air Pada Kolom Gelembung Bersekat Vertikal
Secara Eksperimen dan Simulasi
Margono, Hary, Dicky, Basuky S, Revan A 549
Peat Adsorbents Prepared with Natural Rubber Latex As Filter Media For The Treatment
of Domestic Wastewater
M.A. Nawi, S.S.Chow and M.Z. Ibrahim 551
Korelasi Umum Konstanta Henry untuk Sistem Solute Polar dalam Polimer
M. Arif Batutah, Gede Wibawa dan Kuswandi 567
Perbandingan Tahap Penumpukan Logam-Logam Berat dalam Ikan Tilapia dari Tasik-
Tasik Yang Tercemar dan Tidak Tercemar
Maimon Abdullah, Shahani Shahar, Chung Pei Yin, Norela Sulaiman
Aminah Abdullah dan Salmijah Surif 589
Pengaruh Perlakuan dan Komposisi Terhadap Karakteristik Membran Poliuretan dari Asam
Lemak Bebas Terhidrasi dan 2,4 Toluen Diisosianat
Marlina, N.M. Surdia, C.L. Radiman, S. Achmad 604
xi
Application of chemometrics in Environmental Chemistry for Sustainable Utilisation of
Water Resources: Langat Basin as a Case Study
Mazlin B. Mokhtar, Hafizan Juahir, Sharifuddin M. Zain,
Ijan Khushaida M. Jan, M. Ekhwan Toriman, Baharuddin Abdullah, Zaihan Jalaludin 619
Assessment of Natural Radioactivity In Water and Sediment From Tin Tailing Area In
Malaysia
Mohsen Nasirian & Ismail Bahari 640
Kandungan Radionuklid Tabii Dalam Sampel Amang, Tanah dan Air di Sekitar Kawasan
Industri Perlombongan di Dengkil Selangor
Muhamad Samudi Yasir, Amran Ab.Majid & Redzuwan Yahaya 653
Vatikanol A dan a-Viniferin, Trimer resveratrol dari ekstrak aseton kulit batang
DIPTEROCARPUS RETUSUS Blume
Muhtadi, Euis H. Hakim, Yana M. Syah, Lia D. Juliawaty, Lukman Makmur, Sjamsul
A. Achmad, Ikram M. Said, Laily B Din
dan Jalifah Latip 672
xii
Kandungan Kimia Daripada Garcinia mangostana
Muntaz Abu Bakar, Muhammad Sum Hj Idris 683
Ekstraksi Cu2+ Dalam Larutan Nacl Menggunakan Teknik Membran Cair Emulsi Sistem
Aliran Semikontinu
Nikmans Hattu 702
Pengaruh pengerjaan kitosan dan asam sitrat pada kain kapas terhadap sifat fisik kain
Noerati 703
Crystallography in Japan
Nobuo Tanaka 710
Kesan Penambahan Karbon Hitam ke Atas Sifat Mekanik dan Morfologi Adunan Getah
Asli / Polistirena
Norlinda Daud, Ibrahim Abdullah 713
xiii
Senyawa Flavon Terisoprenilasi dan Steroid Dari Kayu Akar Cempedak Jantan (Artocarpus
heterophyllus )
Nurlelasari, Euis H. Hakim, Yana. M. Syah, Lia D. Juliawaty,
Sjamsul A.Achmad, Lukman Makmur 735
Metil Linderon, Senyawa Calkon Termodifikasi dari Kayu Batang Lindera polyantha
(Lauraceae)
Nyoman S. Suastri, Euis H. Hakim, Yana M. Syah, Lia D. Juliawaty,
Sjamsul A. Achmad, Lukman Makmur, Zalifah Latif, Laily bin Din,
Ikram M. Said 744
Kajian Geokimia Organik Biomarka Hidrokarbon Pada Minyak Mentah Dan Sedimen
Formasi Wonocolo
R. Y. Perry Burhan 748
xiv
Application of Cluster Variables and Factor Analysis in Al (III) sensor using PAN sol gel
film entrapment
Rita Sundari, Musa Ahmad, Lee Yook Heng 796
xv
Karakterisasi Enzim a-Amilase Ekstraseluler dari Isolat Bakteri Termofil SW2
Siswati Setiasih, Budiasih Wahyuntari, Trismilah, dan Dewi Apriliani 864
Quantitative Analysis of Trace pp-DDE in Cod Liver Oil by Isotope Dilution Mass
Spectrometry during APMP.QM-P4 Pilot Study and Uncertainty Evaluations
Sri Sumartini, Nuryatini, Sumardi 872
Isolasi dan Penentuan Struktur Senyawa dari Fraksi Aseton Talus Lichen Ramalina Javanica
Nyl
Suyanto, Suwarso, W.P, Kosela, S, Suwito, H, Winiati, S, Dai, Krohn, K. 908
Isolasi Dan Identifikasi Suatu Limonoid Aphanamixin Dari Ekstrak n-Heksana Kulit
Batang Tumbuhan Aphanamixis polystachya (WALL) R. N. Parker (MELIACEAE)
Tiaras Sinambela, Tukiran, Umi Syafa’ah, dan Kuniyoshi Shimizu 917
Kopolimerisasi Cangkok Asam Akrilat Pada Serat Rayon Dengan Teknik Pra-irradiasi
Peroksida
Tita Puspitasari, Yanti Sabarinah Soebianto dan Endang Asijati Ichsan 921
xvi
Pemetaan air masin dengan teknik geokimia air tanah di sekitar kolam ternakan udang
harimau, Kerpan Kedah
Umar Hamzah 926
Aplikasi Ruang Tutupan Pengekstrakan Mikro Fasa Pepejal Dalam Analisis Kompaun
Meruap Pirazin dan Furan Semasa Pemprosesan Gula Kabung (Arenga pinnata)
Wan Aida, W.M., Ho, C.W., Maskat, M.Y. & Osman, H. 953
Off-line Liquid-Liquid Extraction and Solid Phase Extraction and Online Pre-Concentration
Micellar Electrokinetic Chromatography for Analysis of Organophosphorus Pesticides
Wan Aini Wan Ibrahim, S. M. Monjurul Alam, A. B. Sulaiman 962
The Effect of Palm Oil Vitamin E Supplementation on DNA Damage and Certain Immune
Parameters in the Ageing Population
Wan Zurinah Wan Ngah, Noor Aini Abdul Hamid, Azian Abdul Latiff, Zaiton Zakaria,
Musalmah Mazlan, Johari Ibahim, Chin Siok Fong, Aminuddin Abdul Karim 985
xvii
Interfacial Adsorptions of Metal (II/III) Complexes of 2-(5-Bromo-2-pyridylazo)-5-
diethylaminophenol by the High-Speed Stirring Spectrophotometry
Yoki Yulizar dan Hitoshi Watarai 1023
Studi Komputasi Pengaruh Ligan Fluor Terhadap Pemecahan Orbital d pada Kompleks
[Fe(F6)]4-
Yusthinus T. Male, Djulia Onggo, Muhamad A. Martoprawiro, Ismunandar 1043
Karakterisasi Dna Polimerase Termostabil Dari Bakteri Termofilik Isolat Lokal 1090
I N. Tika*, M.Sindumarta** dan Akhmaloka** 1090
Pollution sources and their effects on drinking water quality: A case study of Semenyih
River Basin
Md Pauzi Abdullah and Soh Shiau Chian 1091
Sertifikasi larutan standar logam, cadmium , timbal dan merkuri dengan metode titrasi
kompleksometri EDTA
Nuryatini dan Sumardi 1093
xviii
Organic Synthesis Chemistry:The Problematical of Complex Target Molecules 1110
Umar A. Jenie
xix
A. A.Istri Ratnadewi , Zulfikar , Muhammad Naqib
Isolasi, Pemurnian Dan Karakterisasi Katalase Dari Buah Apel (Malus Sylvestris
Mill. Kultivar Rome Beauty) sebagai Biomaterial Sensor
1, 2)
Kimia FMIPA, Universitas Jember
Jalan Kalimantan III/25 Jember, 68211, Indonesia
dewi_pjw2003@yahoo.com
zulfikar@yahoo.com
3)
Alumni Kimia FMIPA, Universitas Jember, Indonesia
naqib@yahoo.com
Abstrak
Katalase merupakan enzim oksidoreduktase yang mengkatalisis dua jenis reaksi, yaitu
katalitik dan peroksidatik, dimana masing-masing mendekomposisikan hidrogen peroksida
dan hidroperoksida. Aktivitas spesifik katalase diukur dengan satuan Unit/mg-1. 1 Unit
adalah kemampuan katalase untuk mendekomposisikan substrat 1 µmol hidrogen peroksida
H2O2 dalam 1 menit pada kondisi pH 7 pada temperatur 30 0C. Katalase dapat diisolasi dari
buah-buahan misalnya apel. Penelitian ini berorientasi pada pemanfaatan katalase sebagai
biomaterial sensor, sehingga dibutuhkan katalase yang relatif lebih murni. Penelitian ini
bertujuan untuk mengisolasi dan memurnikan katalase yang dihasilkan dari buah apel
(Malus sylvestris Mill. kultivar Rome Beauty) dan menentukan karakteristik (aktifitas, kadar
protein serta temperatur dan pH optimum). Tahapan-tahapan yang telah dilakukan untuk
memperoleh katalase murni, yang berturut-turut meliputi isolasi dari buah apel kultivar
Rome Beauty, fraksinasi dengan metode presipitasi ammonium sulfat, dialisis menggunakan
membran selofan, desalting dengan kolom Shepadex G-25, kemudian kromatografi kolom
penukar ion DEAE-Selulosa. Elektroforesis dilakukan untuk mengetahui berat molekul
katalase. Hasil penelitian menunjukkan bahwa katalase dari buah apel dapat diisolasi
dengan aktivitas spesifik katalase hasil pemurnian sebesar 1046,93 (Unit/mg-1), kadar
protein 0,206 mg/ml-1 serta temperatur optimum 50 0C dan pH optimum 8. Elektroforegram
menghasilkan satu pita pada kisaran berat molekul 45.000–66.000 kD.
Kata Kunci : Apel Rome Beauty, Katalase, Karakteristik Katalase, dan Elektrofregram
yang sifatnya hampir sama. Untuk memperoleh Sampel yang digunakan adalah buah apel
katalase dengan tingkat kemurnian yang tinggi, (Malus sylvestris Mill. kultivar Rome Beauty
perlu dilakukan pemurnian lebih lanjut hasil budidaya Perkebunan Kusuma
menggunakan metode yang lebih spesifik. Agrowisata, Malang) yang dipetik pada
Pelaksanaan pemurnian masih dirasa sulit dan kematangan komersial, sedangkan bahan
mahal sehingga informasi tentang metode yang digunakan adalah
pemurnian katalase dari buah apel masih tris(hidroksimetilamino)metana, Na2-EDTA,
sangat sedikit. sodium dodesil sulfat (SDS),
polivinilpirollidon (PVP, BM rata-rata 40000),
Pada penelitian ini akan dilakukan isolasi
gliserol 99 %, asam klorida (HCl), hidrogen
katalase dari buah apel (Malus sylvestris
peroksida (H2O2), coomassie brilliant blue R-
kultivar Rome Beauty). Ekstrak kasar katalase
250 (CBB), ethanol (C2H5OH), asam fosfat
hasil isolasi dimurnikan berturut-turut meliputi
(H3PO4), ammonium sulfat [(NH4)2SO4], asam
fraksinasi dengan metode presipitasi
sitrat, natrium dihidrogenfosfat (NaH2PO4. 2
ammonium sulfat, dialisis dengan membran
H2O), glisin, natrium hidroksida (NaOH),
selofan, kromatografi kolom penukar ion
nitrogen cair, bovine serum albumin (BSA),
dengan DEAE-Selulosa. Elektroforesis
reagent-reagent elektroforesis gel
dilakukan untuk menentukan berat molekul.
poliakrilamida-sodium dodesil sulfat dan
Pemanfaatan katalase murni dari buah apel
standar protein (marker), air deionisasi, dan
sebagai biomaterial sensor merupakan suatu
aquadest.
terobosan baru dan katalase yang dihasilkan
akan lebih berguna bila dapat digunakan Isolasi Katalase
berulang-ulang dengan aktifitas dan Sebanyak 30 gram daging buah apel segar
reprodusibilitas yang tetap tinggi. Berdasarkan dihaluskan menggunakan blender disertai
latar belakang yang telah dikemukakan, penambahan pasir kuarsa dan nitrogen cair.
terdapat beberapa permasalahan yang ingin Setelah halus kemudian dihomogenisasi dalam
diungkap, yaitu : (a) Penentuan aktivitas 90 mL. buffer ekstraksi Tris-HCl 0,1 M (pH
katalase hasil isolasi dan pemurnian, (b) 8,5) yang mengandung polivinilpirollidon
Penentuan karakteristik katalase hasil isolasi (PVP) 10%, gliserol 10% , Na2-EDTA 0,5; 2,0
dan pemurnian, yang meliputi pH dan dan 5,0 mM. Homogenat disentrifugasi pada
temperatur optimum, (c) Penentuan kadar 15.000 gravitasi selama 15 menit. Ekstrak
protein katalase hasil isolasi dan pemurnian. kasar katalase diambil dari supernatan dan
digunakan pada tahap berikutnya. Aktifitas
Penelitian ini diharapkan dapat menjadi salah
katalase diukur secara spektrofotometri
satu alternatif pemanfaatan daging buah apel
(Malus sylvestris Mill. kultivar Rome Beauty) Fraksinasi Dan Dialisis Katalase
sebagai sumber katalase yang potensial. Protein dalam ekstrak kasar katalase
Informasi yang diperoleh dari hasil penelitian dipresipitasi dengan penambahan larutan
ini akan dapat menjadi pedoman bagi ammonium sulfat 0–100% (fraksi 0–40%,
pengembangan pemanfaatan katalase buah fraksi 40–60%, fraksi 60–85%, dan fraksi 85–
apel. Informasi mendasar tentang karakteristik 100%) pada 0°C. Ekstrak pelet masing-masing
enzimatis katalase juga dapat dimanfaatkan fraksi kemudian ditentukan aktivitasnya secara
oleh para bioanalis disektor industri maupun spektrofotometri. Ekstrak pelet dengan
riset untuk mempelajari karakteristik katalase aktivitas tertinggi kemudian didialisis selama
dan menganalisis hidrogen peroksida. 12 jam menggunakan kantung dialisis selofan.
2. Percobaan Hasil dialisis kemudian ditentukan aktivitasnya
Tempat dan Bahan secara spektrofotometri
Penelitian dilakukan di Pusat Penelitian Penentuan Aktivitas Katalase Dengan
Biologi Molekuler, Laboratorium Biokimia Spektrofotometri
Jurusan Kimia, dan Laboratorium Penentuan aktivitas berdasarkan metode Cohen
Mikrobiologi Jurusan Biologi Fakultas yang dimodifikasi (Graham dan Higgins, 1993)
Matematika dan Ilmu Pengetahuan Alam, serta dilakukan pada 4°C.
laboratorium Pengendalian Mutu Pusat
Pelatihan Bogasari Fakultas Teknologi
Pertanian Universitas Jember.
cukup penting dalam penambahan Na2-EDTA tinggi. Berdasarkan hal tersebut maka fraksi
ini berkaitan dengan kemampuannya sebagai 60–85% dipilih untuk dipisahkan dan
inhibitor browning (Sapers et al., 1984), dimurnikan lebih lanjut pada tahap dialisis.
inhibitor metallo-protease (Deutscher, 1990; Tabel 2 menunjukkan aktivitas dan kadar
Bollag dan Edelstein, 1991), dan sequester protein fraksi (NH4)2SO4.
logam-logam inhibitor katalase [terutama ion
Katalase Hasil Dialisis
tembaga(II)] (Kocsis dan Hanson, 2000; Gong
Tahap dialisis dilakukan pada temperatur 0–
et al., 2000).
8oC. Pellet fraksi 60–85% yang telah
Katalase Hasil Fraksinasi disuspensi ke dalam buffer diinjeksikan ke
Pada penelitian ini, purifikasi awal dilakukan dalam kantung dialisis. Aktivitas dan kadar
melalui fraksinasi menggunakan ammonium protein suspensi fraksi 60–85% dan katalase
sulfat (NH4)2SO4. Fraksinasi adalah presipitasi hasil dialisis diberikan pada tabel 3.
ekstrak kasar dengan konsentrasi bertingkat
Katalase Hasil Pemurnian Dengan Penukar
(NH4)2SO4 0–100% jenuh. Pada tahap ini
Anion
terdapat pula proses resuspensi dan sentrifugasi
Pemurnian dengan penukar anion DEAE-
tambahan pembentukan pellet yang akan
Selulosa didasarkan pada terdapatnya
menyebabkan pemecahan organel sel (Beevers,
perbedaan pH isoelektrik dari enzim atau
1991). Tabel 2. menunjukkan bahwa aktivitas
protein yang terdapat pada fraksi hasil
dekomposisi tertinggi diperoleh pada fraksi
desalting Sephadex G-25. Katalase diikatkan
60–85%. Apabila dibandingkan dengan ekstrak
pada matriks kolom DEAE-Selulosa dengan
kasar maka katalase yang diperoleh pada fraksi
buffer Tris-HCl 0,1 M (pH 7,0). Proses elusi
60–85% ini memiliki tingkat kemurnian lebih
selanjutnya juga dilakukan menggunakan
80
0.2
Aktivitas Katalitik (unit)
Absorbansi 280 nm
70
60 0.15
50
40 0.1
30
0.05
20
10
0
0M
0
NaCl
0 10 20 30 40 50 60 70 80 90 100
-10 -0.05
Nomor Fraksi (@2,5 ml)
Gambar 1. Profil elusi katalase pada pemurnian dengan kromatografi penukar anion
Profil Aktivitas Relatif Katalase Pada Berbagai Profil Aktivitas Relatif Katalase Pada
Temperatur Berbagai pH
105
1730 95
1430 75
1130 65
55
830 45
530 35
25
230 15
-70 5
-10 0 10 20 30 40 50 60 70 80 90 100 -5
2 3 4 5 6 7 8 9 10 11 12
Temperatur ( C)o pH Medium
Gambar 2. a. Profil aktivitas relatif katalase pada berbagai pH; b. Profil aktivitas relative katalase pada
berbagai temperatur
buffer awal Tris-HCl 0,1 M (pH 7,0) yang atau puncak yang pertama ternyata
diberikan gradien konsentrasi satu tahap NaCl menunjukkan adanya aktivitas katalitik. Fraksi
0-1 M untuk melepas protein enzim secara yang menunjukkan adanya aktivitas tersebut
selektif maupun protein lain yang kemudian dikumpulkan yang selanjutnya
kemungkinan masih terikat pada matriks dilakukan dialisis dalam buffer Tris-HCl 0,1 M
kolom. Profil elusi yang dihasilkan ditunjukkan (pH 7,0). Data pemurnian ditunjukkan pada
pada gambar 1. menggunakan eluen gradien tabel 3.
konsentrasi NaCl 0-1 M dalam buffer Tris-HCl
Fraksi katalase hasil kromatografi penukar
0,1 M (pH 7).
anion ini dianggap telah bersifat murni karena
Pada gambar tersebut tampak bahwa hasil hasil pemisahannya menunjukkan aktivitas
pengukuran absorbansi pada 280 nm terhadap spesifik 65,8 kali lebih besar daripada fraksi
fraksi hasil elusi menunjukkan adanya empat ekstrak kasar. Aktivitas spesifik yang
puncak (peak) protein yaitu pada fraksi 24-39, dihasilkan merupakan rasio unit katalase
fraksi 57-59, fraksi 65-67, dan fraksi 71-79. terhadap jumlah protein yang dimiliki.
keempat puncak tersebut kemudian dilakukan Aktivitas enzim berhubungan dengan tingkat
penentuan aktivitas katalitiknya menggunakan kemurnian, sehingga makin tinggi tingkat
substrat hidrogen peroksida H2O2. hasil yang kemurnian enzim maka besarnya aktivitas
diperoleh menunjukkan bahwa fraksi 24-39 spesifik akan bertambah.
Da 1 2 3 4 5 6 Da
66.000 66.000
45.000 45.000
31.000 31.000
14.200 14.200
1 2 3 4 5 6
5. Ucapan Terimakasih
Da
Penelitian ini dilaksanakan dengan sumber
dana Proyek Penelitian Ilmu Pengetahuan
1 2 3 Dasar DP3M Dirjen DIKTI DEPDIKNAS
66.000 tahun anggaran 2004. Penulis mengucapkan
45.000 terimakasih yang sebesar-besarnya kepada
semua pihak yang telah membantu hingga
terselesaikannya penelitian ini, antara lain
Lembaga Penelitian Universitas Jember, para
Kepala dan Staf laboratorium yang telah
mengizinkan penggunaan fasilitas
laboratoriumnya untuk menunjang penelitian
ini, serta semua pihak yang tidak dapat
disebutkan satu persatu.
Gambar 4. Elektroforegram protein katalase.
Lajur 1: marker, lajur 2 dan 3 : katalase hasil 6. Daftar Pustaka
pemurnian (20 µg). Beevers, H. (1991). Metabolic Compartmentation in
Plant Cells. In : Society for Experimental Biology.
Compartmentation of Plant Metabolism in Non-
4. Kesimpulan Photosynthetic Unit Tissue. Seminar Series : 42,
Ekstrak kasar katalase berhasil diisolasi dari Emes, M. J. (Ed.).. Cambridge University Press,
daging buah apel varietas Rome Beauty dengan Cambridge, pp. 1-21.
aktivitas total sebesar 26,110 unit.ml-1 dan
Bollag, D. M., and S. J. Edelstein, (1991). Protein
kadar protein 1,641 Unit.mg-1. Methods. Wiley-Liss A John Wiley & Sons, Inc.
Purifikasi parsial awal yang dilakukan Publication, New York
menggunakan (NH4)2SO4 60–85% jenuh Bering, C. L., (1994). Enzymes. A Workshop for
dapat meningkatkan aktivitas total ekstrak Secondary School Students, J. Chem.. Educ., 71 (3),
kasar katalase (+ Na2- EDTA 2,0 mM). Hal ini 241.
ditandai dengan aktivitas total yang dihasilkan Deutscher, M.P., (1990). Maintaining Protein
hingga 128,016 unit.ml-1 dan kadar protein Stability. In : Methods in Enzymology, 182. Guide
sebesar 2,094 mg.ml-1. Aktivitas total tersebut to Protein Purification, Deutscher, M. P. (Ed.),
akan meningkat pada penggunaan dialisis pada Academic Press, San Diego, pp. 83-85.
tahap purifikasi parsial berikutnya, yaitu
Gong, Y., P. M. A. Toivonen, P. A. Wiersma, C.
sebesar 276,895 unit.ml-1 dan menghasilkan Lu, and O. L. Lau, (2000). Effect of Freezing on
kadar protein 1,443 mg.ml-1. the Activity of Catalase in Apple Flesh Tissue, J.
Katalase apel hasil dialisis memiliki Agric. Food Chem., 48 (11), 5537–5542.
karakteristik enzimatis meliputi temperatur Graham, J. M., and Higgins, J. A., (1993). Isolation
optimum sebesar 50 oC dan optimum pada pH and Analysis: The Identification of Subcellular
8,0. Penggunaan SDS-PAGE untuk Fractions from Mammalian Cells. In : Methods in
mengetahui homogenitas protein hasil dialisis Molecular Biology Biomembrane Protocols : I.
menghasilkan berat molekul protein katalase Isolation and Analysis, 19, Graham, J. M., and
hasil dialisis, yaitu sebesar 46.431,67- Higgins, J. A. (Ed.), Humana Press, Totowa, pp. 1-
18.
65.894,16 Dalton atau merupakan berat
molekul sub unit monomer katalase. Kharizanov, A., (1974). A Morfological Studies on
Erythroneura arboridia adenae vitisuga, Rev. Appl.
Katalase berhasil dimurnikan dari daging buah Entomol. A-Agric., 62 (2), 133.
apel varietas Rome Beauty dengan aktivitas
total sebesar 215,670 unit.ml-1 dan kadar Kocsis, M. G., and Hanson, A. D., (2000).
protein 0,206 unit.mg-1. Penggunaan SDS- Biochemical Evidence for Two Novel Enzymes in
the Biosynthesis of 1-Dimethylsulfonicpropionate
PAGE untuk mengetahui homogenitas protein in Spartina alterniflora, Plant Physiol., l. 123 (3),
hasil dialisis menghasilkan berat molekul 1153–1161.
protein katalase hasil dialisis, yaitu sebesar
45.000-66.000 Dalton atau merupakan berat Larrigaudiere, C., E. Pinto, I. Lentheric, and M.
molekul sub unit monomer katalase. Vendrell, (2001). Involvement of Oxidative
Processes in the Development of Core Browning in
A. Netty Siahaya1)
1) Jurusan Kimia, Universitas Pattimura
Jl. Dr. Tamaela Kampus PGSD, Ambon, Indonesia
Abstract
Analysis of metas Pb, Cr and Cd in some tissues of sponge spesies (Stylissa certaria,
Pseudoretina purpures and Stylissa massa) has been caried out in three reef platform zones in
spermonde arcipelgo southewst Sulawesi waters. First zone was strongly influenced by off
shore waves. It was found that at zone-1, metal Pb consentration is highest 12,19 mg.kg dry
weight in tissue of Salyssa certaria. Consentration of Cr was found posibility of using sponge
as bioindicator in pollutant monitoring in marine enviromnment with higt diversity in reef
platform waters.
Abstrak
Asam deoksiribonukleat (DNA) sebagai molekul pembawa informasi genetik pada manusia
terdapat pada inti sel dan mitokondria. Seluruh urutan nukleotida baik yang terdapat dalam
mitokondria maupun inti sel telah berhasil ditentukan. Secara kuantitatif jumlah nukelotida
mitokondria hanya sekitar seperduaratus ribu dibandingkan dengan jumlah nukelotida inti
sel. Perbedaan lain antara keduanya adalah DNA mitokondria (mtDNA) diwariskan dari
pihak ibu sedangkan untuk DNA inti sel diketahui setengah berasal dari ibu dan setengah
lainnya berasal ayah. Kedua fenomena yang dimiliki DNA mitokondria di atas, ukurannya
yang kecil dan pola pewarisan dari garis ibu, telah menarik perhatian para ilmuwan untuk
mengetahui lebih jauh mengenai hubungan antara genotipe dan fenotipenya. Hasil yang
diperoleh di antaranya adalah didapatkannya informasi bahwa mutasi tertentu pada DNA
mitokondria menyebabkan suatu penyakit, dan adanya pola keterkaitan antara posisi/jenis
nukleotida (polimorfisme) dengan kelompok tertentu dalam populasi. Namun disayangkan
sampai saat ini belum ada suatu telaah DNA mitokondria yang secara khusus berdasarkan
genotipe tanpa dikaitkan dengan fenotipenya. Hasil yang telah diperoleh berdasarkan
analisa data urutan nukleotida mtDNA menunjukkan bahwa dua individu yang etnisnya
berbeda mempunyai mtDNA yang keseluruhannya sama, sedangkan polimorfisme mtDNA
terdapat pada individu-individu yang secara etnis sama. Fenomena yang didapatkan ini tidak
sesuai dengan pola pikir yang ada, yaitu selalu mencoba mencari hubungan antara genotipe
dan fenotipe mtDNA. Kenapa dalam hal ini genotipe mtDNA tidak berkaitan dengan
etnisnya dapat dijelaskan dengan mempertimbangkan bahwa mtDNA hanya sebagian kecil,
hanya sekitar seperduaratus ribu, dari total infomarsi genetik pada manusia. Migrasi
populasi manusia dapat ditelusuri melalui mtDNA, atau kromosom Y, namun pola genotipe
tidaklah harus selalu berkaitan kelompok populasi. Atas dasar hal-hal di atas dan beberapa
hasil lainnya yang telah diperoleh, diharapkan paradigma alternatif dalam analisa mtDNA
manusia, yaitu telaah yang khusus hanya berdasarkan genotipe, dapat mengukapkan lebih
banyak lagi fenomena yang sampai saat ini belum diketahui.
masa depan.
Abstract
Not available
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
12 Proceeding of The 6th ITB-UKM Joint Seminar on Chemistry
Dawn Carmel Paul, Kalaivani Nadarajah, Abdul Jalil Abdul Kader
1.4
1.2
Figure 1 Profile of biomass and chitosan production from fungi grown on YPG.
1.2
dry cell weight/g
1
0.8
0.6
0.4
0.2
0
0 12 24 36 48 60 72 84 96
time/hour
YPG BG TVB
biomass continued to increase (Tan et al. highest chitosan yield was obtained with formic
1996). This is attributed to the strong binding acid 6% at incubation period 12 hours and
of chitin and chitosan to other cell wall temperature 95˚C (Figure 3). This study also
components (Tan et al. 1996). observed that the same incubation period,
temperature and acid concentration rendered
Extraction
different effects and interactions when different
In the alkaline treatment, five incubation period
acids were used as the extracting solution. For
and three incubation temperature were used
example, in the utilization of acetic acid, it was
(Table 1). It was observed that significantly
found that only the incubation period played a
higher amount of chitosan was extracted with
significant role in affecting the amount of
the increase of incubation period and
extractable chitosan (P<0.05). Whereas for
temperature (P<0.05). The highest yield of
formic acid, temperature was the main
chitosan was obtained at incubation
determining factor for chitosan extraction (P=
temperature 121°C and incubation period 30
0.034) and for hydrochloric acid, acid
minutes (19.7%. chitosan/biomass).
concentration was found to significantly affect
In the acid treatment, it was observed that the chitosan extraction (P<0.01).
utilization of acetic acid and formic acid as the
Quality analyses
extracting solution yielded higher amounts of
The degree of deacetylation for chitosan
chitosan as compared to hydrochloric acid. The
extracted from Absidia sp. DR grown on the
Table 1 Extraction of chitosan from 1 gram biomass using alkali at different incubation period and
temperature
0.25
0.2
chitosan (g)
0.15
0.1
0.05
0
3 6 12
time (hour)
60 C 95 C
Figure 3 Extraction of chitosan using formic acid 6% at different incubation period and temperature
different media were determined. This study ferum, manganese and cobalt ions are able to
found that the growth medium affects the influence the activities of chitin synthase and
degree of deacetylation of chitosan. Fungi chitin deacetylase (Jaworska & Konieczna
grown on TVB and BG produce chitosan with a 2001). Therefore the presence of potassium and
higher degree of deacetylation as compared to calcium ions in BG and TVB were able to
YPG (Table 2). catalyze the activities of chitin deacetylase
whereby more acetyl moieties of chitin and
This suggests that the differences in medium
chitosan chain were hydrolyzed, thus
composition and the presence of certain
increasing the degree of deacetylation of the
elements may affect the activities of chitin
chitosan produced. DD increased with the
deacetylase (Jaworska & Konieczna 2001).
temperature, incubation period and acid
TVB contains 2000 ppm potassium ions and
concentration.
300 ppm magnesium ions whereas BG contains
100 ppm potassium ions and 250 ppm The degree of deacetylation (DD) for chitosan
magnesium ions. In addition, TVB also extracted by the various acid treatment were
contains calcium ions. Microelements such as also determined (Table 3). DD increased with
Table 2 Degree of deacetylation for chitosan extracted from Absidia sp. DR grown on different media
Growth medium DD
YPG 82.56%
BG 83.79%
TVB 84.55%
Table 3 Degree of deacetylation for fungal chitosan extracted using different acid treatments
a
2% 3 hours 60°C 76.16%c a
76.89%c b
86.26%c
a
6% 3 hours 60°C 82.41%d a
81.72% d b
86.78% d
a
10 % 3 hours 60°C 82.82%e a
83.98% e b
88.23% e
a
2% 12 hours 95°C 82.02%f a
82.56% f b
87.31% f
a
6% 12 hours 95°C 86.86%g a
84.83% g b
89.88% g
a
10 % 12 hours 95°C 87.12%h a
86.15% h b
90.45%h
a-b
Mean values in the same row bearing different superscripts have significant statistical difference.
c-h
Mean values in the same column bearing different superscripts have significant statistical difference
Table 4 Hunter Lightness (L) values of chitosan extracted using different acid treatments
Acid concentration Treatment Acetic acid (L) Formic acid Hydrochloric acid
(L) (L)
3 hours 60°C 75.60 81.08 80.72
6 hours 60°C 74.82 80.56 76.34
2% 12 hours 60°C 74.45 78.43 72.97
3 hours 95°C 73.05 78.92 70.26
6 hours 95°C 72.18 79.04 69.23
12 hours 95°C 76.03 78.86 68.60
the increase of incubation temperature, Studies by Arcidiacono and Kaplan (1992) also
incubation period and acid concentration. DD showed that the type of growth medium utilized
was also found to be significantly higher affects the average molecular weight of the
(P<0.01) when hydrochloric acid was used as chitosan extracted from fungi. According to
the extracting solution compared to acetic acid Arcidiacono and Kaplan (1992), fungi grown
and formic acid. The highest DD (90.45%) on defined medium produces chitosan with
was obtained with hydrochloric acid 10%, significantly higher molecular weight as
incubation period 12 hours and temperature compared to chitosan extracted from fungi
95°C meanwhile the lowest DD (76.16%) was grown on complex medium. This study
obtained with formic acid 2%, incubation however found that the average molecular
period 3 hours and temperature 60°C. weight for chitosan extracted from fungi grown
Hydrochloric acid being a strong acid in on complex medium was higher (2.370 x 105
comparison to acetic acid and formic acid, Da in YPG) than chitosan extracted from fungi
caused a higher degree of hydrolysis towards grown on defined (7.66 x 104 Da in TVB) and
the acetyl moieties, in addition to hydrolysis semi defined medium (6.765 x 104 in BG). The
between the monomers in the chitosan polymer. lower molecular weight conferred by fungi
grown on defined medium might be due to the
Abstract
Malaysia and Indonesia are endowed with one of the richest biodiversity in the world. Efforts
to conserve the rich flora and fauna have been carried out in both countries since colonial
days through the establishment of National Parks, Wildlife Sanctuaries, Virgin Jungle
Reserves and various kinds of Protected Areas. In Malaysia. to-day a total of 1.39 million ha
(about 7.6%) of the forests of all types have been set aside for in situ conservation of
biodiversity. It is hoped that these protected areas have captured most of the diverse species
of plants and animals found in various ecosystems. Similarly, efforts in ex situ conservation
have also been undertaken, though on a smaller scale. However, a framework for managing
biodiversity in protected areas is inadequate as strategic planning and management
programmes are yet to be put in place, especially for the plant diversity. Both countries are
yet to define priorities for conservation and sustainable use based on ecosystem, species and
genetic diversity. Measures for sustainable use in traditional agriculture, forestry, fisheries
are in place but those in biodiversity prospecting, eco-tourism and impacts of urbanisation
on biodiversity are yet to be established. Malaysia and Indonesia combined are represented
by about 30,000 species of flowering plants, excluding that of the algae, lichens, bryophytes
and pteridophytes, which are also useful in natural product chemistry and in bioprospecting
for biopharmaceuticals. In the absence of concrete data of biodiversity loss in both countries
it is difficult to ascertain the lists of endangered or otherwise threatened species. However,
efforts to assess and monitor these have been initiated through the recently incepted
Biodiversity Country Studies. Many factors have contributed to biodiversity loss; among them
is the rapid socio-economic development of the country that transformed vast forested lands
by logging activities, land transformation for agriculture and resettlement and subsequently
creating new built-up areas such as urban and industrial areas which are relatively poor in
biodiversity. Other factors such as over-harvesting and pollution have also contributed,
including natural catastrophe as in Indonesia. These activities had led to significant habitat
loss, degradation and fragmentation of the environment and indirectly affecting biodiversity.
What are needed are frameworks and strategies for biodiversity conservation, some socio-
economic strategies for sustainable use and sharing of benefits of biodiversity and also some
legal measures for sustainable use and protection of biodiversity, especially for enhancing
biotechnology and development of alternative medicines.
18
Departement
Proceeding of The 6th ITB-UKM Joint Seminar on Chemistry
of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
A. Latiff , L. B. Din & I. M. Said
Malaysia and Indonesia are two of the 12 Sarawak by the National Cancer Institute,
megadiversity countries in the world. These United States.
megabiodiversity countries together contain at
On the basis of the above, there is tremendous
least 60% of the world’s known species. The
prospect to promote the development of natural
flora of Malaysia is exceedingly rich and is
products and their derivatives as an industry in
conservatively estimated to number about
these two developing countries. The Malaysia
15,000 species of flowering plants (Bidin &
National Policy on Biological Diversity listed,
Latiff, 1995) and more than 1,170 species of
as the first of six main objectives, the
ferns (Parris & Latiff, 1997). Indonesia is
optimisation of economic benefits from
believed to have at least 25,000 species of
sustainable utilisation of components of
flowering plants. After the completion of Tree
biological diversity. Among the 15 strategies
Flora of Malays project, a total of 2,830 tree
outlined for effective management of biological
species were documented and over 26% of
diversity, the following are relevant to natural
these tree species in Peninsular Malaysia are
products development: Improving the scientific
endemic (Ng et al., 1990). Malaysia and
knowledge base; enhancing sustainable
Indonesia are undergoing tremendous socio-
utilisation of biodiversity; developing a centre
economic development, especially in the last 20
excellence in industrial research in tropical
years or so, paving the way for future
biodiversity; enhancing skill, capabilities and
industrialisation. In the process of achieving
competence, encouraging private sector
those ends through the physical development of
participation; reviewing legislation to reflect
natural resources both terrestrial and marine, it
biodiversity needs; enhancing institutional and
is imperative to expect a continuous process of
public awareness; promoting international
habitat transformation, fragmentation,
cooperation, and establishing funding
conversion and destruction which have taken
mechanisms.
great and significant toll of our rich
biodiversity resources. Although this 2. Plant Biodiversity
concomitant loss has not been quantified, by Biodiversity means the variety of ecosystems
and large the biologists, ecologists and the and the range of types and variability of
administrators in both countries recognised the animals, plants and microorganisms within
gradual but steady loss of biodiversity as real them. It is not a fixed entity, but is constantly
and should be addressed before it is too late. changing with the ecological dynamics and
The irony is that much of the biodiversity evolution; it is increased by new genetic
resources, especially those of species and variation that get incorporated into the
genetic, have yet to be studied and documented, organisms and reduced by losses, extinction of
let alone understood, and hence would species and habitat degradation. It has become
definitely impede our efforts to better utilise a common practice to define biodiversity in
them sustainably for our own benefits and those terms of ecosystem, species and genes,
of generations to come. corresponding to three fundamental and
hierarchically related levels of biological
The diversity of biological resources provides
organisation. This concept emphasises the
direct economic benefits such as timber and
interrelatedness and the ecological function of
non-timber goods in the forestry sector, food
the biological world.
and industrial crops in the agricultural sector,
and food in the fisheries sector. Certain Ecosystem diversity is often evaluated through
indigenous plants, animals products and their measures of the diversity of the component
derivatives have long been used in traditional species at a local level and then largely in terms
medicine by various ethnics in Malaysia and of vegetation. It relates to the variety of
Indonesia. Many plants, not presently used in habitats, biotic communities and ecological
traditional medicine, have also been found to processes in the biospheres. Malaysia has at
contain biologically active compounds that are least 19 distinct natural ecosystems (Whitmore,
likely to be starting materials for a large 1975) containing up to about 7% of the world
number of drugs. A case in point is the recent species. Indonesia being a country of large and
discovery of an active compound against the small islands, with many volcanoes surely has
HIV virus found in the bark of Calophylum many more natural ecosystems (Whitten et al.
lanigerum and C. teysmanii (Guttiferae) in 1984, 1987). Species diversity could be
measured by species richness, which is the it about 15,000 species (Latiff, 1994; Bidin &
number of species in a site or habitat. For Latiff, 1995). The flowering plants and in
example, a total of 103 species of mosses and particular the tree species have received
370 species of flowering plants are found at comprehensive studies through the Tree Flora
Fraser’s hill (Damanhuri & Nizam, 2001; Latiff of Malaya project and the on-going Tree Flora
et al. 2001). Discussion of species diversity is of Sabah and Sarawak Project. After the
also typically presented in terms of the number completion of the Tree Flora of Malaya, a total
of species in different taxonomic groups. For of more than 2830 tree species were
example, there are 20 species of Rafflesia are documented and of these 746 species or 26.4%
found in the world (Nais, 2001; Latiff & Wong of the total are found to be endemic to
2003) or there are four species of Peninsular Malaysia. For Peninsular Malaysia
Johannesteijsmannia (Palmae) are found in the number of non-tree species which comprise
Peninsular Malaysia (Lim & Whitmore, 2000). shrubs, herbs, parasites, epiphytes, saprophytes,
These estimates include at least 12,000 species climbers and others may be more than that of
of the known flowering plants, 1159 species of trees, but their taxonomy and diversity remain
ferns (Parris & Latiff, 1997), 287 species of the uncertain because there is no similar effort to
mammals, 158 species of amphibians and study their taxonomy, distribution and
reptiles, 736 species of birds and at least 1161 endemicity like that of tree species. After the
species of fishes. Most of the other taxa in the publication of the two installments of the Tree
Animal Kingdom are poorly known. However, Flora of Sabah and Sarawak which covers 56
our estimates that Malaysia has about 700 small and medium families, it has become
species of fungi, 832 species of mosses suggest apparent that species diversity and endemism
corresponding patterns of species richness are higher.
amongst the invertebrates. The single richest
The plant biodiversity resources in Indonesia is
group is the insects whose estimate is not
far from being known as the area is so vast and
available. Lastly, genetic diversity, on the other
the scientific capacity is not adequate. Only the
hand, represents the heritable variation within
Flora of Java is in place, that of Sumatera,
and between populations of species.
Kalimantan, Sulawesi, Irian Jaya and other
With regards to the total number of species of smaller islands are not known. It is hoped that
living organisms present in the world is with the completion of Flora Malesiana, a
anybody’s guess. Some scientists estimated the project undertaken by Rijksherbarium, Leiden
number to be in excess of 12.5 million species, and Herbarium Bogoriense, some of the
with 1.7million species identified and known to pertinent questions with regards to the rich and
science. Most of the unknown are mainly diverse Indonesia flora will be known for
insects and microorganisms (Wilson, 1988). As sustainable use. On the other hand, Indonesia
for plants a good estimate put them between also suffers great loss of its ecosystems and
250,000 – 300,000 species. Some scientists species to natural disaster and catastrophe as
believed the total species of living organisms evidenced by the past earthquakes and volcanic
will never be realised as environmental eruptions that had occurred.
degradation will take its toll to eliminate them
3. Phytochemical Screening
from various threatened habitats all over the
It is always argued by some scientists that the
world. They can vary by 2-20 times more
preliminary phytochemical screening of plants
(Groombridge, 1992). Biodiversity
would give clues to the subsequent quests for
encompasses all species of plants, animals and
chemical compounds that could be the basis for
microorganisms, and the ecosystems of which
pharmaceutical products. While there are some
they are part. Species diversity refers to the
truths in this as given by the past discoveries of
variety of living organisms on earth, variously
quinine and other drugs, there also exist some
estimated to be between 5 to 30 millions or
quicker but more expensive approaches, such
more, of which only about 1.4 millions have
as the thorough-put screening as practices by
been scientifically documented (Wilson,
large laboratories in the United States and
1988).
Australia. In Malaysia the history of
The flora of Malaysia is extremely rich and a phytochemical screening of plants dated back
conservative estimate of the seed plants has put to Arthur (1954), who screened some plants
from Sabah (then named North Borneo). expensive, and both countries such as Malaysia
However, the involvement of the and Indonesia could not afford the
ethnobotanists and phytochemists at the infrastructures.
Universiti Kebangsaan Malaysia could be
Quest for new medicines and other products
traced only to 1985. Since then there have
By and large there have been debates in many
been a constant flow of activities, from
tropical countries with rich biodiversity that the
carrying out field works and scientific
potential of bioprospecting from biodiversity
expeditions to collect plants and screen the
may give rise to new biotechnology (Svarstad
plant tissues for the presence of certain
& Dhillon, 2000). On one hand, this may be
secondary metabolites such as alkaloids,
true as these countries are custodians of the rich
flavonoids, flavonones, triterpenes, saponins
reservoir of new medicines. But on the other
and others. The phytochemical screening could
hand, most of these countries do not have the
be general in objectives such as those carried
financial means to undertake such a capital-
out by Said et al. (1990, 1992b, 2000), Latiff et
intensive ventures. Furthermore, these
al. (1995), Nik Idris et al. (2001a, 2001b), Din
countries also lack the technology and human
et al. (2001), Nik Idris et al. (2002), Wan
resources. The following statements are
Yaacob et al. (2000) to cite a few or on specific
testimony to the above.
plant family such as Menispermaceae (Latiff,
1985). Subsequently, all these activities were It is estimated that more than 25% of new
summarized by Latiff and Said (1989). medicines that are in the markets are derived
from natural products, especially plants.
These preliminary screenings had paved ways
Estimate of their worth is debatable, but a
for the ultimate natural product chemistry
figure of more than US$60-180 billion each
research by the chemists that have been
year is possible. Two issues are related, namely
undertaken as discussed below. The
Biotrade and life patenting. Some examples are
phytochemical surveys gave leads to the
hereby cited.
chemists as to what taxa they should embarked
to do a comprehensive and extensive studies. The discovery of vinblastine and vincristines
Normally after the preliminary screenings, bulk from Madagascan rosy periwinkle
collection of plants were made to isolate the (Catharanthus roseus) for the treatment of
chemical compounds and these compounds are pediatric leukemia and Hodgkin’s disease led
later subjected to biological screenings and to a small controversies. Some people felt that
toxicity studies before they could be candidates some reciprocal benefits and compensation
for pharmacological works. should be accrued to Madagascar as they
thought the plant species is only found in that
4. Natural Product Chemistry
island republic. In fact the species is found in
Biodiversity could play an important role in
many other tropical countries from Madagascar
pharmaceutical industries, especially in the
to the Pacific. Similar controversy occurs with
quest for new medicines or new derivatives
Pacific yew which is used for the treatment of
(Farnsworth, 1988; Salleh et al., 1995).
ovarian cancer. In India, the neem tree
Farnsworth (1988), in particular really believed
(Azadirachta indica) which for centuries has
that plants are answers to new medicines. It is
been used as natural insecticides had been
already known that, medicinal plants have great
patented by certain pharmaceutical company in
economic significance in both countries if the
the United States. At home, the recently
pursue for new medicines were to be carried
discovered chemicals from Bintangor plants in
out in systematic manner. (Latiff, 1983;
Sarawak (Calophylum lanigerum and C.
Kumari et al., 1998). In the past ethnobiology
teysmanii) which showed some potentials as
and ethnopharmacology have contributed a
anti HIV compounds is beginning to take the
great deal in the search for new medicines and
attention of not only the scientists by also the
they are still important (Ismali et al., 1995;
law makers, especially in Sarawak (Lajis &
Mat-Salleh & Latiff, 2002). Lately, the use of
Kiew, 1995). The examples above were cited to
combinatorial chemistry and the thorough-put
illustrate some controversies resulted from
screenings for new natural products have sped
contentions with regards to Inllectual Property
up the process of discovery of drugs from
Rights without reciprocal benefits and
nature. However, this approach is rather
compensation for the donours of the natural Indonesia, similar progress had been made.
resources. Members of Annonaceae are well-known to
contains many interesting chemical compounds
In ASEAN countries in the last few years some
such as alkaloids, terpenes and flavonoids. Din
progress have been achieved in addressing
et al. (1992, 1993, 1997), Colegate et al. (1990;
some of the important natural products research
1992) have studies some interesting compounds
issues. Among them is the legislation for access
from some members of the Annonaceae,
of natural resources including proclamation of
particularly on the genera Goniothalamus,
the Melaka Accord. This document is still
Desmos, Alphonsea, and Polyalthia. These
under scrutiny by the Attorney Generals Office
genera featured very strongly in tradistional
of Malaysia. However, all ASEAN member
medicine (Mat-Salleh & Latiff, 2002). One
countries have discussed this issue and a joint
interesting discovery is the isolation of
communiqué is awaited, especially with
goniothalamin and its derivatives from some
regards to cooperative research with ASEAN
species of Goniothalamus, including G.
and non-ASEAN institutions.
umbrosus, G. scortechnii, G. macrophyllus that
At the same time many research undertakings hold promises as anti-cancer, anti-inflamation
have been carried out by various universities properties and others.
and research institutes with foreign
In other plant families, Houghton et al. (1991)
counterparts, either as a joint venture, joint-
had studied the alkaloids from Mitragyna
programmes or cooperations.
speciosa, a species that is known locally as
Progress in Natural Products Research biak-biak, and of late decoction of the leaves
In the last decade there have been some had been taken orally for drug substitute. Said
important progress in the natural product et al. (1989, 1991, 1992a) had also studied the
chemistry research, especially on indigenous alkaloids from Tabernaemontana capsicoides,
plant species. The authors would attempt to Dehassia incrassata and Alstonia angustifolia,
highlight some of the significant discoveries by respectively. Similarly, these species have been
researchers at the Universiti Kebangsaan widely used by Malays in their traditional
Malaysia. Other researchers, notably from medicine (Mat-Salleh & Latiff, 2002). Some
Universiti Putra Malaysia, Universiti Malaya, progress in lichen chemistry have also been
Universiti Sains Malaysia, Forestry Research made (Din et al. 2002)
Institute Malaysia have also contributed to
5. Biopharmaceutical Industry
natural product studies.
It is a common knowledge that biodiversity
Din et al. (1989, 1990) had studied laurolitsine resources have important economic, social and
from Actinodaphne pruinosa (Lauraceae) and technological implications. Among them is the
Diospyros species (Ebenaceae). Similarly, Said economic benefits and food security that could
et al. (1991) had studied the alkaloids of be derived from them; biodiversity also
another Lauraceae, Dehassia incrassata. This stabilises the environment through ecological
approach is similar to those taken by our functioning and many plant and animal species
Indonesian counterparts at Institut Teknologi form the biological heritage of a country. In
Bandung (e.g. Hakim and Achmad, 1991, Malaysia, agriculture, forestry and fisheries
Achmad et al., 1992; Hakim et al. (1993) on sectors have contributed about 13.6% of the
Lauraceae. In fact, progress on the natural national gross domestic product in 1995 and
product chemistry of Lauraceae has been very accounted for about 12.1% of the total export
encouraging in their quests for novel natural earnings. In 1994 tourism alone contributed
compounds. Members of the family Lauraceae about RM 8.3 billion to the national economy
are among the commonest in our tropical and much of tourism industry relies on the
forests. In particular, cinnamomun is one of the diverse and unspoiled natural beauty of the
well-exploited spices. The taxonomy of this country's landscapes, including the unique
complex and difficult family at species level species of plants and animals residing in
has impeded our progress in the chemistry of national parks, wildlife reserves and marine
this interesting family. parks. The value of biodiversity to science and
In the Annonaceae, another common family in education does not require any further
the lowland dipterocarp forests of Malaysia and elucidation.
Malaysia and Indonesia ratified the Convention the resources that are available ex situ. In the
on Biological Diversity in 1994 which set the past it is apparent that the supply of plants or
platform of commitments under the treaty and animals could come from the natural habitats.
reaffirms the sovereign rights of States over Realising that more and more natural habitats
their biodiversity and the responsibility to are being degraded by both human
conserve and utilise the resources in a interferences and natural disaster, one must turn
sustainable manner. As Malaysia and Indonesia one’s attention to the supply from the ex situ
are already a party to the Convention of infrastructures such as estates. Institutions such
International Trade in Endangered species of as botanical gardens, zoos and arboreta as well
wild fauna and flora (CITES) and also a as private collections could also play their part
member of the International Union of in some studies. The case of point is the fate of
Conservation of Nature and Natural resources Tongkat Ali (Eurycoma longifolia) which has
(IUCN), as well other international networks, been over-exploited by many small- and
the responsibility is even more pronounced to medium industries for making crude medicine.
conserve our biodiversity and to use them for This species had been claimed to have
sustainable development. Subsequently aphrodisiac properties hence the demand by
Malaysia and Indonesia ratified the United men, in particular had been tremendous. While
Nations Framework on Climate Change and the turn-over has been very excellent, the
RAMSAR Convention on Wetlands of supply of roots and stems of this plant has been
International importance especially as not forthcoming from the natural habitats. One
waterfowl habitats which set its commitment to easily could suggest that planting of this
monitor and carry out research on the impact of material must be carried out, but this requires
climate change and wetland utilisation on extensive studies on its agronomy and soil-
biodiversity, in particular the birds. suitability as well as its variation of chemical
contents.
Of late a new partnership between biodiversity,
biotechnology and pharmacy surfaced through
some international initiatives called 6. Acknowledgements
bioprospecting. With the rapid development of The authors are grateful to the organisers of the
modern technology in the developed countries, seminar, in particular Assoc. Prof. Yang Farina
especially combinatorial chemistry, the interest Abdul Aziz and her Organising Committee for
in traditional medicine and nature as a source the invitation to present this paper and in
of new pharmaceuticals was enhanced. The old particular Dr. Ishak Ahmad and Pn. Kiftiah
scenario where chemists relied on Abdul Razak for making the presentation
ethnobiological information has changed possible.
dramatically. To-day many huge programmes
for natural compound screening are under-way;
these have been initiated by international 7. References
organisations, scientific institutions and giant Achmad, S. A., E. L. Ghisalberti, E. H. Hakim, L.
transnational pharmaceutical companies. Only Makmur & M. Manurung. 1992. A new
sesquiterpene alcohol from Litsea amara Blume
through an equitable partnership between
(Lauraceae). Phytochemistry 31(6) : 2153
parties that biodiversity could be utilised in a
sustainable manner for generations to come. Arthur, H. R. 1954. A phytochemical survey of
One well-known example is the initiatives some plants of North Borneo. J. Pharm. and
taken by National Cancer Institute that sent Pharmacol. 6 : 66-71
their chemists and botanists to most ASEAN Bidin, A. A. & A. Latiff. 1995. The status of
countries to screen plants for anti-cancer terrestrial biodiversity in Malaysia. In : A. H. Zakri
properties. As a spin-off, they made a discovery (Ed.). Prospects in biodiversity prospecting. Genetic
that some chemical compounds isolated from Society of Malaysia & Universiti Kebangsaan
species of Calophyllum of Sarawak, have Malaysia. Pp. 59-76
positive reactions against HIV. Colegate, S. M., Laily B Din, A. Latiff, K. Mat
Salleh, M. W. Samsudin, B. W Skelton, K. Tadano,
Research in natural product chemistry should A. H White & Z. Zakaria. 1990. (+) -
take note of the vast resources that are available Isoaltholactone : A Furanopyrone isolated from
in both countries (Latiff et al. 1984)) and also
on three species of bacteria. Malays. Appl. Biol. Lim, C. K. & T. C. Whitmore. 2000. The
18(1) : 97-106 magnificient Johannesteijsmannia palms of
Malaysia. Folia malaysiana 2 : 13-26
Latiff, A. & Ikram M Said. 1989. Phytochemistry in
Perspectives : Chemical Screening of Malaysian Mat-Salleh, K. & A. Latiff. 2002. (Eds.). Tumbuhan
plants of medicinal interests. In : I. M. Said & L. B. Ubatan Malaysia. Pusat Pengurusan Penyelidikan,
Din (Eds.). Systematic Identification of Natural Universiti Kebangsaan Malaysia. 797 pp
Products. Pp. 97-111, Department of Chemistry,
McNeely, J. A., K. R. Miller, W. V. Reid, R. A.
Universiti Kebangsaan Malaysia, Bangi.
Mittermeier & T. B. Werner. 1991. Conserving the
Latiff, A. 1989. Genetic resources of medicinal World's biological diversity. WRI, IUCN, World
plants in Malaysia. In : A. H. Zakri (Ed.) Genetic Bank, WWF, Conservation International,
Resources of under-utilised plants in Malaysia. Pp. Washington D.C. and Gland, Switzerland Mugabe,
49-63. J., C. V. Barber, G. Henne, L. Glowka & A. La Vina
(Eds.). 1997. Access to Genetic Resources. ACTS
Latiff, A. 1992. Plant resources for natural products
Press, Nairobi.
: An ethnobotanical survey. In: Khozirah Shaari et
al. (Eds.). Medicinal products from tropical rain Nais, J. 2001. Rafflesia of the World. Sabah Parks,
forests. Pp. 1-12. FRIM, Kuala Lumpur. Kota Kinabalu, Sabah.
Latiff, A. 1994. Kepelbagaian Tumbuhan - Status Ng, F.S.P., C. M. Low & Mat Asri Ngah Sanan.
sumber alam Malaysia. Universiti Kebangsaan 1990. Endemic trees of the Malay Peninsula. FRIM
Malaysia Press, 42 pp. Research Pamphlets. 118 pp.
Latiff, A. & I. M. Said. 1994. Legislative framework Nijar, G. S. 1995. Developing a “right regime” for
in conservation of biodiversity and exploitation of control of biodiversity and indigenous knowledge.
organisms for natural products. In : I. M. Said, Z. In : A. H. Zakri (Ed.). Prospects in biodiversity
Zakaria & H. H. Hamzah (Eds.). Bioassay Guided prospecting. Genetic Society of Malaysia &
Isolation of Natural Products. Universiti Universiti Kebangsaan Malaysia. Pp. 225-265
Kebangsaan Malaysia. pp. 1-12
Nik Idris Yusoff, Siti Zaiton Mat So’ad, Ujang Suki,
Latiff, A. & M. I. Said. 1994. Legislative framework A. Z. Ibrahim, A. Latiff & Ikram M Said. 2001.
in conservation of biological diversity and Phytochemical screening of Ayer Hitam Forest
exploitation of organisms for natural products. In I. Reserve : Isolation of Ariskanin-A from Thottea
M. Said et al. (Eds.). Bioassay guided isolation of corymbosa (Griff.) Ding Hou (Aristolochiaceae.
natural products. Pp. 1-12, Department of Pertanika Journal of Tropical Agricultural Science
Chemistry, Universiti Kebangsaan Malaysia. 24 (1) : 49-52
Latiff, A., A. Zainudin Ibrahim, G. H. Petol, Ujang Nik Idris, N. Y., U. Suki, B. Din, A. Zainudin
Suki, R. Mohamad, N. M. Al-Schwedi & M. I. Said. Ibrahim, K. Mat-Salleh & A. Latiff. 2001. A
1995. Phytochemical and toxicity screening of preliminary phytochemical and biological screening
plants from Fraser Hill, Pahang, Malaysia. In : G. of plants from Taman Negeri Perlis, Wang Kelian,
Ismail et al. (Eds.). Chemical prospecting in Perlis. In: Faridah-Hanum, I., Kassim Othman & A.
Malaysian forest Pp. 27-42. Universiti Malaysia Latiff (Eds.). Kepelbagaian Biologi dan Pengurusan
Sarawak. Pelanduk Publications. Taman Negeri Perlis: Persekitaran Fizikal dan
Biologi Wang Kelian. 285-292. Jabatan Hutan
Latiff, A. 1998. Conservation and utilisation of
Negeri Perlis.
botanical diversity in Malaysia. Malaysian Applied
Biology 27 (1& 2) : 1-11 Nik Idris Yusoff, Ikram M Said, Laily b Din, Ujang
Suki, Bakri Din, A. Zainudin Ibrahim, K. Mat-
Latiff, A., S. Khamis, M. Nazre, I. Faidah-Hanum,
Salleh & A. Latiff. 2002. Phytochemical and
A. Z. Ibrahim & K. Mat-Salleh. 2001. An annotated
biological screening of plants from Hutan Simpan
checklist of seed plants of Fraser’s hill. In : A. Latiff
Wang Mu, Taman Negeri Perlis. In : Latiff, Kasim
et al. (Eds.). Bukit Fraser : Persekitaran Fizikal,
Osman, Yusoff A Rahaman & I. Faridah-Hanum
Biologi dan Sosio-ekonomi. pp. 245-275. Universiti
(Eds.). Biodiversity and Management of Perlis State
Kebangsaan Malaysia.
Park – Physical, biological and Social environment
Latiff, A. 2003. Traditional use, potential for of Wang Mu. Pp. 303-308. Department of Forestry,
exploitation and conservation of medicinal plants in Perlis.
Malaysia. Sarawak Development Journal 6 (2) : 21-
Primack, R. B. and T. H. Kunz. 1996. The
38
biodiversity crisis and conservation biology. In :
Latiff, A. & M. Wong. 2003. A new species of Zainal Abidin Abu Hasan & Zubaid Akhbar (Eds.).
Rafflesia fromPeninsular Malaysia. Folia Conservation and faunal biodiversity in Malaysia.
malaysiana 4 (3 & 4) : 135-146 Universiti Kebangsaan Malaysia. Pp. 11-23
Reid, W. V. & K. R. Miller. 1988. Keeping options the South to medicine in the North. Oslo. Wan-
alive : The scientific basis for conserving Yaacob, A., S. W . Tong, Laily b Din, Nik Idris
biodiversity. World Resource Institute, Washington Yusoff, A. Latiff & K. Mat Salleh. 2000. An
D.C. Parris, B.S. & A. Latiff. 1997. Towards a alkaloid phytochemical survey of plants of Gunung
pteridophyte flora of Malaysia : A provisional Danum area, Sabah. Malayan Nature Journal 54 (2)
checklist of taxa. Mal. Nat. J. 50 (4) : 12-45 : 87-94
Said, I. M., C. H. Lim & A. Latiff. 1989. Kajian Whitmore, T. C. 1975. Tropical rainforest of the
alkaloid daripada daun segar Tabernaemontana Far East. Clarendon Press, Oxford.
capsicoides. Sains Malaysiana 18 (2) : 19-23
Whitten, A. J., S. J. Damanik, J. Anwar & N.
Said, I. M., L. B. Din, M. W. Samsudin, Z. Zakaria, Hisyam. 1984. The Ecology of Sumatra. Gadjah
N. I. N. Yusoff, U. Suki, A. Manap, Z. Ibrahim & Mada University Press.
A. Latiff. 1990. A phytochemical survey of Ulu
Whitten, A. J., M. Mustafa & G. S. Henderson.
Kinchin, Pahang, Malaysia. Mal. Nat. J. 43(4) : 260-
1987. The Ecology of Sulawesi. Gadjah Mada
266
University Press.
Said, I. M., A. Latiff, S. J. Patridge & J. D.
Wilson, E. O. 1988. The current state of biological
Phillipson. 1991. Alkaloids from Dehassia
diversity. In : E. O. Wilson & M. P. Francis (Ed.).
incrassata. Planta Medica 57 : 389
Biodiversity. National Academy Press. Pp. 3-18
Said, I. M., L. B. Din, N. I. Yusoff. 1992a. A new
Zakri, A. H. 1986. Status of conservation and
alkaloid from the root of Alstonia angustifolia. J.
utilisation of crop genetic resources in Malaysia.
Nat. Prod. 55 (9) : 1323-1324
Malays. Appl. Biol. 15 : 169-178
Said, I. M., A. Latiff, S. Omar & W. Y. W. Ahmad.
Zakri, A. H. (Ed.). 1995. Prospects in Biodiversity
1992b. Phytochemical studies of Bornean flora. In :
Prospecting. Genetics Society of Malaysia &
Ghazally Ismail et al. (Eds.). Forest Biology and
Universiti Kebangsaan Malaysia.
Conservation in Borneo. Centre for Borneo Studies
Publication No. 2 : 542-544 Zakri, A. H. & A. Latiff 1991. Preserving genetic
diversity : Exotic strains and native plants. In : A. H.
Said, I. M., U. Suki, L. B. Din, N. I. Yusoff, M. W.
Zakri et al. (Eds.). Conservation of plant genetic
Samsudin, Z. Zakaria, A. Z. Ibrahim & A. Latiff.
resources through in vitro methods. FRIM &
2000. Preliminary phytochemical and biological
MNCGPR, Kuala Lumpur. Pp. 171-180
screening of plants from Belum Forest Reserve,
Hulu Perak, Malaysia. Mal. Nat. J. 54(3) : 187-193 Zakaria, Z., L. B. Din, A. Latiff & J. A. Elix. 2000.
Notes on the morphology and chemical constituents
Salleh, M. N., A. A. Kadir, K. Shaari & I. Jantan.
of the lichen, Cladia aggregata (Sw.) Nyl. in
1995. Medicinal products from the tropical
Peninsular Malaysia. Mal. Nat. J. 54(1) : 27-30
rainforests of the Far East. In : A. H. Zakri (Ed.).
Prospects in biodiversity prospecting. Genetic Zakaria, Z., Laily b Din, Nik Idris Yusoff, Mohd.
Society of Malaysia & Universiti Kebangsaan Wahid Samsudin, Ujang Suki, K Mat-Salleh, A.
Malaysia. Pp. 95-105 Zainudin Ibrahim, A. Latiff & Ikram M Said. 2001.
A preliminary phytochemical survey of plants in
Sam, T. C., S. Y. Chew, Sabirin Matsjeh, E. K. Gan,
Fraser’s hill. In : Latiff, A., Zuriati Zakaria, Zaidi M
Dzulkifli Razak & A. Latiff. 1987. Goniothalamin
I, K. Mat-Salleh, Noorazuan Md. Hashim & Laily b
oxide: an embryotoxic compound from
Din (Eds.) Bukit Fraser – Persekitaran Fizikal,
Goniothalamus macrophyllus (Annonaceae).
Biologi dan Sosio-ekonomi. Universiti Kebangsaan
Tetrahedron Letters 28(22): 2541-2544
Malaysia. Pp. 321-330
Svarstad, H. & S. S. Dhillion (Eds.). 2000.
Responding to bioprospecting from biodiversity in
Preparation and Characterization of High Surface Area MgO and The Stability
Study of Cypermethrin
Chemistry Department / Faculty of Science, Universiti Teknologi Malaysia, 81310 Skudai, Johor, Malaysia.
Email: manrahim@kimia.fs.utm.my
Chemistry Department / Faculty of Science, Universiti Teknologi Malaysia, 81310 Skudai, Johor, Malaysia.
Email: hanismy07@yahoo.com
Abstract:
MgO has the ability to act as a catalyst once with high surface area morphology. MgO have
simple rock salt structure with surface morphology of 2D shows predominantly (100) type
crystal face and a small number of morphology defects. In this study, various methods have
been used to prepare the high surface area MgO and include, modified dehydration, open
calcinations and autoclave preparation of MgO aerogel. The samples were characterize by
spectroscopic techniques include Fourier Transform Infra-Red (FTIR), Nuclear Magnetic
Resonance (NMR) and electron Spin resonance (ESR). For better understanding or the MgO
morphology and high surface area, Scanning Electron Microscope (SEM) and BET Surface
Area were used. Through NMR and ESR results it showed that there are 3 types of
coordination on MgO(100) surface. While BET analysis has showed that there is an optimum
point for sample heating, which is at 6000C and the range of the surface area is 200-230
m2/g. An intriguing fact about cypermethrin, it is a pesticide which is not harmful to human.
Thus its stability towards this high surface area alkaline earth oxide has opened a new
dimension of study in fundamental science and technology.
Keywords: MgO, Cypermethrin
Detachable
Trap Ball-
peak grows higher. From this result, the one peak intent to grow more than the other
liability is ESR is in agreement with NMR. two peaks while ESR showed at two minutes of
Comparison of both result showed that in NMR UV-irradiation two peaks appeared but after
MgO(V800)
70.0
%T
60.0
MgO(C)
50.0
40.0
MgO(V400)
30.0 Mg(OH)2
20.0
10.0
0.0
2000.0 1500.0 1000.0
1000.0 500.0
1/cm
(a) (b)
2.5
Absorption
1.5
0.5
0
0 5 10 15
Time (Day)
Cypermethrin Blank Cypermethrin MgO
Figure 3.5 Graph absorption versus time of (I) Cypermethrin-Blank, and (II)
Cypermethrin-MgO
five minutes, only one peak grew higher. much more greater in size compared to
activation MgO [7-9].
3.4 Scanning Electron Microscope (SEM)
The above figure shows SEM micrographs of 3.5 Stability of Cypermethrin
MgO magnified at 1000 of commercial MgO Samples were analyzed using UV-Vis and
and after activation at 6000C. Figure 5(a) FTIR. For UV-Vis the adsorption of the
represent Mg(OH)2 obtained from the first samples were taken every three days, while for
method. Figure 5 (b) is D-Mgo, 3.4 (c) is DC- FTIR the spectrum was recorded every seven
MgO and 3.4 (d) is SG-MgO. The results days.
shows that commercially obtained MgO is
100.0
Cyper-Blank 0 Day
%T
Cyper-Blank 7 Days
80.0
Cyper-Blank 14 Days
60.0
40.0
20.0
0.0
2000.0 1500.0 1000.0 500.0
1/cm
100.0
%T
Cyper-MgO Day 0
80.0
Cyper-MgO 7 Days
60.0
Cyper-MgO 14 Days
40.0
20.0
0.0
2000.0 1500.0 1000.0 500.0
1/cm
Figure 3.7 FTIR spectra of Cypermethrin + MgO
graph. From the graph (Figure 6), shows after 3 Preparation Method on The Structural and
days of incubation, concentration of Surface properties of Various Magnesium
cypermethrin in MgO, whilst it is more stable Oxides and Their Catalytic Activity in The
from blank. After more than 10 days, Meerwein-Ponndorf-Verley Reaction (2003).”
Applied catalysis A: General 244. 207-215.
concentration for cypermethrin in blank
however drops but increase again after 14 days 2. Erich Knozinger, Karl-Heinz Jacob, Surjit
of incubation. This is not so for cypermethrin in Singh and Peter Hofmann (1993). “Hydroxyl
MgO. Group as IR Active Surface Probes on MgO
Crystallite”. Surface Science. 290. 388-402.
The samples were also observed using FTIR to
3. Kenneth J. Klabunde, Shawn Decker, Eric
identify the peaks that present. Table 1 shows
lucas and Olga Koper (1999). “How the Shape
the functional group that has been identified. of Nanoparticles Affects Their Adsorption
According to IR spectrum from Figure 7, Properties”. Manhattan: Kansas State
cypermethrin blank is still stable because the University. 577-581.
functional group still in the spectrum on the A. Hitmi, c. Barthomeuf and H. Sallanon (1999).
14th day. While for FTIR spectra of “Rapid Mass Propagation of Chrysanthemum
cypermethrin + MgO are not stable because on Cinerariaefolium Vis. By Callus Culture and
day 14, C≡N peak was not seen in the Ability to Synthesise Pyrehtrins”. Plant Cell
spectrums thus possesses that cypermethrin has Reports. 19. 156-160.
degrade to other materials. The report from Dee 4. Kenneth J. Klabunde, Jane Stark, Olga Koper,
An Jones (1999), the major pathway of Cathy Mohs, Dong G. Park, Shawn Decker, yan
cypermethrin degradation is it will convert to Jiang, Issabelle Lagadic and Dajie Zhang
phenoxy benzoic acid (PBA), dichlorovinyl (1996). “Nanocrystals as Stoichiometric
dimethyl cyclopropanecarboxylic acid (DCVA) Reagents with Unique Surface Chemistry”. J.
and eventually CO2.this also conclude that the Phys. Chem. 100. 12142-12153.
maximum limit of keeping cypermethrin 5. D. F Shriver and P. W. Atkins (1999).
insecticide is two years. “Inorganic Chemistry 3rd Edition”. United
Kingdom: Oxford University Press. 260-262.
4. Acknowledgments
I would like to thank UTM and MOSTE (IRPA 6. Donald L. Pavia, Gary M. Lampman and
vot: 74185), for sponsoring the project. George S. Kriz Jr. (1992). “Pengenalan kepada
Spektroskopi”. Translated Edition. Universiti
5. References Teknologi Malaysia. 40-42.
1. Maria A. Aramendia, Victoriano Borau, Cesar
7. Abdul Rahim Yacob, Hanis Mohd Yusoff
Jimenez, Jose M. Marinas, Jose R. Ruiz,
(2003). “High Nanosurface Metal Oxides”.
Francisco J. Urbano. “Influence of The
Abstract of the EXPO Science and Technology Metal Oxides”. Proceedings of the IPTA
2003. August 7-9. PWTC, Kuala Lumpur. Conference. October 9-12. PWTC, Kuala
Lumpur.
8. Abdul Rahim Yacob, Hanis Mohd Yusoff
(2003). “High Nanosurface Metal Oxides”. 10. Dee An Jones (1999). “Environmental Fate of
Abstract of the INATEX Exhibition. September Cypermethrin”. Environmental Monitoring and
17-19. Rumah ALUMNI: Universiti Teknologi Pest Management. Department of Pesticide
Malaysia. Regulation: Sacramento.
9. Abdul Rahim Yacob, Hanis Mohd Yusoff, Nur
Hafizah Adam (2003). “High Nanosurface
Tingkah Laku Kakisan Aloi Al-Zn Dan Al-Zn-Mg Dengan Unsur Pengaktif Sn Di
Dalam Air Laut Tropika
Abdul Razak Daud1), Mahdi Che Isa1), Muhamad Daud2), Mohd Yazid Ahmad3)
Abstrak
Aloi aluminium merupakan antara bahan yang penting dalam industri lantaran keunikan
sifatnya dan kepelbagaian penggunaannya. Aloi Al-5.5Zn dan Al-5.5Zn-2Mg mengandungi
Sn telah difabrikasi melalui kaedah tuangan. Spektroskopi Impedans Elektrokimia (SIE) dan
teknik pengutuban elektrokimia telah digunakan dalam mengkaji tingkahlaku elektrokimia
permukaan dan kakisan aloi-aloi tersebut di dalam air laut tropika. Kadar kakisan dan
hubungan keupayaan litar terbuka dengan masa dedahan telah ditentukan. Keputusan
daripada kajian SIE menunjukkan yang unsur Sn bertindak sebagai unsur pengaktif kepada
aloi aluminium dengan merendahkan impedans permukaan. Keputusan ini turut disokong
oleh data daripada pengukuran kadar kakisan.
Kata Kunci : Aloi aluminium, impedans, kadar kakisan, stanum.
34
Departement
Proceeding of The 6th ITB-UKM Joint Seminar on Chemistry
of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Abdul Razak Daud, Mahdi Che Isa, Muhamad Daud, Mohd Yazid Ahmad
aluminium. Tujuan kajian ini adalah untuk voltan ulang-alik kurang daripada 10 mV.
memfabrikasi aloi aluminium yang ditambah Semua ujikaji elektrokimia dijalankan dengan
dengan Sn dan melakukan pencirian terhadap menggunakan peralatan kajian kakisan
tingkah laku kakisannya menggunakan kaedah dilengkapi dengan potentiostat/galvanostat
elektrokimia. Keputusan yang diperolehi akan Gamry model PC4-750 yang dikawal oleh
dihubungkaitkan dengan kebolehan Sn sebagai perisian Gamry Framework V4.2.
unsur pengaktif kepada aloi berkenaan.
3. Hasil dan Pembahasan
2. Percobaan Morfologi Permukaan Aloi Sebelum Ujian
Semua aloi disediakan daripada logam Penelitian dengan mikroskopi konfokal
berketulenan melebihi 99.99%. Logam di lebur imbasan laser ke atas sampel aloi tuangan yang
pada suhu 800º C dan di tuang ke dalam acuan digilap berkilat bagi mengkaji bentuk serta
keluli berbentuk rod dengan diameter 18 mm. taburan mendakan yang mungkin wujud di
Bagi mengelakkan udara terperangkap di dalam dalam aloi tersebut. Rajah 1 menunjukkan
acuan dan mengelakkan kecacatan yang mikrograf yang diperoleh daripada sampel aloi
disebabkan oleh lompang, mikroliang dan tuangan sebelum ujian. Rajah berkenaan
sebagainya semasa proses penuangan, acuan menunujukkan sampel aloi yang mengandungi
terlebih dahulu dipanaskan menggunakan relau Sn mempunyai mendakan hitam yang lebih
pada suhu 150º C. Proses peleburan dan banyak serta tertabur lebih sekata berbanding
penuangan dilakukan di dalam persekitaran dengan sampel tanpa Sn.
lengai (gas argon) untuk mengelakkan daripada
Maklumat mikroskopi konfokal imbasan laser
pengoksidaan.
mendapati diameter mendakan hitam bagi aloi
Komposisi kimia sampel ditentukan Al-5.5Zn dan aloi Al-5.5Zn-2Mg dengan
menggunakan spektrometer serapan atom kehadiran 2% Sn adalah diantara 15-25 µm
model Spectra AA-10 dengan prosidur analisis manakala aloi tanpa Sn pula terdapat sedikit
mengikuti piawai ASTM E536-98 (1998). mendakan hitam dengan saiz diantara 2-10 µm.
Jadual 1 menunjukkan komposisi kimia aloi Mikrograf yang ditunjukkan dalam Rajah 1 di
yang disediakan. Difraktometer sinar-X model atas juga sepadan dengan keputusan yang telah
Bruker AXS dengan punca sinaran Cukα turut dilaporkan oleh penyelidik lain (Yuan et al.
digunakan bagi mengenalpasti kewujudan fasa- 2000; Guillaumin & Mankowski,1998).
fasa tertentu dalam aloi aluminium yang dikaji. Stanum mempunyai kelarutan pepejal yang
Imbasan dilakukan pada kadar 0.002°/saat amat rendah dalam logam aluminium sama ada
dengan sudut imbasan 2θ dari 20° hingga 80°. pada suhu rendah maupun suhu tinggi (kira-
Morfologi permukaan sampel sebelum ujian kira 0.1%bt pada suhu 627 oC). Sehubungan
diperolehi menggunakan mikroskop konfokal dengan itu, ia akan tersingkir ke sempadan
imbasan laser model LSM Carl Zeiss 5 Pascal. butiran, di celah-celah struktur dendrit atau
membentuk sebatian antaralogam semasa
Kajian tingkah laku kakisan aloi aluminium di proses solidifikasi. Kewujudan fasa sekunder
dalam air laut tropika, pH 8.2 pada suhu bilik, telah disahkan dengan analisis pembelauan
27°C dilakukan menggunakan kaedah sinar-X (XRD) dimana sebatian antaralogam
pengutuban elektrokimia. Kadar kakisan Mg2Sn wujud di dalam aloi Al-5.5Zn-2Mg-2Sn
ditentukan daripada plot Tafel. Keupayaan litar sebagaimana yang ditunjukkan pada Rajah 2.
terbuka bagi sampel diukur setiap10 saat dalam Walau bagaimanapun tiada sebatian
tempoh 15 jam rendaman. Bagi kaedah antaralogam dapat dikesan dalam aloi Al-
elektrokimia arus ulang-alik pula, Spektroskopi 5.5Zn-2Sn sebaliknya dipercayai mendakan
Impedans Elektrokimia dijalankan pada julat hitam yang dilihat adalah fasa β-Sn
frekuensi 1x10-3 Hz hingga 1x105 Hz dengan
(a) (b)
(c) (d)
Rajah 1 Mikrograf daripada mikroskop konfokal imbasan laser bagi permukaan aloi Al-5.5Zn
sebelum ujian (a) 0% Sn, (b) 2% Sn dan aloi Al-5.5Zn-2Mg (c) 0% Sn (d) 2% Sn
Rajah 2: Difraktogram XRD bagi (a) aloi Al-5.5Zn-2Mg-2S n dan (b) Al-5.5Zn-2Sn
permukaan aloi menjadi lebih aktif dan mudah peringkat awal 5 jam rendaman sebelum stabil
mengkakis. yakni mengalami perubahan keupayaan yang
kecil sekitar 20-50 mVolt pada jam berikutnya.
Pengukuran Elektrokimia
Keupayaan litar terbuka yang dicerap pada
Cara yang sering digunakan bagi mengawasi
semua keadaan adalah akibat daripada tindak
tingkah laku kakisan bagi logam atau aloi ialah
balas anodik dan katodik yang berlaku pada
dengan cara merekod bacaan keupayaan litar
permukaan aloi. Penambahan Sn terhadap aloi
terbuka terhadap masa rendaman. Rajah 3 dan
Al-5.5Zn menyebabkan berlaku anjakan
4 masing-masing menunjukkan kesan
keupayaan kakisan ke arah positif disebabkan
komposisi aloi keatas keupayaan litar terbuka
oleh sifat Sn yang lebih katodik berbanding Al
merujuk kepada elektrod kalomel tepu (EKT)
dan Zn. Manakala penambahan 2%Mg kepada
terhadap masa rendaman bagi Al-5.5Zn dan Al-
Al-5.5Zn menjadikan aloi tersebut lebih
5.5Zn-2Mg apabila direndam di dalam air laut
elektronegatif kerana Mg merupakan logam
selama 15 jam. Nilai purata keupayaan litar
yang aktif.
terbuka ditunjukkan di dalam Jadual 2. Pada
permulaan rendaman, nilainya menokok kearah Rintangan kakisan bagi aloi aluminium di
positif mengikut masa dan menjadi stabil dalam medium akueus boleh dinilai
selepas 5 jam rendaman. Keputusan ini berdasarkan rintangan pengutuban yang
menunjukkan fenomena fana (transient) pada ditunjukkan oleh keupayaan litar terbukanya.
-1.10
-1.20 (a)
-1.30 (b)
-1.40
(c)
-1.50
-1.60
-1.70
0.0E+00 1.0E+04 2.0E+04 3.0E+04 4.0E+04 5.0E+04 6.0E+04 7.0E+04
Masa (S)
Rajah 3 Perubahan keupayaan litar terbuka mengikut masa rendaman di dalam air laut tropika
pada suhu 27 ºC bagi (a) Al tulen, (b) Al-5.5Zn-2Sn (c) Al-5.5Zn.
-1.10
-1.20 (a)
-1.30 (b)
-1.40
-1.50 (c)
-1.60
-1.70
-1.80
0.0E+00 1.0E+04 2.0E+04 3.0E+04 4.0E+04 5.0E+04 6.0E+04 7.0E+04
Masa (S)
Rajah 4 Perubahan keupayaan litar terbuka mengikut masa rendaman di dalam air laut tropika
pada suhu 27 ºC bagi (a) Al tulen, (b) Al-5.5Zn-2Mg, (c) Al-5.5Zn-2Mg-2Sn
1 ja m 8 jam 2 jam
8 jam 6 jam 1 jam
4 ja m 6 jam
8.E + 03 2 jam 4 jam
1.E+03
7.E + 03
9.E+02
6.E + 03
7.E+02
Z khayalan (ohm.cm2)
Z khayalan (ohm.cm
)
2
5.E + 03 5.E+02
3.E+02
4.E + 03
1.E+02
3.E + 03
-1.E+02
2.E + 03 -3.E+02
-5.E+02
1.E + 03
-7.E+02
0.E + 00 0.E+00 5.E+02 1.E+03 2.E+03 2.E+03
0.E +0 0 2.E +03 4.E +03 6.E +0 3 8 .E +03 1.E +04 1.E + 04 1.E +04 2.E +0 4
2)
Z nyata (ohm.cm2)
Z nyata (ohm .cm
(a) (b)
Rajah 5 Plot Nyquist bagi perubahan impedans pada keupayaan litar terbuka dengan masa
rendaman bagi aloi (a) Al-5.5Zn (b) Al-5.5Zn-2Sn
9.E+03
2.E+03
8.E+03
2.E+03
Z khayalan (ohm.cm2)
7.E+03
1.E+03
6.E+03 1.E+03
5.E+03 1.E+03
8.E+02
4.E+03
6.E+02
3.E+03 4.E+02
2.E+03 2.E+02
0.E+00
1.E+03
-2.E+02
0.E+00
0.0E+00 1.0E+03 2.0E+03 3.0E+03 4.0E+03 5.0E+03
0.E+00 2.E+03 4.E+03 6.E+03 8.E+03 1.E+04 1.E+04
Z nyata (ohm.cm2) Z nyat a (ohm.cm2)
(a) (b)
Rajah 6 Plot Nyquist bagi perubahan impedans pada keupayaan litar terbuka dengan masa
rendaman bagi aloi (a) Al-5.5Zn-2Mg (b) Al-5.5Zn-2Mg-2Sn
6.E+03
Z khayalan (ohm.cm2)
5.E+03
4.E+03
3.E+03
2.E+03
1.E+03
3.E+02
-7.E+02
0.0E+00 5.0E+03 1.0E+04 1.5E+04
Z nyata (ohm.cm2)
Rajah 7 Plot Nyquist bagi perubahan impedans pada keupayaan litar terbuka dengan masa
rendaman bagi logam Al tulen
rintangan dan kapasitan lapisan tersebut. yang demikian ia akan meyediakan ruang untuk
Kehadiran Sn dalam bentuk Mg2Sn bagi aloi inisiasi kakisan. Peranan sebatian antaralogam
Al-Zn-Mg-Sn atau β-Sn bagi aloi Al-Zn-Sn dalam mengaktifkan aloi Al-Mg-Zn turut
akan menyebabkan lapisan oksida yang dilaporkan oleh Barbucci et al. (1998).
terbentuk pada permukaan aloi mempunyai
Daripada plot Tapel seperti yang ditunjukkan
kecacatan dan tidak homogen. Kecacatan pada
dalam Rajah 8 menunjuk kehadiran unsur-
lapisan oksida menyebabkan rintangan elektrik
unsur aloian, Zn, Mg dan Sn menyebabkan aloi
pada lokasi berkenaan menjadi rendah oleh
mempunyai keupayaan kakisan yang lebih
Jadual 3 Keupayaan dan kadar kakisan bagi Al tulen dan aloi Al di dalam air laut yang
diperolehi daripada plot Tafel.
Al tulin 0% Sn Al tulin 0% Sn
-0.60 2% Sn 2% Sn
-0.60
-0.80
Al tulen -0.80 Al tulen
-1.00
Keupayaan (V vs EKT) -1.00 0% Sn
Keupayaan (V vs EKT)
2% Sn
-1.20
-1.20 2% Sn
-1.40
0% Sn -1.40
-1.60
-1.60
-1.80
-1.80
-2.00
-2.00
1.0E-10 1.0E-08 1.0E-06 1.0E-04 1.0E-02 1.0E+00
2 1.E-10 1.E-08 1.E-06 1.E-04 1.E-02 1.E+00
Ketumpatan arus (A/cm )
Ketumpatan arus (A/cm2)
(a) (b)
Rajah 8 Plot Tafel bagi Al tulen dan aloi Al di dalam air laut tropika, pH 8.2, suhu 27 ºC (a)
Al-5.5Zn (b) Al-5.5Zn-2Mg
negatif bermakna aloi-aloi ini bersifat lebih Sn telah menyebabkan lapisan oksida
anodik berbanding dengan Al tulen. Kehadiran pelindung yang terbentuk pada permukaan aloi
Sn pula menampakkan peningkatan kadar mempunyai kecacatan dan tidak homogen.
kakisan yang ketara berbanding dengan Al Kecacatan lapisan oksida pelindung
tulen dan masing-masing aloi Al-5.5Zn dan Al- menurunkan rintangan permukaan aloi dan
5.5-2Mg (Jadual 3). Kadar kakisan aloi-aloi ini menyebabkan aloi menjadi aktif dan kadar
jelas menyokong keputusan yang diperolehi kakisannya meningkat. Peranan Sn sebagai
daripada kajian spektroskopi impedans unsur pengaktif aloi aluminium menjadi lebih
elektrokimia iaitu aloi yang mempunyai ketara dengan kehadiran Mg di dalam aloi
rintangan dan kapasitan yang tinggi tersebut.
memberikan nilai kadar kakisan yang rendah.
5. Ucapan Terimakasih
Keputusan ini seterusnya mengesahkan yang
Para penulis merakamkan penghargaan kepada
Sn memain peranan sebagai pengaktif aloi
Kerajaan Malaysia di atas sokongan kewangan
aluminium terutamanya aloi aluminium yang
melalui geran penyelidikan, IRPA 09-02-02-
mengandungi magnesium.
0118-EA295. Penghargaan juga kepada Institut
4. Kesimpulan Penyelidikan Sains dan Teknologi Pertahanan
Kajian tingkah laku kakisan aloi Al-Zn dan Al- (STRIDE), Kementerian Pertahanan Malaysia
Zn-Mg di dalam air laut tropika telah di atas kemudahan peralatan pemyelidikan
memperlihatkan yang unsur aloian Sn dapat yang dibekalkan.
bertindak sebagai unsur pengaktif aluminium
6. Rujukan
dengan berkesan. Kewujudan Sn dalam aloi Al- ASTM E 536-98. (1998). ASTM Standards test
Zn dan Al-Zn-Mg dalam bentuk Mg2Sn atau β- methods for chemical analysis of zinc and zinc
alloys. Designation E-1998, American Society for Lin, J. C., Shih, H. C., (1987). Improvement of the
Testing and Materials, Philadelphia, USA. current efficiency of Al-Zn-In anode by heat
treatment. J. of Electrochem. Soc., 134(4), 817-823.
Barbucci, P., Cabot, L., Bruzzone, G., Cerisola, G.,
(1998). Role of intermetallics in the activation of Salinas, D. R., Garcia, S. G., Bessone, J. B., (1999).
Al-Mg-Zn alloys. J. of Alloys & Comp., 268, 295- Influence of alloying elements and microstructure
301. on aluminium sacrificial anode performance: case of
Al-Zn. J. of Applied Electrochemistry, 29, 1063-
Breslin C. B., Friery, L. P., Carrol, W. M., (1993).
1071.
Influence of impurity elements on electrochemical
activity of aluminium activated by indium. Yuan G. C., Li Z. J., Lou Y. X., Zhang, X. M.,
Corrosion, 49(11), 895-902. (2000). Study on crystallization and microstructure
for new series of Al-Sn-Si alloys. Mat. Sci. Eng.,
Guillaumin V., Mankowski. G., (1998). Localized
A280, 108-115.
corrosion of 2024 T351 aluminium in chloride
media. Corr. Sci., 41, 421-438.
Abstract
Preparation of nickel nanofilm onto gold thin film substrates by electrochemical deposition is
reported. Electrochemical deposition was carried out using 0.1 M NiSO4 solutions that
contains 10 wt.% glucopone as surfactant. It was carried out under a potential of 2V for 120
seconds by using continuous current. A standard three-electrode cell was used for deposition.
Morphology and composition of nanoparticles were studied by Scanning Electron
Microscopy (SEM) and Energy Dispersive X-ray analysis (EDX) respectively. Estimation
using SEM images indicated that the thickness of nickel film was about 50 nm. The
distribution of Ni particles in the film is very uniform.
Keywords : Electrochemical deposition, glucopone, gold substrate, nickel nanofilm.
42
th
Departement of ChemistryProceeding of The
ITB, Jl. Ganesha 10,6Bandung
ITB-UKM
40132,Joint
PhoneSeminar
: +62 (22)on Chemistry
2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Abdul Razak Daud, Dahyunir Dahlan, Shahidan Radiman
The purpose of this work is to synthesize nickel solution to glucopone used was 9:1. The
nanofilms from nickel sulphate solution solution was stirred for one hour.
containing glucopone as a surfactant by Electrodeposition process was carried out in a
electrodeposition onto gold thin film substrates. cell comprising three electrodes. A graphite rod
and a saturated calomel electrode were
2. Experimental
employed as the counter electrode and
Gold thin film substrates, estimated thickness
reference electrode respectively while a gold
of about 100 nm were produced via evaporation
thin film substrate acted as working electrode.
onto glass slides using Sputter Coater SC 500.
A laboratory DC power supply, GPR-1830 was
The substrates were cut into 5 mm x 25 mm
used to provide electrical potentials with the
and each of them was attached with a copper
current density of 10 to 60 µA cm-2. Once the
wire on their back part using silver paint. They
electrodeposition process was complete, the
were then washed in distilled water and dried.
substrate was then removed from the solution
Nickel sulphate (NiSO4.7H2O) was obtained and cleaned by soaking in deionized water.
from Sigma Aldrich; Glucopone 215 CU SP (a
3. Results and Discussion
technical grade alkyl polyglucosides) was
Figure1 shows deposition of nickel on a gold
supplied by Fluka Chemica. Double distilled-
thin film using continuous current at applied
deionized water was used to prepare 0.1M
potential of 2V for 120 seconds.
NiSO4 solution. For solution containing
Electrodeposition using 0.1 M NiSO4 solution
glucopone, the weight ratio of 0.1M NiSO4
Figure 1. SEM micrograph of surface nickel nanofilm electrodeposited onto a thin film of gold at 2
volts with continuous current for 120 seconds using solution of (a) 0.1M NiSO4 and (b) 0.1M NiSO4 +
10% glucopone
Figure 2. Cross section of a sample indicating Ni nanofilm layered on a gold thin film substrate
deposited on a glass slide.
without glucopone addition has produced free path of the electrons within solid samples
agglomerated nickel particles layer on the is less than 2 nm so the typical information
surface of substrate (Figure 1(a)). However, the depth for XPS is about 5 nm.
addition glucopone to the solution has
4. Conclusion
produced very tiny Ni particles and they were
Glucopone 215 CUSP can reduce the
distributed very uniformly all over the surface
agglomeration of nickel particles in
of the substrate (Figure 1(b)). It seems that
electrodeposition process. When glucopone is
glucopone 215 CUSP has reduced the nickel
added into 0.1M NiSO4 solution, the size of Ni
particle growth or agglomeration during
particles became very fine and the particles
electrodeposition process. Figure 2 shows the
were closely packed and uniformly distributed.
cross section of the sample shown in Figure
The thickness of nickel nanofilm produced was
1(b). A cross sectional view of sample shown
about 50 nm.
in Figure 1 indicated that a dense layer of Ni
particles was formed. No stacking fault 5. Acknowledgement
between particles, which could be seen for this The authors would like to acknowledge the
sample. The thickness of nickel layer was about Government of Malaysia for funding this work
50 nm. through research grant IRPA 09-02-02-0032-
SR0004/04/04.
In order to confirm the presence of Ni film on
the surface of the gold substrate, X-ray 6. Reference
photoelectron spectroscopy (XPS) was Hato M., Minamikawa H., Tamada K., Baba T.,
performed. Figure 3 shows the XPS spectrum Tanabe Y., (1999). Self-assembly of Synthetic
of the nickel film where Ni and Au are clearly Glycolipid/Water System, Advances in Colloid and
Interfaces Science, 80, 233-270.
indicated. The peaks at 850 and 872 eV
correspond to Ni2p3/2 and Ni2p1/2 signals Mandal M., Kundu S., Ghosh S.K., Sau T.K., Yusuf
respectively. The presence of C and O might be S.M., Pal T., (2003). Wet Chemical Method for
due to residual solution or surface Synthesis of Superparamagnetic alloyed Ni-Pd and
contamination by environment during sample Ni-Pt Nanomagnets in micelles, Journal of Colloid
handling. The low intensity of Au peak at about and Interfaces Science, 265, 23-28.
82 eV indicated that nickel film formed on gold Natter H., Happelmann R., (2003). Tailor-made
is thin enough, sufficiently allows electrons of Nanomaterial Designed by Electrochemical
gold atoms emerged from its surface. The mean Methods, Electrochemica Acta, 49, 51-61.
Peycova M., Michailova E., Stoychev D., Milchev Ryan L.D., Kaler E.W., (2001). Alkyl Polyglucoside
A., (1995). Galvanostatic Studies of the Nucleation Microemulsion Phase Behavior, Colloids and
and Growth Kinetics of Copper in the Presence of Surfaces A, 176, 69-83.
Surfactant, Electrochemica Acta, 40(16), 2595-
Siddig M.A., Radiman S., Muniandy S.V., Jan L.S.,
2601.
(2004). Structure of Cubic Phase in Ternary
Przenioslo P., Wagner J., Natter H., Hampelmann Systems Glucopone/water/hydrocarbon, Colloids
R.,Wagner W., (2001). Studies of the Fractal and Surfaces A, 236, 57-67.
Microstructure of Nanocrystalline and Amorphous
Sun X.C., Toledo J.A, (2002). Magnetic and
Chromium Obtained by Electrodeposition, Journal
Microstructural Properties of Assembly of Ni(C)
of Alloys and Compounds, 328(1-2), 259-263.
Nanoparticles, Current Applied Physics, 2, 113-116.
Abdul Salam Babji, Norrakiah Abdullah Sani, Nur Huda Faujan dan Rohasmizah Hashim
Program Sains Makanan, Pusat Pengajian Sains Kimia dan Teknologi Makanan
Fakulti Sains dan Teknologi, Universiti Kebangsaan Malaysia
43600, Bangi, Selangor, Malaysia.
E-mail:daging@pkrisc.cc.ukm.my
Abstrak
Kajian dijalankan ke atas 7 fomulasi burger ayam tua berlemak sawit untuk melihat kesan
penyimpanan selepas penambahan ekstrak tumbuhan tempatan. Tujuh formulasi tersebut
ialah burger ayam tua ditambah 400 ppm ekstrak ulam raja, 200ppm ekstrak daun kesum
dan 1000ppm ekstrak daun kari. Dua formulasi lain ditambah dengan 200 ppm BHT dan
200 ppm BHA sebagai perbandingan antioksida sintetik dan semulajadi hasil ekstrak
tumbuhan tempatan. Burger ayam tua yang tidak ditambah dengan apa-apa bahan bertindak
sebagai sampel kawalan pertama dan fomulasi menggunakan ayam muda sebagai sampel
kawalan kedua. Tumbuhan yang dikaji ialah ulam raja (Cosmos caudatus), kesum
(Polygonum hydropiper), selom (Oonanthe javanica), pegaga (Centella asiatica) dan daun
kari (Murayya koenigii). Analisis yang telah dijalankan keatas ekstrak ialah kandungan
komponen fenolik jumlah dan uijan penurunan Fe3+ (FRAP). Ujian asid tiobarbiturik (TBA)
dan ujian peroksida (PV) dijalankan keatas burger sepanjang tempoh 3 bulan penyimpanan
sejukbeku. Kandungan komponen fenolik jumlah tertinggi diperolehi dari ekstrak daun kari
dengan pelarut etanol dan metanol masing-masing bernilai 423.09 mgTAE/kg berat segar
dan 386.03 mgTAE/kg berat segar. Kesum dengan pelarut air memperolehi ekstrak tertinggi
sebanyak 443.47 mgTAE/kg berat segar (P<0.05). Hasil ujian FRAP, ekstrak air kesum
mempunyai aktiviti penurunan tertinggi. Hasil analisis TBA bagi burger menunjukkan
sampel mentah dengan penambahan ekstrak 200 ppm daun kesum dan 1000 ppm daun kari
dapat melambatkan proses pengoksidaan dengan signifikan (P<0.05) dan setanding dengan
200ppm BHT. Analisis PV sampel mentah pula menunjukkan nilai PV meningkat sepanjang
2 bulan pertama tetapi menurun pada bulan ketiga. Hitungn piring jumlah dan kiraan yis
dan kulat bagi semua perlakuan adalah menurun sepanjang 3 bulan tempoh penyimpanan
dan tidak menunujukkan sebarang perubahan yang signifikan. Perubahan fizikokimia tidak
menjejaskan penerimaan pengguna berdasarkan ujian sensori yang telah dilakukan pada
bulan 0 dan 3 tempoh penyimpanan.
Kata kunci: antioksida semulajadi, antioksida sintetik, pengoksidaan lipid dan burger ayam
tua
46
Departement
Proceeding of The 6th ITB-UKM Joint Seminar on Chemistry
of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Abdul Salam Babji, Norrakiah Abdullah Sani, Nur Huda Faujan dan Rohasmizah Hashim
dibuat termasuk satu sampel kawalan ayam pelarut etanol dan metanol. Peratus hasil
muda. Sampel kajian adalah seperti berikut: dapatan ekstrak yang sama bagi pelarut yang
Kawalan Ayam Muda (K1), Kawalan Ayam berbeza dipengaruhi oleh kepolaran pelarut
Tua (K2), 200 ppm BHT (A1), 200 ppm BHA yang berbeza.
(A2), 400 ppm ekstrak air ulam raja (E1), 200
Kandungan Komponen Fenolik Jumlah
ppm ekstrak air daun kesum (E2) dan 1000
Pengukuran kandungan komponen fenolik
ppm ekstrak air daun kari (E3). Penambahan
jumlah adalah dengan mengira kuantiti jumlah
ekstrak tumbuhan ke dalam produk adalah
kepekatan kumpulan hidroksil polifenol yang
berdasarkan kepada ujian kuasa penurunan
hadir dalam ekstrak asai (Waterman dan Mole,
ferum (III) yang setanding dengan 200 ppm
1994). Berpandukan Jadual 2, didapati daun
BHA.
kari dengan pelarut etanol dan metanol
Ujian Tiobarbiturik (TBA) dibuat merujuk mengandungi komponen fenolik jumlah
kepada kaedah yang dibuat oleh Tarladgis et al. tertinggi (P<0.05) dengan nilai masing-masing
(1960) dengan sedikit pengubahsuaian oleh pada 42.31 dan 38.60 mg TAE/100 g berat
Rhee (1978) manakala Penentuan Nilai basah sampel berbanding tumbuhan lain yang
Peroksida (PV) dengan kaedah PORIM (1995). dikaji. Ini diikuti oleh ulam raja dengan
ekstrak etanol dan metanol masing-masing
Analisis Statistik
bernilai 20.91 dan 18.83 mg TAE/100 g berat
Semua data yang diperolehi telah dianalisis
basah sampel. Ekstrak air kesum menunjukkan
dengan menggunakan program sistem SAS
kandungan komponen fenolik jumlah tertinggi
(Statistical Analisis System, 1995) versi 6.21
iaitu 44.35 mg TAE/100 g berat basah sampel.
untuk ujian ANOVA dan ujian DUNCAN.
Ini diikuti dengan daun kari, ulam raja, selom
3. Hasil Dan Pembahasan dan pegaga. Ekstrak air pegaga mengandungi
Hasil Ekstrak Sampel komponen fenolik jumlah terendah iaitu 3.72
Berdasarkan Jadual 1, peratus hasil dapatan mg TAE/100 g berat basah sampel. Komponen
ekstrak daun kari bagi pelarut etanol dan fenolik yang tertinggi bagi ketiga-tiga pelarut
metanol adalah paling tinggi berbanding adalah daun kari diikuti oleh kesum dan ulam
sampel lain, iaitu masing-masing pada 2.03% raja.
dan 1.65%. Bagi pelarut air pula, daun selom
Ujian Kuasa Penurunan Ferum (III) (FRAP)
menghasilkan peratus ekstrak tertinggi iaitu
Ujian ini dilakukan untuk mengukur perubahan
5.19%. Ulam raja menghasilkan ekstrak
Fe (III) kepada Fe (II) dengan kehadiran
terendah bagi pelarut air iaitu sebanyak 1.93%.
sampel kajian. Kemampuan sesuatu komponen
Secara keseluruhannya pelarut air dapat
menurunkan Fe (III) kepada Fe (II) mungkin
menghasilkan ekstrak tertinggi berbanding
Jadual 1. Peratus Hasil Dapatan Ekstrak Sampel Menggunakan 3 Jenis Pelarut (Etanol, Metanol dan Air)
Sampel Peratus Hasil Dapatan Ekstrak Sampel
Etanol Metanol Air
Daun Kari 2.03 ± 1.43 1.65 ± 0.47 2.95 ± 0.71
Kesum 0.59 ± 0.15 0.80 ± 0.37 4.01 ± 0.60
Ulam raja 0.70 ± 0.35 1.13 ± 0.41 1.93 ± 1.00
Pegaga 0.40 ± 0.12 0.71 ± 0.03 2.22 ± 0.78
Selom 0.42 ± 0.06 0.66 ± 0.14 5.19 ± 1.65
Data analisis diperolehi daripada eksperimen secara triplikat
4.5
berpotensi mempunyai aktiviti antioksida. Ini ekstrak 400 ppm ulam raja menunjukkan nilai
kerana bahan antioksida merupakan agen peroksida yang paling rendah (P<0.05) bagi
penurun yang menyahaktifkan proses sampel mentah, sementara nilai peroksida bagi
pengoksidaan dan dikenali sebagai tindak balas sampel 200 ppm BHT menunjukkan nilai PV
redoks (Benzie dan Strain, 1996). Rajah 1 yang paling rendah (P<0.05) bagi sampel
menunjukkan hasil ujian FRAP bagi ekstrak masak pada tiga bulan penyimpanan sejukbeku.
sampel air tumbuhan tersebut. Pada kepekatan Nilai PV sampel masak adalah lebih rendah
200 ppm, didapati ekstrak air kesum serta ulam berbanding nilai PV sampel mentah.
raja memperlihatkan kuasa penurunan ferum Kemungkinan semasa masak, komponen-
(III) yang setanding dengan BHA. Bacaan komponen peroksida telah meruap.
penyerapan bagi ekstrak air kesum, ulam raja Walaubagaimanpun, nilai peroksida bagi
dan BHA pada kepekatan 200 ppm masing- sampel kajian tidak melebihi 8.0 militara/ kg
masing bernilai 0.809, 0.773, 0.648 dan 0.966. sampel untuk mana-mana perlakuan mentah
Ekstrak air selom memperlihatkan bacaan dan masak. Komponen peroksida tidak
penyerapan paling rendah (0.174) dan tidak bertanggungjawab dalam ketengikan tetapi
berbeza secara signifikan dengan pegaga, dan bertindak sebagai pelopor dalam perkembangan
BHT. Pada kepekatan 1200 ppm ekstrak air proses ketengikan dan pengoksidaan seterusnya
kesum memperlihatkan bacaan penyerapan (Padda, 1987).
3.951 manakala BHA ialah 4.074 (P>0.05).
Analisis Nilai Asid Tiobarbiturik (TBA)
Ekstrak air sampel lain menunjukkan aktiviti
Malonaldehid merupakan hasil produk
kuasa penurunan ferum (III) yang lebih baik
sekunder lipid (Ahn et al., 2002). Analisis
daripada BHT (P<0.05).
TBA merupakan analisis untuk mengukur
Analisis Nilai Peroksida (PV) produk-produk pengoksidaan sekunder
Analisis ini dijalankan untuk menilai produk (Shahidi dan Wanasundra, 1998). Rajah 4
pengoksidaan primer (peroksida dan menunjukkan hasil analisis TBA pada sampel
hidroperoksida) semasa pengoksidaan lipid. mentah sepanjang 3 bulan penyimpanan. Pada
Rajah 2 dan Rajah 3 menunjukkan nilai awal penyimpanan nilai TBA bagi semua
peroksida bagi keseluruhan sampel mentah dan sampel adalah antara 0.566 – 0.811 dan tidak
masak meningkat sepanjang tempoh 2 bulan berbeza secara signifikan (P<0.05). Perubahan
penyimpanan sejukbeku tetapi menurun pada yang ketara dilihat pada bulan kedua
bulan ketiga penyimpanan. Ini mungkin penyimpanan di mana sampel kawalan ayam
kerana, analisis PV hanya sesuai dan sensitif tua menunjukkan nilai TBA yang paling tinggi
untuk menilai tahap permulaan pengoksidaan (1.159) sehingga akhir penyimpanan.
(Hudson, 1989). Sampel kawalan ayam tua
Pada akhir penyimpanan, sampel kawalan
menunjukkan nilai peroksida yang paling tinggi
ayam tua menunjukkan nilai TBA yang paling
bagi sampel mentah dan masak. Sampel
tinggi (1.880) manakala sampel yang diberi
8.0
6.0
Nilai Peroksida
4.0
2.0
0.0
B0 B1 B2 B3
Bulan Penyimpanan
K1 K2 A1 A2 E1 E2 E3
8.0
6.0
Nilai Peroksida
4.0
2.0
0.0
B0 B1 B2 B3
Bulan Penyimpanan
K1 K2 A1 A2 E1 E2 E3
perlakuan 200 ppm BHT menunjukkan nilai ditambahkan dengan 200 ppm BHA (1.057)
TBA yang terendah (0.812). dan tidak berbeza secara signifikan dengan
Walaubagaimanapun, sampel mentah kawalan kawalan ayam muda, 200 ppm BHT dan 400
ayam muda (0.853), ekstrak daun kesum ppm ulam raja. Komponen-komponen
(0.967) dan 1000 ppm ekstrak daun kari (0.983) sekunder yang terhasil mungkin meruap semasa
tidak berbeza secara signifikan pada akhir proses pemasakan dilakukan.
penyimpanan dengan 200 ppm BHT. Peratus
4. Kesimpulan
perencatan pengoksidaan lipid bagi 200 ppm
Analisis kandungan fenolik jumlah yang telah
BHT, 200 ppm BHA, 400 ppm ulam raja, 200
dilakukan terhadap tumbuhan menggunakan 3
ppm daun kesum dan 1000 ppm daun kari
jenis pelarut menunjukkan tumbuhan ulam raja,
masing-masing ialah 38.58, 35.3, 18.69, 31.96
kesum dan daun kari mempunyai komponen
dan 25.42 peratus. Peratus perencatan
fenolik jumlah yang tinggi. Dalam ujian kuasa
pengoksidaan lipid bagi kawalan ayam muda
penurunan ferum (III), semua ekstrak
ialah 41.98 peratus.
tumbuhan dapat menurunkan ferum (III) tetapi
Nilai TBA dalam Rajah 5 bagi sampel masak ekstrak air sampel didapati paling baik.
burger kajian didapati lebih tinggi berbanding Daripada ujian-ujian pengoksidaan, didapati
sampel burger mentah kajian kecuali pada nilai PV semua sampel meningkat pada bulan 0
sampel kawalan ayam tua. Nilai TBA yang sehingga bulan 2 penyimpanan sejukbeku tetapi
paling rendah pada tiga bulan penyimpanan menurun pada bulan 3 penyimpanan. Sampel
sejukbeku adalah pada sampel yang burger dengan 400 ppm ekstrak ulam raja
K1 K2 A1 A2 E1 E2 E3
1.8
1.6
1.4
1.2
sampel)
1
0.8
0.6
0.4
0.2
0
B0 B1 B2 B3
Bulan Penyimpanan
K1 K2 A1 A2 E1 E2 E3
menunjukkan nilai PV yang paling rendah bagi Containing Polyphenolic Compounds in Cooked
sampel mentah tetapi sampel burger dengan Ground Beef, J. Food Chem. Toxicol. 67(4), 1364-
200 ppm BHT menunjukkan nilai PV yang 1369.
paling rendah apabila dimasak. Nilai TBA Al-Jalay B., Blank G., McConnel B., Al-Khayat M.
menunjukkan peningkatan nilai malonaldehid (1987). Antioxidant Activity of Selected Spices
sepanjang tempoh tiga bulan penyimpanan Used in Fermented Meat Sausages, J. Food Prot.
sejukbeku bagi kesemua sampel. Sampel 50, 25-27.
burger dengan 200 ppm BHT menunjukkan Auborg S. P. (1999). Lipid Damage Detection
nilai TBA yang paling rendah bagi sampel During the Frozen Storage of An Underutilized Fish
mentah. Bagi sampel masak nilai TBA sampel Spesies, Food Res. Intern. 32, 497-560.
burger dengan 200 ppm BHA adalah yang Benzie I.F.F., Strain J.J. (1996). The Ferric
terendah pada bulan 3 penyimpanan sejukbeku. Reducing Ability of Plasma (FRAP) as a measure of
5. Ucapan Terimakasih “Antioxidant Power” the FRAP, Assay. Anal.
Penghargaan kepada UKM kerana hadiah Skim Biochem. 239, 70-76.
Pasca Siswazah yang telah membiayai projek Chen C.H., Pearson A.M., Gray J.I. (1992). Effects
tersebut. of Synthetic Antioxidants (BHA, BHT, PG) on the
Mutagenicity of IQ-like Compounds. Food Chem.
6. Daftar Pustaka 43,177-183.
Ahn J., Grun I. U., Fernando L. N. (2002).
Antioxidant Properties of Natural Plant Extracts
El-Alim S.S.L.A., Lugasi A., Hovari J., Dworschak Polyphenolic Flavanoids. Free Radical Res. 22,
E. (1999). Culinary Herbs Inhibit Lipid Oxidation in 375-383.
Raw and Cooked Minced Meat Patties During
Shahidi, F., Wanasundra, U.N. (1998). Methods for
Storage, J. Sci. Food Agric. 79, 277-285.
Measuring Oxidative Rancidity of Fats and Oils.
Halliwell B., Murcia M.A., Chirico S., Aruoma O.I. Dalam Akoh, C.C., Min, D.B. (ed.). Food Lipids:
(1995). Free Radicals and Antioxidants in Food An Chemistry, Nutrtion and Biotechnology. Marcel
in Vivo: What They Do and How They Work, Crit. Dekker, New York.
Rev. Food Sci. and Nut. 35, 7-20.
Sherwin E.R. (1990). Antioxidant Dalam Branen,
Hudson B.J.F. (1989). Evaluation of Oxidative A.L., Davidson, P.M., Salminen, S. (ed.) Food
Rancidity Techniques. Dalam. Allen J.C., & Additives, New York.
Hamilton R.J., (pnyt.). Rancidity in Foods. Elsevier
Singleton V.L., Rossi J.A. (1965). Colorimetry of
Applied Science, London.
Total Phenolics with Phosphomolybdic and
Madsen H. L., Bertelsen G. (1995). Spices As Phosphotungstic Acid Reagents. Am. J. Enol. Vitic.
Review. Trends in Food Sci. Tech. 6, 271-277. 16, 144-158.
Nakatani N. (1992). Natural Antioxidant from St. Angelo A.J., Verticolli J.R., Legendre M.G.,
Spices. American Chemical Society., Marcel Vinnett C.H., Kuan J. W., James C. Jr., Dupuy H.P.
Dekker, Inc., Washington DC. (1987). Chemical and Instrumental Analyses of
Warmed – Over Flavor in Beef. J. Food Sci. 52(5),
Oyaizu M. (1986). Studies on Products of Browning
1163-1168.
Reactions: Antioxidative Activities of Pruducts of
Browning Reaction Prepared from Glucoamine. Sun B.X., Fukuhara M. (1997). Effect of co-
Jap. J. Nutr. 44, 307-315. Administration of BHT, BHA and Flavanoids on the
Activation of Mutagens and Drug-Metabolizing
Padda G.S. (1987). Oxidative Discoloration and
Enzymes in Mice. Toxicol. 122, 61-72.
Rancidity in Meat – A Review. Indian Foodpacker.
41(6), 31. Tarladgis B.G., Watts,B.M., Younathan M.T.,
Dugan, L. (1960). A Distillation Method for the
PORIM (1995). Methods of Test for Palm Oil and
Quantitative Determination of Malonaldehyde in
Palm Oil Products. Dalam Siew, W.L., Tang, T. S.,
Rancid Foods. J. Am. Oil Chem. Soc. 37, 44-48.
Tan, Y. A. (ed.) PORIM Test Methods. Vol. 1.,
Ministry of Primary Industries, Malaysia. Yagi,K., Inagaki T., Sasaguri Y., Nakano R.,
Narasimha T. (1987). Formation of Lipid Laden
Rhee K.S. (1978). Minimazation of Further Lipid
Cells From Cultured Aortic Smooth Muscles Cells
Oxidation in the Distillation 2 – Thobarbituric Acid
and Macrophages by Linoleic Acid Hydroperoxide
Test of Fish and Meat. J. Food Sci. 43, 1776-1781.
and Low Density Lipo-Protein. J. Clin. Biochem.
Rice-Evans C.A., Miller N.J., Bolwell P.G., Nutri. 3, 87-94.
Bramley P.M., Pridham J.B. (1995). The Relative
Waterman P.G., Mole S. (1994). Analysis of
Antioxidant Activities of Plant-Derived
Phenolic Plants Metabolites. Oxford Blackwell
Scientific Publicaions, London.
Kajian Jangka Hayat Dan Penerimaan Produk Bakteri Jenis Pre-proven, Pra-bakar
Serta Thaw And Serve
Norrakiah Abdullah Sani, Abdul Salam Babji, Nurakmal Othman, Norazam Hassan,
Norhayati Abdullah dan Nor Anisah Abdullah
Program Sains Makanan, Pusat Pengajian Sains Kimia dan Teknologi Makanan
Fakulti Sains dan Teknologi, Universiti Kebangsaan Malaysia
Bangi, Selangor, Malaysia.
E.mail: norra@pkrisc.cc.ukm.my
Abstrak
Kajian ini dijalankan bagi menentukan kualiti mikrobiologi produk bakeri jenis pre-proven,
(Strudel Apple, Twist Vanilla Chocolate dan Hazelnut Whirl), pra-bakar (Soft Bun, Foccacio
Bun-eggwash, Multigrain Roll dan Wholemeal Roll) dan thaw and serve (Laugen Sandwich
dan Swiss Sunday Bread). Selain itu penentuan nilai aktiviti air (Aw) dan pH serta tahap
penerimaan produk bakeri mengikut jantina turut dijalankan. Kesemua sampel produk
bakeri ini telah disimpan pada suhu sejukbeku (-22ºC) bagi tempoh penyimpanan 8 hingga
12 bulan bergantung kepada jenis produk iaitu 8 bulan untuk jenis pre-proven dan 12 bulan
untuk jenis pra-bakar dan thaw and serve. Sampel telah dianalisis pada setiap bulan
penyimpanan. Analisis mikrobiologi yang dijalankan adalah hitungan piring jumlah (TPC),
kiraan yis dan kulat, penentuan Bacillus cereus dan Bacillus spp., Koliform, Koliform Najis,
Escherichia coli dan Salmonella spp. Hasil kajian menunjukkan bahawa penyimpanan
secara sejukbeku produk bakeri dapat merencat atau mengawal pertumbuhan bakteria
mesofilik, yis dan kulat serta Koliform. Ketidakhadiran Koliform Najis, E. coli, Salmonella
spp. serta B. cereus dan Bacillus spp. dalam kesemua sampel produk bakeri menunjukkan
tahap kebersihan dan sanitasi yang baik dalam keseluruhan proses penghasilan produk
bakeri ini. Julat nilai pH bagi produk bakeri kajian ialah antara 4.7 hingga 6.5 dan julat
nilai Aw ialah antara 0.91 hingga 0.96. Berdasarkan soal selidik didapati pelajar perempuan
lebih gemar memakan pelbagai jenis produk bakeri berbanding pelajar lelaki tetapi tabiat
pemakanan produk bakeri antara kedua-dua jantina mempunyai banyak persamaan. Tahap
pengetahuan pelajar perempuan berkaitan produk bakeri adalah lebih baik berbanding
pelajar lelaki tetapi pengetahuan tentang produk bakeri sejukbeku secara keseluruhannya
adalah masih rendah.
Kata kunci: Produk bakeri pre-proven, Produk bakeri pra-bakar, Produk bakeri thaw and
serve, Kualiti mikrobiologi, Penyimpanan sejukbeku.
Jadual 1. Sampel Produk Bakeri Yang Dikaji Di Bawah Kategori Yang Berbeza
Kategori Jenis Nama produk
Pre-proven Swiss Danish Pastry Hazelnut Whirl (HW)
Strudel Apple (SA)
Twist Vanilla Choclate (TVC)
Pra-bakar Bun Foccacio Bun Egg Wash (FBE)
Soft Bun (SB)
Roll Multigrain Roll (MGR)
Wholemeal Roll (WMR)
Thaw and Serve Bread Loaves Laugen Sandwich (LS)
Swiss Sunday Bread (SSB)
Kaldu Asas Salmosyst®(SBB) yang dieramkan mesofil bagi produk pre-proven adalah
pada 35oC selama 22 jam. Pencoretan signifikan (p<0.05) disepanjang tempoh
dilakukan pada media selektif Xylose Lysine penyimpanan sejukbeku kecuali bagi produk
Desoxycholate (XLD) dan agar Salmonella Twist Vanilla Chocolate (TVC). Secara
Shigella (SSA) (37oC, 24 jam). Koloni tipikal keseluruhan purata penurunan nilai TPC
diinokulatkan ke agar condong Triple Sugar mesofil bagi kesemua produk pre-proven
Iron (TSI), agar condong Urea dan agar Eosin selepas 8 bulan penyimpanan adalah sebanyak
Methylene-blue Lactose Sucrose (EMB) (35oC, 102 cfu/g iaitu daripada 107 cfu/g kepada 105
24 jam) bagi ujian biokimia kehadiran cfu/g. Walaubagaimanapun, produk pre-proven
Salmonella spp. Kehadiran Bacillus cereus dan yang berinti mempunyai nilai TPC yang lebih
Bacillus spp. ditentukan dengan menggunakan tinggi berbanding produk bakeri tanpa berinti.
agar Mannitol Egg-Yolk-Polymyxine (MYP) Ini kerana pertumbuhan bakteria mesofilik ini
yang dieramkan pada suhu 37oC selama 24 berkemungkinan dipengaruhi oleh jenis
jam. Koloni yang terhasil telah diuji secara kandungan inti. Daripada Jadual 2 didapati
biokimia (katalase, mannitol, glukosa, nitrat bahawa pada bulan 0, purata nilai TPC mesofil
dan Voges proskeur). adalah 7.4 log cfu/g dan nilai ini menurun
hingga 5.3 log cfu/g pada bulan ke 8.
Analisis Fiziko-kimia
Penentuan pH dilakukan dengan menggunakan Nilai TPC yang tinggi ini berjaya diminimakan
pH meter (Ion Meter Fisher, Accument Model dalam kajian ini dengan penyejukbekuan doh
230A). Sebanyak 5 gram sampel dihomogenkan pada suhu -22oC. Oleh kerana suhu untuk
bersama 50 ml air suling. Penentuan nilai Aw menaikkan doh (28-30oC) berada dalam julat
pula dilakukan dengan menggunakan Meter optimum bagi pertumbuhan bakteria mesofilik
Aktiviti Air (Model: AQUA LAB CX-2). (30-35oC), maka keadaan ini membolehkan
pertumbuhan bakteria di dalam produk tersebut
Kajian Pengguna
(Che Omar et al., 1996). Doh pre-proven terus
Kajian pengguna telah melibatkan seramai 100
disejukbekukan selepas proses penaikan doh
orang mahasiswa dan mahasiswi UKM dari
tanpa sebarang perlakuan haba yang tinggi.
pelbagai kaum yang berumur di antara 19
Nilai TPC yang tinggi dalam doh ini dapat
hingga 30 tahun. Pemilihan responden adalah
diminimumkan lagi melalui proses
berdasarkan kepada faktor penghad masa dalam
pembakaran. Proses pembakaran doh mentah
menjalani kehidupan di kampus serta tren
dapat mengurangkan bilangan mikrob dari
kehidupan golongan muda dan terpelajar yang
6.0x107cfu/g kepada 1.7x102cfu/g (Viljoen dan
sentiasa sibuk. Secara tidak langsung soal
Lues, 1993).
selidik ini dapat memberikan pendedahan dan
pemahaman kepada golongan pelajar akan Berlainan pula bagi produk pra-bakar dan thaw
kepelbagaian produk bakeri di pasaran. and serve, hitungan piring jumlah mesofil
menunjukkan pola penurunan yang kecil pada
Analisis Statistik
awal bulan penyimpanan dan kekal konsisten
Kesemua data ujian yang diperolehi dianalisis
pada nilai kurang daripada 2.0 log cfu/g selepas
dengan menggunakan program Statistical
6 bulan penyimpanan. Penurunan yang
Analysis System (SAS) versi window 6.12 bagi
signifikan dapat diperhatikan melalui 4 bulan
ujian ANOVA dan Duncan. Nilai perbezaan
pertama penyimpanan (Jadual 2). Secara
signifikan adalah berdasarkan aras keyakinan
purata, pertumbuhan bakteria mesofil pada
95% (p<0.05).
bulan 0 ialah 2.4 log cfu/g dan menurun kepada
3. Hasil dan Pembahasan 2.0 cfu/g pada bulan ke 4 penyimpanan.
Secara umum, melalui keputusan mikrobiologi, Selepas 6 bulan penyimpanan, beban TPC
didapati bahawa penyimpanan sejukbeku bagi menjadi konsisten pada 2.0 log cfu/g. Merujuk
produk bakeri berkeupayaan untuk merencat kepada kriteria mikrobiologi nilai ini berada di
atau mengawal pertumbuhan mikroorganisma dalam julat yang memuaskan iaitu 101 hingga
perosak dan patogen. Jadual 2 menunjukkan 103 cfu/g (ICMSF, 1990). Penurunan
keputusan bagi hitungan piring jumlah mesofil mikroorganisma di awal kajian adalah
bagi produk pre-proven serta pra-bakar dan disumbangkan oleh perlakuan haba semasa
thaw and serve. Penurunan beban bakteria pembakaran produk bakeri tersebut.
Jadual 3. Kiraan Yis dan Kulat (log cfu/g ) Produk Pre-proven, Produk Pra-bakar serta Thaw and Serve
Semasa Penyimpanan Sejukbeku (-220C)
Sampel Tempoh Penyimpanan (bulan)
0 1 2 3 4 6
SA 7.405aB±0.06 7.105aA±0.09 6.485bA±0.01 6.280bA±0.04 6.160bB±0.03 5.146cA±0.11
HW 7.435aA±0.09 7.030bB±0.08 6.445cC±0.02 6.265dB±0.01 6.205dA±0.02 4.855eB±0.00
TVC 7.350aC±0.07 6.985bC±0.04 6.460cB±0.07 6.215dC±0.08 6.120dC±0.03 4.910eB±0.05
SB 2.35aA±0.06 2.27 bA±0.17 2.15 cA±0.00 2.08 cA ±0.11 2.00dA±0.00 <2.00dA±0.00
aA bA cA cA dA
FBE 2.32 ±0.11 2.23 ±0.11 2.15 ±0.00 2.08 ± 0.11 2.00 ±0.00 <2.00dA±0.00
aA bA cA cA dA
MGR 2.35 ±0.06 2.27 ±0.04 2.15 ±0.00 2.08 ±0.11 2.00 ±0.00 <2.00dA±0.00
aA abA bcA cA
WMR 2.32 ±0.11 2.27 ±0.17 2.23 ±0.11 2.08 ±0.11 2.00 ±0.00 <2.00dA±0.00
dA
aA bA cA cA
LS 2.39 ±0.12 2.23 ±0.11 2.15 ±0.00 2.08 ±0.11 2.00dA±0.00 <2.00dA±0.00
aA abA cbA bA
SSB 2.30 ±0.00 2.27 ±0.04 2.23 ±0.11 2.20 ±0.06 2.08dA±0.11 <2.00dA±0.00
Jadual 3. Kiraan Yis dan Kulat (log cfu/g ) Produk Pre-proven, Produk Pra-bakar serta Thaw and Serve
Semasa Penyimpanan Sejukbeku (-220C)
Sampel Tempoh Penyimpanan (bulan)
0 1 2 3 4 6
SA 7.405aB±0.06 7.105aA±0.09 6.485bA±0.01 6.280bA±0.04 6.160bB±0.03 5.146cA±0.11
HW 7.435aA±0.09 7.030bB±0.08 6.445cC±0.02 6.265dB±0.01 6.205dA±0.02 4.855eB±0.00
TVC 7.350aC±0.07 6.985bC±0.04 6.460cB±0.07 6.215dC±0.08 6.120dC±0.03 4.910eB±0.05
SB 2.35aA±0.06 2.27 bA±0.17 2.15 cA±0.00 2.08 cA ±0.11 2.00dA±0.00 <2.00dA±0.00
aA bA cA cA dA
FBE 2.32 ±0.11 2.23 ±0.11 2.15 ±0.00 2.08 ± 0.11 2.00 ±0.00 <2.00dA±0.00
aA bA cA cA dA
MGR 2.35 ±0.06 2.27 ±0.04 2.15 ±0.00 2.08 ±0.11 2.00 ±0.00 <2.00dA±0.00
aA abA bcA cA
WMR 2.32 ±0.11 2.27 ±0.17 2.23 ±0.11 2.08 ±0.11 2.00 ±0.00 <2.00dA±0.00
dA
aA bA cA cA
LS 2.39 ±0.12 2.23 ±0.11 2.15 ±0.00 2.08 ±0.11 2.00dA±0.00 <2.00dA±0.00
aA abA cbA bA
SSB 2.30 ±0.00 2.27 ±0.04 2.23 ±0.11 2.20 ±0.06 2.08dA±0.11 <2.00dA±0.00
60
50
40
%
30
20
10
0
Pre-proven Pra-bakar Thaw and Serve
Rajah 1. Tahap Pengetahuan Bagi Jenis Produk Bakeri Sejukbeku Mengikut Jantina
100
90
80
70
60
%
50
40
30
20
10
0
Roti Bun Kek Muffin Croissant Pastri pai Roll Lain-lain
Produk bakeri
Perempuan Lelaki
Rajah 2. Jenis Produk Bakeri Yang Kerap Diambil Oleh Pelajar Mengikut Jantina
dalam kampus memudahkan lagi para pelajar koliform najis, E. coli, Salmonella spp. serta B.
untuk membeli dan mendapatkan produk cereus dan Bacillus spp. Berdasarkan kepada
bakeri. kriteria yang telah dikeluarkan oleh ICMSF
(1990), maka kualiti mikrobiologi bagi semua
Soal selidik juga mendapati pelajar lelaki
sampel produk bakeri berada di dalam kategori
mempunyai pengetahuan yang terhad mengenai
yang ‘MEMUASKAN’. Namun begitu, julat
produk bakeri pre-proven, pra-bakar serta thaw
pH dan Aw masih berada di tahap yang mana
and serve berbanding pelajar perempuan.
sesuai untuk pertumbuhan mikroorganisma
Hampir 80% pelajar-pelajar ini memahami
patogen dan perosak. Secara keseluruhan tahap
konsep produk bakeri sejukbeku setelah
pengetahuan pelajar perempuan berkaitan
membaca penerangan ringkas pada borang soal
produk bakeri adalah lebih baik berbanding
selidik tersebut.
pelajar lelaki tetapi secara keseluruhannya
4. Kesimpulan pengetahuan mengenai produk bakeri
Secara keseluruhannya, kesan penyimpanan sejukbeku masih rendah.
sejukbeku terhadap produk bakeri samaada
jenis pre-proven, pra-bakar serta thaw and
serve dalam tempoh tertentu mampu merencat
pertumbuhan mikroorganisma tertentu seperti
Aktivitas Antioksidan Senyawa Fenolik Tipe Baru yang Dikatalisis oleh Enzim
Laccase
Abstrak
Dalam rangkaian pencarian senyawa yang mempunyai aktivitas biologi, diteliti
pemanfaatan enzim dari jamur tiram putih (Pleurotus ostreatus) sebagai sumber enzim
oksidoreduktase, khususnya enzim laccase. Ekstrak enzim kasar dapat diperoleh dari media
tumbuh jamur tersebut dengan bufer fosfat pH 6,0 dan dalam uji aktivitas mampu
mengkatalisis reaksi terhadap model senyawa fenolik, guaiakol. Enzim laccase dapat
memanfaatkan senyawa guaiakol melalui reaksi kopling oksidasi yang ditandai dengan
terbentuknya senyawa baru yang berupa senyawa berwarna yang tidak larut dalam media
reaksinya. Dari proses pemurnian diperoleh senyawa yang berwarna kemerahan, dan uji
lanjut secara spektroskopik menunjukkan adanya pergeseran nilai UV. Analisis lanjut
dengan GC-MS diketahui senyawa tersebut adalah 4,4’-biguaiakol, suatu senyawa dimer
dari substrat guaiakol. Senyawa tersebut mempunyai aktivitas antioksidan yang baik melalui
uji radical scavenger DPPH.
Kata kunci : Enzim laccase, senyawa fenolik, 4,4’-biguaiakol, radical scavenger
1. Pendahuluan (Uyama,2002).
Mengacu pada fenomena perubahan kondisi
Enzim oksidoreduktase dapat diperoleh dari
lingkungan yang dapat menimbulkan stres
berbagai jenis tanaman dan jenis jamur. Jenis
pada makluk hidup khususnya tumbuhan,
jamur yang umumnya tergolong dalam kelas
diketahui bahwa tumbuhan akan merespons
basidiomycetes diketahui sebagai sumber
stres tersebut dengan memanfaatkan senyawa
enzim laccase. Beberapa penelitian
kimia yang dimilikinya untuk membentuk
menunjukkan kemampuan suatu enzim laccase
senyawa baru (Kobayashi, 1998,
dalam mengkatalisis reaksi oksidasi senyawa
Manitto,1981). Aktivitas ini semakin efisien
fenolik yang menghasilkan bentuk polimer dari
karena dapat menggunakan sistem enzim yang
senyawa fenolik yang digunakan. Jamur tiram
diketahui yaitu adanya bantuan enzim
putih (Pleurotus ostreatus), adalah jamur yang
oksidoreduktase, yaitu enzim peroxidase dan
aman dikonsumsi dan digunakan sebagai
laccase (Veitch, 2004, Podzdnyakova,2004).
sayuran. Jamur ini mengandung asam-asam
Penelitian mengenai senyawa hasil
amino esensial yaitu lisin, metionin, triptofan
metabolisme saat ini sangat menarik untuk
dan lain-lain dan mengandung sejumlah
dibahas lanjut karena senyawaan tersebut
vitamin penting yaitu kelompok vitamin B,
dapat dimanfaatkan pula dalam rangka
vitamin C, dan provitamin D , Kalium (K),
pencarian atas senyawa yang mempunyai
Fosfor (P), dan Kalsium (Ca) (Henky, 2004).
aktivitas biologi yang kelak akan dapat
Tinjauan aktivitas sebagai zat antioksidan
memberikan sumbangan informasi bagi
menarik perhatian untuk diteliti mengingat
pengembangan bahan untuk kebutuhan farmasi,
reaksi oksidasi adalah reaksi yang
pertanian, kimia pangan dan industri lainnya
menimbulkan efek merugikan seperti dalam
60
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
A. Herry Cahyana, Siswati Setiasih , Rossi M.T , Noorlela
aspek makanan memungkinkan timbulnya bau 2.2 Reaksi pembentukan senyawa dari
tengik dan sekaligus bersifat racun (Hudson, guaiakol
1990), sedangkan secara luas dikenal sebagai Reaksi pembentukan senyawa dilakukan
stres oksidatif melalui tahapan pembentukan dengan pencampuran langsung antara enzim
radikal bebas yang dapat menimbulkan laccase dengan guaiakol, produk yang
berbagai penyakit. diperoleh diekstrak dengan etil asetat dan
dianalisis lanjut.
Penelitian ini bertujuan untuk mempelajari
penggunaan jamur tiram putih (Pleurotus 2.3 Uji Aktivitas radical scavenger
ostreatus), sebagai sumber enzim laccase dan Uji aktivitas radical scavenger dilakukan
pemanfaatannya dalam pembentukan senyawa dengan metode DPPH (2,2-difenil-1-
baru dari senyawa fenolik, guaiakol serta uji pikrilhidrazil) sesuai prosedur (Molyneux,
aktivitas sebagai sebagai zat antioksidan 2004) dengan sedikit modifikasi. DPPH (0.4
dengan kemampuan sebagai radical scavenger. mg) dilarutkan dalam 100 mL etanol, aktivitas
radical scavenger diukur dengan pengamatan
2. Percobaan
kemampuan menurunkan warna DPPH setiap
2.1 Isolasi Enzim kasar laccase
selang waktu tertentu selama 30 menit, pada
Isolasi enzim kasar laccase dilakukan sesuai
panjang gelombang, λ=516 nm menggunakan
dengan prosedur (Hernandez et al, 2001)
alat UV-Vis spektrofotometer. Percobaan
dengan sedikit modifikasi. Sebanyak 500 gram
dilakukan sebanyak tiga kali ulangan.
jamur tiram putih (Pleurotus ostreatus)
ditambahkan sedikit air, dihancurkan dengan 3. Hasil dan pembahasan
cara diblender. Kemudian dicampurkan dengan Dari jamur tiram putih ( Pleurotus ostreatus)
buffer fosfat pH 6 dalam keadaan dingin, dan diketahui mempunyai kandungan enzim
homogenat disaring, filtrat yang diperoleh laccase dari hasil uji positif dengan metode
kemudian disentrifugasi. Aktivitas enzim Lowry dan Folin Ciocalteau. Pemanfaatan
dilakukan secara spektrofotometri dengan lanjut dilakukan dengan mencampurkan enzim
menggunakan metode katekol dan kadar tersebut dengan senyawa fenolik , guaiakol,
protein enzim dilakukan dengan metode Lowry diperoleh hasil terbentuknya senyawa yang
dan Folin Ciocalteau. mempunyai warna serta tidak larut lagi dalam
sistem reaksi tersebut. Hal ini diduga telah
Rf =0.87
Rf =0.73
Rf =0.65
Rf =0.45
Rf =0.30
G S
Keterangan : G = guaiakol S = senyawa hasil reaksi
terjadi reaksi yang mampu menggabungkan struktur mirip dengan guaiakol, dengan terlihat
substrat guaiakol menjadi senyawa dengan sifat adanya penambahan ikatan rangkap konjugasi
fisik berbeda yaitu timbul warna dan yang ditandai dengan naiknya nilai serapan
menurunnya kelarutan. Identifikasi serapan dalam spektrofotometri UV. Analisis
menggunakan kromatografi lapis tipis (KLT) menggunakan kromatografi gas spektrometri
silika gel dengan larutan pengembang n- massa (GC-MS) diperoleh kromatogram seperti
heksana : etil asetat ( 5:3) diperoleh data pada gambar 3.
sebagai berikut :
Puncak kromatogram pada Rt 19,19
Pada tahap pemurnian lanjut menggunakan
kolom kromatografi silika-gel dengan selanjutnya diidentifikasi, diketahui
campuran pelarut antara n-heksana : etil asetat, mempunyai nilai m/z = 246, hal ini merupakan
hasil dari reaksi pembentukan senyawa dari
dapat diisolasi noktah dengan Rf 0,30 berupa penggabungan antara dua molekul guaiakol.
kristal kuning kecoklatan. Uji titik leleh Konfirmasi lanjut yaitu membandingkan nilai
terhadap terhadap isolat ini dihasilkan nilai 94- m/z 246 tersebut terhadap standar yang ada,
960C. Analisis lanjut dengan menggunakan dan dengan tingkat memiripan sebesar 91%,
spektrometri UV terlihat adanya pergeseran diperoleh data bahwa senyawa yang terbentuk
nilai dari guaiakol sebesar 319 nm menjadi ini diketahui sebagai 4,4’-biguaiakol., suatu
327 nm, seperti gambar 2. struktur dari hasil penggabungan pada posisi
Dari data diatas diduga terjadi telah terjadi para-para pada cincin aromatik dengan
pembentukan senyawa yang mempunyai
OH
Enzim + H 2O 2 Enzim........H 2 O 2 Enzim
OH
OH
OH
Enzim + Enzim......OH
O
OH O
+ H 2O
O
Abstract
The lead/acid battery, LAB, is a commonly used power source in everyday life. The main use
of the LAB has been in automotive start-lighting-ignition (SLI), nowadays it also used in back
up power, along with communication, standby power, industry, electric vehicles, etc. In this
context, it is important to have long life high maintenance-free LABs for modern
applications.
To understand how the mechanism of the battery works is important to perform a post-
mortem failure analyses. Several characterization techniques were used to analyze the
various components of positive plates, namely X-ray Diffraction (XRD), Scanning Electron
Microscopy (SEM), Enviromental Scanning Electron Microscopy (ESEM), X-ray
Photoelectron Spectroscopy (XPS) and Electron Impedance Spectroscopy (EIS). This work
will investigate the possibilities of using above mentioned techniques to understand the
passivation process of positive plates at both the grid/corrosion layer interface, along with
the active material, via monitoring of deleterious phases such as lead monoxide and lead
sulphate.
(ESEM), X-ray Photoelectron Spectroscopy The electrode kinetic factors responsible for
(XPS) and Electron Impedance Spectroscopy improvements in battery cycle-life will also be
(EIS). investigated using EIS. EIS is a powerful
technique that provides kinetic information
XRD may be used to reveal the different lead
about the electrical properties of the
phases in plates (Cui & Luo 2000; De Marco &
dynamically changing electrode/electrolyte
Jones 2000; De Marco & Liesegang 1995; Hill,
interface, and has been used by several authors
Foxworthy & White 1990; Petersson &
to investigate kinetic factors responsible for
Ahlberg 2000a). Electrolyte stratification along
improvements in battery cycle-life (Roberge et
with a diminution in the agglomeration of
al. 1990; Diard et al. 1997; Diard, Gorrec &
spheres, causes a reduction in the efficiency of
Montella 1998; Cheng et al. 1999; Karden,
lead/acid batteries, and clearly related to a short
Buller & De Doncker 2000; Li, Huang & Chen
term loss in performance. This process gives
1999; Pavlov & Petkova 2002). The state of
rise to PbSO4, which can be analysed using
health (SOH) of the positive plate can be
XRD. Numerous authors have demonstrated
determined by evaluating the values of charge-
that sulfation is one of the significant factors
transfer resistance, ion diffusion resistance,
that cause a diminution in the conductivity of
resistance of the grid–PAM interface, and
plates leading to premature capacity loss (PCL)
ohmic resistance of the electrode, as revealed
(Apâteanu, Hollenkamp & Koop 1993; Chao et
by EIS measurements (Pavlov & Petkova
al. 1995; Newnham & Baldsing 1997; De
2002).
Marco & Jones 2000).
2. Experimental
SEM and ESEM are a powerful method that
For XRD analyses, the failed positive plates
can be used to reveal the microstructural
were dismantled and rinsed in distilled water
features of the corrosion layer that forms at the
followed by drying at 50 OC for 24 hours. The
grid/active material phase (De Marco,
material was analysed using a Kristalloflec
Rochliadi & Jones 2001; De Marco & Jones
Siemens D500 X-Ray diffractometer fitted with
2000; Dengke 1999; Meissner 1999; Culpin,
a Cu K-alpha X-ray tube that was operated at
Hollenkamp & Rand 1992; Bagshaw 1997;
an accelerating voltage of 25 kV. The sampling
Petersson & Ahlberg 2000b). In SEM/ESEM,
scheme is shown in Figure 1.
the nature and thickness of the corrosion layers
arising from the different treatments may be
examined. It is generally assumed that the
thickness of the corrosion layer and, in
particular any underlayers of PbO and/or T
PbSO4, is related to poor performance. Several
authors have reported ways to reduce the
C
effects of the corrosion layer using different
grid alloys and/or small additions of tin,
aluminium, silver and cadmium in the alloys B
(Zhong et al. 1996; Fouache 1999; Caillerie &
Albert 1997; Dimitrov & Pavlov 2001; Rocca Figure 1. A schematic diagram showing the
& Steinmetz 1999). The corrosion underlayer sampling scheme used in the post mortem
of PbO could also be removed by etching the analysis of positive plates.
grid with sodium hydroxide prior to the pasting
of plates; this step removes the basic lead For SEM analysis, the grid corrosion layers of
carbonate phase that induces the formation of epoxy mounted, polished cross sections of
insulating PbO in the grid/active material layer positive plates were examined using a JEOL
(De Marco, Rochliadi & Jones 2001). JSM 35c electron microscopy operated at a
beam current of 200 pA and an accelerating
XPS is a powerful technique for detection of voltage of 25 kV.
variations in chemical composition and
oxidation state. Subtle changes in peak In ESEM studies, an accelerating voltage of 30
positions and shape can yield important kV and a spot size of 40 were employed in the
information on changes in surface chemistry measurement of all images and the chamber
(Kratos 2003; Musal 2003). pressure was set to 1.2 torr. The ESEM work
I
n
t
e
n
s
i
t
y
Figure 3. XPS spectrum of the Pb(4f7/2) core level for a region crossing the boundary
between the grid corrosion layer encompassing the outer film of lead dioxide (i.e., PbO2),
along with its associated underlayer film of lead monoxide (i.e., PbO), and the grid metal
(i.e., Pb).
Table 1. XRD phase compositions of lead/acid battery positive plate active materials at
different stages of cycling. The prefix number refers to the cycle number, while the
symbols T, C and B refer to top, centre and bottom of plate, respectively.
the boundary between the grid corrosion layer resistive components that reflect the
encompassing the outer film of lead dioxide electrochemical behaviour of the working
(i.e., PbO2), along with its associated electrode. The spectrum for a miniaturised
underlayer film of lead monoxide (i.e., PbO), lead/acid battery electrode (Figure 5) reveals a
and the grid metal (i.e., Pb). The PbO2, PbO low frequency semicircle that is attributable to
and Pb line scans were measured, and are the charge transfer impedance which is
presented in Figure 4. The XPS data show representative of the rate of the electrochemical
unambiguously an underlayer of insulating PbO reaction. The near straight line at 45 degrees at
in the LABs corrosion layer, and this very low frequencies is attributable to a
passivation layer contributes to premature significant diffusional resistance that is known
capacity loss of the battery. as the Warburg impedance.
The EIS Nyquist plot presented in Figure 5 The ESEM results presented in Figure 6
reveals a semicircle corresponding to interfacial demonstrate that an appropriate grid ecthing
(a)
I
n
t
e
n
s
i
t
y
(b)
I
n
t
e
n
s
i
t
y
(c)
I
n
t
e
n
s
i
t
y
Figure 4. Lead dioxide,(a) PbO2, lead monoxide, (b) PbO and lead, (c) Pb, XPS
line scans for a polished cross-section of a cured lead/acid battery plate that was
subjected to 6 charge/discharge cycles
procedure removes all grid surface The secondary electron micrograph for an as
hydrocerussite. ESEM is capable of providing received grid [see Figure 6(a)] revealed
high resolution images of the wet surface that crystalline deposits of detrimental
are indeed representative of the grid surfaces hydrocerussite, while the etched specimen [see
encountered during plate pasting. Figure 6(b)] revealed the roughened grid
-30
-25
-20
Z" / Ω
-15
-10
-5
0
20 40 60 80 100 120
Z'/ Ω
(a) (b)
Figure 6. ESEM backscattered electron micrographs of (a) as received lead/acid battery grid and (b)
etched grid.
topography that develops after dissolution of A grid pretreatment has been developed that
the crystalline deposits of grid hydrocerussite. removes detrimental grid hydrocerussite, and
this procedure has been used to extend the
4. Conclusion
lifetime of the lead/acid battery by
The results of this study demonstrate the power
approximately 20%
of materials science characterization techniques
in the identification of causes of failure in 5. Acknowledgments
lead/acid batteries. The SEM/ESEM techniques The authors thank the Centre Grant, ARC and
can reveal the underlayer corrosion layer AEDB for financial support.
between grids and active material of LAB.
6. References
XRD shows the composition of lead sulphate Apâteanu, J., Hollenkamp, A. F. & Koop, M. J.
that form in the positive active material, and 1993, 'Electrolyte stratification in lead/acid
also show a stratification effects within the batteries: Effect of grid antimony and relationship to
differences height if the plate. The XPS data capacity loss', Journal of Power Sources, vol. 46,
show unambiguously an underlayer of pp. 239-250.
insulating PbO in the LABs corrosion layer, Bagshaw, N. E. 1997, 'Improving active-material
and this passivation layer contributes to utilization', Journal of Power Sources, vol. 67, pp.
premature capacity loss of the battery. EIS will 105-109.
show the electrochemical behaviour of the
working electrode. Caillerie, J.-L. & Albert, L. 1997, 'Lead-calcium
alloy development: quality improvement', Journal
of Power Sources, vol. 67, pp. 279-281.
Chao, C. W., Lin, S. P., Wang, Y. Y., Wan, C. C. & materials', Journal of Power Sources, vol. 32, pp.
Yang, J. T. 1995, 'Continuous monitoring of acid 315-328.
stratification during charge/discharge by
Karden, E., Buller, S. & De Doncker, R. W. 2000,
holographic laser interferometry', Journal of Power
'A method for measurement and interpretation of
Sources, vol. 55, pp. 243-246.
impedance spectra for industrial batteries', Journal
Cheng, S., Zhang, J., Zhao, M. & Cao, C. 1999, of Power Sources, vol. 85, no. 1, pp. 72-78.
'Electrochemical impedance spectroscopy study of
Kratos 2003, AXIS Ultra : High Performance
Ni/MH batteries', Journal of Alloys and
Imaging XPS : Overview, Available:
Compounds, vol. 293-295, pp. 814-820.
[www.kratosanalytical.net/applications/AxisUlt
Cui, N. & Luo, J. L. 2000, 'An AC impedance stuy ra/oview.html] (3 November 2004).
of self-discharge mechanism of nickel-metal
hydride (Ni-MH) battery using Mg2Ni-type Li, H., Huang, X. & Chen, L. 1999,
hydrogen storage alloy anode.' Electrochimica Acta, 'Electrochemical impedance spectroscopy study of
vol. 45, pp. 3973-3981. SnO and nano-SnO anodes in lithium rechargeable
batteries', Journal of Power Sources, vol. 81-82, pp.
Culpin, B., Hollenkamp, A. F. & Rand, D. J. 1992, 340-345.
'The effect of tin on the performance of positive
plates in lead/acid batteries', Journal of Power Meissner, E. 1999, 'How to understand the
Sources, vol. 38, pp. 63-72. reversible capasity decay of the lead dioxide
electrode', Journal of Power Sources, vol. 78, pp.
De Marco, R. & Jones, J. 2000, 'Change in positive 99-114.
lead/acid battery plate during charge/discharge
cycling', Journal of Applied Electrochemistry, vol. Musal 2003, XPS Services, Available:
30, pp. 77-83. [http://www.phys.murdoch.edu.au/musal/xpsser
vices.html] (3 November 2004).
De Marco, R. & Liesegang, J. 1995, 'Surface
analysis of commercial lead/acid battery grids', Newnham, R. H. & Baldsing, W. G. A. 1997,
Applied Surface Science, vol. 84, pp. 237-244. 'Performance of flooded- and gelled-electrolyte
lead/acid batteries under remote-area power-supply
De Marco, R., Rochliadi, A. & Jones, J. 2001, duty', Journal of Power Sources, vol. 66, pp. 27-39.
'Extending the life of maintenance-free lead/acid
batteries by etching of grids in sodium hydroxide', Pavlov, D. & Petkova, G. 2002, 'Phenomena that
Journal of Applied Electrochemistry, vol. 31, pp. limit the capacity of the positive plate lead/acid
953-959. battery plates. II. Electrochemical impedance
spectroscopy and mechanism of discharge of the
Dengke, Q. 1999, 'Changes in the structure of active plate', Journal of The Electrochemical Society, vol.
materials in lead/acid batteries', Journal of Power 149, no. 5, pp. A654-A661.
Sources, vol. 78, pp. 88-93.
Petersson, I. & Ahlberg, E. 2000a, 'On the question
Diard, J.-P., Gorrec, B. L. & Montella, C. 1998, 'EIS of electrochemical activity of differently formed
study of electrochemical battery discharge on lead dioxides', Journal of Power Sources, vol. 91,
constant load', Journal of Power Sources, vol. 70, pp. 137-142.
pp. 78-84.
Petersson, I. & Ahlberg, E. 2000b, 'Oxidation of
Diard, J.-P., Gorrec, B. L., Montella, C. & Landaud, electrodeposited lead-tin alloys in 5 M H2SO4',
P. 1997, 'Constant load vs constant current EIS Journal of Power Sources, vol. 91, pp. 143-149.
study of electrochemical battery discharge',
Electrochimica Acta, vol. 42, pp. 3417-3420. Roberge, P. R., Halliop, E., Verville, G. & Smit, J.
1990, 'Non-destructive characterization of sealed
Dimitrov, M. K. & Pavlov, D. 2001, 'Influence of lead/acid battery cells with electrochemical
grid alloy and fast charge on battery cycle life and impedance spectroscopy.' Journal of Power
structure of the positive active mass on lead/acid Sources, vol. 32, pp. 261-270.
batteries', Journal of Power Sources, vol. 93, pp.
234-257. Rocca, E. & Steinmetz, J. 1999, 'Mechanism of
passivation of Pb(Ca)-Sn alloys in sulfuric acid :
Fouache 1999, 'Effect of calcium, tin and silver role of tin', Electrochimica Acta, vol. 44, pp. 4611-
contents in the positive grids of automotive batteries 4618.
with respect to the grid manufacturing process',
Journal of Power Sources, vol. 78, pp. 12-23. Zhong, S., Liu, H. K., Dou, S. X. & Skyllas-
Kazacos, M. 1996, 'Evaluation of lead-calcium-
Hill, R. J., Foxworthy, A. M. & White, R. J. 1990, aluminium grid alloys for valve-regulated lead/acid
'PEAKS®: A PC based method for quantitative X- batteries', Journal of Power Sources, vol. 59, pp.
ray diffraction phase analysis of lead/acid battery 123-129.
Pengaruh Temperatur dan Inhibisi oleh Natrium Nitrit dan Natrium Asetat
Terhadap Laju Korosi Spesimen Baja Karbon ASTM 106 Gr B dari Pipa Minyak
Unocal Indonesia, Co.
Abstrak
Penelitian ini bertujuan untuk mengamati pengaruh temperatur dan mencoba dua senyawa
anorganik sebagai inhibitor korosi, yaitu Natrium Nitrit (NaNO2) dan Natrium Asetat
(CH3COONa), untuk spesimen baja karbon ASTM 106 Gr B pipa minyak Unocal Indonesia,
Co. Terlihat bahwa ada perluasan bintik korosi pada spesimen baja karbon ASTM 106 Gr B
sejalan dengan waktu baik pada pengukuran pada suhu 27oC, 50oC, 70oC dan 100oC.
Perluasan bintik terbesar terjadi pada temperatur pengukuran 100oC. Perluasan ini diduga
terjadi karena adanya molekul air dalam fasa uap pada permukaan spesimen baja karbon,
dan semakin tinggi suhu maka jumlah molekul air dalam fasa uap semakin bertambah
banyak yang akan mendorong proses korosi semakin cepat terjadi. Efektifitas inhibitor
diukur dengan melihat tahanan polarisasi dari sistem sel elektrokimia yang ditambahkan
dengan masing-masing inhibitor. Pada inhibitor NaNO2 inhibisi maksimum terjadi pada saat
konsentrasi 0.1% dengan nilai Rp sebesar 2200.0 kohm.cm-2, dan inhibisi maksimum
CH3COONa dicapai saat konsentrasinya 0.3% dengan nilai Rp 9350 kohm.cm-2. Secara
ekonomi metoda pengukuran secara elektrokimia ini dianggap efektif. Mekanisme inhibisi
dari kedua senyawa inhibitor anorganik ini diduga karena adanya lapis tipis yang terbentuk
pada permukaan baja karbon tersebut yang akan mengurangi laju korosi, hal ini dapat
dilihat dari tahanan polarisasi (Rp). Tahanan Polarisasi didapat dari Tafel Plot yang di
peroleh dari pengukuran secara elektrokimia. Pada pengukuran digunakan elektroda kerja
baja karbon ASTM 106 Gr B, Saturated Calomel Electrode (SCE) sebagai elektroda
pembanding, dan Platina sebagai elektroda bantu.
Kata Kunci: Korosi, Inhibitor Anorganik, Bintik Korosi, Tafel Plot
korosinya untuk berbagai macam logam Pertambahan rata-rata bintik korosi akibat
lainnya (Brook 1972, Azim dan Sanad 1972, temperatur ditunjukkan pada Gambar 1
Tortoreli dan Natesan 1998, Stott dan Shih
3.2 Pengukuran dengan menggunakan
2000, Huang dkk 1984). Pengamatan dilakukan
metoda elektrokimia
dengan melihat jumlah bintik korosi rata-rata
Hasil pengukuran sampel dengan menggunakan
dari contoh logam tersebut. Pengamatan juga
metoda elektrokimia akan memberikan kurva
dilakukan dengan menggunakan teknik
Tafel seperti yang terlihat pada Gambar 2.
elektrokimia yaitu dengan mengukur tahanan
Kurva pada Gambar 2 ini diperoleh dari hasil
polarisasinya.
pengukuran untuk sampel ASTM 106 Gr B
Senyawa anorganik dapat digunakan untuk yang telah terinhibisi NaNO2 pada pH 7.5 dan
mengendalikan laju korosi. Dalam penelitian temperatur 27oC, dengan kondisi sel
ini dipilih Natrium Nitrit (NaNO2), dan elektrokimia ter-aerasi. Kurva pada Gambar 2
Natrium Asetat (CH3COONa) untuk ini dikenal sebagai Kurva Tafel (Tafel Plot).
mengendalikan korosi dari spesimen yang
Dalam penelitian ini pengukuran dengan
diamati. Senyawa-senyawa ini akan
menggunakan elektrokimia dilakukan untuk
berinteraksi dengan permukaan baja karbon
mengamati pengaruh inhibitor yang
membentuk lapis tipis melalui mekanisme
memberikan perlindungan terbaik terhadap
adsorpsi (Dai 1997, Sastri dan Elboujdaini,
logam dalam mengurangi laju korosi.
1996).
3.3 Hasil Pengukuran Tahanan Polarisasi
2. Peralatan
Pada pengukuran Tafel, besarnya tahanan
Pengukuran secara elektrokimia dilakukan
polarisasi (Polarisation Resistance, Rp)
dengan Potensiostat dan Galvanostat Volta Lab
dihitung secara otomatis oleh komputer.
PG2-301. Pengukuran secara kuantitatif ini
Dengan pemakaian 2 jenis inhibitor dan variasi
dilakukan dengan sel elektrokimia,
konsentrasi inhibitor maka diperoleh besarnya
menggunakan baja karbon ASTM 106 Gr B
tahanan polarisasi dan laju korosi (corrosion
sebagai elektroda kerja, Saturated Calomel
rate, CR) yang di tampilkan pada Tabel 2.
Electrode sebagai elektroda pembanding, dan
platina sebagai elektroda bantu. Alat-alat gelas Kurva Tahanan Polarisasi terhadap konsentrasi
umum, seperti gelas kimia, pipet tetes, batang inhibitor dapat dilihat pada Gambar 3.
pengaduk, juga digunakan dalam penelitian ini. Nilai tahanan polarisasi tersebut di atas
3. Hasil dan Pembahasan dipengaruhi oleh lapis tipis yang terbentuk dari
3.1. Pengaruh temperatur pada spesimen masing-masing senyawa pada saat proses
logam ASTM 106 Gr B pemaparan. Dari Gambar 3 terlihat bahwa nilai
Temperatur merupakan salah satu faktor yang terbesar Rp dihasilkan oleh NaNO2 pada
mempengaruhi terbentuknya bintik korosi pada konsentrasi 0.1% dan CH3COONa 0.3%. Hal
permukaan material, hal ini dapat dilihat pada tersebut dikarenakan pada konsentrasi-
Tabel 1. Pada temperatur tinggi, 100oC, jumlah konsentrasi tersebut inhibitor bekerja secara
bintik korosi meningkat, ditunjukkan dengan maksimal dalam membentuk lapis tipis pada
perluasan area yang ditempati oleh bintik-bintik permukaan baja karbon.
korosi. Perluasan ini disebabkan adanya
molekul air pada permukaan spesimen baja
karbon. Air mencapai titik didihnya pada 3.4 Pembentukan lapis tipis pada
100oC. Pada suhu ini terjadi perubahan fasa air permukaan baja karbon
dari fasa cair ke fasa uap. Peningkatan jumlah Ketika logam dipapar ke sistem larutan yang
molekul air dalam fasa uap menyebabkan mengandung senyawa aktif, maka akan
jumlah material awal pembentuk lapisan tipis terbentuk besi karbonat. Selain itu pada
elektrolit di permukaan material bertambah. permukaan logam juga terbentuk lapis tipis
Terbentuknya lapisan tipis, mendorong proses yang merupakan selaput pelindung terhadap
korosi semakin cepat terjadi, terlihat dari korosi. Lapis tipis ini terbentuk karena adsorpsi
meningkatnya jumlah bintik korosi rata-rata senyawa aktif di permukaan logam dan akan
dan meluasnya bintik-bintik korosi pada membatasi interaksi logam dengan
permukaan baja karbon. lingkungan.larutannya Pembatasan ini
ditunjukkan dengan naiknya tahanan polarisasi orbital d kosong dari permukaan baja karbon.
ketika logam dipapar ke dalam sistem. Tahanan Ikatan sigma (σ) dari NO2- terbentuk karena
polarisasi tersebut dibandingkan dengan nilai overlap orbital sp2 antara atom N dan O dari 2
tahanan polarisasi ketika logam mengalami ikatan tunggal N-O. Gambar 9 memberikan
proses pra-korosi. skema ikatan σ dan adanya pasangan elektron
bebas dari ion nitrit
3.4.1 Lapisan Senyawa Natrium Nitrit
(NaNO2) Sama halnya dengan proses adsorpsi oleh
Senyawa Natrium Nitrit (NaNO2), dengan NaNO2, maka untuk CH3COONa terdapat satu
struktur pada Gambar 4(i) dapat teradsorpsi atom dengan pasangan elektron bebas yang
pada permukaan baja karbon. Adsorpsi terjadi dapat mengisi orbital d kosong pada permukaan
karena ada sumbangan pasangan elektron bebas baja karbon, namun yang membedakannya
terhadap orbital d kosong pada baja karbon. adalah keberadaan gugus metil (-CH3). Gugus
Peristiwa tumpang tindih elektron dapat dilihat metil merupakan gugus pendorong elektron,
pada Gambar 5. berarti pada senyawa ini gugus metil akan
mengimbas pasangan elektron bebas pada atom
Akibat adsorpsi NaNO2 pada permukaan baja
O untuk lebih bertumpang tindih dengan orbital
karbon, akan terbentuk lapis tipis.
d kosong pada permukaan baja karbon.
Pembentukan lapis tipis ini dapat terjadi karena
adanya tumpang tindih elektron dari besi Kekuatan penempelan lapis tipis dipengaruhi
karbonat dengan elektron bebas atom N dari oleh kemampuan senyawa pembentuk lapis
NaNO2 karena pori permukaan baja karbon tipis untuk mendonorkan pasangan elektron
tidak cukup luas untuk dilapisi oleh NaNO2 bebasnya ke orbital d kosong pada permukaan
saja. Gambar 6 dan 7 memberikan ilustrasi baja karbon.
untuk proses pembentukan lapis tipis.
3.6 Pengaruh Potensial Elektroda
3.4.2. Lapisan Senyawa Natrium Asetat Potensial setimbang (Estb), yaitu potensial yang
(CH3COONa) dicapai saat logam berinteraksi dengan
Struktur Natrium Asetat (CH3COONa) dapat pelarutnya dan nilai arus katodik akan sama
dilihat pada Gambar 4(ii). Sama halnya dengan dengan arus anodik. Pada keadaan ini lah
proses pembentukan lapis tipis oleh NaNO2, korosi akan terjadi. Saat ditambahkan larutan
maka CH3COONa juga dapat teradsorpsi pada NO2- ke dalam larutan maka Estb awal akan
permukaan baja karbon. Namun tumpang tindih berubah, dalam hal ini EoNO2- akan memperkecil
yang terjadi pada natirum asetat adalah akibat nilai Estb awal tersebut, sehingga seperti
interaksi elektron bebas dari atom O dengan diketahui bahwa Estb yang nilainya lebih kecil
orbital d kosong dari lapisan besi karbonat. daripada Eo logam (EoM) akan bersifat
Kemungkinan mekanisme yang terjadi juga menginhibisi logam dan memperlambat
mirip dengan NaNO2, yaitu terjadi lapis tipis terbentuknya oksida logam atau terjadi korosi.
yang menutupi lapis besi karbonat. Gambar 8
4. Kesimpulan
memberikan ilustrasi adsorpsi pada permukaan
Dari hasil percobaan dapat disimpulkan bahwa
baja karbon.
temperatur mempunyai pengaruh terhadap laju
3.5. Kajian Lapis Tipis yang Terbentuk pembentukkan bintik korosi. Semakin tinggi
Lapis tipis yang terbentuk dari kedua senyawa temperatur pada lingkungan sample, semakin
Natrium memiliki kemungkinan mekanisme cepat juga terbentuknya bintik korosi. Semakin
pembentukan yang sama. Proteksi yang tinggi suhu lingkungan menyebabkan semakin
berbeda diukur oleh nilai tahanan polarisasi banyak juga molekul air berada pada fasa
yang berbeda dari kedua senyawa Natrium ini. uapnya. Peningkatan jumlah molekul air dalam
Hal tersebut disebabkan oleh karakteristik lapis fasa uap ini akan menyebabkan jumlah materi
tipis yang terbentuk berbeda pada tiap-tiap lapisan tipis elektrolit pada permukaan material
senyawa. makin bertambah yang pada akhirnya akan
mempercepat proses laju korosi.
Lapis tipis yang terbentuk oleh Natrium Nitrit
pada konsentrasi 0.1% memberikan Mekanisme inhibisi korosi oleh inhibitor
perlindungan maksimal, hal ini diduga karena anorganik terjadi karena terbentuknya lapis
sifat ion nitrit yang memiliki pasangan elektron tipis
bebas pada atom N mengisi kekosongan pada
lapis tipis yang merupakan selaput pelindung Huang, T T; Peterson, B; Shores, D A; Pfender, E
terhadap korosi. Lapis tipis ini terbentuk karena (1984), XPS and AES Studies of the High
adsorpsi senyawa aktif di permukaan logam Temperature Corrosion Mechanism of Fe-30Cr
dan akan membatasi interaksi logam dengan Alloy, Corrosion Science. Vol. 24, no. 3, pp. 167-
183. 1984
lingkungan.larutannya. Mekanisme
pembentukkan lapis tipis ini karena adanya Huheey J.E., Keiter E.A., Keiter R.L., (1999).
tumpng tindih awah elektron orbital d dari Inorganic Chemistry : Principles of Structure and
logam besi dengan pasangan elektron bebas Reactivity. Benjamin Cummings, 4th Edition. 91
pada NaNO2 dan CH3COOH. Jones, D.A. (1992). Principles and Prevention of
Corrosion. McMillan Publishing, Co. New York.
5. Daftar Pustaka
28-29, 91-94, 165
A. ABDUL AZIM and S. H. SANAD (1972),
Effects of acid concentration c-content and Roberge, P.R. (2000). Handbook of Corrosion
temperature on the corrosion rate of steel in HCl, Engineering. McGraw-Hill. 833-837
Corrosion Science, 1972, Vol. 12, pp. 313 to 324.
Sastri, V.S., and Elboujdaini, M (1996), Surface
Brook, P.A. (1972) Potential pH diagrams at analysis of inhibitor films formed in hydrogen
elevated temperatures, Corrosion Science, 1972, Vol sulfide medium, Corrosion. Vol. 52, no. 6, pp. 447-
12, pp. 297 to 306. 452. June 1996
Dai, Z (1997), Effect of filming corrosion inhibitors Supardi, Rachmat. (1997). Korosi. PT.Gramedia
an anodic behaviour of armico iron in neutral Pustaka. 67-69, 100-103, 114
solution, Materials Protection. Vol. 30, no. 12, pp.
1-3. 1997 Tortorelli, P F dan Natesan, K (1998), Critical
factors affecting the high-temperature corrosion
F. H. Stott1 dan C. Y. Shih (2000), High- performance of iron aluminides, Materials Science
Temperature Corrosion of Iron–Chromium Alloys and Engineering A. Vol. 258, no. 1-2, pp. 115-125.
in Oxidizing–Chloridizing Conditions, Oxidation of 31
Metals, Volume 54, Numbers 5-6, Pages: 425 - 443
APPENDIX
0.05 0.1 0.3 0.4 0.5 0.05 0.1 0.3 0.4 0.5
CR
2.784 0.00 0.001 2.544 0.998 0.640 0.001 0.00 0.307 0.015
(mm/year)
Rp
100.93 2200.0 1450.0 109.44 125.72 417.35 138.71 9350.0 121.39 261.79
(kohm.cm-2)
20 baja
karbon
15 pada 50 C
10 baja
karbon
5 pada 70 C
0 baja
karbon
-5 0 50 100 150 200 pada 100
C
Waktu paparan (menit)
Gambar 2 Salah satu hasil kurva Tafel untuk sampel ASTM 106 Gr B dengan inhibitor NaNO2
inhibisi oleh
(kohm.cm-2)
6000 CH3COONa
4000
2000
0
0 0.1 0.2 0.3 0.4 0.5 0.6
-2000
Konsentrasi inhibitor (% )
(i) (ii)
Gambar 5 Skema pembentukan lapis tipis akibat tumpang tindih elektron pada proses adsorpsi oleh elektron
bebas inhibitor NaNO2
1) Pusat Pengajian Sains Kimia dan Teknologi Makanan, Universiti Kebangsaan Malaysia
Bangi, Selangor, 43600, Malaysia
e-mail: afnidart@yahoo.com
2) Pusat Pengajian Sains Kimia dan Teknologi Makanan, Universiti Kebangsaan Malaysia
Bangi, Selangor, 43600, Malaysia
Abstract
A reflectance spectrophotometer fiber optic measurements have been undertaken on
immobilized chrom azurol S (CAS) in XAD-2 for building copper (II) sensor by flow analysis
method. The optimum condition was found at pH 7.0 (λ = 812 nm) using 0.08 g CAS
impregnated in 4.0 g XAD-2. The flow speed has been adjusted to 0.5 ml/min. The working
concentration is in the range of 7.5 – 62.5 ppm Cu(II) in aqueous solution. The
photostability performance is good with an RSD of 2.54 % for 60 min. running. Regeneration
by saturated NaF solution performs successful. This study is a novel investigation that can
be applied a valuable contribution for chemical sensor development in the future.
Studi Pola Pengkelatan Ligan Pirazolil Pada Kompleks Iridium Dikarbonil Dalam
Larutan
Abstrak
Telah dilakukan sintesis kompleks Ir, yakni, hidrotrispirazolilboratoiridium(I) dikarbonil,
atau HB(Pz)3Ir(CO)2 , Pz = ligan pirazolil, yang telah dilaporkan sebagai aktivator dari
ikatan C-H hidrokarbon yang efisien. Dalam laporan itu disebutkan bahwa efisiensi reaksi
fotolisis senyawa iridium sangat dipengaruhi oleh karakter struktural molekul ini dalam
larutan. Pada studi kali ini kompleks iridium direaksikan dengan asam tetrafluoroborat dietil
eter, atau HBF4.(C2H5)2, untuk mempelajari karakter pengkelatan dari senyawa iridium di
atas dalam larutan. Data-data spektroskopi yang diperoleh dari UV-Vis dan FTIR dalam
larutan disajikan secara lengkap dalam poster ini dan digunakan sebagai identifikasi
molekul kompleks induk dan senyawa turunannya, yakni kompleks yang salah satu ligan
pirazolilnya telah menangkap proton. Lebih jauh, analisis data-data spektroskopi juga
menunjukan bahwa kompleks HB(Pz)3Ir(CO)2 dalam larutan berbentuk molekul tridentat dan
bidentat yang berada dalam keadaan kesetimbangan yang sangat dinamis. Seperti telah
dilaporkan sebelumnya bahwa spesies tridentat adalah molekul yang diyakini bertanggung
jawab atas efisiensi reaksi fotolisis aktivasi ikatan C-H hidrokarbon. Sementara itu molekul
bidentat telah dibuktikan tidak fotoaktif melalui studi fotolisis turunan kompleks iridium
dikarbonil lainnya yang memiliki struktur bidentat secara pasti. Analisis kepadatan awan
elektron pada molekul tridentat dan bidentat juga memberikan dukungan tambahan bahwa
molekul terakhir pada dasarnya adalah molekul yang sangat stabil. Kesimpulan penting dari
studi yang disajikan ini adalah bahwa molekul HB(Pz)3Ir(CO)2 dalam larutan memiliki
karakter bidentat yang dapat menghasilkan garam kompleks [HB(Pz)2 (PzH)Ir(CO)2]BF4
dan karakter bidentat inilah yang mengurangi fotoaktifitas senyawa dikarbonil induk dalam
larutan.
Kata kunci: iridium dikarbonil, aktivasi ikatan C-H, pirazolil, pengkelatan
Sintesis Dan Ujian Awal Aktiviti Anti-bakteria Dan Fungi Beberapa Terbitan
Benzoiltiourea
Abstrak
Lapan sebatian terbitan benzoiltiourea, N-benzoil-N’-feniltiourea, 2-
klorofenilbenzoiltiourea, 3-klorofenilbenzoiltiourea, 4-klorofenilbenzoiltiourea, 2-
iodofenilbenzoiltiourea, 4-bromofenilbenzoiltiourea, 2-klorobenzoil-2-klorofeniltiourea dan
N-benzoil-N’-3-nitro-4 klorofeniltiourea telah disintesis dan diciri. Kajian sinar-X
menunjukkan semua sebatian tersebut mempunyai konfigurasi cis-trans bagi kedudukan fenil
dan benzoil terhadap kumpulan C=S pada ikatan C-N. Para dan ortho isomer benzoiltiourea
PhC(O)NHC(S)NHPhX yang mana X = Cl, Br dan I, tidak menunjukkan aktiviti terhadap
bakteria Staphylococcus aureus (MRSA), Pseudomonas aeruginosa, Salmonella typhimurium
dan Bacillus subtilis, kecuali m-klorofenilbenzoiltiourea aktif terhadap Staphylococcus dan
Salmonella. Kehadiran NO2 dalam N-benzoil-N’-3-nitro-4-klorofeniltiourea memberi
aktiviti terhadap Salmonella. Kehadiran kloro dalam 2-klorobenzoil-2-klorofeniltiourea pula
memberi aktiviti terhadap ke empat-empat bakteria. Dalam ujian antifungi, semua
fenilbenzoiltiourea yang mempunyai pengganti halida tidak aktif terhadap ke empat-empat
jenis fungi diuji. Walau bagaimanapun, N-benzoil-N’-3-nitro-4-klorofeniltiourea dengan
kehadiran NO2 dan kloro dalam kumpulan fenil menunjukkan ada aktiviti ke atas fungi
Candida albican dan Saccharomyces cerevisiae.
Kata kunci : Fenilbenzoiltiourea, antibakteria, antifungi
1. Pendahuluan 2. Percobaan
Aplikasi terbitan benzoiltiourea meliputi Penyediaan terbitan benzoiltiourea : Terbitan
pelbagai bidang termasuklah aktiviti biologi. benzoiltiourea disediakan dengan mengrefluks
Sebagai contoh N-[2-(2-klorofenetil)]-N’-[2-(5- larutan campuran benzoilisotiosianat dengan
bromopiridil)]-tiourea dalam aktiviti sebatian amina. Larutan refluks dicurahkan ke
immobolisasi sperma, boleh bertindak sebagai dalam ais dan menghasilkan mendak. Mendak
penghalang non-nukleosid HIV-1 (D’ruz et al dicuci dengan air suling dan metanol. Produk
2000). Beberapa terbitan benzoiltiourea, yang kering dihablur semula menggunakan
dilaporkan boleh bertindak sebagai antifungi etanol.
terhadap patogen tumbuhan dan ini penting
Penentuan struktur sinar-X : Hablur tunggal
untuk mencegah penyakit tanaman (Campo et
yang dipilih dan sesuai dipasang pada SMART
al 2002). Walau bagaimanapun, jumlah terbitan
APEX CCD diffraktometer. Data pembalik
benzoiltiourea yang tersintesis masih terhad.
dipungut dan diproses menggunakan perisian
Oleh yang demikian beberapa sebatian terbitan
SAINT (Siemens, 1996). Pembetulan serapan
benzoiltiourea disintesis dan diuji aktivitinya
pula menggunakan perisian SADABS
terhadap bakteria dan fungi dalam konteks
(Sheldrick, 1996). Penyelesaian struktur
kajian perhubungan struktur-aktiviti.
dilakukan secara kaedah terus dengan
menggunakan perisian program SHELXTL fungi jenis Candida albican (CA), Candida
versi 5.1 (Sheldrick, 1990). lypolytica (2075), Aspergillus ochraceaus (398)
dan Saccharomyces cerevisiae (20341).
Ujian mikrobiologi : Untuk ujian potensi
Aktiviti antimikrobiologi setiap sebatian
biologi sebatian, empat jenis bakteria dan fungi
ditentukan secara kualitatif menggunakan
digunakan iaitu Methicilliun resistant
kaedah cakera peresapan diubahsuai.(Tarafder
Staphylococcus aureus (MRSA), Pseudomonas
et al 2000). Luas zon perencatan keliling cakera
aeruginosa (60690), Salmonella
diukur bagi menentukan tahap keaktifan.
thypimurium(S974), Bacillus subtilis (B29) dan
Jadual 3. Peruntukan 13C Resonan Magnetik Nukleus beberapa arilbenzoiltiourea dalam d6-DMSO
Anjakan
kimia Fenil o-Kloro m-Kloro p-Kloro o-Iodo p-Bromo
kloro, 4-kloro, 2-iodo dan 4-bromo kumpulan fenil, aktif keatas semua jenis
fenilbenzoiltiourea tiada menunjukkan aktiviti bakteria yang diuji.
terhadap ke empat-empat bakteria. Sebaliknya,
Ujian antifungi menunjukkan sebatian (1)
3-klorofenilbenzoiltiourea aktif terhadap 2 jenis
hingga (6) tidak aktif terhadap fungi jenis
bakteria iaitu MRSA dan Salmonella
Candida, Aspergillus dan Saccharomyces.
thyphimurium (Jadual 4). Kehadiran kloro dan
Sebatian (7) N-benzoil-N’-3-nitro-4-
nitro dalam kumpulan fenil, N-benzoil-N’-3-
klorofeniltiourea di dapati aktif terhadap fungi
nitro-4-klorofeniltiourea memberi keaktifan
Candida albican dan Saccharomyces. Berbeza
terhadap Salmonella thypimurium. Kehadiran
dengan sebatian (8) 2-kloro-benzoil-2-
kloro pada kedudukan ortho di kedua-dua
Abstract
Indonesia has the largest volcanic region in the world with over 70 active volcanoes
surrounded by hot springs. This condition enables the country to be one of the largest habitats
for thermophilic microorganism, however a little effort has been made to characterize those
microorganisms. A number of thermophilic microorganisms have been isolated from its
habitats. Some of the organisms have been characterized through both conventional and
ribotyping method. DNA pol I gene from one of these organism has been cloned and
sequenced. The gene showed high homology to DNA pol I from Bacillus caldotenax.
Heterolog expression of the gene in Escherichia coli through pTRXFus expression vector
showed that the fusion enzyme was expressed at over 35% of cellular protein. The fusion
enzyme still exhibited polymerase activity on the crude extract. Purification of the enzyme was
carried out by two steps purification, ammonium sulfate fractionation and cation exchange
chromatography. A few mutants of the gene have been constructed and expressed in E.coli.
Biochemical analysis of the enzyme was studied by comparing the properties of the mutants
and the wild type.
Key words: thermophile, ribotyping, cloning, thermostable DNA Polymerase.
86
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Akhmaloka, H. Pramono, E. Susanti, M.R. Moeis, L. Ambasari, A.Suharto, I.N. Tika,
H. Helwati, and F. Madayanti
enzymes in the replication of cellular low temperature in the PCR amplification. All
information that is present in all living of commercial available DNA Pols have some
organisms. Beginning with the isolation and advantages and disadvantages properties,
characterization of DNA Pol I from E. coli therefore a new and improved thermostable
(Kornberg, 1980), more than 50 DNA Pol have DNA Pol are still needed.
been cloned and sequenced from various
A number of thermophilic microorganisms
organisms(Kim et al. 2001), including
were isolated from hot spring around Bandung.
thermopile and archea. DNA Polymerase has
A few of the organisms grow at temperature up
been used extensively in molecular biology.
to 85oC. Some of these organisms have been
For example, DNA Pol I was used for the nick-
identified through ribotyping analysis
translation of DNA and synthesis of the second
(Indrajaya et al., 2003; Akhmaloka et al.,
strand of cDNA in cDNA cloning (Efstratiadis
2005). DNA Polymerase from one of the
et al., 1976). The modified version of
isolate have been cloned and sequenced
bacteriophage T7 DNA Pol (SequenesTM) was
(Pramono et al., 2002). The gene coded 876
used for dideoxy sequencing of DNA (Tabor
amino acids and heterolog expression of the
and Richardson, 1987). Thermostable DNA
gene still form an active enzyme with
Polymerase, such as Taq DNA Pol, has been
polymerase activity.
the key element in the development of the
polymerase chain reaction (Saiki et al., 1988; In this report we would like to give an
Mullis et al., 1986). The application of overview of our recent work on thermophilic
thermostable DNA Pol in PCR makes the microorganisms and its potential application
automation of PCR become possible. Tag DNA especially on exploration of thermostable DNA
Pol (from Thermus aquaticus) was first polymerase.
characterized thermostable enzyme (Chien, Isolation and Identification of Thermophilic
1976). Thereafter, many of DNA Pol from
Bacteria.
Thermus strain was studied. Tfl, Tth, Tfi, and A number of thermophilic bacteria were
Top Polymerase have been applied to PCR isolated from hot springs around Bandung,
(Kaledin et al., 1981; Ruttimann et al., 1985; including Domas Crater (Tangkuban Perahu
Jung et al., 1997; Kim et al., 1998). However, Mount), Cimanggu Hot Spring, Cibumi Hot
the base-insertion fidelities are low since these Spring, Wayang Crater (Pengalengan),
DNA Pol do not have 3’→ 5’ exonuclease Papandayan Crater and Kamojang Crater.
activity. The high fidelity of DNA Pol, which Physico-chemistry of the hot spring was
has 3’→ 5’ exonuclease activity dependent variation such as pH, temperature and
proofreading activity, should be required for humidity, however most of them are sulfur rich
error correction during the polymerization. habitat.
Several thermostable DNA polymerases with
proofreading activity (Pfu, Vent, Deep Vent, Isolation of the organisms was performed by
and Pwo) have also been studied and introduce taken sediment-rich water from surface, middle
for high-fidelity PCR amplification (Cariello et and bottom of the hot springs. The samples
al., 1991; Lumberg et al., 1991; Kong et al., were cultivated on LB, NB, Sulfolobus,
1993; Frey and Suppmann, 1995; Chine et al., Thermus and sulfate-reducing media. The
1996). isolates were then characterized including,
growth temperature, and morphological
Most of the native thermostable enzymes are properties. Some of the isolates grow at
synthesized at very low levels by the temperature up to 85oC and did not shown any
thermophilic microorganisms; therefore, they growth activity at temperature up to 42oC.
are cumbersome to purify. Most of
thermostable DNA polymerases were produced Identification of thermophilic bacteria was
in a biologically active form in E. coli over- performed through analysis of 16S rRNA gene
expression system (Lu and Ericson, 1997; sequence. The 16S rRNA genes were amplified
Dabrowski and Kur, 1998). However, several with 27F and 1492R primers (Table1). The
problems persist, such as error-prone amplicons were confirmed by agarose gel
amplification and unwanted amplification at electrophoresis. The above primers amplified
1,5 kb of 16S rRNA gene fragment
1 µm
Figure 3. Morphological cells under light microscopy with 1000x amplification
respectively. The DNA fragments were ligated available sequence data on the GenBank and
on pGEM-T vector and the recombinant the result usually showed that the sequence has
plasmid carried DNA fragments were high homology to all 16S rRNA genes. This
confirmed by restriction analysis. confirmed that the amplicon was a part of 16S
rRNA gene. From this alligment could also
The chosen plasmids from the result of
determine the genus of the organism examined.
restriction analysis were sequence based on the
strategy as mentioned on Figure 4. At least two Further analyses to identify the strains of
independent sequences were used to confirm organisms, phylogenetic analysis was used to
the correct sequence of the fragments. The determine the relationship among examined
resulted sequences were compared to that strains. The phylogenetic trees were
Table1 Primers used in this study. Primers no 1 and 2 were used to amplify 16S rRNA;
Primer no 3-9 were used to sequence the 16S rRNA gene
1. 27F 5’-AGAGTTTGATC(A/C) TGGCTCAG-3’
2. 1492R 5’-GGTTAC(G/C) TTGTACCTGCCGGA-3’
3. 357F 5’-TACGGGAGGCAGCAG-3’
4. 803F 5’-GATTAGATACCCTGGTAG-3’
5. 1114F 5’-GCAACGAGCGCAACCA-3’
6. 909R 5’-CCGTCAATTCATTTGAGT-3’
7. 519R 5’-GTATTACCGCGGCTGCTG-3’
8. SP6 5’-GGGCGAATTGGGCCCGAC-3’
9. T7 5’-TGCATAGCTTGAGTATTC-3’
constructed by Clustal W method from of the gene, two sets of primers were designed
Megalign program from DNA Star. Around 30- and constructed (Table 2). Determination of
50 nucleotide sequences showed higest primers position was based on the conserved
homology from BLAST program were region of DNA Pol I gene (Uemori et al.,
analysed to construct Phylogenetic tree. In few 1993). Based on this approach, two amino acid
cases Phylogenetic tree still hard to sequences were founded highly conserved at
differentiate the examined strained, further position between amino acid number 621 –628
analysis could be performed by detail and 828 – 834. The above amino acid
comparison of 16 S rRNA genes among the sequences were inscripto translated into
highest homology. Using this strategy we were nucleotide sequences. Furthermore, the
identified Geobacillus thermoleovorans as one sequences were analyzed by Primer Detective
of examined strain from Wayang Crater Software to determine cross and self-
(Indrajaya et al., 2003) and a new strain from homology, resulting FPI and RPI primers
Papandayan Crater (Akhmaloka et al., 2005). (Table2). The others primers were designed
based on the sequence of internal gene.
Cloning and Expression of Thermostable
DNA PolI The FP1 and RP1 primers would amplify
Coding region of DNA PolI gene from one of around 600 base pairs in the upstream region of
thermophilic bacteria was cloned through PCR the gene, while RP4 and FP4 amplified the
amplification from its chromosomal DNA as entire coding region of the gene (Figure 5.). All
template. To amplify the whole coding region PCR were performed using standard method.
Figure 5. Amplification Strategy and The Primers Position on DNA Pol I gene.
Figure 6. Sequence differences between DNA Pol I Bca and DNA Pol I ITB1.
The PCR product was then assayed on the plasmids were carried out resulting on an entire
agarose gel electrophoresis and the bands were sequence of local DNA Pol ITB1 gene. The
visualized using UV light. The results showed resulted sequence has been compared to
that the fragment size were in agreement with GenBank (NCBI) data. Data analysis showed
the predicted. that the sequence was confirmed as DNA Pol I
gene, with highest homology to DNA Pol I
All PCR products were cloned on suitable
from B. caldotenax (Bac, 98%) and B.
cloning vector and the recombinant plasmids
stearothermophilus (Bst, 83%). Detail
were confirmed by restriction analysis. Further
comparison between DNA Pol I ITB1 to that B.
characterization of DNA Pol I fragments were
caldotenax showed that there was a codon
performed by nucleotide sequences analysis.
deletion on the downstream of the gene, some
The sequencing was carried out using an
missense and silent mutations (Figure 6).
automatic DNA sequencer ABI373A. At least
three independent clone carrying recombinant
Over expression of DNA Pol ITB1 was coding region of DNA Pol ITB1. The pITB9
performed through an expression vector plasmid was confirmed by sequence analyses
pTRXFus. The coding region of DNA Pol ITB1 on the junction regions.
was inserted to pTRXFus in position of KpnI
The pITB9 was used to transform E. coli
and BamHI cleavage sites. The KpnI and
GI724, suitable host for the expression vector.
BamHI sites on the coding region of the gene
For the expression of fusion protein, the culture
were introduction by PCR site directed
on RM medium was inoculated to IM media
mutagenesis. The new coding sequences were
until OD550 = 0.5. The cell was induced by
ligated into pTRXFus (Figure 7) vector
addition of tryptopan to activate the promoter.
resulting pITB9 plasmid with carrying fusion
The crude extract of the culture was analysis-
between 3’-terminal of thioredoxin and entire
using SDS-PAGE; the result showed that the
Kaledin, A. S., Sliusarenko, A. G., and Gorodetskii, High-fidelity amplification using a thermostable
S. I. (1981) Isolation and Propertis of DNA polymerase isolated from Pyrococcus furiosus.
polymerase from the extreme thermophilic Gene 108, 1-6.
bacterium Thermus Falvus. Biokimiia 46, 1576-
Mullis, K., Falooma, F., Saiki, R., Horn, G. And
1584.
Ehrlich, H. (1986) Spesific enzyme amplification of
Kim, B. C., Grite, R., Lee, D.W., Antranikian, G. DNA in Vitro: the polymerase chain reaction. Cold
and Pyun, Y. R. (2001). Thermoanaerobacter Spring Harbor Symp. Quant. Biol. 247, 7116-7122.
yonseiensis sp. Nov., a novelextreme thermophilic,
Pramono, H., Akhmaloka, D. S. Retnoningrum, K.
xylose-utilizing bacterium that grows at up to 85oC.
Padmawinoto dan O. B. Liang (2002). Kloning dan
Int.J.Sys. Evol. Microbiol. 51, 1539-1548.
Penentuan Urutan Nukleotida Fragmen-Fragmen
Kim, J. S., Koh, S., Kim, J. J., Kwon, S. T., and Lee, Gen DNA Polimerase Bacillus thermoleovorans
D. S. (1998) Top DNA polymerase from Thermus Isolat Lokal. Acta Biochim Indo., Vol 26, hal. 155-
thermophilus HB 27: Gene cloning, sequence 162.
determination, and physicochemical properties.
Ruttiman, C., Cotoras, M., Zaldivar, J. and Vicuna,
Molecules and Cell 8, 157-161.
R. (1985) DNA polymerase from the extremely
Kong, H., Kucera, R.B. and Jack, W. E. (1993) thermophilic bacterium Thermus thrmophilus HB.
Characterization of a DNA polymerase from the Eur: J.Biolchem. 149, 41-46.
hyperthermophile archaea Thermococcus litoralis. J.
Saiki, R. K., Gelfand, D. H., Stoffel, S., Scharf, S.
Biol. Chem. 268, 1965-1975.
J., Higuchi, R., Horn, G. T., Mullis, K. B. and
Kusumadinata, Catalogue of References on Erlich, H. A. (1988) Primer-directed enzymatic
Indonesian Volcanoes with Eruptions in Historical amplification of DNA with a thermostable DNA
Time. Department of Mining and Energy (1977). polymerase. Science 239, 487-491.
Lu, C. and Ericson, H. P. (1997) Expression in Sambrook, J., D.W. Russel, (2001), Molecular
Escherichia coli of the thermostable DNA Cloning, Third Edition, CSHL Press, New York.
polymerase from Pyrococcus furiosus. Protein
Tabor, S. and Richarsson, C/ C. (1987) DNA
Expression Purif. 11, 179-184.
sequence analysis with a modified bacteriophageT7
Lunberg, K. S., Shoemaker, D. D., Adams, M. W., DNA polymerase. Proc. Natl. Acad. Sci. USA 84,
Short, J. M., Sorge, J. A. and McArthur, E. J. (1991) 4767.
Alfinda Novi Kristanti, Nanik Siti Aminah, Mulyadi Tanjung, Yusamsutin, Azizah, and
Dahlia Safa Marwati
Abstract
Two anthraquinone compounds emodin (1) and biphyscion (2) have been isolated from the
ethyl acetate extract of the stem bark of Cassia multijuga (Leguminosae). The structures of
these compounds were determined on the basis of spectroscopic evidence.
H O H
MeO CH3
OH O OH
OH O OH
H H H
H
OH O OH
H3C OH
H3 C OMe
H O H
H O H
(1) (2)
Senna/Cassia multijuga merupakan salah satu pemurnian digunakan bahan yang berkualitas
spesies dari genus Senna/Cassia yang telah pro analisis (p.a).
diteliti sebagian. Biji dari tumbuhan ini
Alat-alat penelitian :
dilaporkan menghasilkan senyawa monomer
Seperangkat alat kromatografi kolom cair
dalam bentuk hidroksi maupun glikosida dari
vakum, seperangkat alat kromatografi kolom
senyawa golongan antrakuinon (Singh, 1981).
cepat, seperangkat alat destilasi, seperangkat
Namun bagian kulit batang dari tanaman ini
alat penguap putar, bejana kromatografi lapis
belum pernah diteliti sebelumnya. Oleh karena
tipis, dan alat-alat gelas yang biasa digunakan
itu pada penelitian ini dilakukan isolasi,
di laboratorium.
identifikasi (dengan metode spektroskopi
seperti UV, 1H-NMR, dan 13C-NMR), uji Alat-alat yang digunakan untuk identifikasi
aktivitas antioksidan dan toksisitasnya pada adalah : Fisher Johns melting point apparatus,
benur udang Artemia salina terhadap senyawa- spektrofotometer UV-VIS Beckman DU 7500,
1
senyawa yang terkandung dalam kulit batang H-RMI Brucker AM 300, dan 13C-RMI
Senna/Cassia multijuga. Brucker AM 400.
Penetuan aktivitas antioksidan dengan panduan Cara Kerja :
TLC-autografi merupakan metode yang efektif 1. Penyediaan bahan penelitian
dan cepat untuk mengetahui senyawa yang Sampel tanaman yang berupa kulit batang
mempunyai aktivitas dalam bahan ekstrak. Senna multijuga dibersihkan dari pengotornya,
Interaksi antara senyawa aktif dengan pereaksi kemudian dikeringkan di bawah sinar matahari.
radikal DPPH (2,2-diphenyl-1-picrylhidrazyl) Setelah itu dipotong-potong dan dihaluskan
akan memberikan warna kuning. Selanjutnya hingga berbentuk serbuk.
dengan metode spektrometri senyawa murni
yang mempunyai aktivitas antioksidan 2. Ekstraksi dan isolasi senyawa fenolik
ditentukan IC50 berdasarkan prinsip bahwa Serbuk kulit batang Senna multijuga sebanyak
senyawa aktif dapat meredam puncak 4 kg dimaserasi menggunakan pelarut aseton
absorbansi radikal DPPH. Penelitian senyawa selama 3 x 24 jam sebanyak tiga kali pada suhu
anti radikal bebas merupakan penelitian kamar. Kemudian dipisahkan antara filtrat dan
pendahuluan yang selanjutnya akan residunya. Ekstrak aseton yang diperoleh,
diaplikasikan dalam terapi kanker dan disaring dan diuapkan dengan penguap putar
atheroschlorosis. Uji toksititas menggunakan sehingga diperoleh ekstrak kental, selanjutnya
Brine shrimp lethality test (BSLT) juga ditambahkan air sebanyak 10% dari volume
dilakukan untuk mengetahui toksisitas senyawa semula. Kemudian diekstraksi dengan n-heksan
yang diperoleh. sebanyak tiga kali untuk menghilangkan lemak
2. Percobaan dan senyawa non polar lainnya. Ekstraksi
Bahan penelitian : dilanjutkan dengan menggunakan pelarut etil
Serbuk kulit batang tumbuhan Senna multijuga asetat sebanyak tiga kali untuk mendapatkan
yang diperoleh dari Lembaga Ilmu senyawa antrakuinon dan senyawa semi polar
Pengetahuan Indonesia UPT Balai lainnya. Ekstrak etil asetat yang diperoleh
Pengembangan Kebun Raya Purwodadi, dikeringkan menggunakan magnesium anhidrat
Pasuruan , Jawa Timur. selama 24 jam kemudian disaring dan diuapkan
dengan penguap putar sehingga diperoleh
Bahan Kimia : ekstrak etil asetat kental.
Metanol, aseton, n-heksana, kloroform, etil
asetat, benzena, eter, magnesium sulfat Selanjutnya, terhadap ekstrak etil asetat fraksi
anhidrat, akuades, pelat silika gel GF254, silika dilakukan pemisahan dan pemurnian dengan
gel GF60, silika gel GF254, pereaksi cerium berbagai teknik kromatografi, meliputi
sulfat, pereaksi DPPH, dan sea salt (garam kromatografi cair vakum (KCV), kromatografi
laut). Bahan-bahan kimia yang digunakan kolom gravitasi (KKG), dan kromatografi
untuk keperluan ekstraksi adalah yang kolom cepat (KKC). Proses pemisahan dengan
berkualitas teknis dan sudah didestilasi kromatografi di atas dilakukan berulang kali
sedangkan untuk keperluan analisis dan sampai diperoleh satu noda pada plat KLT.
Fraksi dengan satu noda yang diperoleh dari
proses pemisahan, selanjutnya dimurnikan pada λmaks (MeOH) 307, 401, dan 521 nm.
melalui proses rekristalisasi. Kemudian
Spektrum 1H-NMR (aseton-d6) memperlihatkan
dilanjutkan dengan uji KLT dengan tiga macam
eluen yang berbeda, uji titik leleh dan analisis pergeseran kimia pada δ (ppm) 2,43(3H, s),
spektroskopi. 6,62(1H, d, J=1,5 Hz), 7,08(1H, s), 7,19(1H, d,
J=1,5 Hz), 7,50(1H, s), 9,74(1H, s), 12,02(1H,
3. Identifikasi Senyawa fenolik s), dan 12,14(1H, s).
Senyawa yang diperoleh ditentukan titik Spektrum 13C-NMR (aseton-d6) memberikan
lelehnya dengan menggunakan melting points harga pergeseran kimia pada δ (ppm) 21,8;
Fisher Johns apparatus. Kemudian dilanjutkan 108,8; 108,8; 109,7; 121,4; 124,9; 134,2; 136,4;
dengan analisis spektroskopi yang meliputi UV 136,9; 149,5; 163,2; 166,2; 166,4; 182,2; dan
– Vis, 1H-RMI dan 13C-RMI 191,7 .
4. Uji Antioksidan (TLC-Autografi dan Senyawa (2) berupa serbuk berwarna orange
Spektrometri) sebanyak 32 mg dengan titik leleh >300 0C.
Uji dilakukan dengan menggunakan larutan Spektrum UV-Vis memperlihatkan λmax (MeOH)
DPPH (nm) 208, 270, 351, 446, dan 516. Sedangkan
5. Uji toksisitas dengan Brine Shrimp Lethality λmax (MeOH + NaOH) (nm) 211, 270, 390, 512, dan
Test (BSLT) 520.
Uji dilakukan dengan menggunakan telur Spektrum 1H-NMR (CDCl3) memperlihatkan
Artemia salina Leach. pergeseran kimia pada δ (ppm) 2,33(s, 3H),
2,45(s, 3H), 3,81(s, 3H), 3,86(s, 3H), 6,79(s,
1H), 7,02 (s, 1H), 7,06(s, 1H), 7,39(s, 1H),
3. Hasil dan Diskusi 7,52(s, 1H), 7,64(s, 1H), 12,04(s, 1H),
Berdasarkan serangkain proses yang telah 12,08(s,1H), 12,25(s, 1H), dan 13,02(s, 1H).
dilakukan terhadap fraksi etil asetat, berhasil
diproleh dua senyawa fenolik golongan Spektrum 13C-NMR (CDCl3) memberikan
antrakuinon. Kedua senyawa tersebut terdiri harga pergeseran kimia pada δ (ppm) 22,1;
atas satu monomer antrakuinon yang dikenal 22,2; 56,5; 56,6; 103,6; 104,6; 110,5; 111,0;
dengan nama emodin (1) dan satu dimer 113,5; 113,8; 117,4; 120,1; 121,2; 123,9; 124,4;
antrakuinon yaitu 2,2’-bifiscion atau 1,8- 132,4; 133,3; 133,8; 134,2; 161,2; 162,1; 162,4;
dihidroksi-6-metil-3-metoksi-2(fiscion-2’-il)- 163,3; 164,7; 166,1; 182,2; 182,6; 190,9; dan
9,10-antrakuinon (2). 191,3.
Senyawa (1) yang diperoleh berupa serbuk Senyawa (1) diperoleh melalui tahapan sebagai
berwarna kuning sebanyak 70 mg dengan titik berikut : Fraksi etil asetat sebanyak 63 g
leleh = 142oC (terurai). dipisahkan dengan kromatografi kolom
gravitasi (KKG). Guna memudahkan proses
Spektrum UV-Vis memperlihatkan serapan selanjutnya, fraksi ini dibagi dua yaitu 43 g
maksimum pada λmaks (MeOH) 206, 282, dan 448 dipisahkan dengan KKG1 dan sisanya (20 g)
nm. Efek batokromik dengan penambahan dengan KKG2 dengan eluen n-heksan-aseton
NaOH memperlihatkan serapan maksimum (9,5:0,5). Proses pemisahan ini menghasilkan
H O H
MeO CH3
OH O OH
OH O OH
H H H
H
OH O OH
H3C OH
H3 C OMe
H O H
H O H
(1) (2)
23 fraksi dari KKG1 dan 14 fraksi dari KKG2 di antara karbon yang mengikat metil dan
dan masing-masing dikelompokkan menjadi 4 karbon kuartener. Adanya 2 sinyal proton
gabungan fraksi (A, B, C, dan D). Tiap-tiap masing-masing doublet pada δ 6,62 dan 7,19
fraksi diuji dengan KLT dan hasil uji ppm dengan J= 1,5 Hz menunjukkan bahwa
menunjukkan bahwa fraksi A (400 mg) dari posisi proton aromatik tersebut pada posisi
KKG1 dan B (190 mg) dari KKG2 meta. Di samping itu juga terdapat 3 sinyal
memperlihatkan harga Rf yang sama. Fraksi A proton hidroksi pada δ 9,74(1H, s), 12,02(1H,
dan B digabung, kemudian dipisahkan lebih s), dan δ 12,14(1H, s) serta satu sinyal proton
lanjut menggunakan kromatografi kolom singlet yang mewakili 3 proton dari substituen
modifikasi sebanyak dua kali dengan eluen n- metil pada δ 2,43(3H, s).
heksan-aseton (9:1) dan n-heksan-kloroform
(1:1) sehingga didapatkan 4 fraksi (E, F, G, dan Untuk memastikan adanya kopling meta dari
H). Fraksi G (80 mg) dimurnikan lebih lanjut dua sinyal proton aromatik yang ada dilakukan
dengan kromatografi kolom gravitasi pengukuran spektrum 2D 1H-1H COSY.
menggunakan eluen n-heksan-etil asetat (9:1) Sedangkan pengukuran spektrum 2D 13C-1H
dan hasil uji KLT menunjukkan bahwa fraksi COSY digunakan untuk mengetahui hubungan
(6-19) mempunyai spot tunggal. Gabungan antara proton dan karbon 1 ikatan. Dari
fraksi dengan spot tunggal ini selanjutnya diuji spektrum ini terlihat bahwa atom karbon pada δ
dengan KLT menggunakan tiga sistem eluen 21,8 ppm (CH3) berikatan dengan 3 atom H
yang berbeda untuk menunjukkan kemurniaan pada δ 2,43 ppm, atom karbon pada δ 124,9
senyawa. Hasil uji KLT menunjukkan bahwa ppm (C-4) berikatan dengan atom H pada δ
senyawa (1) yang berhasil diisolasi adalah 7,50 ppm, dan atom karbon pada δ 134,2 ppm
senyawa tunggal. (C-2) berikatan dengan atom H pada δ 7,08
Spektrum UV-Vis memberikan serapan pada ppm. Di samping itu juga diketahui bahwa
λmaks yang khas untuk senyawa golongan atom C pada δ 108,8 ppm berikatan masing-
antrakuinon yaitu 3 atau 4 pita muncul pada masing dengan 1 atom H pada δ 7,19 ppm (H-
λmaks 215 dan 300 nm dan 1 pita lainnya pada 5) dan atom H pada δ 6,62 ppm (H-7).
λmaks diatas 430 nm (Harborne, 1987). Adanya Kesimpulan terhadap struktur senyawa (1) telah
efek batokromik setelah penambahan NaOH dibandingkan dengan literatur (Meselhy, 2003
(sekitar 25 nm) menunjukkan bahwa senyawa dan Lee, 2001).
(1) mempunyai gugus hidroksi benzen (fenolik)
Senyawa (2) diperoleh lewat tahapan sebagai
(Harborne, 1987).
berikut : Sebanyak 100 g fraksi etil asetat sisa
Spektrum 13C-NMR memperlihatkan adanya 12 dipisahkan dengan KCV menggunakan eluen
sinyal yang mewakili 15 atom karbon. Lima heksan:etil asetat dengan meningkatkan gradien
belas atom karbon tersebut terdistribusi ke kepolaran dan diperoleh 4 kelompok fraksi (A,
dalam : 9 atom karbon aromatis (δ = 108,8; B, C, dan D), Fraksi B (900) mg dipisahkan
108,8; 109,7; 121,4; 124,9; 134,2; 136,4; 136,9; lebih lanjut dengan lima kali kromatografi
dan 149,5 ppm), 2 atom karbon karbonil (δ = kolom cepat menggunakan eluen berturut-turut
182,2; dan 191,7 ppm), 3 atom karbon oksiaril n-heksan : aseton(9:1), n-heksan : etil asetat
(δ = 163,2; 166,2; dan 166,4 ppm), dan 1 atom (9:1),n-heksan : aseton (95:5), n-
karbon metil (δ = 21,8 ppm). Berdasarkan data heksan:kloroform (1:1), dan n-heksan-etil :
tersebut, diduga bahwa senyawa (1) adalah asetat (9:1) menghasilkan senyawa (2) berupa
suatu monomer antrakuinon yang mengikat 3 serbuk berwarna orange sebanyak 32 mg. Hasil
gugus hidroksil dan 1 gugus metil. uji KLT dengan tiga sistem eluen
[Heksan:aseton (8:2); Heksan:kloroform (9:1);
Dugaan tersebut diperkuat oleh data 1H-NMR Heksan:etilasetat (8:2)] tersebut menunjukkan
yang memperlihatkan adanya 4 sinyal proton bahwa senyawa (2) merupakan senyawa
aromatik pada pergeseran kimia (δ) 7,08(1H, s, tunggal dan sudah murni.
H-2), 7,50(1H, s, H-4, 7,19(1H, d, J=1,5 Hz, H-
5), dan 6,62(1H, d, J=1,5 Hz, H-7). Proton H-2 Analisis spektrum UV-Vis memberikan
yang terletak diantara 2 gugus OH kurang serapan λmax yang merupakan karakteristik
deshielding dibanding proton H-4 yang terletak spektrum UV-Vis untuk senyawa antrakuinon.
Karakteristik spektrum UV-Vis untuk senyawa mewakili 6 proton dari gugus metoksi pada δ
antrakuinon dapat dibedakan dari kelas kuinon 2,33 (s, 3H) dan 2,45 ppm (s, 3H); dua sinyal
lainnya karena mempunyai empat atau lima proton mewakili 6 proton dari gugus metoksi
pita serapan didaerah UV dan daerah tampak. pada δ 3,81 (s, 3H) dan 3,86 ppm (s, 3H); serta
Tiga dari pita serapan tersebut terletak antara 6 sinyal proton aromatik pada δ 6,79, 7,02,
215 dan 300 nm, dan serapan yang satu lagi 7,06, 7,39, 7,52, 7,64 ppm (masing-masing s).
diatas 430 nm (Harborne, 1987). Sedangkan
Sedangkan pengukuran 2D 13C-1H COSY
adanya pergeseran batokromik setelah
digunakan untuk mengetahui hubungan antara
penambahan NaOH sekitar 4-30 nm (λmax 254, proton dan karbon satu ikatan. Dari spektrum
255, 377, dan 517) menunjukkan bahwa ini terlihat bahwa karbon pada δ 22,1 ppm
senyawa (2) mempunyai gugus hidroksi (CH3) berikatan dengan 3 proton pada δ 2,33
fenolik. ppm dan karbon pada δ 22,2 ppm (CH3) dengan
Analisis spektroskopi karbon NMR (13C-NMR) 3 proton δ 2,45 ppm, karbon pada δ 56,5 ppm
dalam pelarut CDCl3 memperlihatkan adanya (OCH3) berikatan dengan 3 proton pada δ 3,81
32 sinyal yang mewakili 40 atom karbon. ppm dan karbon pada δ 56,6 ppm (OCH3)
Sinyal-sinyal karbon tersebut terdistribusi dengan 3 proton δ 3,86 ppm, karbon pada δ
sebagai : empat sinyal karbon karbonil pada δ = 103,6 ppm berikatan dengan proton pada δ 7,52
182,2; 182,6; 190,9; dan 191,3 ppm, 24 sinyal ppm (H-5), karbon pada δ 104,6 ppm berikatan
karbon aromatik yang mewakili 30 karbon pada dengan proton pada δ 6,79 ppm (H-7), karbon
δ = 103,6; 104,6; 110,5; 111,0; 113,5; 117,4; pada δ 121,2 ppm berikatan masing-masing
120,1; 121,2; 123,9; 124,4; 132,4; 133,3; 133,8; dengan proton pada δ 7,39 (H-3’) dan 7,64 ppm
134,2; 161,2; 162,1; 162,4; 163,3; 164,7; dan (H-1’`), karbon pada δ 123,9 ppm berikatan
166,1 ppm, dua sinyal karbon metoksi pada δ = dengan proton pada δ 7,02 ppm (H-8’), dan
56,5 dan 56,6 ppm, dan dua karbon dari gugus karbon pada δ 124,4 ppm berikatan dengan
metil pada δ = 22,1 dan 22,2 ppm. Dengan proton pada δ 7,06 ppm.
demikian dapat diduga bahwa senyawa tersebut Berdasarkan data spektrum UV-Vis, 13C-NMR,
merupakan dimer antrakuinon yang masing- 1
H-NMR dan 13C-1H COSY dapat disarankan
masing monomernya mengikat dua gugus bahwa senyawa (2) adalah 2,2’-bifiscion atau
hidroksi, satu gugus metil dan satu gugus 1,8-dihidroksi-6-metil-3-metoksi-2 (fiscion-2’-
metoksi. il)-9,10-antrakuinon.
Data ini didukung oleh data spektrum 1H-NMR Hasil Uji Bioaktivitas
yang memperlihatkan adanya proton dengan Uji aktivitas Antioksidan
perincian: empat sinyal proton hidroksi pada δ Uji aktivitas peredaman radikal bebas DPPH
12,04; 12,08; 12,25 dan 13,02 ppm ( masing- senyawa hasil isolasi dilakukan pada
masing s); dua sinyal proton alifatik yang
konsentrasi 62,5 ppm, 125 ppm, 250 ppm, 500 Emodin menunjukkan aktivitas antioksidan
ppm dan 1000 ppm. Pengukuran pada (IC50 = 200 ppm) dan 2,2’-bifiscion atau 1,8-
spektrofotometer UV-Vis dilakukan setelah 5 dihidroksi-6-metil-3-metoksi-2-(fiscion-2’-il)-
menit penambahan sampel. Hasil pengukuran 9,10-antrakuinon tidak menunjukkan aktivitas
dan penghitungan % peredaman DPPH antioksidan.
senyawa antrakuinon hasil isolasi adalah : IC50
Kedua senyawa hasil isolasi menunjukkan
emodin = 200 ppm sedangkan IC50 2,2’-
toksisitas terhadap benur udang Artemia salina,
bifiscion atau 1,8-dihidroksi-6-metil-3-metoksi-
yaitu emodin (LC50 = 173,65 ppm) dan 2,2’-
2(fiscion-2’-il)-9,10-antrakuinon = 1.305 ppm
bifiscion atau 1,8-dihidroksi-6-metil-3-metoksi-
Berdasarkan data tersebut diatas, terlihat bahwa 2-(fiscion-2’-il)-9,10-antrakuinon (LC50 =
monomer antrakuinon memiliki aktivitas 31,25 ppm).
antioksidan yang jauh lebih tinggi dibanding
dimer antrakuinon. Suatu senyawa dikatakan
memiliki aktivitas antioksidan apabila harga 5. Daftar Pustaka
Cos, P.; Ying, P.; Calomme, M,; Hu, J.P.; Cimanga,
IC50 < 1000 ppm. K.; Poel, B.V.; Pieters, L.; Berghe, D.P., 1998,
Structure Activity Relationship and Classification of
Uji toksisitas dengan benur udang Artemia flavonoid as Inhibitor of Xanthine Oxidase and
Superoxide Scavengers, J. Nat. Prod., 61, 71-76
salina (BSLT)
Terhadap senyawa hasil isolasi juga dilakukan Dai, J.R.; Hallock, Y.F.; Cardellina II, J.H.; Boyd,
uji toksisitas terhadap benur udang Artemia M.R., 1998, HIV-Inhibitory and cytotoxic
salina. Pada larutan sampel dibuat 4 macam oligostilbenes from the leaves of Hopea malibato, J.
variasi konsentrasi dan masing-masing Nat. Prod., 61, 351-353
konsentrasi dibuat 3 kali replikasi. Setelah 24 Geewananda, Y.A.; Gunawardena, P.;
jam, jumlah benur udang yang mati pada Sotheeswaran, S.; Sultanbawa, M.U.S.;
masing-masing konsentrasi larutan sampel dan Surendrakumar, S.; Bladon, P., 1986, Another
larutan kontrol dihitung, dicatat, dan ditentukan antibacterial polyphenol, coppaliferol B from
% kematian. Data tersebut selanjutnya Vaterian copallifera (Dipterocarpaceae),
Phytochemistry, 25, 1498-1500
digunakan untuk menentukan LC50 dengan
menggunakan analisis probit program SPSS. Harborne, J. B., 1987, Metode Fitokimia. Penentuan
Suatu senyawa dikatakan memiliki toksisitas Cara Modern Menganalisis Tumbuhan, ITB,
terhadap benur udang Artemia salina apabila Bandung
harga LC50 < 1000 ppm. Hasil uji toksisitas Joyeux, M.; Lobstein, A.; Anton, R.; Mortier, F.,
senyawa hasil isolasi terhadap benur udang 1995, Comparative Antilipoperoxidant, Antinecrotic
Artemia salina adalah : LC50 emodin = 173,65 and Scavenging Properties of Terpenes and
ppm, sedangkan LC50 2,2’-bifiscion atau 1,8- Biflavones from Ginko and some Flavonoids,
dihidroksi-6-metil-3-metoksi-2(fiscion-2’-il)- Planta Medica, 61, 126-129
9,10-antrakuinon = 31,25 ppm Meselhy, R., 2003, Constituents from Moghat, the
Emodin dan 2,2’-bifiscion atau 1,8-dihidroksi- Roots of Glossostemon Bruguieri (Desf.),
Molecules, 8, 614-621
6-metil-3-metoksi-2(fiscion-2’-il)-9,10-
antrakuinon menunjukkan toksisitas terhadap Lee, C.K.; Lee, P.H.; Kuo, Y.H., 2001, The
benur udang Artemia salina (LC50<1000 ppm). Chemical Constituents from the Aril of Cassia
fistula L., J. Chinese Chem. Soc., 48, 1053-1058
Meyer, B. N.; Ferrigni, N.R.; Putnam, J.E.;
4. Kesimpulan
Jacobsen, L.B.; Nichols, D.E.; McLaughlin, J.L.,
Dua senyawa golongan antrakuinon, yaitu 1982, Brine shrimp : a convenient general bioassay
emodin dan 2,2’-bifiscion atau 1,8-dihidroksi- for active plant constituents, Planta medica, 45, 31-
6-metil-3-metoksi-2-(fiscion-2’-il)-9,10- 34
antrakuinon telah berhasil diisolasi dari kulit
Singh, J.; Tiwari, A.R.; Tiwari, R.D., 1981,
batang Senna multijuga.
Anthraquinones and Flavonoids of Cassia laevigata
Roots, Phytochemistry, 19, 1253-1254
Abstract
The bacterial communities from one of hot spring at Gedongsongo (WGS2) Ambarawa,
Central Java, Indonesia; was investigated by molecular analysis based on the 16S rRNA gene.
Two minimal media, MM1 and MM2 were used for growth of aerobic microbial communities.
Cultures media were combined by filtration through 0.2-µm-pore-size filter for total genomic
DNA extraction. The DNA that was extracted both from cells of filtration and cultures have
been well characterized as microbial chromosomal DNA and used as PCR template. Partial
16S rRNA gene sequences were PCR amplified using one primer set. One primer complements
a region conserved among members of the domain Bacteria (Escherichia coli positions 1055
to 1070. The other primer is based on a universally conserved region (E. coli positions 1392
to 1406 and incorporates a 40-base GC clamp. These primers amplified a 323-bp section of
the 16S rRNA genes. The amplicons were separated by denaturing gradient gel
electrophoresis (DGGE) for community analysis. The DGGE profiles showed that there were
three distinct bands, but only two of them that represent the predominant bacteria.
Departement of ChemistryProceeding
ITB, Jl. Ganesha 10, 6
Bandung 40132,Joint
PhoneSeminar
: +62 (22)on2502103 ext 101,
100
th
of The ITB-UKM Chemistry
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
A.L.N. Aminin, M. Asy’ari, N.S. Mulyani, F. Madayanti, P. Aditiawati, and Akhmaloka
bacterioplankton (Fuhrman, J.A., et al. 1993), kinds of minimal mediums which are MM1 and
soil (Nakatsu, C. et al. 2000) as well as MM2. The formula of MM1 medium is like ½
hydrothermal environment (Moyer, C.L., et al. LB and MM2 like NB medium, except the
1994). water which were used is the spring water.
These medium were cultured at 60oC without
Denaturing gradient gel electrophoresis
shaking for 24 hours. For the filtration
(DGGE) technique is now routinely used in
procedure, the water sample was kept in a
many microbiological laboratories worldwide
sterile plastic container (2L) and brought to the
as molecular tool to compare the diversity of
laboratory immediately within 2 hours.
microbial communities and to monitor
Afterwards, cells were harvested by filtration of
population dynamics. Separation fragments in
1 L volumes of spring water gently through 0,2
DGGE is based on the decreased
µm (nominal pore size) Millipore filters.
electrophoretic mobility of partially melted
Resulting filtrates containing bacterial
double-stranded DNA molecules in
communities were stored at -20°C until DNA
polyacrylamide gels containing a linear
was extracted.
gradient of DNA denaturants (a mixture of urea
and formamide). Molecules with different Nucleic acid extraction. Each microbial
sequences may have a different melting sample which is from cultivation or filtration
behavior, will stop migrating at different was pellet by centrifugation. DNA was
positions in gel. More information about the extracted using slight modifications of a
identity of community members can be method described by Klijn et al. (1991). The
obtained by hybridization analysis of DGGE pellet was suspended in 200 µl of 10 mM Tris
patterns with polynucleotide probes or direct HCl buffer (pH 8.0) containing 8mg/ml of
sequencing of reamplified DGGE bands lysozyme and incubation at 37°C for 1 h, the
(Muyzer, G., 1999). cells were lysed by adding 200 µl lysis buffer
containing 2% sodium dodecyl sulfate, 0,8
Our objective in this study was to describe the
mg/ml proteinase K and 200 mM EDTA pH
diversity and constructing the phylogeny tree of
8,0. The lysis process was done by incubation
bacterial community inhabiting one of hot
at 50oC for 30 min. The purification step was
spring at Gedongsongo field of Ungaran
carried out by adding 200 µl of
volcano, central Java. The extensive study has
chloroform:isoamil-alcohol (24:1), vortex and
been done to this field according their
centrifugation at 1300 g, 30 second. The upper
geophysical and geochemistry study (Widarto
solution was moved to clean tube. This step
et al, 2003). The hydrothermal system of
was done 3 times. Subsequently, the DNA was
Gedongsongo field consists of some hot-
precipitated by adding 60 µl of 3 M sodium
springs, hot-pools, and steaming ground.
acetate and 1 ml of 96% ethanol (stored at -
However, there has no report according their
20°C). After centrifugation, the DNA pellet
microbial diversity. Aminin et al (2003) has
was dissolved in 10 mM Tris HCl buffer (pH
been isolate and characterize the extracellular
8.0). The DNA pellet was washed with 70%
proteolitic enzyme from thermophilic bacteria
ethanol and finally dissolved in 50 µl of TE
of Gedongsongo hot spring, but has not been
buffer (10 mM Tris HCl [pH 8.0], 1 mM
characterize the species of this thermophile.
EDTA).
2. Experimental
PCR. The amplification of partial 16S rRNA
Description of the WGS2 hot spring and
genes of the domain Bacteria were as
sampling procedure. WGS2 hot spring belong
previously described (Ferris, et al, 1996). One
to Gedongsongo field that located in the
primer (P1) complements a region conserved
southern flank of Ungaran volcano, central Java
among members of the domain Bacteria
(110o20’23,4”E; 07o12’08,5”S; and the altitude
(Escherichia coli positions 1055 to 1070). The
1400m). This hot spring has temperature
other primer (P2) is based on a universally
70,2oC and pH 5,85. The microbial sample was
conserved region (E. coli positions 1392 to
collected on 11 June 2004 from one point (the
1406; and incorporates a 40-base GC clamp).
center) of WGS2 hot spring. The microbial
The primer sequence:
diversity studies were approached using two
methods: cultivation and filtration. The P1: 5’-ATGGCTGTCGTCAGCT-3’
cultivation procedure was carried out using two
P2:5’-CGCCCGCCGCGCCCCGCGCCCG and run with 0.5x TAE buffer (13 TAE is 0.04
GCCCGCCGCCCCCGCCCCACGGGCGGT M Tris base, 0.02 M sodium acetate, and 1.0
GTGTAC-3’. mM EDTA; pH adjusted to 7.4). An Ingeny
Phor U gel electrophoresis unit was used with
The specificity of this primer is imparted by the
glass plates (16 by 18 cm), 1.0-mm spacers,
underlined region. Theoretically, these primers
and 1-cm-wide loading wells. A 15 liter
should amplify a 323-bp section of the 16S
aquarium served as the lower buffer chamber.
rRNA genes of members of the domain
DGGE gels contained a 20 to 60% gradient of
Bacteria, including the highly variable V9
urea and formamide (UF) solution increasing in
region. PCRs were performed by using cloned
the direction of electrophoresis. A 100% UF
Pfu DNA polymerase according to the
solution is defined as 40% (vol/vol) formamide
instructions provided by the manufacturer
plus 7.0 M urea (1, 20). DGGE was conducted
(Promega). PCR products were examined on
at 60oC, firstly at 20V for 10 min and then at a
ethidium bromide-stained agarose gels, and the
constant voltage of 200 V for 5 h.
reaction mixtures yielding products of the
expected size were used for DGGE analysis. Silver Staining. Gel was stained with silver
The temperature cycle for the PCR was 1 min staining method (Bassam, B.J. et al., 1991).
of denaturation at 94oC, 1 min of annealing (see Firstly, gel was fixed using 10% acetic acid for
below), and 3 min of primer extension at 72oC. 2x10 minutes and then rinsed with distilled
An initial denaturation step in which the water for 6 minutes. Subsequently gel was
temperature of the PCR mixture (without the stained for 30 min in 100 ml silver nitrate
polymerase) was raised to 94oC for 5 min and solution containing 0,1 % AgNO3 and 150 µl
then lowered to 80oC for 1 min, at which time formaldehyde/HCHO 37%. After that, gel was
the polymerase was added, was used. During an rinsed for about 10 seconds in distilled water
initial touchdown cycle, the annealing and immediately soaks with the cold (4-10oC)
temperature was lowered from 53 to 43oC in developing solution (100 ml solution
intervals of 18oC per cycle; 20 additional containing 3 % sodium carbonate, 150 µl
annealing cycles were done at 43oC. The final formaldehyde and 20 µl sodium thiosulfate
primer extension was for 10 min. stock solution (10 mg/ml)) for 2 to 5 minutes.
Therefore, the solution is typically replaced
DGGE. All reagents and techniques were as
every few minutes until the desired staining
previously described, except as noted (Ferris, et
intensity is reached. Terminate staining by
al, 1996). Acrylamide gels (8%) were prepared
Fig 1. The location of Gedongsongo field. The hot springs are WGS-1, WGS-2, WGS-3,
WGS-4, and WGS-5 (Widarto, D.S. et al., 2003).
discarding the developing solution and MM1 and MM2 medium, that contain a half
replacing it with 10% acetic acid. recipe of LB medium and NB medium
respectively, and the need of trace element will
3. Result and Discussion
be fulfilled by using the spring water in this
This study focused on the bacterial community
medium. The using of these medium assumed
in a 70,2oC hot spring that named it WGS-2.
that there will a lot enough kinds of
Actually, beside this hot spring, there are
microorganism that growth in.
several hot springs that closed to this spring.
Figure 1 can represent the location of five hot The cells both from cultivation and filtration
springs in Gedongsongo field. are lysed to extracted their chromosomal DNA
for used as a template in amplification of 16S
The community study of bacteria in this hot
rRNA gene. The result is shown in figure 2; all
spring was carried out using cultivation method
of the DNA bands appear in the same size,
and direct analysis through filtration of spring
about 23 kb which prove that these bands
water. According our knowledge,
represent the chromosomal DNA of
microorganisms from the extreme environment
microorganism.
are tending to growth well in a minimal
medium and they need the trace element to Theoretically, the primer pair of P1 and P2
support their metabolism. In this study, we used should amplify a 323-bp section of the 16S
1 2 3 4
23130
1. λ/HindIII
9416
2. GS-F
6557
4361 3. GS-1
4. GS-2
2322
2027
Fig 2. The electrophoresis profiles of chromosomal DNA that were extracted from the cells
of filtration (GS-F); culture MM1 (GS-1), and culture MM2 (GS-2) respectively.
1 2 3 4
1419 1. pUC/HinfI
2. GS-1
517 3. GS-2
396 4. GS-F
214
Fig 3. Amplicon profiles of PCR-amplified 16S rDNA segments. GS-1, GS-2, and GS-F, the
amplicon of PCR product used DNA template from culture of MM1, culture MM2 and
filtration respectively.
GS-F
GS-F
GS-1
GS-2
GS-F
GS-F
GS-1
GS-2
A B
Applied & Environmental Microbiology, Vol. 69, Muyzer, G., 1999, DGGE/TGGE a Method for
No. 5, p. 2893–2898 Identifying Genes from Natural Ecosystems,
Current Opinion in Microbiology 2: 317-322
Fuhrman, J. A., McCallum, K., and Davis, A.A.,
1993. Phylogenetic diversity of subsurface marine Pace, N. R., D. A. Stahl, D. J. Lane, and G. J. Olsen.
microbial communities from the Atlantic and Pacific 1986. The analysis of natural microbial populations
Oceans. Applied & Environmental Microbiology, by ribosomal RNA sequences. Adv. Microb. Ecol.
59:1294–1302. 9:1–55.
Klijn, N., Weerkamp, A. H., and de Vos, W. M., Schmidt, T. M., E. F. DeLong, and N. R. Pace.
1991, Identification of Mesophilic Lactic Acid 1991. Analysis of marine picoplankton community
Bacteria by Using Polymerase Chain Reaction- by 16S rRNA gene cloning and sequencing. J.
Amplified Variable Regions of 16S rRNA and Bacteriol. 173:4371–4378.
Specific DNA Probes, Applied & Environmental
Ueda, K., Ohno, M., Yamamoto, K., Nara, H.,
Microbiology, Vol. 57, No. 11, p. 3390-3393
Mori, Y., Shimada, M., hayashi, M., Oida, H.,
Liesack, W., and E. Stackebrandt. 1992. Occurrence Terashima, Y., Nagata, M., and Beppu, T., 2001,
of novel groups of the domain Bacteria as revealed Distribution and Diversity of Symbiotic
by analysis of genetic material isolated from an Thermophiles, Symbiobacterium thermophilum and
Australian terrestrial environment. J. Bacteriol. Related Bacteria, in Natural Environments, Applied
174:5072–5078. & Environmental Microbiology, Vol. 67, No. 9, p.
3779–3784
Martin, A.P, 2002, Phylogenetic Approaches for
Describing and Comparing the Diversity of Widarto, D.S., Indarto, S., dan Gaffar, E.Z., 2003,
Microbial Communities, Applied & Environmental Hasil Awal Geotermometri Kimia Airpanas
Microbiology , Vol. 68, No. 8, p. 3673–3682 Lapangan Panasbumi Gedongsongo di Lereng
Gunung Ungaran, Jawa Tengah, Buletin Geologi,
Moyer, C.L., Dobbs, F.C., and Karl, D.M., 1995,
Vol. 35, No.2, h.55-73
Phylogenetic Diversity of the Bacterial Community
from a Microbial Mat at an Active, Hydrothermal Woese, C.R., 1987, The Universal Ancestor, Proc.
Vent System, Loihi Seamount, Hawaii, Applied & Natl. Acad. Sci. USA, Vol. 95, pp. 6854–6859.
Environmental Microbiology, Vol. 61, No. 4, p.
1555–1562.
Abstrak
Kajian ini dijalankan untuk menilai kesan suhu dan tekanan terhadap ciri-ciri pengelatinan
tepung beras semasa penggorengan. Cecair penyalut dihasilkan melalui percampuran tepung
beras kepada air dalam nisbah 1:1.2 (tepung:air). Nuget ayam dicelup ke dalam cecair
penyalut dan digoreng pada suhu 150, 165 dan 180°C pada102 kPa (tekanan atmosfera) dan
156 kPa selama 0, 6, 18 dan 30 saat. Salutan sampel gorengan ini seterusnya dianalisis
menggunakan Kalorimeter Pembias Kebedaan (DSC). Parameter yang direkodkan adalah
suhu awal (To) , suhu puncak (Tp) dan suhu akhir (Tp). Darjah pengelatinan sampel turut
dianalisis. Hasil menunjukkan suhu dan tekanan semasa penggorengan tidak memberi kesan
yang signifikan terhadap parameter pengelatinan iaitu suhu awal (To), suhu puncak (Tp) dan
suhu akhir (Tp). Walaubagaimanapun, menggunakan suhu yang lebih tinggi semasa
penggorengan (180°C) pada kedua-dua tekanan memberi kesan peningkatan kadar
pengelatinan semasa penggorengan. Oleh kerana tiada perubahan yang signifikan diperolehi
pada semua perlakuan terhadap suhu awal (To) , suhu puncak (Tp) dan suhu akhir (Tp), kesan
suhu penggorengan yang lebih tinggi dalam peningkatan kadar pengelatinan kemungkinan
besar disebabkan oleh peningkatan kadar pemindahan haba terhadap salutan semasa
penggorengan.
Kata kunci : Pengelatinan, DSC, tepung beras, suhu, tekanan penggorengan.
106
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Salma, M.Y, Maskat, M.Y, Wan Aida, W.M. & Aminah, A.
dalam bentuk buih-buih dan bermigrasi meruap dan dibiarkan mencapai keseimbangan
daripada bahagian dalam makanan ke bahagian dalam baling pengering selama 2 jam pada
permukaan. Kras yang terbentuk di permukaan suhu ambien. Sampel kemudian dipanaskan
luar makanan adalah hasil daripada dehidrasi dari suhu 25°C – 120°C pada kadar 10°C/min.
oleh minyak panas (Aguilera 2001). Proses Satu pan kosong digunakan sebagai kawalan.
inilah yang mungkin dipengaruhi oleh suhu dan Suhu awal (To) , suhu puncak (Tp) dan suhu
tekanan semasa penggorengan yang mungkin akhir (Tp) dan tenaga endotermik (∆H) dicatat.
memberi kesan terhadap proses pengelatinan.
Analisis Statistik
Maka, objektif kajian ini dilakukan adalah Data yang diperolehi dianalisis menggunakan
untuk menentukan kesan suhu dan tekanan perisian Statistical Analysis System versi 6.12
terhadap ciri-ciri pengelatinan tepung beras (SAS 1998) menggunakan kaedah analisis
semasa penggorengan. ujian-t. Dalam semua analisis yang dilakukan,
aras keyakinan adalah 95% (p=0.05). Kesemua
2. Percobaan
perlakuan dianalisis secara 3 replikasi.
Penyediaan sampel
Tepung beras (Jenama Erawand, Tiga Gajah 3. Hasil dan Pembahasan
Cho Heng Sdn. Bhd., Pulau Pinang) diperolehi Jadual 1 menunjukkan suhu pengelatinan
daripada Pasaraya Desanika, Bandar Baru tepung beras. Didapati suhu awal pengelatinan
Bangi. Tepung tersebut dicampurkan dengan tepung beras bagi setiap suhu dan tekanan
air pada nisbah 1:1.2 (tepung:air). Nuget ayam semasa penggorengan adalah 78 - 79°C.
dicelup kepada cecair penyalut dan digoreng
Suhu puncak pengelatinan turut mencatatkan
pada suhu 150, 165 dan 180°C, di bawah
bacaan yang hampir sama iaitu dalam julat 81 -
tekanan atmosfera (102 kPa) dan 156 kPa
82°C bagi setiap perlakuan penggorengan,
selama 0, 6, 18 dan 30 saat. Salutan sampel
manakala suhu akhir pengelatinan adalah 85 -
gorengan itu kemudiannya dipisahkan dan
86°C. Suhu puncak pengelatinan salutan beras
dikeringkan menggunakan pengering sejuk-
didapati berada dalam julat yang sama seperti
beku selama 15 jam. Sampel itu dinyahlemak
yang dilaporkan oleh St-Pierre et al. (1997)
menggunakan Kaedah Ekstraksi Soxhlet
iaitu sekitar 60 - 100°C. Ini menunjukkan
(AOAC 1990) selama 2 jam dengan
bahawa, walaupun dikenakan suhu dan tekanan
menggunakan heksana sebagai pelarut.
berbeza, tepung beras tetap mengelatin pada
Kalorimeter Pembias Kebedaan (DSC) julat suhu yang sama mengikut sumber dan
Suhu pengelatinan dan perubahan entalpi ciri-cirinya. Hasil turut menunjukkan suhu dan
diukur menggunakan alat Mettler-Toledo DSC tekanan semasa penggorengan tidak memberi
822e. Perisian STARe digunakan untuk menilai kesan signifikan terhadap suhu awal, suhu
termogram DSC yang diperolehi. Sebanyak 5 puncak dan suhu akhir pengelatinan (Jadual 1).
mg sampel digunakan untuk setiap ujikaji dan
Berdasarkan Rajah 1, diperhatikan dengan jelas
diletakkan dalam pan aluminium. Pan tersebut
bahawa dengan menggunakan suhu
dipaterikan secara hermetik dengan
penggorengan yang lebih tinggi (180°C),
menggunakan aksesori bagi sampel mudah
JADUAL 1. Suhu Pengelatinan Bagi Salutan Tepung Beras Yang Digoreng Pada Suhu dan Tekanan Yang
Berbeza Pada Saat ke-30 Penggorengan.
100
Darjah Pengelatinan (%)
80
60
40
20
0
0 6 12 18 24 30
Masa Penggorengan (saat)
(a)
100
Darjah Pengelatinan (%)
80
60
40
20
0
0 6 12 18 24 30
Masa Penggorengan (saat)
(b)
RAJAH 1.Darjah Pengelatinan Salutan Beras Semasa Penggorengan Pada Suhu Berbeza Dengan Tekanan
Penggorengan a)102 kPa dan b) 156 kPa
samada dengan tekanan 102 atau 156 kPa, besar bergantung kepada kenaikan kadar aliran
kedua-duanya menyebabkan peningkatan yang haba yang berlaku kepada salutan tepung beras
konsisten terhadap darjah pengelatinan salutan semasa penggorengan.
beras. Tren ini dapat dilihat seawal saat ke-6
5. Ucapan Terimakasih
penggorengan dan berterusan hingga saat ke-30
Pengarang ingin merakamkan terima kasih
penggorengan. Hasil yang sama dapat
kepada Kementerian Sains, Teknologi dan
diperhatikan oleh Lin 1997 yang mengkaji
Inovasi di atas bantuan kewangan untuk
tentang kesan suhu, di mana penurunan suhu
kajilidikan ini di bawah peruntukan IRPA 03-
doh menghasilkan darjah pengelatinan yang
02-02-0059-EA119.
lebih rendah semasa proses mengeringkan
makanan haiwan. Walaubagaimanapun, kesan 6. Daftar Pustaka
tekanan didapati kurang signifikan terhadap A.O.A.C. 1990. Official Method of analysis.
darjah pengelatinan. Kajian ini turut 15th edition. Washington, DC: Association of
menunjukkan bahawa, walaupun selepas 30 Official Analytical Chemists. USA.
saat penggorengan, salutan beras masih belum Aguilera, J. M., Cadoche, L., Lopez, C.,
tergelatin 100%. Gutierrez, G. 2001. Microstructural changes of
4. Kesimpulan potato cells and starch granules heated in oil.
Oleh kerana tiada perubahan signifikan berlaku Food Research International. 34: 939-947.
terhadap suhu awal, puncak dan akhir Hoseney R. C. 1984. Differential Scanning
pengelatinan pada semua perlakuan, kesan suhu Calorimetry of Starch. Journalof Food Quality.
penggorengan yang lebih tinggi dalam 6: 169-182.
meningkatkan kadar pengelatinan kemungkinan
Abstrak
Cerium (IV) berhasil dipisahkan dari mineral monasit dalam dua tahap proses membran cair
berpendukung (supported liquid membrane, SLM). Pada SLM tahap pertama logam-logam
tanah jarang (LTJ) dipisahkan secara simultan dari larutan hasil leaching mineral monasit.
Pada SLM tahap kedua cerium dipisahkan dari fasa penerima SLM pertama dengan terlebih
dahulu dioksidasi menjadi Ce(IV). Larutan carrier yang digunakan pada penelitian ini
merupakan campuran TBP dan D2EHPA dengan perbandingan (0,25:0,75) M dalam kerosen.
Selanjunya larutan carrier tersebut diamobilkan pada membran PTFE dengan ukuran pori
0,5 µm, dan sebagai fasa penerima digunakan larutan HCl . Pada penelitian ini oksidasi
Ce(III) menjadi Ce(IV) dilakukan dengan menggunakan campuran HClO4 dalam suasana
HCl. Pada kondisi tersebut jumlah Ce(IV) yang ditranspor ke fasa penerima sangat sedikit
dibandingkan dengan ion LTJ (III) lainnya, ion Ce(IV) tetap tinggal pada fasa penerima
sehingga dengan mudah dapat dipisahkan dari LTJ lainnya. Faktor-faktor yang dipelajari
untuk mengoptimalkan pemisahan Ce(IV) dari ion LTJ(III) adalah : dengan variasi : pH fasa
umpan, konsentrasi total LTJ pada fasa umpan dan konsentrasi HCl pada fasa penerima.
Nilai masing-masing parameter tersebut yang memberikan hasil pemisahan cerium (IV)
terbaik diperoleh pada : pH fasa umpan 3,0 , konsentrasi total LTJ dalam fasa umpan 2000
ppm. Pada kondisi ini kemurnian garam cerium berhasil ditingkatkan dari 54,8 % menjadi
91,8 %. Selain itu dengan meningkatnya konsentrasi asam pada fasa penerima laju transpor
pemisahan cerium (IV) dari ion LTJ(III) lainya juga semakin meningkat.
Kata kunci: cerium, SLM bertingkat, monasit.
1. Pendahuluan tinggi.
Cerium merupakan salah satu logam tanah
Pemisahan dan pemurnian cerium dari monasit
jarang (LTJ) yang memainkan peranan penting
masih sulit dilakukan. Hal ini disebabkan
dalam aplikasi komersial. Cerium banyak
digunakan sebagai bahan oksidator, katalis, karena kelompok LTJ mempunyai sifat-sifat
kimia dan fisika yang mirip. Penelitian dan
batu pematik api, polishing presisi tinggi,
pengembangan teknik ekstraksi dan pemisahan
pewarna gelas, keramik dan cat. Salah satu
mineral utama cerium adalah monasit (Ln,Th LTJ masih perlu dilakukan mengingat sampai
saat ini belum ada metode pemisahan yang
(PO4)) yang banyak terdapat di sekitar
kepulauan Bangka, Belitung dan Singkep. benar-benar handal untuk unsur-unsur tersebut.
Monasit saat ini diperoleh sebagai hasil Masalah ini memerlukan perhatian yang serius
samping pada pengolahan timah. Agar karena kebutuhan terhadap LTJ antara lain
monasit menjadi bahan yang bernilai ekonomis cerium terus meningkat baik dalam jumlah
maupun kualitasnya. Salah satu teknik
tinggi maka perlu diolah lebih lanjut agar
pemisahan yang berkembang saat ini adalah
menjadi bahan yang bernilai ekonomis
Departement of ChemistryProceeding
ITB, Jl. Ganesha 10, 6
Bandung 40132,Joint
PhoneSeminar
: +62 (22)on2502103 ext 101,
110
th
of The ITB-UKM Chemistry
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Aminudin Sulaeman, Buchari dan Ummy Mardiana
pemisahan dengan teknik membran cair dahulu dibuat kompleks berwarna dengan
berpendukung (supported liquid membrane, alizarin sulfonat pada pH 4,5. Bahan-bahan
SLM). Teknik ini dikembangkan dari teknik kimia lain yang digunakan dalam penelitian ini,
ekstraksi pelarut, yaitu dengan mengamobilkan semuanya berkualifikasi p.a. kecuali jika
zat pengekstraksi (carrier) pada suatu membran disebutkan lain. Peralalan eksperimen dalam
polimer berpori, dengan cara ini selain penelitian ini terdiri dari gabungan 2 sel,
selektifitas transpor menjadi meningkat, juga dintara kedua sel ini diberi lubang dengan
jumlah pengekstraksi yang diperlukan menjadi diameter 3,4 cm, pada bagian lubang inilah
sangat sedikit ( kurang dari 1 % dari yang membran pendukung ditempatkan. Luas
diperlukan pada ekstrasi pelarut biasa. permukaan membran pendukung = 9,1 cm2 .
Konsentrasi ion logam sebagai fungsi waktu
Dalam penelitian ini, pemisahan cerium dengan
ditentukan dengan mengukur absorban sampel
teknik SLM, menggunakan carrier camputran
yang diambil dari larutan fasa umpan atau fasa
Tributthyl phosphate (TBP) dan asam di(2-
penerima, untuk LTJ tunggal dilakukan dengan
ethylhexyl)phosphate (D2EHPA). Sebagai
spektrofotometer pada 535 nm setelah dibuat
membran pendukung digunakan mebran
kompleks berwarna dengan indikator alizarin
polytetrafluoroethylene (PTFE) berpori. Pada
sulfonat pada pH 4.5. sedangkan untuk LTJ
SLM tahap pertama LTJ dipisahkan dari
campuran dilakukan dengan menggunakan
unsur-unsur non LTJ, kemudian larutan LTJ
ICP-AES Merck Shimadzu AS-6.
yang diperoleh dari fasa penerima SLM-1
Reproducibilitas percobaan dicek dengan
tersebut dioksidasi dengan asam perklorat.
mengambil rata-rata hasil eksperimen dari dua
Pada SLM tahap kedua, Ce(IV) dipisahkan dari
kali pengulangan.
LTJ lainnya. Cerium dengan bilangan oksidasi
+4 mempunyai sifat yang berbeda dengan ion a. Penyiapan SLM
lantanida (III) yang lainnya, antara lain dalam Larutan pengemban campuran dibuat dari
hal kemampuanya pada pembentukan senyawa campuran D2EHPA dan TBP dalam pelarut
kompleks dengan suatu ligan. Hal ini membuka kerosen. Mebran cair berpendukung disiapkan
peluang untuk dapat memisahkan Ce(IV) dari dengan cara merendam membran plat-sheet
Ln(III) lainnya. Dalam penelitian ini akan FTFE berpori pada carrier campuran,
diteliti pengaruh dari variasi pH fasa umpan. kemudian kelebihan larutan pengemban yang
konsetrasi total LTJ pada fasa umpan dan menempel pada membran pendukung
konsentrasi HCl pada fasa penerima, terhadap dihilangkan dengan mengguanakan kertas
pemisahan dan kemurnian produk Ce(IV) yang saring. Jumlah total larutan pengemban yang di
dihasilkan. tertahan pada fasa membran sekitar 0,25 ml,
dengan volume fasa umpan dan fasa penerima
2. Percobaan
masing-masing 100 mL.
Bahan dan peralatan
Larutan carrier menggunakan campuran b. Pelindian monasit
D2EHPA (di-(2-ethylhexyl) phosphoric acid) Sejumlah g monasit yang telah dihaluskan
dan TBP (tri-butyl phosphate) dari Aldrich sampai lolos ayakan 100 mesh dicampur
Chemicals Co, USA, dalam pelarut kerosen. dengan NaOH dengan perbandingan massa 1 :
Larutan carrier dengan komposisi tertentu 1, kemudian dimasukkan ke dalam suatu bom-
diamobilkan pada membran pendukung PTFE teflon, setelah ditutup rapat kemudian bom-
berpori.. Membran pendukung tersebut teflon tersebut disimpan dalam open dengan
selanjutnya digunakan untuk memisahkan suhu 200oC selama 2 jam. Setelah dingin
antara fasa umpan dan fasa penerima. kemudian dilarutkan dalam 200 mL air
Perbandingan komposisi D2EHPA dan TBP kemudian disaring. Filtratnya ditampung dalam
yang digunakan adalah (0,25 : 0,75) M. labu takar 1 L, dan diasamkan dengan HCl
Larutan logam disiapkan dengan melarutkan sampai pH=3, endapan yang terbentuk
sejumlah lantanida oksida dalam asam klorida, kemudian disaring dan filtratnya dijadikan
kelebihan asam dihilangkan dengan cara sebagai larutan fasa umpan SLM-1.
diuapkan. kemudian dilarutkan dalam labu
takar 250 mL dan ditepatkan dengan air
destilasi. Kandungkan ion logam dalam larutan
ditentukan secara spektrometri setelah terlebih
0.965
yang dikehendaki. Larutan produk diperoleh 0.960
dari fasa umpan seletah proses dijalankan 0.955
dengan ICP-AES.
70 90 110 130 150 170
Temperatur(oC)
0.97
0.96 ion LTJ yang dipelajari sifat transpornya
0.95 melaui SLM, yang banyak dipengaruhi
0.94 perubahan pH fasa umpan adalah La(III).
0.93 Tetapi yang dicari dalam penelitian ini adalah
0.92 mendapatkan pH fasa umpan yang memberikan
0.91 transpor minimum untuk ion Ce(IV) dan
0 20 40 60 transpor maksimum untuk ion-ion LTJ(III)
w aktu (m enit)
lainnya. Dan gambar 3 jelas kondisi tersebut
diperoleh pada pH larutan umpan =3. Untuk
lebih jelasnya dapat dilihat pada gambar 4.
Gambar 2 Pengaruh waktu oksidasi Pada gambar 4 ditunjukkan pola transpor ion
terhadap jumlah fraksi Ce(IV) yang Ce(IV), La(III), Nd(III), Gd(III) dan Lu(III)
terbentuk melalui SLM pada pH larutan umpan =3.
informasi kondisi oksidasi Ce(III) → Ce(IV) Pada gambar 4. ditunjukkan bahwa Ce(IV)
dicapai pada temperature proses 140oC dan tidak ditranspor. Seangkan dari gambar tampak
dalam waktu 20 menit. sedikit ada yang ditraspor, hal itu disebabkan
oleh adanya ion Ce(IV yang berubah menjadi
b. Pengaruh pH terhadap laju transpor ion ion Ce(III), disisi lain ion LTJ(III) lainnya
Ce(IV), La(III), Nd(III), Gd(III) dan Lu(III) ditranspor ke fasa penerima dengan kecepatan
melalui SLM transpor yang hampir sama. Berdasarkan hasil
Pengaruh variasi pH fasa umpan terhadap eksperimen tersebut, dibuktikan bahwa dengan
transpor ion Ce(IV), La(III), Nd(III), Gd(III) teknik SLM ini, ion Ce(IV) dapat dipisahkan
dan Lu(III) melalui SLM dipelajari dari pH 2 - ion LTJ(III) lainnya.
4, pemilihan rentang pH ini didasarkan pada
data- c. Pengaruh konsentrasi HCl dalam fasa
penerima terhadap transpor ion Ce(IV),
Penelitian sebelumnya bahwa pada pH La(III), Nd(III), Gd(III) dan Lu(III) melalui
dibawah 2 dan di atas pH 4 transpor LTJ SLM
melalui SLM tidak begitu baik. Gambar 3 Pengaruh variasi konsentrasi HCl dalam fasa
0.9
0.8
0.7
0.6
0.5
C/Co
0.4
0.3
0.2
0.1
0
2 2.2 2.4 2.6 2.8 3 3.2 3.4 3.6 3.8 4
pH Lart. Um pan
Ce(IV) La(III) Nd(III) Gd(III) Lu(III)
Gambar 3. Pengaruh pH fasa umpan terhap fraksi ion Ce(IV), La(III), Nd(III), Gd(III)
dan Lu(III) yang tertahan pada fasa penerima setelah diproses dengan SLM selama
300 menit, dengan konsentrasi HCl pada fasa penerima 0.5 M.
1
0.9
0.8
0.7
0.6
C/Co
0.5
0.4
0.3
0.2
0.1
0
0 60 120 180 240 300
Waktu (menit)
Ce(IV) La(III) Nd(III) Gd(III) Lu(III)
Gambar 4 Pola transpor ion Ce(IV), La(III), Nd(III), Gd(III) dan Lu(III)
melalui SLM, pada pH fasa umpan =3.
0.9
0.8
0.7 Ce(IV)
La(III)
0.6
Nd(III)
C/Co
0.5 Gd(III)
Lu(III)
0.4
0.3
0.2
0.1
0
0 0.5 1 1.5 2 2.5 3
Molaritas HCl pada fasa penerim a, M
Gambar 5. Pengaruh konsentrasi HCl pada fasa penerima terhap fraksi ion Ce(IV),
La(III), Nd(III), Gd(III) dan Lu(III) yang tertahan pada fasa umpan setelah diproses
dengan SLM selama 300 menit, dengan pH fasa umpan =3
penerima terhadap transpor ion Ce(IV), Pada gambar 5. ditunjukan bahwa, dengan
La(III), Nd(III), Gd(III) dan Lu(III) melalui semakin bertambahnya konsentrasi HCl dalam
SL. Konsntrasi HCl dalam fasa penerima fasa penerima, jumlah ion LTJ yang ditranspor
divariasi dari mulai konsentrasi 0,5 M – 3 juga meningkat, hal ini terutama disebabkan
M . Gambar 5. menunjukkan pengaruh oleh adanya peningkatan gradient pH sebagai
variasi konsentrasi HCl terhadap fraksi pendorong transpor dan bertambahnya daya
konsentrasi masing-masing LTJ yang terima fasa penerima terhadap ion-ion tanah
dipelajari dalam fasa umpan. jarang yang tertranspor. Hal ini sebenarnya
tidak berpengaruh terhadap kecepatan tranpor
0.9
Ce(IV)
0.8
La(III)
0.7
Nd(III)
0.6
Gd(III)
C/Co
0.5 Lu(III)
0.4
0.3
0.2
0.1
0
20 30 40 50 60 70 80 90 100
Gambar 6. Pengaruh konsentrasi LTJ pada fasa umpan terhap fraksi ion Ce(IV), La(III), Nd(III),
Gd(III) dan Lu(III) yang tertahan pada fasa umpan setelah diproses dengan SLM selama 300 menit,
dengan pH fasa umpan =3 dan konsentrasi HCl pada fasa penerima 3 M.
100%
91.85 91.41
80%
32.51 81.7 79.2
Lu
60%
Gd
54.8 Nd
40% La
Ce
20%
0%
Asal 25 mL 50 mL 75 mL 90 mL
Gambar 7. Pengaruh volume pemipetan ( Konsentrasi LTJ) dalam fasa umpan terhadap % komposisi
LTJ dalam fasa umpan (produk) setelah diproses dengan SLM selama 300 menit, dengan pH fasa
umpan =3 dan konsentrasi HCl pada fasa penerima 3 M
ion Ce(IV), karena pada kondisi ini ion Ce(IV) La(III), Nd(III), Gd(III) dan Lu(III)
tidak bisa membentuk kompleks dengan melalui SLM
carrier, sehingga tetap tidak ditranspor. Namun Dari informasi tentang pengaruh variasi
demikian fenomena tersebut justru akan konsentrasi HCl dalam fasa penerima terhadap
meningkatkan kemurnian dari Ce(IV) yang transpor ion LTJ melalui SLM. Maka untuk
diperoleh. meningkatkan efisiensi proses, penelitian
selanjutnya difokuskan pada konsentrasi LJT
d. Pengaruh konsentrasi LTJ dalam fasa
maksimum berapa dalam fasa umpan yang
umpan terhadap transpor ion Ce(IV),
dapat memberikan kemurnian Ce(IV)
tertinggi?. Komposisi ion LTJ dalam fasa Pada gambar 7. ditujukkan bahwa, pada
penerima SLM-1 (larutan induk fasa umpan volume pemipetan 25 dan 50 mL larutan induk
SLM-2) adalah sebagai berikut : Ce(III) 2135 3897 ppm) dalam satu kali proses SLM-2
ppm; La(III) 1267 ppm; Nd(III) 330 ppm; konsentrasi Ce(IV) dapat ditingkatkan dari 54,8
Gd(III) 122 ppm dan Lu(III) 43 ppm dan total = % menjadi 91,85 dan 91,41 %.
3897 ppm. Variasi konsentrasi LTJ dalam fasa
umpan dilakukan dengan cara memvariasikan
volume larutan induk yang dimasukkan ke fasa 4. Kesimpulan
Teknik SLM dapat digunakan untuk
umpan . variasi volume pemivetan larutan
memisahkan ion LTJ dari ion non-LTJ dalam
induk ke fasa umpan meliputi : 25, 50, 75 dan
90 mL, setelah diatur pH-nya =3 kemudian satu kali proses dengan baik. Dengan teknik ini
ditanda bataskan dengan larutan pH 3 hingga cerium dapat dipisahkan dari ion LTJ lainnya
dengan terlebih dahulu dioksidasi menjadi ion
100 mL. Gambar 6. menunjukkan pengaruh
variasi konsentrasi LTJ dalam fasa umpan Ce(IV). Dalam satu kali tahap proses SLM
terhadap fraksi konsentrasi Ce(IV), La(III), kemurnian ion Ce(IV) dapat ditingkatkan dari
54,8 % menjadi 91,8 %..
Nd(III), Gd(III) dan Lu(III) yang tertahan
dalam fasa umpan.
5. Daftar Pustaka
1. Sulaeman, A.,(2002).Pola Transport pada
Pada gambar 6. tampak bahwa pada volume Ekstraksi dan Pemisahan Unsur Tanah jarang
pemipetan larutan induk 25 mL dan 50 mL dengan Teknik Membran Cair berpendukung
(973 dan 1945 ppm) tidak memberikan Menggunakan Pengemban Campuran Asamdi-(-
pengaruh yang berarti terhadap perubahan etilheksil)fosfat (D2EHPA) dan Tributilfosfat
komposisi LTJ dalam fasa umpan (larutan (TBP), Desertasi Doktor, departemen Kimia,
Institut Teknologi Bandung, 2002
produk). Ttetapi pada volume pemipetan
larutan induk yang lebih besar (75 dan 90 mL) 2. Kopunec, R.and Benitiz, JC.,(1991)
mulai terlihat adanya penurunan % Ce(IV) Extraction of Rare Earth Elements with
dalam larutan produk. Hal ini terjadi Organophosphorus Extractants as carrier in
disebabkan oleh adanya keterbatasan daya Supported Liquid Membranes, J of
Radioanalytical and Nuclear Chemistry, 150(2),
terima dari fasa penerima. Berdasarkan data
269-280.
tersebut diperoleh imformasi bahwa
konsentrasi masimum LTJ dalam fasa umpan 3. Gaiwad, A.G., (2003), Synergic Transport
untuk konsentrasi asam dalam fasa penerima 3 of Yttrium Metal Ions Through Supported
M adalah sekitar 2000 ppm. Liquid Membrane, Chem. Biochem. Eng. Q., 17
(4) 327–334.
Kajian Kehadiran Platinum, Palladium dan Rhodium Dalam Sampel Debu Jalan
dan Rumput Menggunakan Teknik Spektrometri Jisim Gandingan Plasma Teraruh
(ICP-MS)
Amran Ab.Majid1, Hidayah Sahar1 , Afzana Anum Ahmad Anuar1 dan Muhamad Samudi
Yasir2
1
Pusat Pengajian Sains Kimia dan Teknologi Makanan,
Fakulti Sains dan Teknologi, Universiti Kebangsaan Malaysia,
43600 Bangi, Selangor Darul Ehsan. Malaysia
email: amran@pkrisc.cc.ukm.my
2
Pusat Pengajian Fizik Gunaan
Fakulti Sains dan Teknologi, Universiti Kebangsaan Malaysia,
43600 Bangi, Selangor Darul Ehsan.Malaysia
email: msyasir@pkrisc.cc.ukm.my
Abstrak
Tiga unsur kumpulan logam platinum (PGE), Pt, Pd dan Rh merupakan unsur yang paling
sukar ditemui dalam kerak bumi dan juga dalam sampel alam sekitar. Peningkatan
penggunaan penukar bermangkin dalam kenderaan bermotor telah menyebabkan semakin
bertambahnya unsur kumpulan platinum dalam alam sekitar. Kajian kehadiran unsur PGE
dalam sampel debu jalan dan rumput dibeberapa lokasi sekitar Lembah Kelang/ Kuala
Lumpur dan UKM/ Bandar Baru Bangi telah dijalankan menggunakan teknik spektrometri
jisim gandingan plasma teraruh (ICP-MS) dan spektrometri serapan optik gandingan plasma
teraruh (ICP-OES). Pemilihan kawasan kajian dibuat berdasarkan perbezaan ketumpatan
trafik kerana kehadiran unsur PGE dijangka berkait rapat dengan ketumpatan trafik dilokasi
kajian. Keputusan kajian menunjukkan logam Pt didapati hadir pada semua lokasi
persampelan bagi kedua-dua sampel debu jalan dan rumput di sekitar UKM dan Bandar Baru
Bangi. Julat kepekatan logam Pt dalam sampel debu jalan di antara 1.2 hingga 116.3 ppb (ng
g-1), manakala bagi sampel rumput, julat kepekatan Pt adalah 2.5 hingga 102.5 ppb. Bagi
Rh, kepekatan yang dapat dikesan di dalam sampel debu jalan adalah 1.8 hingga 171.4 ppb,
manakala dalam sampel rumput kepekatan Rh adalah 5.0 hingga 33.8 ppb. Bagi lokasi
Lembah Kelang/ Kuala Lumpur pula, Pt hanya ditemui pada tiga lokasi kajian dengan julat
kepekatan 25 – 475 ppb. Manakala bagi unsur Rh semua lokasi kajian menunjukkan
kehadirannya dengan julat kepekatan antara 25 – 125 ppb.Walau bagaimana pun logam Pd
tidak dapat dikesan di dalam kedua-dua sampel debu jalan dan rumput. Analisis lain-lain
unsur dalam sampel kajian terutama yang berkaitan dengan aktiviti automobil akan turut
dibincangkan.
Kata kunci: ICP-MS, Pd, Pt, Rh.
penggunaan unsur ini boleh menyebabkan Perubahan kimia dan fizikal yang berlaku
pencemaran alam sekitar akibat penyerapan dalam sesebuah penukar bermangkin boleh
unsur ini ke dalam tanaman, air serta tanah menyebabkan pemegang dalam penukar
(Moldovan et al. 2001). bermangkin mudah haus. Dengan itu, unsur
PGE yang digunakan di dalam sesebuah
Keberkesanan penukar bermangkin
penukar bermangkin boleh terlepas keluar dan
menukarkan gas berbahaya kepada gas yang
disebarkan ke dalam persekitaran. Unsur ini
lebih mesra alam sehingga 90% telah diperakui
boleh tersebar jauh sehingga ke dalam sistem
di seluruh dunia (Barefoot 1997). Bermula pada
akuatik termasuk sedimen dan boleh
tahun 1970-an, pengunaan penukar bermangkin
memberikan kesan terhadap hidupan akuatik.
telah mula diperkenalkan pada ekzos kenderaan
Ini telah dibuktikan oleh Jarvis et al. 2001, di
di Amerika Syarikat (Ely et al. 2001), diikuti
mana pada tahun 1997, sebanyak 64550 kg Pt
dengan Jerman pada pertengahan 1980-an
digunakan untuk pengeluaran penukar
(Schafer et al. 1999; Zereini et al. 1997).
bermangkin di seluruh dunia, sebanyak 16049
Kemudian ianya mula diperkenalkan pula di
kg daripadanya digunakan di dalam penukar
Eropah pada akhir 1980-an dan bermula pada
bermangkin di Eropah. Dianggarkan hanya 20
Januari 1993, kesemua kereta keluaran terbaru
hingga 30% logam Pt yang dapat dikitar
di Kesatuan Eropah telah dilengkapi dengan
semula. Dalam masa lebih daripada 5 tahun
alat ini bagi mengurangkan perlepasan gas
penggunaan penukar bermangkin, kira-kira
berbahaya ke dalam udara (Jarvis et al. 2001).
70% logam Pt yang terdapat di dalam penukar
Namun begitu, kelengkapan ini masih
bermangkin tersebar keluar ke persekitaran.
mempunyai kekurangan yang tersendiri kerana
Unsur-unsur PGE yang terbebas akan terjerap
kajian terdahulu telah membuktikan bahawa
pada unsur persekitaran, seperti debu jalan,
unsur PGE yang digunakan sebagai mangkin
permukaan tanah, rumput dan juga air; terbebas
boleh terlepas keluar daripada pemegangnya
sama ada secara terus (dari ekzos kenderaan)
(Jarvis et al. 2001; Tuit et al. 2000).
ataupun dengan bantuan agen sekitaran seperti
Penukar bermangkin merupakan suatu alat angin dan air hujan (Jarvis et al. 2001;
pengawal pencemaran yang diletakkan di Moldovan et al. 2001; Schafer et al. 1999;
dalam ekzos kenderaan di mana, ia Barefoot 1997).
mengandungi 0.10% hingga 0.15% (w/w) Pt,
Pelbagai kesan negatif telah dikenalpasti
Pd dan Rh untuk melakukan proses penukaran
sebagai kesan daripada pendedahan secara
bahan pencemar (Ely et al. 2001). Pt, Pd dan
berlebihan terhadap unsur PGE. Antaranya
Rh di dalam penukar bermangkin disalutkan
adalah radang pada kulit, mata, salur
pada suatu struktur yang menyerupai sarang
pernafasan dan salur pencernaan (The National
lebah atau struktur “honey comb” bagi
Research Council 1977). Walau bagaimanapun,
mendapatkan luas permukaan tindak balas yang
kehadiran unsur PGE yang sedikit di dalam
tinggi. Mangkin ini mempercepatkan tindak
persekitaran menyebabkan kurangnya risiko
balas pengoksidaan dan penurunan gas yang
terjadinya kesan negatif sama ada pada
melaluinya dan seterusnya menghasilkan gas
persekitaran mahupun kesihatan (Ravindra et
kurang berbahaya seperti CO2, nitrogen,
al. 2004) Namun begitu, penggunaan unsur
oksigen dan wap air (Brains 2001).
PGE yang semakin tinggi dalam pelbagai
Penukar bermangkin yang biasa digunakan industri seperti barangan perhiasan, perubatan
merupakan penukar bermangkin tiga cara atau dan pergigian dan automobil mampu
“Three-way Catalytic Converter” yang menambahkan kepekatannya di dalam alam
bermaksud tiga bahan pencemar yang menjadi sekitar dan seterusnya mungkin menyebabkan
sasaran penukar bermangkin iaitu molekul pencemaran tidak mustahil untuk berlaku.
karbon monoksida, nitrogen oksida dan
2. Percobaan
hidrokarbon tak terbakar. Penggunaan unsur Rh
Sampel dan Lokasi kajian
sebagai agen penurunan dan unsur Pt dan Pd
Sampel debu jalan diambil dibahu jalan lokasi
sebagai agen pengoksidaan membolehkan
terpilih sekitar Lembah Kelang dan Bandar
penukar bermangkin menukarkan bahan
Baru Bangi menggunakan berus dan penyodok
berbahaya ini kepada molekul karbon dioksida,
plastik. Lokasi persampelan tertumpu kepada
nitrogen dan wap air.
kawasan yang mempunyai ketumpatan trafik
yang tinggi kerana kehadiran unsur PGE kepekatan terendah. Keputusan analisis sampel
dijangkakan berkait rapat dengan ketumpatan debu jalan di lokasi persampelan Lembah
trafik di sesuatu lokasi. Sampel debu jalan yang Kelang/ Kuala Lumpur pula menunjukkan
telah diambil diasingkan mengikut julat saiz kepekatan logam Pt pada julat TDK hingga 475
dan sampel bersaiz ≤ 250 µm sahaja yang ppb manakala kandungan logam Rh pula
dianalisis kandungan unsur PGE. Persampelan berada pada julat TDK hingga 125 ppb (Jadual
bagi rumput juga dijalankan di lokasi yang 2). Logam Pd tidak dapat dikesan pada semua
sama dengan persampelan debu jalan. Sampel sampel manakala logam Pt dan Rh hanya dapat
rumput dibersihkan dengan air suling yang dikesan dalam beberapa sampel sahaja.
banyak untuk membasuh bahan yang mungkin
Pada amnya keputusan kajian awal ini
terlekat pada permukaan daun rumput. Sampel
menunjukkan terdapatnya hubungan antara
kemudiannya dikeringkan menggunakan
kandungan Pt dengan lokasi atau ketumpatan
ketuhar pada suhu 105°C selama sekurang-
trafik kerana kandungan tertinggi yang ditemui
kurangnya 2 hari. Sampel yang telah
dalam kajian ini adalah bagi kawasan Plaza tol
dikeringkan dihancurkan menggunakan
Kajang, Plaza Tol Gombak dan Pos Kawalan
pengisar kering sebelum penghadaman
Genting Highland. Namun bagi Rh kaitan
dilakukan.
antara kepekatan dengan lokasi atau
Penghadaman Sampel ketumpatan kenderaan sukar dilihat kerana
Kedua-dua sampel debu jalan dan rumput terdapat keadaan dimana Rh ditemui tinggi
dihadamkan menggunakan kaedah dilokasi dimana Pt tidak dapat dikesan. Kajian
penghadaman basah menggunakan larutan aqua yang lebih lengkap yang dijalankan di German
regia (HNO3: HCl; 1:3). Larutan aqua regia (Schafer et. al 1999) menunjukkan bahawa
dicampurkan dengan 2 g sampel dan dibiarkan julat kandungan masing-masing Pt, Rh dan Pd
selama sekurang-kurangnya setengah jam bagi dalam sampel debu jalan adalah 112 – 166 ppb,
membolehkan proses penghadaman berlaku. 16.6 – 43.3 ppb dan TDK – 27.2 ppb. Kajian
Campuran larutan seterusnya dipanaskan mereka juga dapat mengaitkan antara
menggunakan kukus air sehingga kering. kepekatan PGE dengan ketumpatan trafik.
Sampel yang telah dihadamkan seterusnya Dalam kajian penentuan PGE di dalam sampel
dicampurkan dengan larutan asid nitrik cair dan debu jalan di kawasan terowong di Poland
dituraskan. Larutan hasil turasan disimpan bagi pula mendapati kandungan Pt merupakan yang
tujuan analisis unsur. Semua kerja-kerja paling tinggi iaitu sebanyak 34.2 hingga 110.9
penghadaman dilakukan di dalam kebuk wasap. ngg-1 manakala kandungan Rh pula sebanyak
6.0 hingga 19.7 ngg-1 (Lesniewska et al. 2004).
Analisis unsur kumpulan platinum (PGE)
Selain ketumpatan trafik, perubahan suhu pada
Analisis unsur PGE dilakukan menggunakan
julat tinggi, kelajuan kenderaan dan usia
kaedah analisis Spektrometri Pancaran Optik
penukar bermangkin juga dilaporkan
Gandingan Plasma Teraruh (ICP-OES –
mempengaruhi jumlah pembebasan unsur PGE
Optima 4300 DV) dan Spektrometri Jisim
daripada penukar bermangkin (Ely et al. 2001).
Gandingan Plasma Teraruh (ICP-MS- ELAN
6000). Selain daripada unsur PGE, unsur lain Keputusan analisis PGE dalam sampel rumput
juga dikenalpasti terutamanya unsur yang bagi kawasan UKM/Bandar Baru Bangi
dijangkakan mempunyai perkaitan dengan ditunjukkan dalam Jadual 3. Kepekatan Pt yang
aktiviti trafik. dapat dikesan berada dalam julat 2.50 hingga
16.30 ppb dengan dua sampel dari kampus
3. Hasil dan Pembahasan
UKM menunjukkan kepekatan tertinggi iaitu
Keputusan analisis unsur PGE dalam sampel
60.0 dan 102.5 ppb, manakala kandungan Rh
debu jalan di UKM/ Bandar Baru Bangi
yang dapat dikesan berada dalam julat
diberikan dalam Jadual 1. Hasil kajian
kepekatan 5.0 hingga 33.8 ppb. Sepertimana
menunjukkan hanya Pt dan Rh yang hadir
dalam sampel debu jalan, Pd juga tidak dapat
dalam sampel debu jalan manakala Pd tidak
dikesan dalam kesemua sampel rumput yang
dapat dikesan dalam kesemua sampel yang
diuji. Keputusan kajian awal ini didapati lebih
dikaji. Julat kepekatan bagi masing-masing Pt
tinggi berbanding kajian yang dijalankan di
dan Rh dalam debu jalan adalah di antara 1.2
USA dimana kandungan masing-masing Pt, Pd
hingga 116.3 ppb dan 1.8 hingga 171.4 ppb
dan Rh dalam sampel rumput di kawasan jalan
dengan kawasan kawalan menunjukkan
Jadual 1. Analisis kepekatan PGE dalam sampel debu jalan UKM/ Bandar Baru Bangi menggunakan ICP-
MS
Jadual 2. Analisis kepekatan PGE dalam sampel debu jalan Lembah Kelang/ Kuala Lumpur menggunakan
ICP-OES
Jadual 3. Analisis kepekatan PGE dalam sampel rumput UKM/ Bandar Baru Bangi menggunakan ICP-MS
Jadual 4. Analisis kepekatan Cu, Ni, Pb dan Zn dalam sampel debu jalan UKM/ Bandar Baru Bangi
menggunakan ICP-MS.
Materials. Environ. Sci. Technol., 1997, 31 : 309- Isopod Asellus Aquaticus, Wat. Res.,2001, 35, :4175
314. – 4183.
Brains, M. 2001. What Is A Catalytic Converter Ravindra, K., Bencs, L. & Grieken, R. V. 2004.
And How Does One Work? (atas talian Platinum group elements in the environment and
their health risk. The Science of the Total
http://auto.howstuffworks.com/question66.htm. (27
Environmen,. 2004, 318 : 1-43.
Jun 2004).
Schafer, J., Eckhardt, J. D., Berner, Z. A. & Stuben,
Ely, J. C., Neal, C. R., Kulpa, C. F., Schneegurt, M.
D. 1999. Time-Dependent Increase of Traffic-
A., Seidler, J. A. & Jain, J. C. 2001. Implication of
Emitted Platinum-Group Elements (PGE) in
Platinum–Group Element Accumulation Along U.S.
Different Environmental Compartments. Environ.
Roads From Catalytic-Converters Attrition,
Sci. Technol., 1999, 33 : 3166-3170.
Environ. Sci. Technol., 2001, 35 : 3816-3822.
The National Research Council. 1977. Platinum-
Jarvis, K. E., Parry, S. J. & Piper, J. M. 2001.
Group Metals. Washington D.C. : National
Temporal and Spatial Studies of Autocatalyst-
Academy of Sciences.
Derived Trace Elements in the Environment.
Environ. Sci. Technol., 2001, 35 : 1031-1036. Tuit, C. B., Ravissa, G. E. & Bothner, M. H. 2000.
Antropogenic Platinum and Palladium in The
Lesniewska, B. A., Godlewska-Zylkiewicz, B.,
Sediments of Boston Harbor. Environ Sci. Technol.,
Bocca, B., Cairni, S., Caroli, S. & Hulanicki, A.
2000, 34 : 927-932.
2004. Platinum, Palladium and Rhodium Content in
Road Dust, Tunnel Dust and Common Grass in Zereini, F., Skerstupp, B., Alt, F., Helmers, E &
Bialystok Area (Poland): A Pilot Study. Science of Urban, H. 1997. Geochemical Behaviour of
Total Environment, 2004, 321 : 93-104 Platinum-Group Elements (PGE) in Particulate
Emissions by Automobile exhaust catalysts:
Moldovan, M., Rauch, S., Gomez, M., Palacios, M.
experimental results and environmental
A. & Morrison, G. M. 2001. Bioaccumulation of
investigations. The Science of the Total
Palladium, Platinum and Rhodium from Urban
Environment,1997, 206 : 137-146.
Particulates and Sediments By the Freshwater
Amril Latif
Abstrak
Asam Lemak Rantai Medium (Medium Chain Fatty Acid) merupakan asam lemak yang sangat
bermanfaat untuk kesehatan, sebagian besar asam lemak ini terkandung dalam minyak kelapa
dalam bentuk trigliserida rantai medium (medium chain triglycerides). Minyak kelapa yang
mengandung medium chain triglycerides (MCT) dapat diekstraksi dari santan, dengan
beberapa metode diantaranya adalah ekstraksi enzimatik (aqueous extraction).
Tujuan penelitian adalah memperoleh enzim yang mampu mengekstraksi santan guna
menghasilkan minyak kelapa dengan kandungan MCT tinggi. Untuk mencapai tujuan
dilakukan optimasi konsentrasi, pH, suhu dan waktu inkubasi terhadap ragi tempe, enzim α-
amilase, papain, dan bromelin dengan medium santan. Kandungan MCT minyak kelapa hasil
ekstraksi, dianalisis kandungan MCT-nya dengan gas kromatografi.
Hasil optimasi konsentrasi menunjukkan jumlah optimum ragi tempe, enzim α-amilase, enzim
papain, dan enzim bromelin masing-masing adalah 1,64 gram; 2,22 gram; 1,20 gram; dan
0,60 gram. Suhu ekstraksi optimum adalah 60 OC kecuali untuk enzim α-amilase 70 OC.
Sedangkan pH medium dapat digunakan pH santan yaitu pH 6. Waktu inkubasi optimum bagi
semua enzim dan ragi adalah 18 jam. Ragi tempe mampu menghasilkan minyak kelapa
dengan rendemen paling tinggi, yaitu sebesar 61,87%; Analisis gas kromatografi
memperlihatkan total kandungan MCT paling tinggi diperoleh dalam minyak hasil ekstraksi
dengan enzim papain, yaitu 57,5%. Sedangkan perolehan MCT secara total rendemen yang
tertinggi dihasilkan oleh ragi tempe, yaitu sebesar 45,6%.
Kata kunci :medium chain triglycerides, ekstraksi enzimatik, minyak kelapa, ragi tempe,
enzim papain.
Departement of ChemistryProceeding
ITB, Jl. Ganesha 10, 6
Bandung 40132,Joint
PhoneSeminar
: +62 (22)on2502103 ext 101,
123
th
of The ITB-UKM Chemistry
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Amril Latif
enzim protease, sellulase dan hemisellulase terdapat pada minyak kelapa hasil ekstraksi
dengan rendemen minyak yang dihasilkan dari keempat enzim dilakukan di Laboratorium
65%, Che Men et al. (1996 ) dengan enzim Kimia Pangan Jurusan Teknologi Pangan dan
protease, sellulase dan α-amilase dengan Gizi, Fakultas Teknologi Pertanian, IPB.
rendemen yang dihasilkan 73%, Christensen& Bahan baku, Bahan kimia, Alat
Olsen (1990) dengan menggunakan enzim Bahan baku yang digunakan dalam penelitian
poligalakturonase,galaktomanase dan SP-249 ini adalah daging kelapa segar, diperoleh dari
(polisakaridase) dengan rendemen minyak yang pasar Prumpung Parung Bogor. Bahan kimia
dihasilkan 81%, dan penggunaan enzim yang digunakan adalah ragi tempe dengan
protease seperti yang dilakukan oleh Siregar merek Raprima diproduksi oleh PT. Aneka
(1987) menggunakan enzim papain 6 ppm Fermentasi Industri Bandung-Indonesia, enzim
menghasilkan minyak dengan rendemen 47,69 papain diperoleh dan diproduksi oleh
%, Tiarawaty (1996) menggunakan enzim Laboratorium Mikrobiologi Pusat Penelitian
bromelin dari buah nanas menghasilkan minyak Kimia LIPI Serpong, enzim bromelin dan
dengan rendemen 22,42%, Jadri (1986) enzim amilase produksi Sigma, serta bahan
menggunakan lumatan daun pepaya kimia lainnya seperti: heksan, HCl, NaOH,
menghasilkan minyak dengan rendemen NaHPO4, NaH2PO4, phenolphtalein, asam
17,9%. asetat glasial, dan asam sulfat. Alat yang
Dalam penelitian ini diaplikasikan ragi tempe, digunakan neraca analitik, sentrifius, labu
enzim α-amilase, papain, dan bromelin dengan Kjedahl, water bath, soklet ekstraksi,
perlakuan meliputi optimasi konsentrasi, pH, spektrofotometri, dan gas kromatografi.
suhu dan waktu inkubasi. Minyak kelapa yang Metode Penelitian
diperoleh dianalisis komposisi dan persentase Pada tahap pendahuluan dilakukan uji bahan
asam lemak rantai mediumnya dengan gas baku (kelapa parut) meliputi: uji kadar air
kromatografi. dengan prosedur analisis A.O.A.C., 1981, kadar
lemak dengan prosedur A.O.A.C., 1981 dan
Tujuan Penelitian kadar protein AOAC, 1984, pada tahap ini
juga dilakukan uji aktivitas enzim terhadap ragi
1. Mendapatkan kondisi optimum ragi tempe, alfa amilase dengan menggunakan
tempe dan 3 jenis enzim, yang meliputi metode Nelson–Somogyi, enzim papain dan
konsentrasi, pH, suhu dan waktu inkubasi bromelin dengan menggunakan metode Berg.
untuk mengekstraksi santan guna Meyer, H.U. dan Grassi, M (1983).
menghasilkan minyak kelapa dengan Tahap kedua merupakan tahap optimasi pada
rendemen tinggi. tahap ini ragi tempe dan enzim yang telah diuji
2. Mengetahui komposisi dan persentase aktivitasnya diaplikasikan pada 200 ml santan,
medium-chain triglycerides yang optimasi pertama adalah optimasi konsentrasi
terkandung dalam minyak kelapa dari pada tahap ini jumlah ragi tempe dan enzim
santan hasil ekstraksi oleh ragi tempe dan yang digunakan disesuaikan dengan jangkauan
3 jenis enzim kerja enzim masing-masing. Jumlah ragi tempe
dan enzim yang digunakan dapat dilihat pada
3. Memperoleh enzim yang mampu tabel 1.
mengekstraksi santan dengan kandungan
medium-chain triglycerides tinggi. Selanjutnya adalah optimasi pH, suhu, dan
waktu inkubasi, pH dikondisikan pada pH 4, 5,
6, dan 7 penkondisian pH didasarkan bahwa
2. Percobaan enzim mempunyai aktivitas maksimum pada
Waktu dan Tempat kisaran pH 4,5 sampai 8,0 (Muchtadi 1992).
Penelitian ini dilaksanakan mulai bulan Mei Suhu dikondisikan 40 OC, 50 OC, 60 OC, dan 70
sampai Desember 2003. Uji aktivitas enzim, O
C penkondisian suhu tersebut didasarkan
optimasi konsentrasi, pH, suhu dan waktu kepada enzim yang mempunyai aktivitas
inkubasi enzim dilakukan di Pusat Penelitian maksimum pada kisaran suhu yang disebut
Kimia LIPI Serpong, sedangkan untuk analisis suhu optimum yang umumnya antara 40 OC
kandungan asam lemak rantai medium yang sampai 70 OC (Muchtadi 1992).Waktu
inkubasi dikondisikan 6 jam, 12 jam, 18 jam sebanyak 1 µl. Alat kromatografi Gas tersebut
dan 24 jam penkondisian waktu inkubasi yang dilengkapi dengan detektor FID, integrator
dimulai dari waktu inkubasi 6 jam karena di Chromatopac C-R6 dan kolom kapiler DB-23
bawah 6 jam berdasarkan pengamatan belum (30 m X 0,25 mm id; J & W Scientific, Folsom,
terbentuk minyak. CA). Suhu injector diatur 250 OC dan suhu
detektornya 260 OC. Suhu awal kolom 140 OC
Tahap ketiga analisis komposisi serta
yang dipertahankan selama 6 menit dengan laju
persentase kandungan asam lemak rantai
kenaikan suhu 30 OC/menit. Suhu akhir kolom
medium yang terkandung pada minyak hasil
diatur 230 OC dan dipertahankan selama 25
perlakuan waktu inkubasi dari ragi tempe, α-
menit. Gas pembawa yang digunakan adalah
amilase, papain maupun oleh bromelin dengan
gas helium dengan tekanan 1 kg/cm2 dan
gas kromatogafi. Pada tahap ini metil ester
detektor FID. Tekanan gas hidrogen dan
asam lemak yang telah dibebaskan dari
tekanan udara diatur sampai 0,5 kg/cm2 .
kandungan air dengan natrium sulfat anhidrat
dan telah dipekatkan dengan gas nitrogen Tahap-tahap yang dilakukan di atas dapat
disuntikan ke alat Kromatografi Gas GC-9AM dilihat pada gambar 1.
Kelapa parut
Ragi tempe Enzim Alfa-Amilase,
Papain, dan Bromelin yang
telah diuji aktivitas enzimnya
Pencampuran
Analisa kadar air, Santan + Enzim
minyak, dan protein
Konst.
Suhu
pH
Waktu
Tabel 3 . Aktivitas enzim dari ragi tempe, "-amilase, papain, dan bromelin.
Aktivitas Enzim
Ragi Tempe "-amilase Papain Bromelin
Protease -* -* 830 U/gr 1697,1 U/gr
Karbohidrase 60,95 U/gr 897,13 U/gr -* -*
" 1,4 glikosida
• Tidak dilakukan.
sehingga dengan demikian dapat ditentukan tersusun dari sejumlah asam amino mempunyai
jumlah ragi dan enzim yang digunakan untuk sifat ionik gugus karbonil dan gugus amino,
optimasi lebih lanjut, yaitu untuk: ragi tempe sifat ionik itu mudah dipengaruhi oleh pH
1,64 gram, enzim α-amilase 2,22 gram, papain (Campbell et al. 2002). Selain itu pH juga
1,20 gram dan enzim bromelin 0,60 gram. dapat menyebabkan daerah katalitik dan
konformasi enzim menjadi berubah. Perubahan
Dari data yang tersaji pada gambar 2 juga dapat
pH juga menyebabkan denaturasi enzim dan
diketahui bahwa ragi tempe walaupun
mengakibatkan hilangnya aktivitas enzim
mempunyai aktivitas terendah dibanding
(Campbell et al. 2002). Untuk itulah dalam
dengan enzim lainnya mampu menghasilkan
penelitian ini optimasi pH dilakukan. Data dari
minyak dengan rendemen tinggi. Hal ini
optimasi pH terlihat pada gambar 3.
dimungkinkan karena ragi tempe mempunyai
jenis kapang Rhizopus oligoporus atau Analisis statistik yang dilakukan terhadap data
Rhizopus oryzae (Srikandi 1989), kapang pada gambar 3 menunjukan bahwa perlakuan
tersebut menghasilkan enzim α-amilase, β- pH 5, pH 6 dan pH 7 tidak menunjukan
amilase, glukoamilase, pektinase, dan lipase perbedaan nyata, hal tersebut karena enzim
(Muchtadi 1992). Enzim β-amilase merupakan mempunyai aktivitas maksimum pada kisaran
enzim yang berkemampuan memutus ikatan β- pH 4,5 sampai 8,0 (Muchtadi 1992). Namun
Ragi
80
60 Amilase
60, 5 ml
65, 5 ml
61, 5 ml
47 5 ml
63 ml
40 Papain
60 ml
51, 5 ml
56, 5 ml
53 ml
48 ml
50 ml
53 ml
50 ml
40 ml
20
Bromeli
0
pH 4 pH 5 pH 6 pH 7
80
Ragi
Volume Minyak
60
75 ml
65 ml
Amilase
62 ml
61,5 ml
63,5 ml
66,5 ml
40
70 ml
55 ml
63 ml
68 ml
67 ml
Papain
69 ml
46 ml
48 ml
47 ml
20
40 ml
Bromelin
0
4040OOC
C 5050OC
OC O
60 OC
60 C O
70 OC
70 C
1,4 glikosida pada polisakarida. Polisakarida demikian karena rendemen minyak yang
merupakan struktur dinding sel daging kelapa diperoleh lebih rendah dibanding dengan
dimana minyak berada, sementara itu enzim perlakuan konsentrasi maka untuk optimasi
yang lain tidak mempunyai kemampuan lebih lanjut perlakuan pH diabaikan dan pH
memutus ikatan β-1,4 glikosida. larutan yang digunakan adalah pH santan
kelapa itu sendiri, yaitu pH 6. Pada pH tersebut
Optimasi pH
ragi tempe dan ketiga enzim lainnya mampu
pH juga berpengaruh pada aktivitas enzim,
beraktivitas dengan baik.
sebagaimana telah diketahui bahwa enzim yang
100
Volume minyak
80 Ragi
85 ml
74, 5 ml
71, 5 ml
83 ml
78 ml
60 Amilase
65, 5 ml
73 ml
61, 5 ml
72 ml
77 ml
67 ml
47, 5 ml
40 Papain
45.5 ml
48 ml
36 ml
39 ml
20 Bromelin
0
6 Jam 12 Jam 18 Jam 24 Jam
Optimasi suhu enzim enzim mulai efektif bekerja setelah 6 jam. Hasil
Reaksi yang dikatalisis oleh enzim juga sensitif perlakuan waktu inkubasi dapat dilihat pada
terhadap suhu, enzim sebagai protein akan gambar 5.
mengalami denaturasi jika suhunya dinaikan di
Analisis statistik terhadap data perlakuan waktu
atas suhu optimalnya (Campbell et al. 2002).
inkubasi untuk ragi tempe, enzim papain, dan
Untuk itu perlu diketahui suhu optimal dari
bromelin menunjukkan bahwa pengaruh
masing-masing enzim yang akan diaplikasikan,
perlakuan waktu inkubasi 18 jam dengan 24
hasil uji terhadap perlakuan suhu enzim
jam tidak berbeda nyata Untuk ragi tempe dan
disajikan dalam gambar 4.
3 jenis enzim waktu inkubasi 24 jam
Analisis statistik terhadap data gambar 4 memberikan rendemen dengan volume minyak
menunjukan perlakuan suhu 50 OC,60 OC, dan yang dihasilkan masing-masing 61,87%;
70 OC untuk ragi tempe, enzim papain, dan 56,77%; 56,05% ; dan 54,23%. Sementara itu
bromelin tidak berbeda nyata kecuali untuk penelitian sebelumnya yang dilakukan oleh
enzim "-amilase. Dari data tersebut juga Bih-King Cheng et al. (2002) dan Christensen
terlihat enzim "-amilase pada suhu 70 OC & Olsen (1990) dengan menggunakan enzim
memberikan hasil tertinggi dibandingkan enzim karbohidrase masing-masing menghasilkan
lainnya. Enzim "-amilase mempunyai berat minyak dengan rendemen 84% dan 81%,
molekul sekitar 50 kD dan setiap molekul sedangkan penggunaan enzim protease seperti
mengandung satu gram atom kalsium, dengan yang dilakukan oleh Siregar (1987) dan
adanya kalsium yang berikatan dengan molekul Tiarawaty (1996) masing-masing menghasilkan
enzim menyebabkan terbentuknya ikatan minyak dengan rendemen 47,69% dan 22,42%.
elektrostatik atau ikatan ionik, ikatan inilah
Dari hasil optimasi konsentrasi, pH, dan waktu
yang menyebabkan enzim tahan terhadap
inkubasi dapat ditentukan bahwa ragi tempe
pengaruh suhu dan pH (Muchtadi 1992)
memberikan rendemen tertinggi diikuti oleh
sehingga lebih kompetitif dibanding enzim
enzim "-amilase. Dengan demikian dapat
lainnya.
ditentukan kondisi optimum dari ragi tempe
Optimasi Waktu Inkubasi dan 3 jenis enzim, yaitu : ragi tempe
Pada perlakuan waktu inkubasi faktor konsentrasi 1,64 gram, pH 6, suhu 60 OC dan
konsentrasi dan suhu diintegrasikan sedangkan waktu inkubasi 18 jam, "-amilase konsentrasi
faktor pH diabaikan dan pH larutan yang 2,22 gram, pH 6, suhu 70 OC dan waktu
digunakan adalah pH santan kelapa itu sendiri, inkubasi 18 jam, papain konsentrasi 1,20 gram,
yaitu pH 6. Pada perlakuan waktu inkubasi pH 6, suhu 60 OC dan waktu inkubasi 18 jam,
diaplikasikan 4 macam perlakuan waktu yaitu 6 bromelin konsentrasi 0,60 gram, pH 6, suhu 60
O
jam, 12 jam, 18 jam, dan 24 jam pertimbangan C dan waktu inkubasi 18 jam.
perlakuan waktu dimulai dari 6 jam karena
Rendemen Minyak yang Dihasilkan
berdasarkan pengamatan langsung ragi maupun
Dari penelitian yang telah dilakukan medium pada minyak kelapa untuk asam lemak
menunjukkan bahwa ragi tempe mampu oktanoat (6 – 9 %), dekanoat ( 6 – 10 %), dan
mengekstrasi santan untuk menghasilkan laurat (46 – 50 %)
minyak dengan rendemen tertinggi dibanding
Dengan demikian hasil ekstraksi menggunakan
enzim lainnya, yaitu 85 ml atau 61,87%. Hal
ragi dan 3 jenis enzim tersebut sedikit lebih
tersebut dapat terjadi karena ragi tempe
rendah bila dibandingkan dengan Bailey (1996)
memiliki jenis kapang Rhizopus oligoporus
akan tetapi peroses ekstraksi dengan
atau Rhizopus oryzae (Srikandi 1989). Kapang
menggunakan solvent n-heksana yang
Rhizopus sp. dalam proses metabolitnya
digunakan Bailey (1996) mempunyai beberapa
menghasilkan enzim α-amilase, β-amilase, keburukan yaitu mudah terbakar, mudah
glukoamilase, pektinase, dan lipase (Muchtadi meledak, sedikit beracun, dan mempunyai
1992), enzim α-amilase, β-amilase, dampak lingkungan yang kurang baik.(Cater et
glukoamilase merupakan enzim pemutus ikatan al. 1974).
glikosida. Menurut penelitian yang telah
dilakukan oleh Balasubramaniam (1976) & Selanjutnya bila ditinjau dari klasifikasi enzim
Saittagaroon (1982) diketahui bahwa 34,38% bahwa enzim papain dan bromelin merupakan
struktur sel daging kelapa segar adalah enzim yang sama-sama kelompok protease
polisakarida yang tersusun atas: galaktomanan sufhidril, enzim bromelin justru menghasilkan
61%, mannan 26%, dan selulosa 13%. MCT paling rendah sementara enzim papain
Polisakarida itu mampu dihidrolisis oleh enzim paling tinggi. Perbedaan itu mungkin dapat
α-amilase, β-amilase, glukoamilase yang dijelaskan berdasarkan struktur enzim bromelin
terdapat pada ragi tempe. yang merupakan glikoprotein yang
mengandung 3 mol manosa, 1 mol fruktosa, 1
Kandungan Asam Lemak mol xylosa, dan 2 mol N – asetil glukosamin
Analisis kandungan Medium Chain (Muchtadi 1992). Enzim bromelin mempunyai
Triglycerides yang ada pada minyak hasil gugus pokok asam amino protein dan gugus
ekstraksi dari ragi tempe dan 3 jenis enzim karbohidrat sebagai gugus prostetik. Adanya
dilakukan dengan menggunakan gas gugus prostetik karbohidrat dalam enzim
kromatografi. Hasil analisis dapat dilihat pada tersebut lebih menampakan ciri bromelin yang
tabel 4. berbeda dengan papain. Bromelin merupakan
Tabel 4 menunjukkan bahwa ekstraksi dengan glikoprotein sedangkan papain tidak demikian,
enzim papain dapat menghasilkan satuan adanya perbedaan tersebut diduga
minyak dengan kandungan MCT lebih tinggi menyebabkan aktifitas enzim berbeda.
dibanding enzim lainnya, yaitu 57,25%. Namun 4. Kesimpulan
bila perhitungan MCT itu didasarkan kepada Jumlah optimum ragi, α-amilase, papain, dan
rendemen minyak hasil optimasi waktu bromelin untuk mengekstraksi minyak dari
inkubasi maka MCT total untuk ragi tempe santan kelapa masing-masing adalah 1,64 gram,
menjadi = 45,60%, "-amilase = 40,83%, 2,22 gram, 1,20 gram, dan 0,60 gram. suhu
papain = 44,08%, dan bromelin = 39,15%. ekstraksi optimum adalah 60 OC kecuali untuk
Sementara itu Bailey (1996) dengan α-amilase 70 OC. sedangkan pH medium dapat
menggunakan pelarut ekstraksi n-heksana digunakan pH santan, yaitu pH 6. Waktu
menyatakan kandungan asam lemak rantai
Tabel 4. Persentase asam lemak rantai medium hasil ekstraksi
Persentase Asam lemak Rantai Medium Ekstraksi
Asam Lemak Rantai Medium
Ragi "-amilase Papain Bromelin
Oktanoat C8H16O2 7,0 7,2 7,55 7,05
Dekanoat C10H20O2 5,0 5,0 5,45 5,8
Laurat C12H24O2 41,65 40,15 44,1 39,7
inkubasi optimum bagi semua enzim dan ragi Bih-King Chen and Levente L. Diosady, 2002.
adalah 18 jam. Rendemen yang dihasilkan dari Enzymatic Aqueous Processing of Coconuts, Int. J.
kombinasi kondisi perlakuan untuk ragi tempe, Appl. Sci. Eng., 2003.1,1. p.55-61.
α-amilase, papain, dan bromelin masing- Brand G. 1990. Medium chain triglycerides. J.
masing sebesar 61,87%; 56,77%; 56,05% ; dan Coconuts Today Special issue.
54,23%. Bruce five, 2000. The Health Benefits of Medium
Berdasarkan analisis kromatografi gas total Chain Fatty Triglycerides. www.coconut-info.com
kandungan medium chain triglycerides 2003
tertinggi diperoleh pada minyak yang Campbell, Neil and Jane B. Reece. 2002. Biology.
diekstraksi dengan enzim papain yaitu sebesar 6th ed. Benjamin Cummings,
57,5%, dengan komposisi asam lemak oktanoat San Fransisco, CA. pp.96-102
7,55%, dekanoat 5,45%, laurat 44,25% diikuti
oleh ragi tempe 53,65% dengan komposisi Cater, C.M., Rhee, K.C., Hangenmaier, R.D., and
asam lemak oktanoat 7,0%, dekanoat 5,0% dan Mattil, K.F.1974. Aqueous extraction-An alternative
laurat 41,6%, "-amilase 52,35%, dengan oilseed milling process. Journal of the American Oil
Chemists Society 51:137-141.
komposisi asam lemak oktanoat 7,2%,
dekanoat 5,0%, laurat 40,15%, dan bromelin Che Man, Y.B., Suhardiyono, Asbi, A.B., Azudin,
52,55% dengan komposisi asam lemak M.N., and Wei, L.S. 1996. Aqueous enzymatic
oktanoat 7,05% dekanoat 5,8%, laurat 39,7%. extraction of coconut oil. Journal of the American
Oil Chemists Society73:683-686
Jumlah medium chain triglycerides yang
Christensen, F.M. and Olsen, H.A.S. 1990. U.S.
diperoleh berdasarkan rendemen dan total
Patent 4, 904,483.
medium chain triglycerides terkandung
dihasilkan dengan menggunakan ragi tempe Dendi,D.A.V. dan W.H.Timmins. 1973.
pada kondisi ekstraksi 1,64 gram, pH 6, suhu Development of Wet Coconut Process Designed To
60 OC, dan waktu inkubasi 18 jam dengan total Extract Protein And Oil From Fresh Coconut.
Tropical Product Institute-Foreign And
medium chain triglycerides terkandung 45,6%.
Commonwealth Office, London.
Enig, Mary G. 1999. Coconut: in Suport of good
SARAN health in the century. http://www.apcc.org.sg/special
Dari aspek aplikasi perlu diteliti efek .htm.
sinergisme dari beberapa enzim dalam
International Union of Biochemistry (UB). 1961.
mengekstraksi minyak dari santan guna Report of the Commission on Enzymes. Oxford:
mengoptimalkan medium chain triglycerides . Pergamon Press
Sedangkan untuk memastikan kemampuan
katalitik dan besar energi aktivasi yang Jadri, A. 1986. Penggunaan papain sebagai
dibutuhkan perlu dikaji lebih lanjut mekanikal pemecah emulsi dalam produksi minyak kelapa.
Skripsi Fakultas Teknologi Pertanian. IPB, Bogor.
kuantum dan mekanikal molekuler dari masing-
masing enzim. MDidea (2004) derrida@vip.163.com
http://www.mdidea.com Exporting Division
5. Daftar Pustaka
AOAC. 1995. Official Methods of Analysis. Anal. Muchtadi, D dkk. 1992. Enzim dalam Industri
Chem. Washington, D.C. Pangan. PAU-IPB, Bogor.
Arif, J. 1991. Mempelajari penggunaan bibit Marks, Dawn B, et al. 1996. Basic Medical
khamir roti secara berulang dalam ekstraksi minyak Biochemistry: A Clinical Aproach. Temple
kelapa. Skripsi. Fakultas Teknologi Pertanian, IPB. University School of Medicine Philadelphia,
Pensylvania
Balasubramaniam, K. 1976. Polysaccharides of the
kernel of maturing and matured coconuts. Journal of Robert C. King and William D. Stansfield, Oxford
Food Science 41: 1370-1373 University Press, New York, New York, 2002
Bailey, A.E. 1996. Industrial Oil and Fat Products. Saittagaroon, S., Kawakishi, S., and Namiki M.
Interscience Publisher Inc. NY. 1983. Characterisation of polysaccharides of copra
meal. J.Sci. Food Agric. 34.855-860.
Berg. Meyer, H.U. dan Grassi. M (1983). Methode
of enzymatic analysis vol.2 Siregar, A.S, S.U. 1987. Pengaruh papain pada
pembuatan minyak kelapa. PAU-UNSRI.
Srikandi, 1989. Mikrobiologi pangan. PAU-IPB, Bromelin. Skripsi. Fakultas Teknologi Pertanian,
Bogor. IPB
Tano-Debrah, K. And Ohta, Y. 1997. Aqueous Thieme, J.G. 1968. Coconut Oil Processing. FAO
extraction of coconut oil by an enzyme assisted Agricultur Development, Rome.
process. Journal of the Science of Food and
Suhartono MT. 1992. Protease. Bogor : IPB PAU
Agriculture 74: 497 – 502.
Bioteknologi
Tiarawaty, R. 1996. Ekstraksi Minyak Kelapa dari
Daging Kelapa Segar dengan Menggunakan Enzim
Abstract
Pesticide biodegradation pathway is now an important subject that should be learned to
assure that the degradation products are save for our environment. The pathway of
glyphosates biodegradation on using E. Coli and Pseudomonas sp bacteria have been studied.
The decreasing of glyphosate concentration was observed continually and the biodegradation
products were monitored by HPLC and GC techniques. The result showed that Pseudomonas
sp work better than E. Coli as biodegrader. Pseudomonas sp accelerated the rate of
glyphosates biodegradation + 15 times faster than natural biodegradation and + 3 times
faster than E. Coli. (glyphosate it self can be degraded naturally with t1/2 100
days).Moreover, glyphosates biodegradation followed sarcosine/glysine pathway, both on
using E. Coli as well as Pseudomonas sp bacteria.
Key word. Pesticides, glyphosate biodegradation, biodegradation pathway, sarcosine,
glysine.
132
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Anna Permanasari, Zackiyah, Hokcu S., Ida I., and Dadan S
(a) (b)
(c)
(d)
61000
51000
Area 41000
with E.Coli
31000
without E.Coli
21000
11000
1000
0 3 6 11 13 15 18
Picture 2. Chromatogram of 18th day biodegradation with pseudomonas sp.
Time(day)
(a)
45000
area
40000
35000
30000
25000
20000
15000
10000
5000
0
3 6 11 13 15 18
time (day)
(b)
(a)
(b)
(c)
C-P lyase enzyme in bacteria would be acted as consumed. By assumption, that pesticides
katalist in breaking the C-P bond to produce biodegradation followed first order of reaction,
sarcosine, and moreover was changed into the half time of biodegradation (t1/2) can be
glysine by sarcosine-oxidase enzyme. measured base on consentration as time
Meanwhile, the third peak in HPLC function, on using equations,
chromatograms would be a side product such as
formaldehyde or AMPA it self, that coudn`t be In
[C]t = −kt
detected by GC. Some references wrote that [C]0
bacteria can degrade organic matters through
some pathways. 0,693
t1/ 2 =
The study about acceleration of glyphosate k
biodegradation showed a good prospect. Both [C]0 is initially concentration, [C]t is
of bacteria accelerated the glyphosate
biodegradation in soil, with the different time concentration on t, and k is constant.
Tabel 2 showed the acceleration of glyphosate Mata Sandoval, Juan, Jefferey Karns, and Alba
biodegradation, with and without bacteria. Torrent (2000), The Influence of Rhamnolipids and
Triton x-100 on the Biodegradation of Three
Based on data above, we concluded that both of Pesticides in Aqueous Phase and Soil Slurry, ARS
Pseudomonas sp and E. Coli bacteria could National Program, Dept. of Agriculture, US.
effectively accelerated the rate of glyphosate
Natawigena, Hidayat (1985), Pestisida dan
biodegradation in soil. Pseudomonas sp could Kegunaannya, Cetakan ke dua, Penerbit CV
degraded 17 times faster than naturally Armiko, Bandung.
biodegradation , and about 3 times faster than
E. Coli. Permanasari, Zackiyah, Fachruroji (2003), Studi
Biodegradasi Herbisida Glifosat dalam limbah
4. Conclusion pabrik menggunakan bakteri Pseudomonas sp,
Glyphosates biodegradation in soil by Laporan Penelitian dana Mandiri, UPI.
Pseudomonas sp and E. Coli have shown high Pettit, Robert E. (1995), Organic Matter, Humus,
efficiency compare with it naturally Humic acid, Fulvic Acid, and Humin: Their
biodegradation. Biodegradation of glyphosate Impportance in Soil Fertility and Plant Health,
by both of bacteria followed sarcosine/glysine Huma Tech. Inc.
pathway and produced the save substances for Rabelitso, T.Komang, Erick Senior, Henk W. Van
environment. Nerseveld (2002), Microbial Aspecs of Attrazine
5. References Degradation in Natural Environtment,
AOAC (Official Methods of Analysis (991.98) Biodegradation, 13: 11-19
(1995), Analysis of Glyphosate and AMPA. Schuette, Jeff (1998), Environmental Fate of
Cox, Caroline (2002), Glyphosate Factsheet, J. of Glyphosate, Environtmental Monitoring and
Pesticides Reform., V.108, No.3 Pesticides Management. Dept. of Pesticides
Regulation, Sacramento
Eberbach, Philip L, Lyle A. Douglass (1991),
Methods For the Determination of Glyphosate and Shimazu, Mark, Ashok Mulchandani, Wilfred Chen
(Aminomethyl) phosphonic Acid in Soil Using (2001), Simultaneous Degradation of
Electron Capture Gas Chromatography, J. Agric. Organophosphorus Pesticides and Para-nitrophenol
Food Chemistry, 39: 1776-1780 by a Genetically Engineered Moraxella sp with
Surface-Expressed Organophosphorus Hydrolase,
Granby, Kit. And Martin Vahl (2001), Investigation Biotechnology ang Bioengineering, Vol. 76, No.4:
of Herbicide Glyphosate and the Plant Growth 318-324
Regulators Chlormequat and Mepiquat in Cereal
Produced in Denmark, Food Additives and Tarumingkeng Rudy C., (2001), Pestisida dan
Contaminants, V.18, No.10 Penggunaannya, UKRIDA Press. 250 p.
http://www. google.com. (26-09-03).
Inskeep, William P., Johnston, and Carl.G.(1999),
Effects of Surfactants on Bioavailability and United State of Environmental Protections Agency
Biodegradation of Contaminant in Soils, National (US-EPA) (1992), Food Used Pesticides Classified
Centre for Environmental Research, Montana State by US-EPA as Potential Carcinogens, Northwest
University Coalition For Alternatives to Pesticides.
Abstrak
Pemekatan dan pemurnian emas hasil pelarutan dengan sianida dapat dilakukan dengan
metode stripping, yaitu emas(I) sianida dalam fasa air diekstraksi ke dalam fasa organik
menggunakan [C16H33(CH3)3N]Br (cetyltrimethylammonium bromide) sebagai pereaksi.
Dalam fasa organik emas(I) sebagai kompleks pasangan ion [C16H33(CH3)3N] +[Au(CN)2].
Stripping dilakukan dengan menambahkan fasa air baru ke dalam fasa organik yang telah
mengandung kompleks pasangan ion di atas. Pada penelitian ini, dipelajari pengaruh pH,
dan pengaruh konsentrasi ion SCN- dalam fasa air. Hasil penelitian menunjukkan bahwa
konsentrasi emas(I) hasil stripping dipengaruhi oleh pH dan konsentrasi SCN-. Kondisi
optimum dicapai pada pH=8 dan konsentrasi SCN- = 4 mM. Pada kondisi tersebut
konsentrasi emas hasil ekstraksi sebesar 209 ppm dari konsentrasi emas awal sebesar 49
ppm.
Kata kunci : emas(I) sianida ; stipping ; cetyltrimethylammonium bromide
75
kembali (ppm)
70
65
60
55
50
2 3 4 5 6 7 8 9 10
pH
3.2. Pengaruh Konsentrasi Ion Tiosianat kondisi tersebut, konsentrasi emas yang
Konsentrasi Emas(I) Hasil Ekstraksi dihasilkan mencapai 209 ppm. Semakin besar
Kembali konsentrasi ion SCN- akan memperbesar
Pada penelitian ini diamati perubahan jumlah [Au(CN)2]- yang tergantikan pada
konsentrasi emas(I) hasil ekstraksi kembali kompleks pasangan ion
+ -
pada konsentrasi tiosianat 0 hingga 40 mM, [C16H33(CH3)3N] .[Au(CN)2] menjadi
untuk konsentrasi CTAB 0,4 mM dan [C16H33(CH3)3N]+.SCN-. Semakin banyak
konsentrasi emas(I) awal 49 ppm. Hasil [Au(CN)2]- tergantikan atau lepas maka
penelitian pengaruh konsentrasi ion tiosianat semakin banyak emas(I) yang terdistribusi ke
disajikan pada Gambar 2. Pada gambar tersebut dalam fasa air. Perbandingan mol CTAB :
dapat dilihat bahwa semakin besar konsentrasi SCN- pada kondisi ini adalah 1: 1.
ion tiosianat dapat meningkatkan konsentrasi
3.3. Pengujian Tingkat Pemekatan
emas(I) hasil ekstraksi kembali. Konsentrasi
Untuk menguji tingkat pemekatan emas(I) hasil
emas(I) hasil ekstraksi kembali diperoleh pada
ekstraksi kembali dilakukan pada berbagai
konsentrasi ion SCN- sebesar 4 mM. Pada
konsentrasi emas(I). Penujian dilakukan pada
Konsentrasi emas hasil ekstraksi
250
200
kembali (ppm)
150
100
50
0
0 1 2 3 4
Konsentrasi ion tiosianat (mM)
Gambar 2. Pengaruh konsentrasi ion tiosianat terhadap konsentrasi emas(I) hasil ekstraksi kembali.
Tabel I. Konsentrasi emas(I) hasil ekstraksi kembali pada konsentrasi emas awal yang berbeda.
Pusat Pengajian Sains Kimia & Teknologi Makanan, Fakulti Sains dan Teknologi,
Universiti Kebangsaan Malaysia, 43600 Bangi Selangor
email: arbaat@yahoo.com and mysukro@pkrisc.cc.ukm.my
Abstract
The sophisticated developments in bio-technology and food industries have made seasonal
fruits available all times. Fruits exported from temperate countries (e.g.: apples and grapes),
can be available at tropical and all places, as if they were grown from local areas, all year
round. What make these fruits fresh, as if they were just plucked from trees, had raised
questions among Americans even though they were concerned about their health. The
dilemma of plant growth regulator, Alar (other names: Butanedioic amino acid mono;
succinic acid; 2,2 dimethylhydrazide; UDMH=unsymmetrical dimethylhydrazine), spray to
delay in ripening fruits, attain better colour, and a firmer texture (particularly on apples),
exploded in 1989. This major environmental and health risk issues created a furor among
Americans considered a national disaster. The concern on the consuming Alar-laden apples,
believed to be the most potent cancer causing substance (carcinogenic), got out of control.
School lunchrooms and school districts in the USA removed apples from their menus. Parents
threw apple products for their children and family down sink drains. Stores pulled apples
from their shelves. Apples sales plummeted. Apple industries (e.g.: Gerber, Heinz, and Beech
Nut) stopped using Alar-treated apples in baby foods, Safeway, Kroger, Grand Union, and
Giant grocery chains stopped stocking apples treated with Alar . Apple growers suffered loses
at hundred of millions of dollars. There had been less news coverage of the fact that studies
after studies had since found that Alar was neither an environmental health problem nor a
cause a panic. To present, there was no mainstream, peer-reviewed research suggested that
trace exposures to Alar, of the sort consumers could expect from eating apples or drinking
apple juice, had caused cancer. After years, however, the fallout from this man-made panic is
still around. Apple growers had never recovered the money they lost. Public remains wary of
man-made chemicals, which ironically, had generated the higher crop yields that helped feed
the world. This issue has also distracted Americans from genuine risks of cancer and the plant
growth regulator (Alar) spray on apples…still lingers as a nighmare…
Keywords: Alar , plant growth regulator, succinic acid, UDMH, carcinogen
Fig 5: McIntosh Fig 6: Cortland Fig 7: Jonathan Fig 8: Red Delicious Fig 9: Granny
Smith
Fig 10: Apples juice Fig 11: Apple custard Fig 12: Tomato sauce Fig 13: Tomato juice
scare spread throughout the country very fast. Studies Related to Alar
The public panicked, parents poured apple Developed in the 1960s, Alar was a means of
juice, apple sauces, apple custard, and other slowing the growth of plants. Its active
apple products down sink drains. School ingredient, daminozide, is a manmade,
systems quickly scrapped apples from their hormonlike chemical. It’s utility lay largely in
menus, supermarkets took them off their its conduciveness to the maturation of red
shelves, and public stopped buying apples. As apples and cherries. It underwent two years of
consequences, apples sales plummeted. Apple carcinogenicity testing on rats before the US
orchard owners and industries lost their Food and Drugs Administration (FDA) make it
businesses around $375 millions. This amount legal for market. Dr Bernard Oser had
has never been recovered (Negin, 1999). The conducted carcinogenicity tests of Alar on rats
broadcast and ban were not the end of the story. and mice for the FDA as early in 1966. After
Apple growers in Washington State filed a libel two years of high-dose feeding, no tumors were
suit against CBS, NRDC and Fenton found in any of the 32 tissues examined. The
Communications, claiming the "scare" had cost manufacturer, Uniroyal Corp., was given the
them $100M. The suit was dismissed in 1994. license to sell Alar in 1968. Alar can hold
Meanwhile, Elizabeth Whelan and her apples longer on the tree, so growers have more
organization, the American Council on Science picking time before the fruit drops, and the
and Health (ACSH), were working to establish apples have more time to develop red bright
a narrative of the episode as a "scare". The deep color. These are the economic and
ACSH claimed that Alar and its breakdown cosmetic advantages (Wargo, 1996).
product UMDH had not been shown to be
carcinogenic, even going so far as to claim that Couple toxicological tests in 1970 showed that
the National Cancer Institute had cleared Alar Alar broke down into UDMH=unsymmetrical
as a carcinogen. Whelan's campaign was so dimethylhydrazine or 1,1─dimethylhydrazine,
effective that today, "Alar scare" is shorthand which might be carcinogenic, a cancer causing
among news media and food industry substance. By 1973, there were some highly
professionals for an irrational, emotional public controversial and purely hypothetical risks
scare based on propaganda rather than facts associated with Alar. Dr Bela Toth, of Eppley
(Arbaat & Maimunah, 2004). Institute for Research in Cancer of the Omaha,
Nebraska, conducted several experiments,
While this growth regulator has been verified found that at several times the (1) “maximum
as a human carcinogen, the amount necessary tolerated dose (MTD)” for males (i.e., in
for it to be dangerous may well be absurdly quantities that might render an intrinsically
high. While the lab tests that prompted the uninjurious substance harmful), a breakdown
scare required an amount of Alar equal to over product of Alar─1,1-unsymmetrical
5000 gallons (20,000 L) of apple juice per day, dimethylhydrazine (UDMH), had caused
Consumers Union ran its own studies and tumors in blood vessels, livers, kidneys, and
estimated the human lifetime cancer risk to be lungs of mice, and (2) at several times the
between 5 to 50 per million (1 case per million MTD, Alar itself had been responsible for a
is the threshold at which the government higher tumor incidence in mice (Smith & Raso,
considers a carcinogen a significant public 1999). This finding was of interest of the
health concern). Needless to say, there is a lot federal regulators because Alar contains about
of room for debate on the issue (as there is with 50 parts per million (ppm) UDMH, mammals
any politicized issue). The so-called Alar scare convert about one percent of Alar to UDMH,
dilemma occurred more than 10 years but is and about five percent of the Alar residue on
still very much in the news. The affair also apples converts to UDMH during processing of
becomes a favourite media symbol for a false apple juice and applesauce. This proof was
alarm. Lets us find out into points of several supported in subsequent study by other
toxicological tests, to find supports whether the evidence completed in 1977 when Dr Toth
chemical of Alar posed dangers or not, found high tumor in mice fed Alar (Rosen,
conducted by several individuals and agencies 1990).
(Arbaat & Maimunah, 2004).
A study conducted in 1973 served as the
toxicological basis for the EPA’s concern over
Alar. The experiment conducted by the NCRI More and more studies were conducted In
supplied UDMH drinking water on rats. Two 1985. The EPA’s Head of Special Review
male and two female rats were treated with a Branch officer, Paul Lapsley, received data
single oral dose of approximately 5 mg/kg from Uniroyal related to the residue of crops
unlabelled daminozide and 96 hours later with and dairy animals for meat. The information
a single 5 mg/kg oral dose of 14C-labelled showed that daminozide was present “at
daminozide (position of 14C label unspecified) significant levels,” The evidence was also
to study the absorption and excretion of demonstrated that daminozide “converted into
daminozide. After 2 days, 69% of the UDMH in human body.” Thus, UDMH was
administered dose had been excreted in the probably 1,000 times more carcinogenic than
faeces, 24% in the urine, and 2.4% expired as the parent compound Alar and washing apples
14
CO2. Daminozide is rapidly excreted and did treated with Alar did not remove either these
not bioaccumulate in rats. Rats sacrificed 2 contaminants (Raloff, 1985).
days after dosing contained an average of
The EPA stated that lifetime exposure to the
0.35% of the administered dose in the brain,
chemical Alar could cause cancer in a large
liver, lung, heart and spleen with the majority
population of human beings. Based upon this
of this residue in the liver. The rats sacrificed 4
and previously studies, the EPA in September
days after dosing contained only 0.03 or 0.12%
1985 planned to ban Alar (carcinogen
of the administered dose in these organs (Ryer,
daminozide) (Raloff, 1985). Again, during
1966). This was disturbing news because Alar
March 1989, the EPA repeatedly said that they
can degrade into UDMH in the human stomach
planned to ban Alar within eighteen months.
when it is heated, for example, in the process of
The reason being that was UDMH (the break
making applesauce and apple juice.
down product of Alar ) is the chemical cousin
More studies in 1978 and 1979 proved UDMH of rocket fuel which forms through heat
to be a potent carcinogen in mice, rats, and processing into sauce or juice. This may also be
hamsters. In 1978 the NCRI published results found in traces of Alar itself which is often
of a carcinogen bioassay of daminozide and sprayed in apple orchards. Furthermore, the
concluded that it was a weak carcinogen. EPA believed that UDMH in apple products
Bioassay is a test of a substance activity in would probably cause cancer of 45 in one
organisms (mice, for example). However, million over a lifetime (Begley & Hager, 1989;
daminozide’s carcinogenicity measurement was Smith & Raso, 1999).
so trivial that the EPA could not use the NCI
The National Food Processors Association
data for quantitative assessment. The
(NFPA) announced in 1986 that Alar or
manufacturer of Alar, Uniroyal, took further
UDMH had been found in 73 samples of
action by sponsoring several other
applesauce and 132 apple juice. Gerber even
daminozide’s carcinogenic bioassay tests to
found Alar in its baby food products. By law,
find more supporting evidences (Smith & Raso,
the EPA should have banned Alar because
1999, p. 2).
cancer causing agents were not permitted in
According to Levendosky (1984) Alar might processed food. However, even several
cause cancer! He added his statement: “Yes, in evidences were found, EPA still legalized Alar
mice! However, if a person is given the to be on the market. EPA finally decided not to
equivalent of 28,000 pounds of apples treated ban Alar but to cut by 50 percent the amount
with Alar…everyday….for the duration of 70 that could legally be contained in apples. That
years, the possibility that he or she gets cancer was the eight recommendation of a member
is high. However, this fact was not EPA scientific committee; seven were who
publicized…if you got full after eating 14,000 paid consultants to the chemical industry.
pounds of apples a day, there was no Others came to their own decisions. The larger
measurable effect with the amount. The bottom producers of baby foods (Heinz, Beech Nut,
line is “Alar is harmful to people” (p. 5-6). In and Heinz) stopped using Alar-treated apple in
1984, the U.S. government’s National their baby foods. The grocery chains (Safeway,
Toxicology Program categorized UDMH as a Kroger, Grand Union, and Giant) announced
“probable human carcinogen” (Montague, that they would not stock apples treated with
1997). Alar. The urge to ban Alar also came from the
American Academy of Pediatrics. Several the risk of eating apple with trace amounts
states, like Maine and Massachussetts, of Alar is “certainly less than the risk of
restricted Alar use immediately. Citizen eating a well-done hamburger” and about
groups, states, and pediatricians were suing the same risk as eating peanut butter
EPA to enforce the law and ban of Alar. The sandwich” (Smith, 1998)..
NRDC released findings in press conference
Additionally, in June 1993 ECO Journal
and a book stating that children received higher
issue, Dr. Michael Gough, a molecular
exposures to chemicals in foods than adults.
biologist and risk-assessment specialist at
This is because they consume more fruits,
the Congressional Office of Technology
particularly apples, applesauce and apple juice,
Assessment said that the NRDC ignore the
and vegetables. They are also more sensitive to
highest proven risks to health, like smoking
many toxins, than are adults. The NRDC study
and fat in diet, and focus their energies on
discussed not just for Alar, but 23 other
risks that are tiny in comparison. It is
chemicals, mostly pesticides in fruits and
designed to attract donations, not to improve
vegetables (Wargo, 1996).
public health” (Smith, 1998).
The acting EPA Administrator was
commenting on the preliminary results of The debate on the Alar dilemma has been going
Uniroyal’s own study of Alar in 1989, stated on and on. Pesticide residue, like Alar, in food
that “There is an inescapable and direct and drinking water has also become a “hot
correlation between exposure to UDMH and button” issue for millions of parents and
the development of life-threatening tumors in consumers. The National Surveys indicated
mice.” The EPA calculated and believed that that 80% of consumers worry about pesticide
UDMH in apple products would cause cancer residues ─ especially on the food they feed
of 45 in one million over a lifetime. The EPA their children. In 1993, a panel convened by the
announced the beginning of a process that National Academy of Science reported the
would result in the ban of Alar, but before it federal allowances for pesticide residues were
could take effect, the manufacturer pulled it too lenient, and that infants and children could
from the market and its registration, or license be harmed by present residue levels that the
for use, soon expired. In 1991 and 1992, EPA government considers “legal.”
reconfirmed its decision that Alar posed an
The Environmental Working Group (EWG)
unacceptable risk as a probable human
(1998) study reported that out of every four
carcinogen. The NCI never issued a report
child age five or under eats a peach or an apple,
clearing Alar as a carcinogen, a serious cancer
he or she is exposed to unsafe level of
risk.
neurotoxic organophosphate (OP) insecticides.
Under the circumstances, it’s not surprising that Thirteen (13%) percent of apples, 7.5% of
a number of health experts have personally pears, and 5% of grapes in the US food supply
stepped forward to criticize the Alar scare. expose the average young child eating these
fruits to unsafe levels. Many of these
In a February 1992 press conference, Dr. C. exposures exceed the federal safety standard by
Everett Koop stated that “As a pediatric factor of 10 or more.”The group added that
surgeon, as well as the national former millions of American children of the above-
Surgeon General, I care deeply about the mentioned ages are at risk every year from
health of children, and if Alar ever posed a ingesting dangerous levels of at least 13
health hazard, I would have said so then different OP pesticide residues in their apples,
would say so now. When used in the applesauce, apple juice, peaches, popcorns,
regulated, approved manner as Alar was corn chips, and other “junk” foods (Cumins,
before it was withdrawn in 1989, Alar- 1999).
treated apple products posed no hazard to
Feeling the heat of consumer concern, the
the health of children or adults” (Smith,
Clinton/Gore administration announced that the
1998).
EPA would be releasing a brochure
Dr. Richard Adamson of the National supermarket to shoppers for that would outline
Cancer Institute informed The Washington precautions regarding “Pesticides on Food.”
Times in March 1992 interview stated that Besides advice on scrubbing, washing, peeling,
and cooking fruits, particularly on apples, and name a few, served as the toxicological basis,
vegetables, the EPA advised consumers stated that Alar broke down into UDMH or
concerning pesticides. Consumers are advised 1,1─dimethyl- hydrazine, might be
to purchase organically grown fruits, carcinogenic. After supplying UDMH in the
vegetables, and other foods (Cumins, 1999). drinking water of samples (rats and mice), there
were found that samples developed several
2. Experimental
kind of cancers (kidney, liver, blood vessels,
The methodology applied for this study
uterine, and blood vessels) (Ryan, 1966; Smith
involved four methods: (1) Reviewing coverage
& Raso, 1999).
in newspapers, journal articles, reports, and
also internet during the explosion of the issue (2) The personnel of Illinois EPA Chicago
of Alar on apples from 1989. The journals and Branch were helpful to provide printed
newspapers reviewed published more than 300 materials and Fact Sheets, containing
articles. In addition to that, the internet listed information related to Alar (Arbaat &
more than 600 sources. There found to be Maimunah, 2004). A report issued by an
“good” and “bad” aspects about this growth environmental advocacy group on February 27,
regulator (Arbaat & Maimunah, 2004). Many 1989, claimed that children face a massive
played the story in the prime news sections, public health problem from pesticide residue in
alerting people to possible problems. Those food. This report found in a 2-year study that
media included a large number of sources and the allowable pesticides in farm produce caused
provided the apple industry a prominent voice. cancer and nerve damage in children. The
More problematic was their concern about the agency charges EPA with failing to take into
Alar stories; (2) Requiring information, printed account the exposure levels of children and
data, and telephone interview from the infants when developing tolerance levels.
Environmental Protection Agency, Chicago Forefront in the public’s eye is the issue of Alar
Branch office; (3) Distributing of opinionnaire- on apples. According to them, effects on
questionnaire survey to the residents of Baptist humans consuming fruits treated with this
Student Center (BSC) of Southern Illinois chemical are unknown. The toxicity studies
University at Carbondale, Illinois, and (4) were conducted using animals because to
Conducting additional opinionnaire-telephone administer such chemical tests to human was
interview to several selected apple orchard illegal. The results, there was no
farmers in Carbondale and Murphysboro, on epidemiological evidence at presents to any
the issues of Alar on apples (Arbaat & effects on humans from consuming apples
Maimunah, 2004). treated with Alar.
The information and data were organized in (3) One-hundred fifty (n=150) questionnaire
such manner to provide the picture about Alar surveys were distributed to the residents of
issue on apples based on the four different BSC, Southern Illinois University at
above-mentioned methodologies. Carbondale, Illinois, USA regarding their
opinion toward the use of Alar. They returned
3. Results and Discussion
the questionnaire surveys in two (2) days. The
Th e results of the issue were categorized data gathered were tabulated and organized.
based on these four factors: The summary of their opinions of Alar on
apples issue are as follow (see Fig 14) (Arbaat
(1) The journals and newspapers reviewed & Maimunah, 2004).
found to be publishing more than 300 articles
pro viding information on facts, results of (a) Almost all of the Baptist Student Center
several toxicological tests, and also public (BSC) residents were uncertain if Alar was
concerned on Alar. The internet had listed a health risk. They wanted more evidences
more than 600 references presenting the same in deciding about the safety of Alar;
factors. Some experiments were conducted by (b) They were uncertain about laboratory
Carson (1964), Oser (1966), Toth (1970, 1973 tests using animals were consistent.
& 1977), the National Cancer Research Furthermore, they said they needed more
Institute (1978 & 1979), Lapsley (1985), and knowledge and convinced data about the
the Environmental Working Group (1998), to certainty in laboratory tests for humans;
from tests should be reliable and convince Environmental Research Foundation. (1989). The
the public stating that the application of Alar rebellion of 1989. Annapolis, MD: Rachel’s
Alar on fruits was definitely dangerous & Health Weekly.
and could cause severe illnesses. www.monitor.net/rachel/r535.html
Therefore, public should not eat apples GNU FDI. (2003). Alar on apples.
and/or its products. www.disinfodeia.org/wiki.phtml? title= Alar
3. The Baptist Student Center residents _and_apples
needed more exposure and knowledge Hawley, G. (Ed.). (1981). Alar. The Condensed
about Alar. Several agencies (the EPA, Chemical Dictionary (10th ed.) New York, NY:
NCRI, ACSH) could play their roles in the Van Nostrand Reinhold Co.
community by organizing and giving JMPR. (1977). Daminozide: pesticide residue in
shows, talks, seminars, workshops, etc. on foods 1977 evaluation.
pesticides residue in foods and fruits that
Levendosky, C. (1984). Scratching the underbelly
they consume everyday were safe from of the Oprah Lawsuit. Casper Star Tribune. 1-14.
chemical, insecticide, pesticide, fungicide,
etc. Levendosky, C. (1998). Scratching the underbelly
of the Oprah Lawsuit. Casper Star Tribune. 1-16.
4. Apple orchard owners needed more
exposure and extra knowledge about Montague, P. (1997). The real story about Alar.
America, the Environment, and the Global
applying the Alar and its effects on their
Economy, 1-14.
crops, like vegetables and fruits,
particularly apples they grow. If found Negin, E. (1999). Ten years later, myth of ‘Alar
that this chemical is really causing more scare’ persists. Columbia Journalism Review, 1-4.
dangers than the benefits, then they can Negin, E. (1989). The Alar scare was for real; and
decide whether or not to use Alar on their so is that “veggie hate-crime” movement. Columbia
orchards. Therefore, they could decide to Journalism Review, 1-5
discontinue using Alar. Raloff, J. (1985, September). EPA planned to ban
carcinogen daminozide. Science News, 128 & 149.
5. Acknowledgments
The writers wish to extend their gratitude to Ms Rosen, J. (Fall 1990). Much ado about Alar. Issues
in Scienca and Technology, 85-90.
“Sweet Pie” Candee Cole of Southern Illinois
University at Carbondale, USA, for the Ryer, F.H. (1966). Final Report: Radiotracer
cooperation and help in jointly gathering data Metabolism Study, Alar -C14. Unpublished report
from various agencies, like the residents of from Hazleton Labs., Inc., submitted to the World
BSC, the EPA Chicago Branch, and apple Health Organization by the United States Rubber
Company.
orchard owners in Carbondale and
Murphysboro during the study. Shabecoff, P. (1989, February 2). Hazard reported
in apple chemical: EPA cites risk of cancer but will
6. References not ban use yet. The New York Times, 138, A1-18
Arbaat & Maimunah. (2004 August). The myth of
Alar scare …on apples? Paper presented at the Smith K. & Raso, J. (1999). Unhappy anniversary:
Annual Fundamental Science Seminar 2004 (AFSS the Alar ‘scare’ ten years later. Washington, DC:
2004) on June 14-15, 2004 in Skudai Ibnu Sina for American Council in Science and Health
Fundamental Science Studies, Universiti Teknologi Smith, K. (1998). Alar five years later. The
Malaysia. Washington Times. American Council on Science
Begley, S & Hager, M. (1989, March 27). A guide and Health.
to the grocery. Newsweek. CXIII (13), 16-19. Wargo, J. (1996). How a public health story
Cumins, R. (1999, February 7). Food safety crisis in becomes an industry legend. Annapolis, MD: Island
the U.S.A. Motion Magazine. Press
Abstract
Utilization of bentonite in wastewater treatment of alcohol industry has been studied. The
research was carried out to identify the effect of natural bentonite to the pollutant correspond
of concentration, contact time and the synergetic effect of flocculants. The characterization of
bentonite before and after contacting with sample was analyzed by SEM, IR and XRD. The
concentration of pollutant in wastewater was measured by spectronic method. The result
showed that the percentages of pollutant have decreased by 94% at 15 g natural bentonit
addition to 50 ml wastewater. The contact time optimum was 15 minutes. The synergetic effect
of superfloc is better than poly aluminum chloride (PAC).
1.2
1
0.8
Abs
0.6
0.4
0.2
0
3500 2500 1500 500
-1
cm
Picture 1. IR Spectrophotometer (a:) initial bentonite, (b:) vinase, and (c:) final bentonite.
(a) (b)
monmorilonite structure was not significant showed that there are some new peaks have
change, as shown at Picture 1, spectrum (a) is appeared and some disappeared. The
initial bentonit and (c) is final bentonit. disappeared peaks correspond to compound
which have been adsorbed by bentonite, at
Spectrum (b) is a vinase, showed that O—H
retention time between 21 to 26 minutes in
vibr was absorbed at 3355,9 cm-1; C==O str of
different intensities. Mean while the new
carboxylic acid at 1624 cm-1; O—H vibr at
appeared peaks were predicted as the rest of
1415,7 cm-1. C—H vibr at CH2—O or CH3—O
used coagulant and formation of new
at 2935,5 cm-1 and 1045,3 cm-1, as primer
compounds.
alcohol, meanwhile secondary alcohol was
absorbed at 1080,1 cm-1, and C—O str Performance Analysis
carboxylic acid was appeared at 1203,5 cm-1. 1. Time of Mixing
Scanning Electron Microscope (SEM) with Intensity of color of the mixture was monitored
3000 X enlargements showed that difference during reaction was going on. The intensity of
between initial bentonite microstructure. color was strongly decreasing up to seven
Picture 2b showed that clumps spread out over minutes reaction. After that it was decreased
the bentonite surface. It is indicated that vinase slowly, as shown at Graphic 1.
has been adsorbed into bentonite surface.
2. Concentration of bentonite
The result analysis of vinase by GCMS showed
The vinase color was decreased depend on
that vinase contains some compounds as
addition of bentonite to the solution. However,
presented at Table 2. The final vinase spectrum
70
60
% Decretion of color
50
40
30
20
(a) (b) (c)
10
0 Picture 3. The difference color of (a) initial
0 5 10 15 20 25 30 vinase, (b) after adding 15 g bentonit, and (c)
after adding 3 x 5 g of bentonite
Mass (gram )
Rodríguez, J. Gómez y O. (2000). Effects of vinasse of vinasse-# 6 fuel oil emulsions. Brazilian Journal
on sugarcane (Saccharum officinarum) productivity. of Chemical Engineering vol. 5. Tersedia:
Rev. Fac. Agron. (LUZ). 17:318-326. [online] http://www.scielo.br/ [19 –10- 2004]
http://www.ldd.go.th [12-10-2004]
Puslitbang Geologi (P3G) Prosedur Pemotretan
Potter, C., M. Soeparwadi, dan aulia Gani. (1994). Scanning Electron Microscope (SEM), JSM-35 C.
Limbah Cair Berbagai Industri di Indonesia. Bandung. Tidak Diterbitkan. (in press)
Sumber, Pengendalian, dan Bahan baku. Project of
Katti, Kalpana dan Katti, Dinesh. (tanpa tahun).
The Ministry of State for The Environment,
Effect Of Clay-Water Interactions On Swelling In
Republic of Indonesia and Dalhousie University,
Montmorillonite Clay. [online]
Canada. Indonesia: Environmental Management
http://www.ce.washington.edu/em03/proceedings/pa
Development in Indonesia.
pers/812.pdf
Cortez, L.A.B. dan Pérez, L.E.B. (1997).
Experiences on vinasse disposal part III: combustion
Abstract
A fungus, Cunninghammela elegans 2A1 was found to be a potential candidate for production
of lipid rich in γ - linolenic acid (GLA). This study was carried to culture the fungus, obtain its
lipid / oil, to analyst the fatty acid composition and to develop preliminary safety assessment
on the extracted lipid by LD50 test. Submerged shaked flask fermentation system with a defined
growth medium was employed to culture the mycelium. Fermentation was carried out for 8
days before harvesting the culture. Mycelia obtained were freeze-dried before its lipid / oil
was extracted using ethanol and hexane. The amount of oil extracted was calculated and, its
fatty acid profile was analyzed using gas chromatography technique. The 8 day culture was
able to produce 0.2g oil / g biomass containing 7.2% GLA in a basal culture medium. The
fungus produced 0.5g oil / g biomass containing 6.34% GLA when 5 ml/L sunflower oil was
added into the basal medium. 2000mg/kg extracted lipid was administered to groups of rats in
LD50 test and neither significant toxic sign nor death observed during the test and this shows
that LD50 dose of Cunninghammela elegans 2A1 extracted lipid is greater than 2000mg/kg.
Key words: polyunsaturated fatty acid, γ - linolenic acid, fungal oil, fermentation, GC (gas
chromatography), LD50
GLA would be the precursor of arachidonic Automated) with a BPX-70 (Supelco Inc. USA)
acid (AA), which is found abundantly in neural column (60 m length X 0.32 µmid). Carrier gas
tissue such as brain and retina. used was helium at a linear velocity of 25 cm/s
Cunninghammela elegans 2A1 fungus was (1.7 ml/min). Split injection with a split ratio of
found to be a potential candidate in production 10:1 was applied. The temperatures of injection
of oil rich in GLA, and also will be use in rich port and FID detector were 250oC and 280oC,
GLA supplement production. Previous study respectively. Column temperature was
shows that toxicity studies on fungus, namely maintained at 200oC (isothermal heating) and
Mortierella alpina, which also an oil rich in nitrogen flow was 0.6 (ml/min). Compounds
GLA producer, has been extensively studied were tentatively identified by comparing the
since its oil has been used in infant milk retention time of Fatty Acid Standards (Supelco
fortification. This paper will represent the LD50 Inc. USA).
test report on this Cunninghammela elegans Acute Study
2A1 oil as a preliminary step to develop safety Acute study was perform by LD50 test.
assessment on this fungal oil. Sprague-Dawley rats of both sexes were
2. Eksperimental obtained from the Medical Faculty of
Fermentation University Kebangsaan Malaysia’s Animal
Pure culture Cunninghammela elegans 2A1 House (Kuala Lumpur). The animals were
fungus was obtained from Department of acclimatized for 2 weeks before any treatment
Microbiology, University Kebangsaan proceeded. All the animals were fasted from
Malaysia, cultured on potato dextrose agar. food but not water 24 hours before treatment.
Control growth culture was made by We expected that this fungal oil would be
inoculating 1 cm2/L of pure culture into 5 liters relatively safe because it was extracted using
of growth medium as describe by Kendrick & very low toxic solvents and was evaporated
Ratledge (1992) contained glucose (50g/L, thoroughly. Thus, a single high dosage, as
separately sterilized) and 1g/L ammonium described by Ryu et al. (2004), of 2000 mg/kg,
tartrate, 7g/L potassium dihydrogen phosphate, was administered by gavages to 10 male and 10
2g/L disodium hydrogen phosphate, 1.5g/L female rats weighing 150 - 200g and water was
magnesium sulphate, 1.5g/L yeast extract, 1 given to 10 male and 10 female as control
ml/L trace elements and 5 ml/L sunflower oil in group. After a single administration, sign of
5 conical flask (2 liter conical flask) with possible toxicity were observed every hour for
continuous shaking in an environ shaker (30oC, the first 6 hours and every day for 14 days.
250rpm) for 8 days. The same method and Statistics
material goes for sunflower oil added culture The results are expressed as means ± standard
by adding in the medium. deviation (S.D.). The data were analyzed by
Lipid extraction Independent-Samples T-test, using SPSS
The fungi were harvested after eight days version 10. Statistical significance was set at
fermentation and freeze dried before undergo the 0.05 levels.
lipid extraction using ethanol-hexane double 3. Result and Discussion
extraction method as described by Certik et al Lipid Production
(1996). Lipid-ethanol containing fraction was Table 1 shows total biomass, total lipid extract,
evaporated before added into hexane-lipid percent lipid yield and GLA weight percentage
containing fraction and evaporated again. of control fermentation and sunflower oil added
Percent lipid yield was calculated before fermentation. For total biomass, there is no
preparing for lipid profile analysis. significant difference between the control
Lipid profile analysis fermentation and sunflower oil added
Lipid samples were converted to their fermentation. Addition of sunflower oil in the
constituent fatty acid methyl ester (FAME) by growth medium significantly increased the lipid
the method of Timms (1978). Routine analysis yield and percent of lipid yield as compared to
of the FAME was carried out using a capillary the control group.
Gas Chromatograph (GC-Agilent 6890 Series
Table 1. Mean total biomass, total lipid extract, percent lipid yield and GLA weight percentage of control
and sunflower oil added fermentation.
* = Significant difference between control & sunflower oil added fermentation, p<0.05
The GLA weight percentage of sunflower oil composition of lipid classes containing γ-linolenic
that was added to the fermentation is 0.03 ± acid ectracted from fungi. JAOCS 73: 357-365.
0.02 percent (n=3) and this figure is nearly Colquhoun A. (2002). Gamma-linolenic acid alter
negligible compared to the control fermentation the composition of mitochondrial membrane
and the sunflower oil added fermentation. subfractions, decreases outer mitochondrial
Statistic analysis shows that there is no membrane binding of hexokinase and alters
significant different on GLA percentage carnitine palmitoyltransferase I properties in the
between control fermentation and sunflower oil Walker 256 rat tumour. Biochemica et Biophysica
added fermentation although there is a slight Acta 1583: 74-84.
different, when the data was observed visually. Hempenius R. A., Van Delft J. M. H., Prinsen M.,
Results suggest that Cunninghammela elegans Lina B. A. R. (1997). Preliminary Safety
2A1 was using the exogenous fatty acids from Assessment of an Arachidonic Acid-enriched Oil
medium by incorporate the fatty acids and derived from Mortierella alpina: Summary of
transform them to longer and more unsaturated Toxicological Data. Food & Chemical Toxicology
35: 573-581.
state.
Hrelia S., Bordoni A., Biagi P., Rossi C. A.,
Acute Toxicity Study Bernardi L., Horrobin D. F., Pession A. (1996).
To establish the safety, LD50 test was Gamma-linolenic Acid Supplementation Can Affect
conducted. 2000mg/kg Cunninghammela Cancer Cell Proliferation via Modification of Fatty
elegans 2A1 fungal oil was administrated to Acid Composition. Biochemical & Biophysical
both sexes of rats. Neither significant toxic Research Communications 225: 441-447
signs nor death was observed during the Kendrick, A & Ratledge, C. (1992). Lipid of
observation period. Therefore, the oral LD50 of selected molds grown for production of n-3 and n-6
Cunninghammela elegans 2A1 fungal oil was polyunsaturated fatty acids. Lipids 27:15-20.
clearly greater than 2000mg/kg in rats.
Ryu S. D., Park C. S., Baek H. M., Baek S. H.,
4. Conclusion Hwang S. Y., Chung W. G. (2004). Anti-diarrheal
Addition of sunflower oil into the fermentation and spasmolytic activities and acute toxicity study
significantly increased the lipid yield and of Soonkijangquebo, a herbal anti-diarrheal formula.
percentage of the lipid yield without Journal of Ethnopharmacology 99: 75-80.
significantly altered the GLA percentage. The Timms, R.E. (1978). Artifact peaks in the
LD50 dose for this fungal oil is clearly greater preparation and gas chromatography determination
than 2000mg/kg in rats. of methyl ester. The Australia J. Of Dairy Tech.:
March 1978: 4-5.
5. References
Certik M., Andrasi P., Sajbidor J. (1996). Effect of
extraction methods on lipid yield and fatty acid
Ashraf Jaradat1, Aziz Deraman1, Sufian Idris1, Laily Din2 & Nizam Said2
1
Fakulti Teknologi Dan Sains Maklumat
Universiti Kebangsaan Malaysia
43600 UKM BANGI, Selangor
Malaysia
2
Fakulti Sains Dan Teknologi
Universiti Kebangsaan Malaysia
43600 UKM BANGI, Selangor
Malaysia
Abstrak
Untuk memenuhi keperluan penyedia maklumat, konsep objek digital (DO) menyediakan satu
penyelesaian untuk menguruskan kompleksiti kepelbagaian jenis bahan dalam perpustakaan
digital. Namun demikian, banyak kerja terdahulu mempunyai kelemahan sebagai berikut:
sistem perpustakaan digital tidak mempunyai sistem pengecaman pengetahuan yang
mencukupi yang boleh dicapai berikutan kekurangan perwakilan komponen DO; sebahagian
pengetahuan diasing dan diabaikan yang pada hakikatnya boleh dihasilkan daripada
dokumen perpustakaan digital; pelaksanaan DO yang lazim hanya menyediakan perwakilan
statik dengan menakrifkan komponennya sebagai dataset. Dalam kertas ini, konsep DO
dikembangkan menjadi kontena teknikal untuk kepelbagaian pengetahuan yang boleh dirujuk
sebagai objek digital informatif (iDO). Konsep iDO ini akan memudahkan mekanisma
pengorganisasian dan perwakilan tradisonal pengarkiban sistem maklumat kepada pangkalan
pengetahuan. Dengan itu, pertanyaan berkaitan dengan pengetahuan iDO boleh dibuat
secara lebih dinamik dan pintar. iDO juga boleh digabungkan dalam repositori utama Sistem
Pengarkiban Pengetahuan Biodiversiti (BioKAS) untuk memudahkan manipulasi maklumat
dan pengetahuan objek digital.
158
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Ashraf Jaradat, Aziz Deraman, Sufian Idris, Laily Din & Nizam Said
berbagai projek seperti Kahn & Wilensky dan menjadi asas kepada pembentukkan model Do
Warwick Framework (Lagoze et al., 1996; yang lebih maju, iaitu rangkakerja Kahn &
Daniel and Lagoze, 1997; Daniel et.al.). Model Wilensky dan Warwick. Kedua-dua
yang lebih terperinci seperti model FEDORA rangkakerja ini menjadi asas kepada
(Daniel et al. ; Payette and Lagoze, 1998), pembentukan pakej bebas-kandungan (Kahn
model CNRI (Bianchi dan J. Petrone, 2001) and Wilensky, 1995) atau sebagai kantung
dan model DUSHAY [8] menjadi asas kepada pakej metadata (Lagoze et al., 1996). Kedua-
pembentukkan perpustakaan digital. Pada dua rangkakerja ini dibina dengan matlamat
asasnya konsep DO mewakili entity logical untuk mewakilkan data dan metadata dalam
yang komponen utamanya adalah berbentuk objek perpustakaan digital di persekitaran
digital dan menjadi kandungan kepada terangkai.
perwakilan perpustakaan digital.
Rangkakerja Kahn & Wilensky boleh dianggap
Namun demikian, dengan DO sebagai satu sebagai asas kepada pembentukan konsep DO.
konsep baru yang masih terbuka dari segi Ia menakrifkan entiti asas suatu infrastruktur
pelaksanaannya, penjenisan kandungan yang yang menyokong kelas maklumat digital
diwakilkannya menyebabkan penggabungan teragih seperti perpustakaan digital.
maklumat masih sukar sukar untuk disusun dan Rangkakerja ini secara tak rasmi menakrifkan
diwakilkan untuk menjadikannya sebagi satu DO sebagai “struktur data dengan komponen
petunjuk pengetahuan yang bermakna dan utamanya adalah bahan digital atau data
berguna. Oleh yang demikian, kertas ini cuba termasuk suatu pencam yang unik yang
membincangkan pengembangan konsep DO dipanggil pengendali. Seterusnya penakrifan
menjadi lebih dinamik. Konsep objek digital yang lebih formal dibuat dengan DO sebagai
informative (iDO)diperkenalkan dengan suatu kewujudan jenis data abstrak yang
kantung pengetahuan yang lebih jelas mempunyai dua komponen iaitu data dan
semantiknya untuk sesuatu perwakilan DO. metadata-kunci. Berasaskan data dan metadata-
Secara khususnya iDO ini difokuskan kepada kunci, penakrifan DO boleh dikembangkan
biodiversiti flora dan fauna yang mempunyai untuk menjadikan pengedalian repositori dalam
potensi untuk diwakilkan pengetahuannya pelbagai bidang aplikasi lebih mudah.
secara lebih berkesan. Konsep iDO ini akan
Rangkakerja Warwick pula dibina sebagai cara
memudahkan mekanisma pengorganisasian dan
untuk untuk menguruskan pakej metadata ke
perwakilan tradisonal pengarkiban sistem
dalam kantung dengan menyediakan hubungan
maklumat kepada pangkalan pengetahuan.
eksplisit antara pakej-pakej dalam kantung
Dengan itu, pertanyaan berkaitan dengan
dengan menakrifkan abstraksi baru yang
pengetahuan iDO boleh dibuat secara lebih
dipanggil Katalog Rangkakerja Warwick
dinamik dan pintar. iDO juga boleh
(WFC). WFC menyediakan senarai pakej
digabungkan dalam repositori utama Sistem
individu dan hubungan antara mereka. WF
Pengarkiban Pengetahuan Biodiversiti
menakrifkan DO sebagai kantung yang
(BioKAS) untuk memudahkan manipulasi
mempunyai tiga pakej metadata yang berbeza
maklumat dan pengetahuan objek digital.
iaitu Mudah: pakej set metadata yang
Seksyen berikut akan membincangkan
mengandungi metadata sebenar; Pakej Tak
rangkakerja DO dan diikuti dengan
Langsung: pakej yang tak perlu dimasukkan
perbincangan berkaitan dengan model DO.
dalam kantung (ianya boleh dicapai
Selepas itu satu cadangan rangkakerja objek
menggunakan rujukan seperti URL); Pakej
digital informatif akan dibincangkan dengan
Kantung: kantung itu sendiri. Kantung boleh
terperinci.
wujud dalam dua bentuk sama ada “transient”
2. Rangkakerja Objek Digital atau “persistent”. Dalam “transient”, kantung
Pendekatan objek digital merupakan kaedah wujud sebagai objek pengangkutan antara
yang selesa untuk menggambarkan item repositori, pelanggan dan agen. Dalam
maklumat. DO menyediakan perantaraan untuk “persistent”, ianya wujud sebagai objek kelas-
menyusun dan mengenalpasti kandunagn atau pertama dalam infrstruktur maklumat yang
maklumat bagi penyimpanan, capaian dan boleh dinamakan dan distor dalam satu atau
penagihan. Dalam skop yang dibincangkan di lebih pelayan, direplikasikan, dan dicapai
sini, terdapat dua rangkakerja yang dikira
daraipada pelayan-pelayan ini menggunakan digital (Payette and Lagoze, 1998; Payette et
pencam capaian global (URI). al., 2002). FEDORA menggunakan konsep
rangkakerja Warwick yang telah dikembangkan
Bagaimanapun, WF dan katalog hanya
dengan memenuhi keperluan rangkakerja Kahn
menyediakan model yang berhubungan dengan
& Wilensky berkaitan dengan syarat
metadata sahaja. Oleh itu rangkakerja
kebenaran, DO sebagai bebas-kandungan, dan
Hubungan Aktif Teragih (DAR) telah
pengagihan. Dengan membina di atas
dibangunkan yang mengembangkan WF
rangkakerja Warwick, ia membenarkan
dengan mengitlakkan rangkakerja yang
aggregasi kandungan tempatan dan teragih.
membenarkan kantung mememgang atau
Dengan pembangunan menggunakan abstraksi
merujuk semua sumber dan bukan sahaja
DAR, FEDORA membenarkan pengagihan
metadata. Tahap perbezaan hubungan antara
daripada aggregasi kandungan (Daniel et al. ).
data dan metadata tidak penting bagi DAR,
namun terdapat kepelbagaian perbezaan antara Senibina FEDORA adalah struktur
sumber data yang perlu dipertimbangkan perkhidmatan multi-lapis yang termasuk
(Daniel and Lagoze, 1997). Kaedah URL perkhidmatan:
(Uniform Resource Locator) atau URN
repositori yang menyediakan mekanisma
(Uniform Resource Names) boleh menjadi
untuk menginput, menyimpan dan
contoh penggunaan hubungan dalam WFC.
mencapai objek digital;
Penamaan hubungan antara dataset dan
menggunakan pencam seperti demikian amat indeks yang menyediakan mekanisma bagi
memudahkan penjanaan pencam unik untuk penemuan objek digital;
hubungan seperti ini. Pengitlakkan ini
menyediakan satu model yang baik untuk
pungutan yang menyediakan kaedah
aggregasi objek digital dan perkhidmatan
mewakili data dan metadata dalam
untuk menjadi koleksi yang bermakna;
perpustakaan objek digital denagn persekitaran
terangkai. Sumber boleh dikaitkan tanpa penamaan yang mendaftar dan
menghiraukan di mana lokasinya, dan mendapatkan nama yang unik secara
hubungan antara sumber-sumber ini boleh global untuk objek digital;
diperolehi dan dilaksanakan di mana-mana
sahaja dalam rangkaian. Tahap perkaitan antaramuka pengguna yang menyediakan
seperti ini membolehkan data berada dalam pintu laluan untuk mendapatkan
satu repositori dengan pemerihalannya berada perkhidmatan lain.
dalam repositori yang lain. DO mempunyai pencam kekal unik (PID), satu
atau lebih penyebar, satu atau lebih
3. Model Objek Digital
Kajian dan penggunaan DO masih baru dan “datastream” dan metadata sistem. Salah satu
memerlukan lebih banyak penyelidikan dibuat cirri penting DO FEDORA adalah
dalam bidang aplikasi ayang berbeza. kepupayaannya mengaggregasikan kedua-dua
Penyelidikan oleh Kahn & Wilensky kandungan (data dan metadata) dan kelakuan.
membolehkan pemhaman rangkakerja yang (perkhidmatan). Kedua-dua unsur ini boleh
lebih baik untuk dikaitkan dengan pemodelan diagihkan dan dirujuk melalui URI (Payette
DO. Namun demikian, rangkakerja ini hanya and Staples, 2002) yang distorkan dalam
membolehkan pemahaman konsep dibuat tanpa repositori.
dijelaskan keupayaan sebenar pelaksanaan DO Senibina CNRI pula memudahkan pengurusan
dalam bidang aplikasi yang dipilih. Oleh itu, kandungan dan perkhidmatan perpustakaan
berikut ini dibincangkan tiga model DO yang digital dalam konteks persekitaran teragih
lebih terperinci iaitu FEDORA, CNRI dan melaui pengunaan mekanisma penjenisan objek
Dushay. digital teragih. CNRI membenarkan DO
FEDORA (Flexible and Extensible Digital dianggap sebagai “gist key” yang diperihalkan
Object and Repository Architecture) adalah melalui penggu aan penjenisan abstrak “jenis
model DO yang merupakan senibina DO dan kandungan” dengan matlamat pencipta DO
repositori terbuka yang dibina untuk memperihalkan objek dengan menakrifkan set
menyediakan kaedah terbaik untuk menimpan, pandangan yang boleh diperolehi daripadanya
mencapaian dan mengagihkan kandungan (Bianchi dan Petrone, 2001). CNRI juga
Cipta
ETC…ETC…
iDO terbentuk oleh kepelbagaian objek boleh ditakrif dengan baik. Atribut objek
komponen yang direalisasikan oleh biasanya tetap tetapi nilai semasa mungkin
hubungan. Oleh itu penakrifan hubungan dinamik dan inilah yang mencirikan iDO yang
berasaskan kandungan sebenar boleh dikelaskan sebagai mudah atau
komponen amat penting. kompleks. Pembolehubah mudah boleh jadi
berjenis primitif seperti integer, real atau string.
Komponen boleh dating dengan berbagai Pembolehubah kompleks boleh mengandungi
jenis data seperti teks, audio, imej dan
koleksi jenis-jenis item atau maklumat. Sebagai
sebagainya.
contoh:
Kepelbagaian hubungan membolehkan iDO 1 mempunyai bentuk:bulatan;
pengetahuan sesuatu DO dibina dan warna:hitam; saiz: besar
diperbanyakkan dengan sistematik.
iDO 2 mempunyai bentuk:bersegi; warna:biru;
Oleh itu, boleh difahamkan yang kantung iDO saiz: kecil
adalah satu blok pengetahuan yang besar
mengenai sesuatu objek melalui pembolehubah, Setiap iDO mempunyai ciri yang sama seperti
peristiwa, lokasi, perkhidmatan atau unsur lain bentuk, warna, saiz dan seterusnya, namun
seperti yang ditunjukkan oleh Rajah 1. setiap satu objek mungkin memiliki nilai yang
berbeza.
Seperti yang dibincangkan, iDO mewakili
objek dunia nyata sebagai campuran maklumat Perkhidmatan / Aplikasi
digital atau multimedia melalui kandungan Tiada objek boleh wujud sendirian melainkan
kompnen masing-masing. Oleh yang demikian, bergantungan dengan pihak lain. Oleh itu, apa
komponen iDO boleh dibahagikan kepada tiga sahaja yang objek boleh buat dinyatakan dalam
bahagian yang penting iaitu: bentuk perkhidmatan. Sebagai contoh,
penemuan tumbuhan tongkat ali bukan sahaja
Atribut menjadi ramuan ubatan malah telah menjadi
Terdapat ciri pada setiap objek yang ramuan untuk minuman. Minuman ini
menunjukkan ciri yang stabil dan membuatkan sebenarnya adalah di luar objek “tongkat ali”
itu sendiri. Berasaskan kepada nilai semasa, Daniel, R.J. dan Lagoze, C. 1997.Distributed Active
perkhidmatan spesifik objek boleh jadi mudah Relationships in the Warwick Framework.
atau kompleks. Proceeding of the 1997 IEEE Metadata Conference.
(Online)
Hubungan http://www.computer.org/proceedings/meta97/paper
Komponen ini memberikan penyatuan semantic s/rdaniel/rdaniel.pdf(24-03-04).
beberapa komponen objek untuk membentuk Daniel, R.J., Lagoze, C. dan Payette, S.D. A
pengetahuan. Hubungan ini boleh diumpukkan Metadata Architecture for Digital Libraries.
secara menegak atau mendatar. Hubungan Proceedings of the IEEE International Forum on
mendatar menggabungkan item di abawah Research and Technology Advances in Digital
paras yang sama untuk menghasilkan maklumat Libraries, ADL. Pages: 276-288.
umum yang boleh menjelaskan iDO yang Dushay, N. 2002, Localizing experience of digital
berlainan. Hubungan menegak pula content via structural metadata, Proceedings of the
menggabungkan kumpulan komponen yang second ACM/IEEE-CS joint conference on Digital
berkaitan pada paras yang berlainan untuk libraries. Pages: 244 -252.
menunjukkan iDO yang spesifik.
Kahn, R. dan Wilensky, R. 1995, A Framework For
5. Kesimpulan Distributed Digital Object Services. Corporation for
Kertas ini telah membincangkan pelbagai isu National Research Initiatives (CNRI). (Online)
untuk perwakilan Do yang dilihat menajdi http://www.cnri.reston.va.us/home/cstr/arch/k-
semakin penting terutama sekali dalam w.html (4-Jan-2004).
pemodelan flora dan fauna. Kesungguhan
Lagoze, C., Lynch, C.A. dan Daniel, R. 1996. The
penyelidikan dalam pemodelan DO ini amat Warwick Framework: A Container Architecture for
perlu untuk memudahkan penyediaan Aggregating Sets of Meta data. D-Lib Magazine.
repository pengetahuan yang lebih mudah Technical Report, Cornell University. (Online)
difahami dan digunakan. Dengan cadangan
penggunaan model iDO, kandungan sesuatu http://www.dlib.org/dlib/july96/lagoze/07lagoze.ht
ml (01-Mar-04).
DO boleh dikembangkan tahap pengetahuan
kepada produk yang lain tetapi masih berpautan Payette, S. dan Lagoze, C. 1998. Flexible and
dalam bentuk hubungan mendatar atau Extensible Digital Object and Repository
menegak. Kaedah iDo ini diharapkan akan Architecture (FEDORA). Proceedings of the Second
memberi satu pendekatan baru untuk European Conference on Research and Advanced
Technology for Digital Libraries. Lecture Notes in
memastikan pemodelan reposiotri pengetahuan
Computer Science, Volume 1513, pages: 41-59.
akan terus cekap dan berkesan.
Payette, S. dan Staples, T. 2002. The Mellon Fedora
6. Daftar Pustaka Project. Proceedings of the 6th' European
Bianchi, C. dan Petrone, J. 2001.An Architecture for Conference on Research and Advanced Technology
Digital Object Typing. Corporation for National for Digital Libraries, ECDL. Volume 2458 /2002,
Research Initiatives (CNRI). (Online) Pages: 406 -421.
http://www.cnri.reston.va.us/software/repository/rep
o-whitepaper.pdf (02-Mar- 04).
Isolasi Dan Identifikasi Bakteri Termofilik Penghasil Enzim Lipase Dari Kompos
Abstrak
Proses-proses industri yang menggunakan lipase umumnya berjalan pada temperatur di atas
45oC, karena itu penelitian mengenai lipase yang berasal dari bakteri termofilik penting
untuk dilakukan. Bakteri termofilik diisolasi dari sampel pengomposan limbah organik ketika
berada pada tahap termogenik, dan dapat ditumbuhkan pada suhu 50, 60 dan 70oC pada
media yang mengandung olive oil sebagai sumber karbon terbesar. Uji mikroskopis
memperlihatkan isolat yang didapatkan berbentuk basil dan kokus. Identifikasi bakteri
penghasil lipase dilakukan dengan menumbuhkan isolat pada media Nutrien Broth dan media
termus yang mengandung substrat lipid 1%. Inkubasi dilakukan mulai pada suhu 50oC hingga
70oC. Isolat yang mempunyai aktivitas lipolitik ditandai dengan terbentuknya halo (zona
bening) atau pendar fluoresens merah-oranye di sekitar koloni.
Badrul Munir Md-Zain1, Vun Vui Fui1, Zainal Zahari Zainuddin2, Mahani Mansor Clyde1
Abstract
We present the molecular study to examine the genetic variation of Malaysian Banded leaf
monkey. We sequenced 500 base pairs of the mitochondrial DNA (mtDNA) (Cyt-b gene).
Three subspecies of Malaysian banded leaf monkey were used including Presbytis melalophos
siamensis, P. m. robinsoni and P. m. cruciger. Our interpretation based on distance analysis
suggests that siamensis has a distant relationship with robinsoni as compared to cruciger
while robinsoni has a closed relationhip with cruciger. Results provide some genetic
information that can be used to characterize genetic structure at subspesific level. Later, the
final results can be translated for conservation and management of Malaysian banded leaf
monkey.
Keywords: Malaysian Banded Leaf Monkey, Primates, Mitochondria, Cyt-b DNA Sequences.
Table 2. Oligonucleotide primer pair used in this study and its PCR conditions
Forward/Reverse L14724: 5'-CGAAGCTTGATATGAAAAACCATCGTTG-3'
Primer Sequences
Cyt-b H15149:5'-AAACTGCAGCCCCTCCGAATGATATTTGTCCTCA-3‘
1 2 3 4 5 6 7
500bp
Table 3. Average percent sequence divergence among and between siamensis and robinsoni using Kimura 2
paramater
1 2 3 4 5 6 7 8 9
1 P. m. siamensis BM21 -
2 P. m. siamensis BM22 0.226 -
3 P. m. siamensis BM23 0.457 0.224 -
4 P. m. siamensis BM24 0.457 0.224 0.000 -
5 P. m. robinsoni BM27 7.651 7.372 7.112 7.119 -
6 P. m. robinsoni BM28 7.878 7.563 7.339 7.315 0.000 -
7 P. m. robinsoni BM30 4.286 4.500 4.776 4.761 6.591 6.796 -
8 P. m. robinsoni BM33 4.790 4.517 4.783 4.784 6.055 6.050 0.458 -
9 P. m. cruciger BM105 5.262 5.119 5.249 5.232 6.299 6.247 0.917 0.231 -
Md- Zain et al. (2002) contradict the Brandon- that there is a big separation between siamensis
Jones et al. (2004) classification, showing little and robinsoni. Surprisingly, there is also a big
phylogenetic separation of one subspecies from genetic distance between 2 population of
another. Indeed, to the extent that one can robinsoni (Kuala Kangsar and Selama) at 6.4
identify groupings within P. melalophos, they %. This finding of course warrants special
do not coincide with those listed by Brandon- attention from molecular and morphological
Jones et al. (2004) P. f. femoralis does not approaches to define the intersubspecific
group with the P. f. robinsoni, nor does P. s. population differences.
siamensis group with P. s. natunae.
This study's results are particularly relevant to
In this study, using Cyt-b mtDNA, the final the systematics of the Malaysian Banded leaf
conclusion cannot be made until the sequences monkey and Asian Leaf monkeys in general.
of femoralis, cruciger and chrysomelas are The data presented here can be used as an
obtained from several individuals. However, important source to define conservation and
based on the genetic distance, the pattern shows management units of Banded leaf monkeys.
Table 4. Summary average percent sequence divergence among and between siamensis and robinsoni using
Kimura 2 paramater
Cyt-b siamensis robinsoni cruciger
siamensis 0.265
robinsoni 6.034 6.373
cruciger 5.216 3.424 -
Table 5. Average percent sequence divergence among and between siamensis and robinsoni using the Tajima and
Nei method (Md-Zain 2001)
However, only after comprehensive data matrix westcentral Sumatra- a summarized report. Kyoto
of Banded leaf monkeys completed with Univ. Overseas Rsch. Rep Studies on Asian Non-
genetic distance and tree topologies, then such Human Primates 3: 37-44.
units can be defined. Kocher, TD, Thomas, WK., Meyer, A, Edwards,
SV, Paabo, S, Villablanca, FX, & Wilson, AC
4. Acknowledgements (1989). Dynamics of mitochondrial DNA evolution
We kindly appreciate Faculty of Science and in animals: Amplification and sequencing with
Technology (UKM), Jabatan PERHILITAN conserved primers. Proc. Natl. Acad. Sci. U.S.A.
and the Government of Malaysia. Special 86: 6196-6200.
thanks to several institutions that provide us
Li, M, Wei, F, Huang, C, Pan, R & de Ruiter, J
with necessary facilities and assistance for (2004). Phylogeny of Snub-nosed monkeys inferred
tissue sample collection including Jabatan from mitochondrial DNA, Cytochrome B, and 12S
Perhilitan Malaysia and Wildlife Conservation rRNA sequences. International Journal of
Society. This research is made possible under Primatology 25: 861-873.
grant IRPA 08-02-02-0019 EA 301.
Md-Zain, B.M. (2001). Molecular systematics of the
5. References genus Presbytis. PhD thesis. Columbia University.
Aimi, M. and Bakar, A. (1992). Taxonomy and
Md-Zain, B.M., Hassan, M.H. & Melnick, D.J,
distribution of Presbytis melalophos group in
(2002) Defining evolutionary significant units for
Sumatera, Indonesia. Primates 33: 191-206
Presbytis melalophos conservation using
Aimi, M., Hardjasasmita, H. S., Sjarmidi, A., and mitochondrial DNA sequences, Proceedings
Yuri, D. (1986). Geographical distribution of Regional Symposium on Environment and Natural
Aygula-group of the genus Presbytis in Sumatra. Resources. Bangi, Selangor 279-286.
Kyoto University Overseas Report of Studies on
Md-Zain, B.M ., Vun, V.F, Zainal, Z.Z., &
Asian Non-Human Primates 5: 45-58.
Clyde, M.M. (2005). Pengoptimuman tindakbalas
Applied Biosystems, Inc., A Division of Perkin- berantai polimerase (PCR) fragmen gen sitokrom-b
Elmer Corporation (1994). AutoAssembler, DNA bagi lutong Presbytis dan Trachypithecus. Prosiding
sequence assembly software. Seminar IRPA RMK-8 Kategori EAR, 2005. 112-
114.
Brandon-Jones D, Eudey AA, Geissmann T, Groves
CP, Melnick DJ, Morales JC, Shekelle M, Stewart Oates, J. F., Davies, A. G. and Delson, E. (1994).
C-B. (2004) Asian Primate Classification. The diversity of living colobines. In Davies, A. G.
International J. Primatology 25: 97-164. and Oates, J. F. (eds), Colobine monkey: their
ecology, behavior and evolution. Cambridge
Hillis, DM, Moritz, C, & Mable, BK. (1996). University Press, Cambridge, pp. 45-73.
Molecular systematics 2nd edition. Sinauer
Associates, Massachusetts, U.S.A. Payne, J. and Francis, C. M. (1985). A field guide to
Mammals of Borneo. Sabah Society, Sabah,
Kawamura, S. (1984). Distribution and vocalization Malaysia.
of Presbytis melalophos and P. femoralis varieties in
Swofford, D. L. (1999). PAUP: Phylogenetic M., and Ehara, A (eds). Basel: S. Karger,
Analysis Using Parsimony, version v4.0b2, Illinois Contemporary Primatology, pp. 459-463.
Natural History Survey, Champaign, IL.
Wilson, C. C. and Wilson, W. L. (1977). Behavioral
Wilson, W. L. and Wilson, C. C. (1975). Species- and morphological variations among primate
specific vocalizations and the determination of population in Sumatra. Yearbook of Physical
phylogenetic affinities of the Presbytis aygula- Anthropology 20: 207-233.
melalophos group in Sumatra. In Kondo, S., Kawai,
Heavy Metals Migration Beneath Unlined Waste Disposal Site At Dengkil, Selangor,
Malaysia
Abdul Rahim Samsudin 1, Bahaa-eldin Elwali A.Rahim 2, Wan Zuhairi Wan Yacob 3, and
Abdul Ghani Rafek 4
1) Geology Program, School of Environment and Natural Resources Sciences, UKM, Bangi, 43600,
Malaysia
e-mail: abrahim@pkrisc.ukm.my
2) Geology Program, School of Environment and Natural Resources Sciences, UKM, Bangi, 43600,
Malaysia
e-mail: bahaa_wali@yahoo.com
3) Geology Program, School of Environment and Natural Resources Sciences, UKM, Bangi, 43600,
Malaysia
e-mail: yaacobzw@pkrisc.cc.ukm.my
4) Geology Program, School of Environment and Natural Resources Sciences, UKM, Bangi, 43600,
Malaysia
e-mail: aghani@pkrisc.ukm.my
Abstract
Heavy metals namely Cu, Cr, Ni, Zn, Pb, and Co in soil horizons beneath the Ampar Tenang
waste disposal site at Dengkil, Selangor were extensively studied through chemical analyses
of twenty-one representative triplicate soil samples. The soil samples were collected from nine
augered boreholes. Three of the boreholes are located within the disposal site and three each
in the upstream and downstream regions outside the disposal area. Soils sampled from the
soil-waste interface (ATI) within the dumping site indicated relatively high concentration of
most of the heavy metals analyzed compared to those of samples collected from an upstream
area (ATU) of the dumping site. Whereas soil samples from a down stream area (ATD) show
slightly elevated concentration of heavy metals. The results of chemical analyses reveal that
Cr, Zn and Pb had higher levels of concentration among all examined heavy metals. It was
found that in most cases, the heavy metals concentrations were generally high within the soil
of near surface layer and then they appear to decrease with increasing depth. It was noticed
that, in addition to the vertical infiltration of leachate from the solid waste, the increase of
groundwater level has also a strong influence on the contaminants dispersion in soils below
the waste site.
Keywords: Leachate, Soil contamination, Chemical analysis, Heavy metals, Groundwater.
expressed in mg/kg. The statistical analyses metals, only Cr, Zn, and Pb distributed
were performed using the SPSS FOR considerably differently (P ≤ 0.01) throughout
WINDOWS statistical software package, the area, whereas Ni showed significant
Release 11.50 (6 Sep. 2002). Statistical distribution difference at P ≤ 0.05. However,
differences between the means were compared Cu and Co were distributed insignificantly.
using least significant differences at probability
The vertical distribution of the most of the
P ≤ 0.05 (significant) and P ≤ 0.01 (very
analyzed elements along the soil profiles (i.e.
significant).
ATU, ATI, and ATD) exhibits notable
3. Results decrease with increasing depth depending on
The study area is covered by a thin layer (50 the location of the profile. Nevertheless, some
cm) of dark brown spongy amorphous peat at elements showed irregular migration patterns
the surface which, underlain by a very soft (e.g. Cu, Co, Cr). On the contrary, Zn and Pb
compressible clay. This clay is light grey in concentration exhibits sharp increase at a depth
colour and is a very soft to very stiff sandy and below 40 cm before showing the usual
silty clay. The soils in the vicinity of Ampar behavior of the downward-decrease with
Tenang site were characterized by acidic pH of increasing depth.
mean values ranging between 2.44 to 3.01.
4. Discussion
There was no change in pH with depth except
The most contaminated soil in the present
for the ATD soil samples, which showed
study occurs in areas, where extensive wastes
slightly decrease with depth of up to 70 cm and
had been disposed (ATI) as shown in Table 1.
then remained unchanged (figure 3).
Thus, the high concentrations of these metals
Results of total concentrations and vertical especially, Zn, Pb and Cr at ATI locations were
migration of the analyzed heavy metals are directly attributed to the release of
illustrated in Table 1 and Figures 4 to 6. contaminated leachate generated from
However, among all the analyzed heavy decomposed garbage.
Metal b ATS
Cu upstream 0.28 ± 0.02
Cu interface 2.21 ± 1.17
Cu downstream 0.54 ± 0.36
Co upstream 0.13 ± 0.20
Co interface 0.79 ± 0.35
Co downstream 0.14 ± 0.18
Cr upstream 1.06 ± 0.40 **
Cr interface 11.51± 2.12 **
Cr downstream 2.59 ± 1.00 **
Ni upstream 0.82 ± 0.18 *
Ni interface 4.35 ± 0.97 *
Ni downstream 1.81 ± 0.92 *
Zn upstream 1.57 ± 0.33 **
Zn interface 12.97± 5.28 **
Zn downstream 5.41 ± 1.09 **
Pb upstream 1.36 ± 0.58 **
Pb interface 12.78± 1.48 **
Pb downstream 3.38 ± 1.07 **
a
n = 21; ATS: Ampar Tenang soil; Concentration in Mg/Kg
b
upstream= ATU; interface= ATI; downstream= ATD
** Means are very significant at P ≤ 0.01
* Means are significant at P≤,0.05
pH
pH
0 1 2 3 4
0
20
40
60 ATU
depth (cm)
80 ATI
100 ATD
120
140
160
conc. (M g/kg)
0 1 2 3 4 5
0
Cu ATU
depth (cm)
40 Cu ATI
Cu ATD
80
Co ATU
120 Co ATI
160 Co ATD
According to Elzahabi and Yong (2001), the BH3 respectively) which fluctuates very close
solubility of heavy metals is highly pH to the ground surface during the rainy season
dependent and increases with decrease in the supported the assumption of washing these
soil pH. In the present work, the very acidic metals into the groundwater. Furthermore,
soil pH which enhanced the solubility of the even during the dry season the insignificant
contaminants eased the mobility of heavy drop of the groundwater table to some 0.5 m
metals spatially and vertically. However, the can highlight the short-distance pathway
contamination present in the solid waste needed for these migrating elements to be
exerted a significant impact on the underlying released into the groundwater zone. In turn,
soil but it has to be stressed that different this phenomenon can efficiently minimize the
metals behaved differently. The first layer of effect of natural attenuation of these elements
the soil i.e. near the ground surface (Figures 4 by the clay minerals of the local soil material
to 6) efficiently retained some metals such Cr because even the partially attenuated elements
and Zn and to less extent Co and Ni. However, near the ground surface can easily be washed
the occurrence of the groundwater table at the during the periodical fluctuations of the
Ampar Tenang area at shallow depths (i.e. 6.41 groundwater table.
m to ≈10 m above the sea level at BH1 and
conc. (Mg/kg)
0 3 6 9 12 15
0 Cr ATU
Cr ATI
depth (cm) 40 Cr ATD
Ni ATU
80 Ni ATI
Ni ATD
120
160
conc. (Mg/kg)
0 3 6 9 12 15 18 Zn ATU
0 Zn ATI
40 Zn ATD
depth (cm)
Pb ATU
80
Pb ATI
120 Pb ATD
160
With exception of Pb in ATI soil and Zn in groundwater zone. The preliminary results of
ATD soil, which exhibited lower concentration groundwater analysis assert this interpretation.
levels in the upper 30 cm, almost all of the Apart from this, the elevated concentration of
examined metals throughout the study area these metals in ATD can be attributed to the
showed a notable decrease in the concentration movement of leachate plume downward of the
below the depth 60 cm. The observed tendency site toe; however, the possible contribution
to decrease with depth increase was related from the use of chemical fertilizers also needs
mainly to the flushing of these metals into the to be considered.
groundwater due to the mechanism of water
In general, the concentration levels of all
table fluctuation. This mechanism was
analyzed heavy metals in the soil at the study
supposed to cause occasionally a considerable
area were found to be below the target limits
contaminants release into groundwater in the
determined by DoE (1997).
vicinity of Ampar Tenang open-tipping site.
Furthermore, the acidic pH of soil could
facilitate migration of these metals towards the
5. Conclusion Ding, A., Zhang, Z., Fu, J., Cheng L., 2001.
Soils of Ampar Tenang open-tipping site were Biological control of leachate from municipal
extensively investigated in terms of landfills. Chemosphere 44 (1), 1-8.
concentration and vertical migration of DoE. 1997. Environmental Impact Assessment
selected heavy metals. Since the waste was Guidelines For Groundwater and/or Surface Water
disposed directly onto an unlined natural Supply Project. Department of Environment of
formation, a number of contaminants including Malaysia Putra Jaya, Malaysia.
heavy metals readily penetrated efficiently Elzahabi, M., Yong, R.N., 2001. pH influence on
through the soil and eventually reached the sorption characteristics of heavy invadose zone.
groundwater. The short pathway needed for Eng. Geo. 60, 61-68.
these contaminants before releasing into the Erses, A.S., Onay, T., 2003. In situ heavy metals
groundwater besides, the periodical water table attenuation in landfills under methanogenic
fluctuations can possibly minimize the effect of conditions. Journal of Hazardous Materials. B99,
natural attenuation of these heavy metals by 159-175.
the soil material. It was found that soils from
ISO 10390., 1994. Soil Quality-Determination of
ATI locations were highly contaminated by
pH. International Organization for Standardization.
heavy metals due to the impact of leachate Geneva, Switzerland. 5p.
seepage through the underlying soils. The
acidic soil environment besides local Lamthothe, P.J., Fries, T.L., Consul, J.J., 1986.
groundwater flow directions availed the Evaluation of a Microwave Oven System for the
dissolution of geologic samples. Anal. Chem. 53,
mobility of these metals spatially and vertically
1886-1887.
in the vicinity of the pollution source at Ampar
Tenang site. In addition, the heavy metals Martens D., Balta-Brouma K., Brotsack R.,
present in the contaminated soils can be Michalke B., Schrame P., Klimm C.,Henkelmann
remobilized from the soil as a result of B., Oxynos, K., Schramm K., Diamadopoulos E.,
Kettrup,A., 1998. Chemical impacts of uncontrolled
enhanced groundwater levels; therefore their
solid waste combustion to the vicinity of the
replacement before constructing an Kouroupitos Ravine, Crete, Greece. Chemosphere,
impermeable barrier is highly recommended. 36 (14), 2855-2866.
The results of groundwater chemical analysis
indicate a heavy contamination load by various Minerals and Geosciences Department of Malaysia.
types of contaminants including heavy metals 2001. The study on sustainable groundwater
resources and environmental management for
e.g. lead (Pb) and copper (Cu). Langat Basin in Malaysia., Interim Report # 1, in
6. Acknowledgements association of Japan International Cooperation
This work was financially supported by the Agency (JICA).
Ministry of Science and Technology of Omar, C.R., Jaafar, R., Hassan, H., 1999.
Malaysia through an IRPA Project No. 08-02- Engineering geology and earthwork problem
02-0008- EA 178. associated with highway construction in soft soil as
Sg. Rasau, Dengkil, Selangor. Geol. Soc. Malaysia
7. References Bull. 45, 174-186.
Ahel, M., Nevevka, M., Bozena, C., Prohic, E.,
Vesna, S., 1998. The impact of contamination from U.S. Environmental Protection Agency. 2000.
municipal solid waste landfill (Zagreb, Croatia) on Standard operating procedures: Soil Sampling. SOP
underlying soil. Wat. Sci. & Tech. 37 (8), 203-210. 2012-02/18/00.
Bosch, J.H. 1988. The Quaternary Deposits in the
coastal plains of Peninsular Malaysia. Report #
QC/1. Geological Survey of Malaysia.
Bambang Ariwahjoedi
Abstrak
Perilaku mesofasa karbon pada gegala diperrumit oleh adanya kereaktifan kimia pada
temperatur pengamatan serta oleh lebarnya rentang dari struktur molekul spesi-spesi yang
berada dalam sistem gegala itu. Sementara kompleksitas ini menyarankan penggunaan
aluran transformasi waktu/tempartur, pertimbangan perilaku fasa hipotetis dari gegala yang
mengandaikan tidak adanya perubahan komposisi keseluruhan dengan waktu telah cukup
membantu dalam interpretasi gejala termal yang diamati. Dalam makalah ini diusulkan dan
dijelaskan konstruksi suatu diagram fasa yang dapat secara lebih umum dipakai dalam
interpretasi maupun prediksi peralihan mesomorfik dalam sistem gegala karbon.
Paper is on page1131
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Proceeding
Fax : +62 (22) 2504154, Homepage of The 6th ITB-UKM Joint Seminar
: http://www.chem.itb.ac.id/jschem, E-mail :on Chemistry
jschem@chem.itb.ac.id
B. Kuswandi, E. Agustina, A.A Gani and E. Asijati
Abstract
Poly-o-toulidin (POT), substituted derivative of polyanilin is viable materials for use in
development of optical pH sensing. Thin films of POT readily deposit on polystyrene sheets,
when o-toluidin is chemically polymerised in hydrochloride acid solution. The films have been
characterised by absorption spectra in visible region between 400-800 nm. They undergo pH-
dependent changes in their absorption spectra in the physiological pH range. The main
advantageous of these pH sensors are that no indicator dye is needed because the POT films
itself acts as both matrix and the indicator, compatible with solid state instrument, and easily
be prepared.
Keywords: pH sensor; Poly-o-toulidin film; Optode; Chemical polymerisation
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
178
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
B. Kuswandi, E. Agustina, A.A Gani and E. Asijati
straightforward preparation methods and its A wide range buffer solution was prepared
stability (Gottesfeld et al., 1987; Glarum and (Perrin & Dempsey, 1974) containing 0.1 M
Marshall, 1987). Apart from these properties, it citric acid, 0.1 M potassium
is known that after chemical polymerisation, dihydrogenphosphate, 0.1 M sodium
aniline give rise to thin film of PANI deposited tetraborate, 0.1 tris(hydroxymethil)-
onto polyester support, with a pH dependent aminomethane and 0.1 M potassium chloride,
absorption spectrum in the visible region 50 ml of this solution was diluted to 200 ml
(Pringsheim, et al., 1997; De Marcos, et al., with water, and 0.4 M sodium hydroxide or 0.4
2000), which exhibit different forms: M hydrochloride acid solution was used to
emeraldine salt (protonated), which is green; adjust pH to desired value over the pH range 2-
emeraldine base (partially protonated), which is 11.
blue; and pernigraniline (deprotonate), purple.
2.2. Apparatus
These forms are related to the pH of the
Absorbance measurements were performed
solution and, what is more important,
using an Hitachi spectrophotometer (U-1800)
reversibility from protonated to the
and a glass cuvette of 1 cm path length. The pH
deprotonated form is easily achieved. The main
was monitored with a commercial glass
advantage of these films is that they can be
electrode and a pH-meter (Hanna Instruments
used to measure pH from the acid to the base
9318) calibrated at the pH values of 4.00, 7.00
range. This has been used for the construction
and 9.00. The pKa was calculated graphically,
of pH sensors in the near IR region (Grummt et
since titration plots deviate from the theoretical
al., 1997) as well as its substituted polyanilines
(Henderson-Hasselbach) shape.
(Pringsheim, et al., 1997).
2.3. Preparation of POT films
At the present study, the substituted
POT films were fabricated by polymerization
polyanilines, i.e. poly-o-toulidin (POT) has
in 15 ml glass beaker, where the base of such
been prepared as uniform film of good quality
beaker glass has been covered with circle
on practically polystyrene support. Here, by
polystyrene sheet (6 cm in i.d.). To this end,
changing the solvent used for casting and by
typically 2 ml of 0.1 M ammonium
selecting an appropriate oxidising agent as well
peroxodisulphate, 0.1 ml of 1M hydrochloride
optimised the oxidant/aniline ratio and their
acid and 75 µl of pure o-toluidine (of various
polymerisation times, one can obtain different
ratios oxidant/o-toluidin, see Table 1) were
types of conductive POT, whose spectra differ
added and continuously stirred. After
distinctly in the visible – near IR region.
polymerisation for selected time (30, 60 and 90
Therefore, the main goal of the present work
mins, see Table 1), a thin film of POT was
was to verify the applicability of film POT as
deposited on the polystyrene sheet. The
substituted polyaniline, for a dyeless pH
polymerisation reaction was stopped by
optode. In particular, the following
discharging the solution and washing the film
characterictics have been observed: linear
POT deposited on the sheet with distilled water
range, sensitivity, reproducibility and
several times and stores the film in water at
reversibility, as well as long term stability.
4oC. Their Thickness was determined by
2. Experimental interferometry to be between 80-100 nm,
2.1. Reagents and solutions according to time of polymerisations. Though
O-toulidin was obtained from Sigma and used the film thickness was not routinely determined
as received. Iron(III) chloride hexahydrate and for all samples, since we may be conclude from
ammonium peroxodisulphate were obtained their absorbance that the thickness was always
from BDH (PA grade). Solutions of these in the same order of magnitude.
compounds were prepared by dissolving the
2.4. Measurement procedure
corresponding quantity of the reagent in
Variations of absorbance in the films were
distilled water. Acetic acid solutions were
determined by placing the film (1x 5 cm) in
prepared daily by dilution of the glacial acetic
glass cuvette, previously filled with the desired
acid (BDH) in distilled water. The acetic acid
buffer (pH 2-11), and by measuring the
concentration of solutions was obtained by
absorbance changes at the desired wavelengths
acid-base titrimetry, if necessary.
(wavelength where a wide linear range of pH
has been observed). Although changes in
0.5 0.5
0.45 0.45
0.4 0.4
Absorbance
Absorbance
0.35 0.35
0.3 0.3
pH 4
0.25 0.25
pH 7 pH 4
0.2 pH 9 pH 7
0.2
pH 9
0.15
0.15
400 500 600 700 800
400 500 600 700 800
(a) (b)
0.5
0.45
pH 4
0.4 pH 7
pH 9
0.35
Absorbance
0.3
0.25
0.2
0.15
400 500 600 700 800
Wavelength (nm )
(c)
Figure 1. POT film spectra toward pH (4, 7 and 9) at variouse polymerisation time
(a) 30’; (b) 60’ dan (c) 90’ with mol ration (oxidant/monomer) 1.62.
absorbance occur within the first seconds, all ratio of the oxidant/monomer concentration. As
data were collected 60 seconds later, in order to far as ammonium peroxodisulphate is
obtain reproducible and comparable concerned, the best results were obtained with a
measurements. 0.1 M solution. With polymerisation times of
up to 30 minutes, typically, uniform thin films
3. Results and discussion
are obtained with good transparency and show
3.1. Optimisation of polymerisation
pH dependent. If polymerisation times more
parameters
than 60 minutes, thicker films are obtained with
Some parameters which might improve the
low transparency (probably due to different
response of the POT film were studied. Among
polymer composition and multilayer formed),
these parameters, it was observed that when
which in turn, in lowering their absorbances
iron(III) chloride was used as an oxidant, lower
and longer response times toward pH (4, 7 and
absorbances of the POT film were obtained
9) (Fig. 1). Therefore, polymerisation times of
than with peroxodisulphate. Furthermore, the
30 minutes was selected for further
film showed lower sensitivity toward variations
polymerisation time.
of pH in term of absorbances in the visible
reagent (400-800 nm). Therefore, according to With regard to the oxidant/o-toludine ratio, all
this fact, ammonium peroxodisulphate was measurements were carried out with a 1M
used as an oxidant for further POT film solution of ammonium peroxodisulphate, o-
preparation. toluidine (as purchased) and different volume
of each solution. Figure 2 show variation of the
The most important parameters to be
absorbance spectral with pH at different
considered for polymerisation are: (NH4)2S2O8
oxidant/monomer ratio at visible wavelength
concentration, polymerisation time and the
(400-800 nm). As can be seen, that the mol
0.5 0.5
pH 4
0.45 0.45
pH 7 0.4
0.4
pH 9
Absorbance
0.35
Absorbance
0.35
0.3
0.3
0.25 pH 4
0.25
0.2 pH 7
0.2
0.15 pH 9
0.15
0.1
0.1
0.05
0.05
400 500 600 700 800
400 450 500 550 600 650 700 750 800
Wavelength (nm)
wavelength (nm)
(a) (b)
0.5
0.45 pH 4
0.4 pH 7
Absorbance
0.35 pH 9
0.3
0.25
0.2
0.15
0.1
0.05
400 450 500 550 600 650 700 750 800
Wavelength (nm)
(c)
Figure 2. Film POT spectral in various mol rasio (oxidant/monomer) (a) 1,08; (b) 1,62 dan (c)
2,16 with polymerisation time 60 menutes
ratio of 1.62 show more pH dependence a slightly sigmoidal curve. The results really
significantly than other ratio (1.08 and 2.16). point to a more complicated reversible
Therefore,ratio of 1.62 at polymerisation time structural transition than the mere less or gain
30 minutes was used for further film of proton in the molecule. These results are in
fabrication. The polymerisation time observed agreement with PANI film as reported
for POT film in agreement as reported for previously (De Marcos et al., 2000).
PANI film (Stejskal and Gilbert, 2002).
In order to show the broader linear response of
3.2. Spectral characteristic of POT film the POT film toward pH (2-110). The selected
toward pH wavelength at 800 nm has been used for
Visible spectrums of the POT films (ratio 1.62 calibration of the POT films, as shown in Fig.
and polymerization time 30 minutes) were 5, with correlation coefficients (R2) 0.9844.
acquired over the 400-800 nm at pH 2-11 (Fig Through the slope of the curve at Fig. 5, it can
3). The spectrum is highly pH dependent; the be stated that the sensitivity of the curve is
change on going from the dark blue emeraldine 0.0314. Here, the change in 1 pH unit only
base to the green protonated from is shown in resulted the absorbance change at 0.0314,
Fig. 3, where increasing the pH from 2 to 11 which is still low compared to the pH electrode.
lead to shift in the absorption maximum of film
The apparent pKa value of POT film (7.20) is
POT from 800 (at pH 2) to 600 nm (at pH 11).
in the physiological range. In general, titration
In acidic solutions, POT film is green but
curves of monobasic acid have a sigmoidal
changes to blue in neutral and dark blue in
shape which can be expressed by the
basic solutions. The pH dependence of the
Henderson-Hasselbach equation. However, the
maximum wavelength at 600 to 800 nm, are
titration curves of PANI films are much
plotted in Fig. 4, where the wavelength of the
broader than predicted by this equation, and the
maximums in fact change with pH according to
0.5
0.45
pH 2
pH 3
Absorbance
0.4
pH 4
0.35 pH 5
pH 6
0.3 pH 7
pH 8
0.25 pH 9
pH 10
0.2
pH 11
0.15
400 500 600 700 800
Wavelength (nm)
800
750
lamdamax (nm)
700
650
600
550
0 2 4 6 8 10 12
pH
pH dependence of the films occurs over a much with distilled water. The reproducibility is
wider pH range. Here, the dynamic range (the satisfactory enough, since the absorbance
absorbance change at 800 nm) is from pH 2 to varies by around 0.004-0.013 only or less than
11 (Fig. 5). Obviously, the Henderson- 5% (RSD=4.88%). Thorough inspection of the
Hasselbach equation is not valid for POT films, data shows that there are always some minor
and the pKa values given are apparent values, drifts of the absorbance observable. The drift
probably the average of several species of amounts to well below three percent of the
variable chain length and composed of different highest absorbance per day under condition of
structural moieties. experiment. Nevertheless, it should be
underlined that due to the hysteresis it is
3.3. Reproducibility and stability
necessary to preconditioned the film before
To study the reproducibility of its response, a
each measurement. POT films are stable in
POT film was exposed to solutions of different
water even for months. Exposure to air over
pH up to 50 times. Typically, a spectrum was
long period (1 day), however, causes the films
taken first buffer of pH 2. After washing with
undergo a color change from green to slightly
distilled water, the second measurement was
yellow. These films were no longer show a pH
performed in buffer of pH 3, followed by
dependence of the absorption spectra.
measurements in buffer of pH 4 up to pH 11.
Films were washed between each measurement
0.6
y = -0.0314x + 0.5069
0.5
R2 = 0.9844
0.4
Absorbance
0.3
0.2
0.1
0
0 2 4 6 8 10 12
pH
Table 1. Comparison of tap water pH with commercial pH meter and film PANI (n=5)
Sample pH meter PANI films
Tap water 6.96 ± 0.02 6.78 ± 0.2
Gottesfeld, S., Redondo, A. Feldberg, S.W., J. Quillard, S., Berrada, K., Louarn, G., Lefrant,
Electrochem. Soc., 134 (1987) 271. S., Lapowski, M., Pro, A., New J. Chem., 19
(1995) 365.
Glarum, S.H., Marshall, J.H., J. Electrochem.
Soc., 134 (1987) 142. Sellien, W., Czolk, R. Reichert, J., Ache, H.J.,
Anal. Chim. Acta, 269 (1992) 83.
Grummt, UW., Pron, A., Zagorska, M.,
Lefrant, S., Anal. Chim. Acta., 357 (1997) 253. Stejskal, J., Gilbert, R.G., Pure Appl. Chem.,
74, (2002) 857.
Kuswandi, B., Narayanaswamy, R., Fresenius
J. Anal. Chem., 364 (1999) 605. Wolfbeis, O.S. Fibre optic chemical sensors
and biosensors, Vols. 1 and 2, CRC Press,
Pringsheim, E., Terpetschnig, E., Wolfbeis, O.
Boca Raton, Florida. (1991) Pp. 359-384.
S., Anal. Chim. Acta, 357 (1997) 247.
Wolfbeis, O.S., Li, H., Biosens and
Perrin, D.D., Dempsey, B., Buffers for pH and
Bioelectron., 8 (1993) 161.
metal ion control, Chapman and Hall, London.
1974, pp. 48-49.
Pemanfaatan Zeolit Alam Sebagai Fasa Diam Kromatografi Lapis Tipis Pada
Pemisahan Hasil Ekstraksi Tar Batubara Dengan Pelarut Piridin Dan n-Heksana
Abstract
Utilization of zeolite as stationary phase in thin layer chromatography for separation of coal
tar extraction using pyridin and n-hexane, as solvent, have been done. Coal tar was produced
by pyrolisis of coal in temperature 7000C with the flow of N2 gases is 100 ml/minute and the
increase of the heat is 300/minute. Pyrolisis done by variating the time from 2 untul 4,5 hours
to find the optimum of product.
The extraction of coal tar was done by using pyridin as solvent with the ratio of tar and
pyridin was 1:2, continued with extraction using n-hexane with ratio of tar and n-hexane was
1:2. n-Hexane extract was separated using natural zeolite as stationary phase in thin layer
chromatography with eluent of n-hexane: acetone in ratio 3:1.
The result of the research was, the optimum product of pyrolisis in 3 hours with convertion is
26,70%. Extraction of coal tar showed that pyridin solved almost all of the coal tar
compounds, instead n-hexane solved only a few of them. From the peak of TLC
chromatogram of n-hexane extract using zeolite as stationary phase, found that the best
separation was showed by Mn-zeolite, followed by active, calcinate zeolite and silica gel.
Keywords : coal tar, extraction, thin layer chromatography
400
200
100
0
0 1 2 3 4 5
Waktu pirolisis (jam)
Gambar 1. Hubungan antara lama pirolisis dengan banyaknya tar yang dihasilkan
dan lamanya pirolisis dan didapat data seperti menunjukkan bahwa piridin melarutkan semua
gambar 1. komponen dalam batubara. Akan tetapi ketika
diekstraksi dengan n-heksana terbentuk
Dari gambar 1 dapat dilihat bahwa waktu
kembali dua lapisan yang menunjukkan bahwa
optimum pirolisis batubara adalah pada 3 jam,
n-heksana hanya melarutkan sebagian dari
karena pirolisis dengan waktu lebih lama akan
komponen yang terlarut dalam piridin.
menghasilkan penurunan jumlah tar yang
diperoleh. Hasil ektraksi dari tar batubara dengan pelarut
piridin dilanjutkan dengan pelarut n-heksana
Ekstraksi Tar Batubara
dapat dibandingkan dengan tar batubara awal
Tar batubara yang diperoleh dalam penelitian
dengan melihat kromatogram KLT pada
ini dilarutkan dengan piridin yang kemudian
gambar 2.
dilanjutkan dengan ekstraksi menggunakan n-
heksana. Kemampuan piridin melarutkan tar batubara
dilihat dengan membandingkan kromatogram
Dari tabel 1 terlihat bahwa pada tar awal yang
KLT dari ekstrak piridin dengan tar batubara
terdiri dari dua lapisan menjadi satu lapisan
yang terdapat pada gambar 3.
ketika diekstraksi dengan piridin, ini
Tabel 1. Perbandingan tar awal dengan ekstraksi dengan piridin dan n-heksana
Tar awal Ekstraksi dengan piridin Ekstraksi dengan n-heksana
Terdiri dari dua fasa Terdiri dari satu fasa Terdiri dari dua fasa
Lapisan atas keco-klatan Berwarna coklat kehi-taman Lapisan atas kuning bening
dan lapisan bawah lebih dan lapisan bawah lebih
bening kuning
Berbau tajam Berbau lebih tajam Berbau lebih lembut
Gambar 2. Kromatogram KLT hasil ekstraksi tar batubara dengan pelarut piridin dengan plat
silika gel
Gambar 3. Kromatogram KLT tar batubara awal dengan plat silika gel
heksana melarutkan komponen yang lebih Pemisahan KLT dengan menggunakan zeolit
bersifat non-polar. alam terkalsinasi sebagai fasa diam
menghasilkan sembilan puncak kromatogram..
Zeolit alam aktif sebagai adsorben KLT
Pada pemisahan dengan zeolit alam terkalsinasi
Pemisahan ekstrak n-heksana dengan zeolit
dapat diketahui bahwa persentase dari
alam aktif sebagai fasa diam pada kromatografi
komponen yang terserap pada fasa diam
lapis tipis terlihat pada gambar 5.
berkurang, dibandingkan dengan zeolit alam
Pada pemisahan KLT dengan menggunakan aktif, yang berarti bahwa afinitas sampel
zeolit alam aktif ini terlihat bahwa komponen berkurang terhadap fasa diamnya.
tar batubara yang terekstrak oleh pelarut n-
heksana lebih menyukai fasa diamnya karena Mn-zeolit sebagai adsorben KLT
komponen dengan harga Rf relatif paling kecil Dengan menggunakan Mn-zeolit sebagai fasa
mempunyai intensitas paling besar. Afinitas diam KLT pada pemisahan hasil ekstraksi tar
komponen terlarut dalam n-heksana dengan batubara dengan pelarut n-heksana, diperoleh
zeolit alam aktif disebabkan karena adanya kromatogram seperti terlihat pada gambar 7.
kesesuaian antara ukuran pori zeolit dengan Pemisahan dengan menggunakan Mn-zeolit
molekul senyawa dalam komponen tersebut. menghasilkan kromatogram dengan jumlah
Zeolit alam terkalsinasi sebagai adsorben puncak sebanyak 46 puncak.. Pemisahan
KLT dengan plat Mn-zeolit menunjukkan bahwa
Pemisahan senyawa hasil ekstraksi tar batubara tiap-tiap komponen dalam ekstrak n-heksana
dengan pelarut n-heksana menggunakan zeolit mempunyai afinitas yang berbeda-beda
alam terkalsinasi terlihat pada kromatogram terhadap Mn-zeolit. Untuk senyawa yang
gambar 6. mempunyai ukuran yang lebih kecil dibanding
ukuran pori Mn-zeolit akan terbawa oleh eluen,
sehingga harga Rf-nya besar, sedangkan yang 3. Dari ekstrak n-heksana yang dielusikan
ukurannya lebih besar dari pori Mn-zeolit akan pada variasi fasa diam dengan eluen n-
tinggal dan harga Rf-nya kecil. Mn-zeolit heksana : aseton 3 :1 (v/v), terlihat jumlah
memiliki luas permukaan spesifik paling besar puncak kromatogram KLT yang
di antara ketiga jenis zeolit yang digunakan. dihasilkan. Pemisahan yang baik berturut-
Hal ini disebabkan karena Mn-zeolit turut menggunakan zeolit adalah Mn-
mempunyai ukuran volume paling besar zeolit, zeolit alam aktif dan zeolit
diantara ketiganya terkalsinasi.
Pada pemisahan dengan menggunakan zeolit 5. Daftar Pustaka
sebagai fasa diam KLT, luas permukaan Agustine, J.R., 1990, Heterogeneuous Catalysis for
spesifik dari zeolit memberikan pengaruh yang The Synthetic Chemist, 1st Edition, Marcel Decker,
besar. Makin besar luas permukaan zeolit, Inc., New York
maka makin baik pemisahan yang dihasilkan Davies, C., A.I. Porter dan G.J. Rees, 1991, The
karena makin besar luas permukaan akan Effect of Heat on Coal, An Annotated Bibliografi,
memperbanyak situs aktif dari zeolit. Selain itu Speculation in Science and Technology, Vol. 14, no
kesesuaian antara ukuran pori dengan ukuran 2-3
molekul yang diserap juga turut mempengaruhi Gates, B.C., J.R. Katzer dan G.C.A. Schuil, 1979,
proses pemisahan pada KLT. Chemistry of Catalytic Processes, 1th Edition,
McGraw-Hill Book Company, New York
Dari banyaknya jumLah puncak kromatogram
KLT dapat diketahui bahwa pemisahan hasil G.Q. Max Lu, 2000, Molecular Enginering of
ekstraksi tar batubara dengan pelarut piridin Nanoporous Materials for SuperiorAdsorbents and
dan n-heksana yang paling baik berturut-turut Catalysts, Prosiding Seminar Nasional Kimia,
menggunakan zeolit adalah Mn-zeolit, Zeolit Jurusan Kimia FMIPA UGM
alam aktif dan zeolit terkalsinasi Hessley, R.K., John W.R. dan John T.R.,1986, Coal
Science An Introduction to Chemistry, Technology
4. Kesimpulan and Utilization, John Wiley and Sons, New York
Dari uraian pada hasil dan pembahasan dapat
ditarik beberapa kesimpulansebagai berikut : Poole, C.F. dan Salwa K. Poole, 1991,
Chromatography Today, Elsevier Science B.V.
1. Untuk mendapatkan hasil pirolisis yang Netherland
terbanyak pada suhu pirolisis sampai
Rachmat, A., 2001, Pengaruh Temperatur Pirolisis
dengan 700°C, maka lama pirolisis yang
dan Jenis Pelarut pada Ekstraksi Terhadap Produk
terbaik adalah pada 3 jam dengan hasil Cair Batubara, Tesis S-2, Program Pascasarjana
maksimum sebanyak 26,70% berat UGM, Yogyakarta
batubara awal.
Smart, L. dan Elaine M., 2001, Solid State
2. Ekstraksi tar batubara dengan pelarut Chemistry (An Introduction), 2nd Edition, Nelson
piridin melarutkan hampir semua Thornes Ltd., UK
komponen tar batubara, sedang pada Suyati, L., 2000, Kinetika Reaksi Pirolisis Batubara
kromatogram ekstrak n-heksana terlihat dengan Menggunakan Katalis Nikel/Zeolit, Tesis S-
adanya pengurangan jumlah puncak yang 2, Program Pascasarjana UGM, Yogyakarta
menunjukkan bahwa, n-heksana hanya
Touchstone, J.C., 1992, Practise of Thin Layer
melarutkan sebagian dari komponen tar
Chromatography, 3rd Edition, John Wiley and Sons,
batubara. New York
Bahruddin Saad1), Ikenna Alphonse Osisi, Muhammad Idiris Saleh, Norziah Mohd Hani2),
Ahamad Abu3) , Noor Hasani Hashim3), Norhayati Ali4)
Tiosianat Dan Isotiosianat Dalam Sintesis Terbitan Tiourea Tindak Balas Lama
Tetapi Produk Dan Mekanisma Baru
Bohari M. Yamin
Abstrak
Pada amnya sebatian karbonil klorida bertindak balas dengan ammonium tiosianat
menghasilkan karbonil isotiosianat yang boleh dijadikan bahantara untuk mengsintesis
pelbagai terbitan tiourea melalui tindak balas dengan sebatian amina. Ia perlu dilakukan
secara insitu untuk mengelakkan hidrolisis sebatian klorida atau isotiosianat tersebut. Dalam
keadaan tertentu pelarut dan jenis amina boleh mempengaruh tindak balas dan menghasilkan
produk diluar jangkaan. Peranan pelarut dapat ditunjukkan oleh tindak balas
benzoilisotiosianat dengan metionin dalam aseton menghasilkan 2,(3-benzoiltioreido)-4-
metilsulfonilbutirik sebaliknya dalam etanol menghasilkan N-benzoil-N’etiltiourea .
Sinamoilisotiosianat bertindak balas dengan 2-morfolinoetilamina dalam aseton
menghasilkan 1-(2-morfolinoetil)-3-(3-fenilakriloil)tiourea tetapi tindak balas dengan analin
dalam pelarut yang sama menghasilkan sebatian siklik 4,4,6-trimetil-1-fenil-3,4-
dihidropirimidina-2(1H)-thione. Tidak semua karbonil klorida bertindak balas dengan
ammonium tiosianat menghasilkan isotiosianat. Penemuan 1-2(-(o-toluidino)-4-metiltiazol-5-
il)etanon daripada 3-kloroasetilaseton dengan ammonium tiosianat dan o-toluidin memberi
peluang baru untuk mengsintesis pelbagai terbitan siklik tiazol . Mekanisme tindak balas ini
memerlukan pembentukan tiosianat iaitu 3-tiosianatopenta-2,4-dion. Sesungguhnya kedua-
dua isotiosianat dan tiosianat mempunyai reaktiviti apabila bertindak balas boleh
menghasilkan sesuatu yang diluar jangkaan dan memberi peluang kepada penerokaan
mekanisme yang baru.
Kata kunci: benzoilisotiosianat, isotiosianat , tiosianat, 3-tiosianatopenta-2,4-dion
192
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Bohari M Yamin
+ -
CH3CH2OH H OOCCHCH2CH2SCH3 Et OH2 + OOCCHCH2CH2SMe
+
NH2
H COOH
-
+
CH3CH2OH + N C (CH2)2SMe Et OH2 + HN CHCH2CH2SMe
H
H COOH
H
+
Et OH2 Me C+ + H2 O
H
O S Et+
H H H
Ph C N C N C CH2CH2SMe
COOH
O S Et
H + H
Ph C N C N C CH2CH2SMe
H
COOH
O S +
HC CH2CH2SMe
H
Ph C N C NHEt +
COOH
OOCHCH2CH2SMe
+
HC CH2CH2SMe + OOCCHCH2CH2SMe CH CH2CH2SMe
COOH COOH
sebaliknya kehadiran isyarat CH2 dan Me. dilakukan dalam aseton menghasilkan 2,(3-
Spektrum 13C NMR dan analisis mikrounsur benzoiltioreido)-4-metilsulfonil butirik seperti
CHNSO menunjukkan ia adalah N-benzoil- yang dijangkakan.
N’etiltiourea. Kajian kristalografi sinar-X
Jelas sekali etanol pasti memainkan peranan
menunjukkan ia mempunyai konfigurasi cis-
hinggakan tiourea yang terbentuk mengalami
cis bagi kedudukan kumpulan benzoil dan etil
interaksi seterusnya seperti mekanisme yang
terhadap kumpulan tion pada paksi C-N
dicadangkan di bawah (Rajah 1). Pembentukan
masing-masing. (Yamin & Yusof, 2003). Sifat
moieti tiourea menunjukkan serangan
ini berbeza dengan terbitan benzoil yang
nukleofilik bes nitrogen kepada karbon C=S
mempunyai kumpulan aril pada atom N ke dua
pasti berlaku dan membentuk 2,(3-
(Yusof & Yamin, 2004; Yamin et al., 2004a,
benzoiltioreido)-4-metilsulfonil butirik.
2004b).Konfigurasi cis-cis tersebut
Kumpulam etil pasti datang daripada etanol
membolehkan ia berfungsi sebagai ligan
yang boleh membentuk ion karbonium melalui
bidentat. Sebaliknya tindak balas yang sama
H
H3C O Langkah terakhir adalah pembentukan tiazol dan kondensasi
C N H3C
O S C N H CH3
H3C CH C
C CH N C S N
CH3
H
H3C C O O H HO
+ C
H N
H3C
Langkah 1 Langkah 4 C
H3 C C
C S N
O
H
H3C O O
C N H3C H3C C N H CH3
H
H3C CH C H3C CH C
C S N C S N
O H CH3
O H
H3C C
H
N
H3C O C
H3C CH3 C
C N C
HO S N + O
C O
H3C CH C H N H H
C S N C H CH3
C
H3C
O H C S N 1-(2-(o-toluidino)-4-metilthiazol-5-il)etanon
O H CH3
Langkah 3
Langkah 6
Bong Pei Thing 1), Laily B. Din 2) dan Nik Idris Nik Yusoff 3)
Chemistry Department, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 UKM
Bangi, Selangor Darul Ehsan, Malaysia
1) e-mail : peithingb@yahoo.co.uk
2) e-mail : lbdin@pkrisc.cc.ukm.my
3) Faculty of Science and Technology, Kolej Universiti Islam Malaysia, C/O Poly-Tech MARA, Section 14,
43650 Bandar Baru Bangi, Selangor Darul Ehsan, Malaysia
e-mail : nikzed@yahoo.com
Abstract
Room temperature methanol extraction of the roots of Goniothalamus macrophyllus yielded
about 4.6% of crude product. Separation of components by standard chromatographic
procedures yielded goniothalamin (1) and N-methylaristolactam (10-N-methyl-3,4-
dimethoxyphenanthrene-1-carboxylic acid lactam) (2). The structures were elucidated by 1D
and 2D NMR, UV, IR and mass spectrometry.
Keywords: Annonaceae; goniothalamin; Goniothalamus macrophyllus; N-
methylaristolactam
1. Introduction 2. Experimental
The genus Goniothalamus (Annonaceae) General
comprises some 115 species of shrubs and Melting points were determined using a
trees, which grow in Asia (Airy-Shaw 1966). In Electrothermal melting point apparatus. IR
the tropical rain forest of Malaysia, there were spectra were measured as KBr discs and
around 44 species existed (Din et al. 1991). recorded on a Perkin Elmer GX spectrometer
The study of Goniothalamus spp. plants which where UV spectra were obtained on Shimadzu
started in 1972 has seen significant UV-160 spectrophotometer. Mass spectra were
development in the last 20 years with more performed on a QP 5050A spectrometer. The
1
compounds being identified such as H, 13C NMR (1D and 2D), HMQC and HMBC
styrylpyrones (Zhang et al. 1999), spectra were carried out on a JEOL NMR 400
furanopyrones (Fang et al. 1991), acetogenins MHz in CDCl3 with TMS as internal standard.
(Alali et al. 1999), alkaloids (Lu et al. 1985),
Plant material, isolation and purification
flavonoids (Siedel et al. 2000), as well as
The roots of G. macrophyllus were collected
sesquiterpenes (Ee et al. 2001). The bioactivity
from the forest of Tasik Chini, Pahang. A
of compounds derived from these plants has
voucher specimen (SM 380) is deposited at the
stirred interest among the bioscientists to
Universiti Kebangsaan Malaysia Herbarium
investigate the anti-cancer, anti-tumor, anti-
(UKMB). Powdered roots of G. macrophyllus
inflammatory and immunosuppressive
(820g) were soaked in methanol for three times
properties. Most of the studies have been
(4 x 2.5L x 3 days). The combined extracts
conducted on the leaves and stem barks of the
were filtered and the solvent was removed
Goniothalamus. In this paper, work on the roots
under vacuum using a rotary evaporator and as
of Goniothalamus macrophyllus will be
the result, a dark brown liquid (38g) has been
presented.
yielded. The crude was then flash
196
th
Departement of ChemistryProceeding
ITB, Jl. Ganesha 10, 6
of The Bandung 40132,Joint
ITB-UKM PhoneSeminar
: +62 (22)on
2502103 ext 101,
Chemistry
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Bong Pei Thing , Laily B. Din dan Nik Idris Nik Yusoff
Abstrak
Linear alkilbenzena sulfonat (LAS) adalah campuran senyawa-senyawa nonvolatil yang
dihasilkan dari sulfonasi linear alkil benzena. LAS merupakan bahan pembersih yang
terdapat dalam deterjen.
Penggunaan deterjen telah digunakan secara luas oleh berbagai industri maupun
masyarakat, dimana limbah cairnya dibuang langsung ke alam tanpa melalui proses
pengolahan dan menyebabkan polusi lingkungan. Telah dilaporkan bahwa LAS bersifat toksik
terhadap mahluk hidup aquatik.
Dalam makalah ini akan dilaporkan hasil penelitian tentang optimasi biodegradabilitas
mikrobiologi air terhadap LAS berdasarkan waktu paruhnya (DT50) dan identifikasi serta uji
toksisitas relatif produk intermediet yang dihasilkan. Pada konsentrasi medium yang
digunakan (20 ppm), waktu adaptasi dan pertumbuhan bakteri Acinetobacter sp telah
menunjukan kemampuan biodegradasi yang lebih baik dari ketiga jenis bakteri lainnya
(Pseudomonas putida, pseudomonas fuorecence, Bacillaria spp), sehingga bakteri tersebut
digunakan untuk penelitian lebih lanjut terhadap biodegradasi LAS.
Berdasarkan waktu paruh untuk biodegradasi LAS dalam kultur Acinetobacter sp yaitu ±
52,32 % dan kultur campuran yaitu ± 46,82 % tercapai pada hari ke-4, maka LAS dapat
dikategorikan sebagai senyawa yang mudah terdegradasi.
Uji toksisitas berdasarkan reduksi tetrazolium dye dengan bakteri Rhizobium meliloti yang
mengakibatkan peningkatan warna, jika senyawa toksik merusak membran plasma maka
intensitas warna akan berkurang. LAS sebagai senyawa induk bersifat lebih toksik
dibandingkan produk intermediet hasil degradasinya dengan nilai IC50 = 34,35 ppm,
sedangkan produk intermedietnya yaitu bahan Ac dan bahan Cm masing-masing adalah
446,19 ppm dan 111,28 ppm.
Identifikasi produk intermediet menggunakan analisis IR dan LC-MS menunjukkan bahwa
dalam produk tersebut masih terdapat gugus-gugus fungsi benzena, asam benzoat, hidroksil,
karbon alifatik, dengan berat molekul yang masih besar. Dengan demikian proses
biodegradasi LAS hingga tercapai waktu paruh hanya terjadi reaksi pada rantai karbon
alifatik, belum sampai pada tahap pembukaan cincin aromatik.
Kata kunci :Linear Alkilbenzena Sulfonat (LAS), Tetrazolium dye, Biodegradasi, Rhizobium
meliloti
berbahaya menjadi senyawa yang tidak bakteri anaerobik ditekan pada konsentrasi
berbahaya, diantaranya adalah melalui proses sulfonat 15 g/kg dalam kondisi tes. Dalam
biodegradasi. Penggunaan mikroorganisme reaktor pada konsentrasi yang tinggi (> 30
secara langsung dalam proses perlakuan air g/kg) sodium sulfonat sulit dilarutkan sehingga
limbah adalah usaha yang sangat sederhana dan mengurangi bioaktivitas, dan ini berarti bahwa
ekonomis dalam pemanfaatan kemampuan senyawa ini sangat keras (AISE & CESIO,
mereka untuk beradaptasi dengan spesifik dan 1999).. Dalam ekotoksikologi, sejumlah besar
mendegradasi senyawa berbahaya (Fujita & test mendapatkan bahwa LAS dapat
Ike, 1994). Deterjen atau bahan pembersih menyebabkan toksisitas akut dan kronik pada
sejenis lainnya merupakan senyawa kimia yang organisme akuatik. LAS dengan konsentrasi
banyak digunakan dalam domestik maupun 20-30 % larutan dapat menyebabkan kerusakan
industri. Bahan-bahan ini diketahui merupakan jaringan pada tikus setelah kontak kulit lebih
salah satu penyebab utama pencemaran tanah dari 15 hari. Pada konsentrasi 25 mg/L LAS,
ataupun sumber air bagi makhluk hidup. ikan bereaksi dengan pola meningkatnya
aktivitas, inaktivasi dan immobolisasi, dan jika
Linear Alkilbenzena Sulfonat (LAS) adalah
tidak dihilangkan dari sistem akan
surfaktan anionik yang digunakan secara luas
menyebabkan kematian. Efek minimal yang
untuk menggantikan golongan Alkil Benzena
berhubungan dengan perubahan biokimia dan
Sulfonat (ABS) sebagai bahan pembersih
hispatologi dalam liver telah dilaporkan dalam
(detergen). Produksi dunia tahunan untuk
studi subkronik terhadap tikus yang diberi
surfaktan tidak termasuk sabun, dalam tahun
konsentrasi LAS 120 mg/kg berat badan
1990 diperkirakan mencapai 7 juta ton.
perhari di dalam makanan atau air minum.
Sedangkan pada tahun 1997 produksi surfaktan
meningkat mencapai 18 juta ton. Sejak tahun Berdasarkan pengamatan mengenai amat
1990, LAS menjadi perhatian peneliti karena vitalnya kebutuhan air dan cukup tingginya
terbukti residu LAS ditemukan pada limbah pemakaian LAS oleh masyarakat dan industri,
lumpur yang digunakan untuk lahan pertanian. sedangkan telah diketahui bahwa LAS bersifat
Hasil penelitian menunjukkan bahwa LAS toksik dan waktu biodegaradasi LAS 100 %
terdistribusi predominan dalam air (97,5 %), membutuhkan waktu beberapa hari, maka
tanah (0,5 %) dan sedimen (2 %). penelitian ini difokuskan pada optimasi
kemampuan biodegradabilitas mikrobiologi air
LAS mampu dibiodegradasi di bawah kondisi
terhadap LAS serta karakteristik dan toksisitas
aerobik. Degradasi aerobik melewati rute
relatif produk intremediet hasil degradasi LAS
degradasi secara umum yang dinamakan ώ-
terhadap bakteri Rhizobium meliloti. Hal ini
oksidasi pada kelompok rantai alkil terminal
dilakukan untuk memprediksi apakah produk
asam karboksil dan selanjutnya β-oksidasi pada
intermediet hasil degradasi tersebut aman bagi
siklus asam lemak menghasilkan CO2, H2O dan
lingkungan atau bahkan lebih toksik
SO42-Telah dilaporkan bahwa Pseudomonas
dibandingkan senyawa asalnya. Penelitian ini
Spp sanggup untuk tumbuh pada beberapa
difokuskan dengan tujuan pada optimasi
aromatik sulfonat (Focht & William, 1970).
kemampuan biodegradabilitas mikrobiologi air
Pseudomonas spp resisten terhadap kelaparan
tehadap LAS serta identifikasi dan toksisitas
dan dapat tetap hidup saat periode lama dalam
relatif produk intermediet hasil degradasi LAS
ekosistem yang mengandung populasi
terhadap bakteri Rhizobium meliloti. Adapun
mikrobial alami. Bakteri alami Comamonas
produk intemediet yang dimaksud adalah
testosteroni T-3, mempunyai kemampuan
produk yang terbentuk setelah waktu paruh
mendegradasi P-toluen sulfonat (pTS) sebagai
(Degradation Time) DT50 untuk memprediksi
model senyawa aromatik (Locher, 1991).
apakah produk intermediet hasil degradasi
Sedangkan dalam biodegradasi, LAS
aman bagi lingkungan atau bahkan lebih toksik
membutuhkan keberadaan komunitas beberapa
dibandingkan senyawa asalnya.
spesies bakteri termasuk Flavobakterium sp.,
Pseudomonas spp., dan Acinetobacter sp.
(Chhabra, 1996). 2. Percobaan
LAS sangat sedikit didegradasi di bawah
kondisi anaerobik. Hal ini dikarenakan rantai 2.1 Bahan: Bahan-bahan yang digunakan
alifatik tidak dapat direduksi lebih lanjut, dan dalam penelitian ini adalah sebagai berikut :
Linear alkilbenzena sulfonat (LAS), Nitro Blue Penentuan Biomassa Bakteri: Pertumbuhan
Tetrazolium dye C40H30Cl2N10O6 (2,2’-Di-p- bakteri diamati dengan mengukur optikal
nitrofenil-5,5’ difenil-3,3’-[3,3’-dimetoksi-4,4’- densitas menggunakan spektrofotometer sinar
difenilen]-tetrazolium klorida), etanol teknis tampak pada panjang gelombang, λ= 600 nm.
70%, agar batang, aquabidest, Na2HPO4, Selanjutnya Biomassa dan sampel dipisahkan
KH2PO4, NaCl, NH4Cl, glukosa, dari supernatannya dengan cara sentrifugasi
MgSO4.7H2O,CaCl2, Mannitol, yeast, agar dan selama 10 menit pada kecepatan 16.000 rpm.
sampel air dari waduk Setia Budi Jakarta Pusat
Analisis kadar LAS dan Produk Intermediet
dan Bakteri Pseudomonas putida,
Hasil degradasi untuk mengetahui perubahan
Pseudomonas fuorecence, Bacillaria spp,
konsentrasi substrat selama waktu inkubasi dan
Acinetobacter sp (bakteri didapat dalam bentuk
produk degradasi, dilakukan secara analisis
terinokulasi dari LIPI Mikrobiologi Bogor yang
dengan HPLC.
merupakan hasil isolasi dari sampel air dari
waduk Setia Budi Jakarta Pusat), dan bakteri Identifikasi Senyawa Intermediet Hasil
Rhizobium meliloti. Degradasi LAS
Identifikasi produk inetmediet hasil degradasi
2.2Peralatan: Alat-alat yang digunakan adalah
LAS dilakukan dengan HPLC-MS dan
sebagai berikut : Sentrifugasi, Autoklaf,
Spektrometer IR.
spektrometer UV-Vis, mikroskop, jarum ose,
pH meter, HPLC-MS (High Performance 2.4 Perlakuan Terhadap Sampel Air
Liquid Chromatography – Mass Spectrometer), Tercemar
Spektrofotometer Infra Merah (IR) dan Isolasi Bakteri
peralatan gelas lainnya. Sampel air yang tercemar LAS diambil dari
waduk Setia Budi, Jakarta yang merupakan
2.3 Cara Kerja
tempat pembuangan limbah domestik dan
Uji Pendahuluan
industri terutama limbah deterjen. Bakteri
Kultivasi Mikrooorganisme : Ke dalam labu
diisolasi untuk mengetahui bakteri
erlenmeyer yang telah berisi medium MSM +
pendegradasi LAS di alam. Isolasi bakteri
LAS (konsentrasi 10, 20, dan 30 ppm) dan
dalam penelitian ini dilakukan oleh Pusat
larutan blanko, masing-masing ditambahkan
Penelitian dan Pengembangan Mikrobiologi-
bakteri Pseudomonas putida, Pseudomonas
LIPI Bogor.
fluorescent, Bacilus subtilis, dan Acinetobacter.
Kemudian semua larutan diinkubasi pada suhu Pengukuran Konsentrasi LAS
kamar dengan laju pengocokan 200 rpm. Konsentrasi LAS ditentukan secara
Pengamatan dilakukan terhadap pertumbuhan Kromatografi Cair Kinerja Tinggi (KCKT) atau
bakteri dengan mengukur nilai optikal HPLC.
densitasnya menggunakan spektroskopi sinar
2.5Uji Toksisitas Produk Intermediet hasil
tampak pada panjang gelombang 600 nm.
degradasi LAS
Pengujian Kemampuan Isolat/Perlakuan Kultur Rhizobium meliloti dalam Medium
Biodegradasi Padat Luria Berthany (LB): Sebanyak 1 lup
Pengujian kemampuan isolat untuk perlakuan kultur bakteri Rhizobium meliloti inokulasikan
biodegradasi selanjutnya adalah terhadap pada media padat LB (10 g tripton, 5 kg ekstrak
larutan arisifisial yang mengandung konsentrasi yeast, 5 g NaCl, dan 15 gr agar) secara aseptis
LAS dengan pertumbuhan bakteri yang paling dan diinkubasikan pada 37°C selama 24 jam,
optimum dari hasil uji pendahuluan. dilakukan regenerasi berulang sebelum siap
digunakan.
Dari data yang diperoleh dari uji pendahuluan
tersebut didapat hasil optimal menggunakan Pertumbuhan Bakteri Rhizobium meliloti:
bakteri Acinetobacter sp dan campuran Rhizobium meliloti ditumbuhkan dalam
mikroorganisme dengan konsentrasi LAS 20 medium YEMA (0,5 g K2HPO4; 0,2 g MgSO4;
ppm. Campuran mikrooorganisme digunakan 0,1 g NaCl, 3 g CaCO3, 10 g Mannitol, 20 g
dalam uji ini untuk membandingkan optimasi Agar (untuk medium padat); 0,5 g yeast; 0,2 g
biodegradasinya dengan optimasi biodegradasi KH2PO4; 0,2 g (CH4)2SO4, dan 0,1 g CuSO4).
bakteri tunggal. Bakteri Rhizobium meliloti dari kultur media
padat LB dinokulasikan ke medium ini dan
diinkubasikan selama 8 jam. Sel dipanen dari merupakan konsentrasi senyawa kimia yang
medium YEMA, lalu dikumpulkan dengan dihasilkan dalam 50 % penurunan absorban
sentrifugasi (1000 rpm) dan dicuci dua kali jika data yang ada tidak dapat digunakan.
dengan 0,2 M buffer fosfat, pH 7,5. Setelah sel
4. Hasil dan Pembahasan
dicuci lalu diresuspensikan dalam buffer fosfat
Penelitian ini bertujuan untuk mengetahui
sampai absorban 0,3 (550 nm).
waktu dan kemampuan optimasi biodegradasi
Uji Toksisitas: Uji dibentuk dengan bakteri alam serta untuk identifikasi produk
mencampurkan buffer Tris HCl (0,1 M, pH intermediet hasil degradasi LAS sebagai bahan
7,5), 1,2 ml sampel (variasi konsentrasi atau utama deterjen, disamping sifat toksisitasnya.
volume senyawa toksik dimana uji tetap Untuk itu dilakukan pengukuran biomassa
diperlakukan dalam volume tabung yang (turbiditas) dan perubahan konsentrasi LAS
konstan), dan 1 ml sel dalam tabung 13 x 110 selama proses degradasi. Pengukuran turbiditas
mm. Absorban ini diukur pada waktu = 0 menit didasari oleh adanya konsumsi subtrat oleh
pada 550 nm. Selanjutnya 0,1 ml MTT bakteri, sehingga bakteri tumbuh dan
(tetrazolium dye), 0,0012 M ditambahkan ke berkembang biak dalam sampel yang diuji
dalam setiap tabung dan dikocok dengan vortek selama masa inkubasi. Selain itu, untuk
dan tabung diinkubasi pada 30°C dengan water mengetahui apakah produk hasil biodegradasi
bath. setelah 20 menit inkubasi absorban tersebut masih bersifat toksik atau bahkan lebih
kembali diukur. Selisih absorban antara T = 0 toksik dari senyawa asalnya, maka dilakukan
dan absorban akhir merupakan “absorban” identifikasi dan sifat toksisitas produk
yang digunakan dalam perhitungan toksisitas. intermediet hasil biodegradasi.
Perhitungan Toksisitas: Untuk perhitungan Pengambilan produk intermediet dibatasi pada
toksisitas, data diplotkan dalam bentuk grafik waktu tercapai Degradation Time (DT50), yaitu
yang merupakan variasi konsentrasi atau suatu ukuran waktu dimana 50 % senyawa
volume sampel pada sumbu-X dan absorban induk hilang atau terurai dalam tanah atau air.
pad sumbu –Y. Regresi linear diukur dengan Selain itu LAS merupakan senyawa kimia
Y= mx + B, dimana Y adalah absorban kontrol, xenobiotik polutan di badan air, telah
yaitu sampel tanpa senyawa toksik: m adalah dilaporkan dari studi sebelumnya bahwa
slope garis regresi; B adalah Y intersep (nilai biodegradasi LAS 100% membutuhkan waktu
untuk Y saat x = 0); Y/2 adalah nilai untuk beberapa hari, sedangkan air merupakan
absorban dengan reduksi penghambatan dye 50 kebutuhan yang sangat vital bagi masyarakat.
%; x adalah konsentrasi senyawa toksik yang Dengan demikian adalah penting untuk
dihasilkan dari 50 % pengahamtan reduksi dye mengetahui bagaimana toksisitas senyawa
yang diukur dari absorban Ykontrol /2. Nilai yang kimia yang terbentuk selama proses
didapat ini mengacu sebagai IC50 (Konsentrasi biodegradasi.
Penghambatan 50 %). Jika R2 untuk koefisien Berdasarkan pertimbangan-pertimbangan
regresi < 0,080 data tidak digunakan. seperti yang tertera diatas maka penelitian ini
Persamaan ini dapat dirumuskan : dibagi menjadi tiga tahap, tahap pertama adalah
uji pendahuluan, uji ini untuk mengetahui
kemampuan mikroorganisme bakteri yang
y mampu mendegradasi LAS, tahap kedua adalah
2 -B
x= pengujian ulang terhadap kemampuan bakteri,
m tahap ketiga adalah identifikasi dan uji
toksisitas produk intermediet hasil
biodegradasi.
y/2 – B
Log x = ________ Penelitian ini adalah penelitian awal dimana uji
m toksisitas dengan organisme bakteri diharapkan
menjadi uji penapisan pendahuluan yang dapat
mengeliminasi beberapa tahapan uji untuk
penelitian lebih lanjut terhadap bahan-bahan
Untuk beberapa senyawa kimia antilog pada kimia yang bersifat toksik atau identifikasi
log x terkadang harus digunakan yang
2
2
1.5
Optikal Densitas
Optikal Densitas
pp 1.5 pp
pf pf
1
bac bac
acineto 1 acineto
0.5
0 0.5
2 4 6 8 10 2 4 6 8 10
Hari Hari
(a) (b)
1.5
Optikal Densitas
pp
pf
1 bac
acineto
0.5
0
2 4 6 8 10
Hari
(c)
Gambar 1. Kurva Optikal Densitas Bakteri pada Konsentrasi LAS (a) 10 ppm, (b) 20 ppm dan
(c) 30 ppm
awal yang identik dengan sifat mutagen atau pertumbuhan bakteri pada konsentrasi LAS 20
karsinogen suatu bahan kimia. ppm berjalan optimal dan pada konsentrasi
LAS 30 ppm, pertumbuhan bakteri kembali
lambat. Hal ini dapat dijelaskan sebagai
Uji Pendahuluan Bakteri Pendegradasi berikut: pada konsentrasi LAS 10 ppm,
LAS: Untuk mengamati kenaikan biomassa
pertumbuhan bakteri sangat lambat, disebabkan
terhadap pertumbuhan koloni-koloni pada LAS yang digunakan sebagai substrat untuk
media uji dengan konsentrasi LAS 10, 20, dan pertumbuhan bakteri kurang mencukupi untuk
30 ppm, maka dilakukan pengukuran jumlah bakteri yang ada dalam media.
absorbansi terhadap turbiditas bakteri pada Sedangkan dalam media yang mengandung
setiap waktu sampling. Analisis dilakukan pada konsentrasi LAS 20 ppm, pertumbuhan bakteri
panjang gelombang maksimum, λ = 600 nm. lebih tinggi atau lebih optimal dibandingkan
Adanya kenaikan turbiditas mengindikasikan dalam media yang mengandung LAS 10 ppm,
bahwa bakteri tersebut mampu memanfaatkan yang berarti bahwa konsentrasi LAS 20 ppm
substrat sebagai makanannya untuk digunakan dapat dimanfaatkan oleh bakteri-bakteri yang
pada proses perkembangbiakannya. Hasil ada dalam media sebagai substrat atau
pertumbuhan bakteri yang mampu mencukupi untuk pertumbuhannya. Sedangkan
mendegradasi LAS pada media dapat dilihat pada konsentrasi LAS 30 ppm pertumbuhan
pada Gambar 1. bakteri mulai mengalami penurunan kembali,
Dari sejumlah faktor-faktor yang dapat karena LAS yang terdapat dalam medium
mempengaruhi kecepatan biodegradasi merupakan senyawa racun, sehingga dalam
diantaranya adalah ukuran populasi, daya konsentrasi tinggi akan semakin menghambat
adptasi dari mikroba dalam hal ini jenis bakteri proses adaptasi atau pertumbuhan bakteri.
yang digunakan dan jumlah konsentrasi Pada konsentrasi 20 ppm di atas yang dipilih
senyawa kimia yang didegradasi. untuk uji selanjutnya, dapat dilihat bahwa dari
Dari Gambar 1 dapat dilihat bahwa keempat jenis bakteri yang ada (Pseudomonas
pertumbuhan berjalan lambat untuk semua jenis putida, Pseudomonas flurocence, Bacillaria
bakteri pada konsentrasi LAS 10 ppm, spp, Acinetobacter sp), bakteri Acinetobacter
120
80
kultur Acinetobacter
60
kultur Campuran
40
20
0
0 2 4 6 10
Hari
substrat tersebut oleh inokulum bakteri yang bakteri yang digunakan sebagai inokulum
digunakan (Widodo, 2001). Dalam uji ini dalam mendegradasi senyawa LAS.
konsentrasi LAS yang digunakan adalah 20
ppm.
Hal ini menunjukkan hasil yang lebih baik
dari pada laporan penelitian sebelumnya
Dari kedua kultur yang ada, yaitu kultur bakteri (Chhabra, 1996), yang menyatakan bahwa
Acinetobacter dan campuran, Gambar 3 waktu paruh untuk biodegradasi aerobik
menunjukkan bahwa mulai hari kedua, LAS adalah 1-8 hari di dalam air sungai, 1-
konsentrasi substrat dalam kultur bakteri
2 hari dalam sedimen, dan 5-10 hari dalam
Acinetobacter sudah menurun hingga 28,93 %,
sedangkan kultur campuran 20,43 %. air laut.
Penurunan konsentrasi LAS terus berlangsung Akan tetapi, jika dilihat dari kecepatan
hingga hari ke-10 yaitu 92,42% untuk kultur biodegradasi yang menghasilkan penurunan
bakteri Acinetobacter dan 95,28 % untuk kultur konsentrasi LAS hingga > 90%, biodegradasi
campuran. kultur campuran lebih cepat dibandingkan
kultur Acinetobacter dalam mendegradasi LAS
Untuk menentukan mudah tidaknya suatu hanya hingga tercapai waktu paruh, setelah itu
senyawa dapat terdegradasi, maka dilakuan kemampuan mendegradasi sedikit menurun.
penentuan waktu paruh DT50, yaitu suatu Sedangkan pada kultur campuran, dimana
ukuran dimana senyawa induk hilang atau terdapat beberapa bakteri yang didalamnya juga
terurai dalam tanah atau air. Berdasarkan terdapat Acinetobacter, setelah pencapaian
klasifikasi ini seperti yang tertera dalam waktu paruh, aktivitas degradasi masih tetap
Gambar 3, yaitu tercapainya DT50 untuk kedua berkompeten dilaksanakan oleh bakteri-bakteri
kultur terjadi pada hari ke-4, dimana jika nilai lain dalam medium. Fenomena ini juga sesuai
DT50 < 20 hari, maka LAS dapat dikategorikan dengan penelitian sebelumnya yang
sebagai senyawa yang mudah terdegradasi menyebutkan bahwa dalam biodegradasi, LAS
(OECD, 2000). membutuhkan keberadaan komunitas beberapa
Berdasarkan klasifikasi ini juga dapat dilihat, spesies bakteri termasuk Flavobakterium sp.,
bahwa waktu paruh DT50 untuk biodegradasi Pseudomonas spp. dan Acinetobacter sp.
LAS dalam kultur Acinetobacter yaitu ± 52,32 dengan hasil degradasi mencapai 90% pada
% tercapai pada hari ke-4, sedangkan untuk hari ketujuh (Chhabra, 1996).
kultur campuran yaitu ± 46,82 %. Dari Chhabra (1996) menyatakan bahwa
persentasi yang dicapai dalam kedua kultur keberhasilan biodegradasi akhir LAS
dapat disimpulkan juga bahwa proses (sedikitnya 80 %) secara normal membutuhkan
biodegradasi oleh kultur Acinetobacter lebih aktivitas beberapa spesies bakteri. Beberapa
baik dibandingkan kultur campuran. Fenomena mikrooorganisme seperti Acinetobacter
ini seperti telah diterangkan di atas bahwa merupakan bakteri pendegradasi senyawa
faktor-faktor seperti kompetisi antar alifatik, sedangkan untuk degradasi senyawa
mikrooorganisme dalam medium aromatik lebih berpotensi dilakukan oleh
mempengaruhi proses biodegradasi dalam bakteri lain seperti Pseudomonas, Bacillus sp
kultur campuran. selain hal tersebut juga dapat dan lain-lain.
disebabkan adanya perbedaan kemampuan
0.45
0.4
0.35
0.3
Absorban
0.25 Bahan Ac
0.2 Bahan Cm
0.15
0.1
0.05
0
0 100 200 300 400
Volume
Dengan membandingkan pengukuran kenaikan akan berkurang. Dari Gambar 4 dapat dilihat
turbiditas bakteri dan penerunan konsentrasi bahwa absorbansi bahan Ac, dengan kenaikan
LAS, dapat disimpulkan bahwa bakteri yang jumlah volume zat menyebabkan kenaikan
digunakan mampu mendegradasi LAS dengan jumlah absorban. Hal ini berlawanan dengan
memanfaatkan LAS sebagai sumber karbonnya. prinsip percobaan yang seharusnya dengan
penambahan konsentrasi atau volume zat uji
3.3 Uji Toksisitas
terjadi penghambatan reduksi sehingga
Untuk mengetahui apakah produk hasil
intensitas warna berkurang. Perhitungan IC50
degradasi tersebut aman bagi lingkungan atau
adalah 1427,83 µl, dengan R = 0,63. Botsfort
bahkan lebih toksik dari senyawa asalnya,
et.al (1996) serta Rolf & Sokal (1981)
maka dilakukan uji toksisitas terhadap produk
menyatakan bahwa jika koefisien regresi < 0,8,
intermediet hasil degradasi LAS dari kultur
maka percobaan dibuang sebagai data statistik
Acinetobacter dan kultur campuran. Dalam
yang diragukan.
penelitian ini, uji toksisitas dilakukan dengan
menggunakan organisme indikator yaitu bakteri Akan tetapi, jika perubahan absorban zat uji
Rhizobium meliloti. Hasil uji toksisitas dibandingkan dengan absorban kontrol, terjadi
ditunjukkan dalam Gambar 4. penurunan intensitas warna oleh zat uji walau
sedikit. Untuk itu karena koefisien regresi
Selanjutnya, untuk memudahkan penyebutan,
untuk bahan Ac < 0,8., maka dilakukan
maka dilakukan penamaan terhadap produk
pengukuran absorban vs log konsentrasi bahan
intermediet dari kedua kultur ini, yaitu bahan
Ac. Antilog x adalah nilai IC50 = 4,12 x !05 µl
Ac dari kultur Acinetobacter dan bahan Cm
dengan R = 0,896.
dari kultur campuran.
Pada bahan Cm, dapat terlihat bahwa
Tujuan dari percobaan ini adalah untuk
penurunan absorban berbanding terbalik
mengukur tingkat kerentanan bakteri
dengan kenaikan volume bahan uji yang
Rhizobium meliloti yang digunakan terhadap
ditambahkan. Nilai IC50 = 356,89 µl dengan R
perusakan sel pada sistem transport elektronnya
= 0,94. Data ini menunjukkan bahwa bahan uji
oleh produk inetrmediet hasil degradasi LAS,
dari kultur campuran bersifat toksik dan
serta menyatakan toksisitas relatif terhadap
mampu merusak sistem transport elektron
Rhizobium meliloti dengan IC50, yaitu
dengan menghambat reduksi dye oleh bakteri.
konsentrasi atau volume zat yang dapat
mengahambat 50 % reduksi dye yang dihitung Sebagai pembanding kedua bahan di atas, maka
sebagai absorban. Parameter ini sebanding dalam penelitian ini, juga dilakukan uji
dengan LD50 (Bostfort, 1996). toksisitas terhadap LAS sebagai senyawa induk
(lihat Tabel 1).
Uji ini didasari pada reduksi dye oleh bakteri
yang dapat menyebabkan peningkatan warna Nilai IC50 dari LAS adalah 34,35 ppm, R =
atau optikal absorban, jika toksik merusak 0,899. Data ini sesuai dengan penelitian
membran sitoplasma, maka akan menghambat sebelumnya yang menyatakan bahwa LAS
transport elektron sehingga intensitas warna dengan konsentrasi yang tinggi (> 20 - 30 ppm)
Bahan Cm
Tabel 1. Uji Toksisitas LAS dalam
2950,80 – 3157,84 merupakan pita serapan
Variasi Konsentrasi
vibrasi ulur sangat lebar dari gugus asam
karboksilat (COOH)
Senyawa LAS
Konsentrasi Absorban 3566,46 merupakan pita serapan vibrasi ulur
0 0.384 dari gugus hidroksil (OH)
10 0.245
20 0.246 2838,42 merupakan pita serapan dari gugus
30 0.217 alipatik CH3,CH2, dan CH
40 0.180 1452,27 dan 1653,96 merupakan pita serapan
vibrasi dari gugus C-C aril
dapat menghambat proses degradasi mikrobial
(Chhabra, 1996). Bagaimanapun telah banyak 1021,86 merupakan pita serapan vibrasi ulur
dilakukan penelitian terhadap nilai toksisitas dari SO3
dari LAS. Nilai toksisitas LAS terhadap 687,36 merupakan pita serapan dari benzena
organisme yang berbeda juga bervariasi. LD50 tersubsitusi
untuk garam sodium pada tikus secara oral
adalah 1259 – 2300 mg.kg, sedangkan pada Analisis Kromatografi Cair-Spektrometer
mencit adalah 3000 mg/kg dan pada kulit Massa (LC-MS)
marmut adalah 60 mg/kg. Efek reproduktif, Senyawa LAS
termasuk penurunan rata-rata kehamilan Analisis LC untuk LAS mengahsilkan waktu
dilaporkan dalam hewan yang diberi dosis > retensi (Rt) pada 3,8 menit. Sedangkan untuk
300 mg/kg (Folke dan Landner, 2000). MS, fragmen ion [M+H2]+ dengan m/z =
350,9995, selanjutnya terbentuk pola fragmen
Dengan membandingkan IC50 dari ketiga ion [M+( CH2)n + H2]+ dengan m/z =
senyawa di atas maka LAS sebagai senyawa 432,9805., 514,9411., dan fragmen ion [M-
induk bersifat lebih toksik dibandingkan (CH2)n + H2]+ dengan m/z = 269,0211,
produk intermedietnya dengan nilai IC50 dari 187,0407
LAS adalah 34,35 ppm, sedangkan bahan Ac
nilai IC50 = 1427, 83 µl atau 446,196 ppm, dan Bahan Ac
bahan Cm nilai IC50 = 356,89 µl atau 111,28 Spektrum LC-MS dengan waktu retensi yang
ppm. Sedangkan untuk bahan Ac adalah kurang berbeda dan berat molekul yang berbeda
toksik dibandingkan kedua senyawa di atas. memperlihatkan bahwa bahan Ac terdiri dari
berbagai senyawa. Fragmen ion [M+H]+
Identifikasi Produk Intermediet Hasil dengan m/z = 372,8306 adalah turunan asam
Degradasi LAS benzoat (C16H23O5SNa), [M+H]+ dengan m/z =
Analisis Spektrum Infra Merah (IR) 207,0078 adalah C8H9O3SNa, [M+H]+ dengan
:Analisis produk intermediet hasil degradasi m/z = 187 adalah turunan benzil alkohol
LAS dengan spektrum infra merah (IR) (C7H6O4S), [M+H]+ dengan m/z = 155 adalah
memberikan pita-pita serapan pada daerah protokatekuat (C7H6O4).
bilangan gelombang, v, (dalam cm-1) yaitu :
Bahan Cm
Bahan Ac Dari spektrum LC-MS yang menunjukkan
2965,17 – 3331 merupakan pita serapan vibrasi bahwa di dalam bahan Cm terdapat beberapa
ulur sangat lebar dari gugus asam karboksilat senyawa, tetapi lebih sedikit dibandingkan
(COOH) bahan Ac, yaitu : Fragmen ion [M+H]+ dengan
2840,48 merupakan pita serapan dari gugus m/z = 372,8106 adalah turunan asam benzoat
alifatik CH3,CH2, dan CH (C16H23O5SNa), [M+H]+ dengan m/z =
206,8335 adalah C8H9O3SNa.
1452,34 dan 1654,41 merupakan pita serapan
vibrasi dari gugus C-C aril Identifikasi produk intermediet menggunakan
analisis IR dan LC-MS menunjukkan bahwa
1020,75 merupakan pita serapan vibrasi ulur produk tersebut masih terdapat senyawa-
dari SO3 senyawa benzena, asam benzoat, hidroksil,
702,57 merupakan pita serapan dari benzena karbon alifatik, dengan berat molekul yang
tersubsitusi masih besar. Dengan demikian proses
biodegradasi LAS hingga tercapai waktu paruh dengan NIlai IC50 dari LAS adalah 34,35 ppm,
hanya terjadi reaksi pada rantai karbon alifatik, sedangkan bahan Ac nilai IC50 = 1427,83 µl
belum sampai pada tahap pembukaan cincin atau 446,196 ppm, dan bahan Cm nilai IC50 =
aromatik. 356,89 µl atau 111,28 ppm. Sedangkan untuk
bahan Ac adalah kurang toksik dibandingkan
Chhabra (1996) menyebutkan bahwa degradasi
kedua senywa di atas.
LAS dimulai pada rantai panjang akhir linear,
oleh omega dan β-oksidasi menghasilkan asam 3. Identifikasi produk intermdiet menggunakan
sulfofenilmono-karboksilat. Senyawa analisis IR dan LC-MS menunjukkan bahwa di
intermediet ini selanjutnya mengalami oksidasi dalam bahan tersebut masih terdapat gugus-
pada cincin aromatik dan terjadi pembukaan gugus fungsi benzena, asam benzoat, hidroksil,
gugus sulfonat. karbon alifatik, dengan berat molekul yang
masih besar. Dengan demikian proses
4. Kesimpulan dan Saran
biodegradasi LAS hingga tercapai waktu paruh
4.1.Kesimpulan
hanya terjadi pada rantai karbon alifatik, belum
1. Dalam uji kemampuan ulang biodegradasi:
sampai pada tahap pembukaan cincin aromatik.
Berdasarkan persentase penurunan
5. Daftar Pustaka
jumlah LAS pada DT50 maka kultur AISE & CESIO, 1999. Anaerobic Biodegradation of
Acinetobacter, menunjukkan % Surfactant, Review of Scientific Information, CEFIC,
penurunan yang lebih besar Brussels, Belgium.
dibandingkan kultur campuran dalam
Botsford J. L 1996. Reduction of Tetrazolium Dye
medium.
by Rhizobium meliloti: A possible assay for toxic
Berdasarkan tercapainya DT50, dimana chemical, Can. Jour. Microbial., Submitted
waktu paruh untuk kedua kultur tercapai Chhabra, R.S, et al, 1996. Linear
pada hari ke-4, maka LAS dapat Alkylbenzenesulfonates and Related Compounds,
dikategorikan sebagai senyawa yang International Programme on Chemical Safety
mudah terdegradasi. (IPCS), Geneva.
Dilihat dari kecepatan biodegradasi yang Folke J., and Landner L., 2000. Risk Assessment of
menghasilkan penurunan konsentrasi LAS in Sewage and Soil. European Environmental
LAS hingga > 90 %, biodegradasi kultur Research Group Inc. Stockholm, ed. 3.5, doc. no.
campuran lebih cepat dibandingkan 20002.
kultur tunggal Acinetobacter, hal ini Fujita M., & Ike M.,1994. Wastewater treatment
disebabkan oleh pengaruh kemampuan using genetically engineered microorganisms,
optimasi aktivitas biodegradsi Technomic Publishing Company, Inc., Lancaster,
mikroorganisme. USA.
Locher H. H., 1991. Bacterial Degradation of p-
Dengan membandingkan pengukuran
ToluenSulfonate and Related Aromatic Sulfonic
kenaikan turbiditas bakteri dan waktu Acid; Characterization of Degradative Pathways and
paruh yang dicapai terhadap penurunan Enzymes, Ph. D. Thesis, Diss. ETH Nr.9434, Swiss
konsentrasi LAS, dapat disimpulkan Federal Institute of Technology, Zurich,
bahwa bakteri yang digunakan mampu Switzerland.
mendegradasi LAS dengan
Organization for Economic Co-operation and
memanfaatkan LAS sebagai sumber Development (OECD), 2000
karbonnya.
Widodo A., 2001. Studi Pendahuluan Pemanfaatan
2. LAS sebagai senyawa induk bersifat lebih Mikroorganisme Tanah untuk Mendegradasi
toksik dibandingkan produk intermedietnya Senyawa 2,4-diklorofenol, Skripsi.
Abstrak
Perkembangan teknologi membran di Indonesia tidak sepesat di negara lain karena
kelangkaan membran sebagai produk lokal. Untuk itu perlu dilakukan upaya pemanfaatan
kekayaan alam Indonesia sebagai bahan baku membran. Pulp abaka ((Musa textilis) yang
sudah diputihkan merupakan salah satu sumber selulosa dari bahan nonkayu (nonwood) yang
telah dimanfaatkan dalam penelitian ini untuk pembuatan membran selulosa asetat.
Penelitian dilakukan dalam tiga tahap yaitu asetilasi pulp abaka, pembuatan membran
selulosa asetat dan karakterisasi membran. Proses asetilasi dengan asam asetat dan asam
sulfat sebagai katalis menghasilkan selulosa asetat dengan kadar asetil 40,23 %. Spektrum
FTIR membuktikan adanya puncak serapan gugus asetil yang khas pada 1238 cm-1. Berbagai
analisa telah dilakukan yaitu penentuan massa molekul relatif rata-rata viskositas, kadar
asetil dan derajat kristalinitas. Pembuatan membran mikrofiltrasi dilakukan dengan metoda
inversi fasa dan pengendapan secara pencelupan. Komposisi optimal yang diperoleh adalah
14 %(b/b) selulosa asetat, 78 %(b/b) aseton dan 8 %(b/b) formamida. Hasil karakterisasi
membran pada tekanan 2 kg/cm2 menunjukkan fluks air sebesar 39,2 L/m2.h dan koefisien
rejeksi sebesar 99,3 % terhadap dekstran T-2000. Membran yang dibuat dari selulosa asetat
komersial dengan komposisi yang sama ternyata mempunyai fluks air sebesar 2,8 L/m2.h dan
koefisien rejeksi sebesar 99,6 % terhadap dekstran T-2000. Perbedaan fluks yang sangat
besar disebabkan oleh perbedaan massa molekul ke dua jenis selulosa asetat, yang
mengakibatkan perbedaan kerapatan pori membran seperti yang ditunjukkan oleh SEM. Dari
hasil penelitian ini dapat disimpulkan bahwa abaka dapat dimanfaatkan sebagai bahan
membran yang potensial.
Kata kunci: abaka, selulosa asetat, membran mikrofiltrasi, Musa textilis
karakterisasi membran. Proses asetilasi diendapkan dengan air dan endapan yang
dilakukan dengan asam asetat dan asam sulfat diperoleh disaring, dicuci sampai netral dan
sebagai katalis dan hasil yang diperoleh dikeringkan dalam oven pada 60-70 oC.
dikarakterisasi dengan analisa gugus fungsi,
2.4. Penentuan Kadar Asetil Selulosa Asetat
penentuan massa molekul relatif rata-rata
Sejumlah 1 g selulosa asetat dikeringkan pada
viskositas, kadar asetil dan derajat kristalinitas.
100 oC selama 7 jam dan didinginkan dalam
Pembuatan membran mikrofiltrasi dilakukan
desikator. Kemudian dimasukkan ke dalam
dengan cara inversi fasa. Kualitas membran
labu Erlenmeyer bertutup dan ditambahkan 40
yang dihasilkan dibandingkan dengan
mL etanol. Campuran kemudian dipanaskan
membran yang dibuat dari selulosa asetat
pada 60 oC selama 30 menit dan ditambahkan
komersial dengan komposisi yang sama.
40 mL NaOH 0,5 M. Pemanasan dilanjutkan
2. Percobaan pada temperatur yang sama selama 15 menit,
2.1. Bahan yang digunakan kemudian dibiarkan pada temperatur ruang
Penelitian dilakukan dalam tiga tahap yaitu selama 3 hari dalam keadaan tertutup. Setelah
asetilasi pulp abaka, pembuatan membran itu dititrasi dengan larutan HCl 0,5 M dengan
selulosa asetat dan karakterisasi membran. indikator fenolftalein sampai warna merah
Kecuali dekstran yang diperoleh dari muda hilang. Kemudian ditambahkan 1 mL
Pharmacia Fine Chemicals, semua zat kimia HCl 0,5 M dan dibiarkan 24 jam; setelah itu
yang digunakan berasal dari Merck. Untuk campuran dititrasi dengan NaOH 0,5 M dengan
proses asetilasi digunakan asam asetat glasial, indikator fenolftalein. Kadar asetil ditentukan
anhidrida asetat dan asam sulfat pekat. Untuk dari persamaan:
pembuatan membran digunakan formamida dan
% asetil = [(D-C)Ma + (A-B)Mb] x 4,305/W
aseton, sedangkan untuk karakterisasi membran
dengan:
digunakan dekstran T-10, T-40, T-70, T-500
dan T-2000. Untuk penentuan kadar dekstran A = volum NaOH yang diperlukan untuk
digunakan asam sulfat pekat dan fenol. Sebagai titrasi sampel
pembanding digunakan selulosa asetat B = volum NaOH yang diperlukan untuk
komersial yang diperoleh dari Brataco. titrasi blanko
2.2. Alat yang digunakan Mb = molaritas NaOH
Alat yang digunakan adalah berbagai peralatan
gelas, antara lain viskometer Ostwald 150 dan C = volum HCl yang diperlukan untuk titrasi
peralatan lain seperti spektrofotometer FTIR sampel
Perkin Elmer, Spectronic-20, SEM (Scanning D = volum HCl yang diperlukan untuk titrasi
Electron M icrograph) Jeol JSM 35 C, XRD blanko
Diano 2100 E, dan sel berpengaduk (stirred-
cell) Ma = molaritas HCl
2.3. Pembuatan Selulosa Asetat W = berat sampel (g)
Ke dalam labu Erlenmeyer dicampurkan 10 g 2.5. Karakterisasi Selulosa Asetat
pulp Abaka yang sudah diputihkan dan 24 mL Analisa gugus fungsi dilakukan dengan
asam asetat glasial dan diaduk pada 40 oC spektroskopi FTIR dengan sampel pelet KBr
selama 1 jam, kemudian ditambahkan 60 mL dan derajat kristalinitas diukur dengan
asam asetat glasial dan 0,09 mL asam sulfat difraktometer sinar X. Penentuan massa
pekat dan diaduk lagi selama 45 menit pada molekul relatif rata-rata viskositas (Mv)
temperatur yang sama. Campuran didinginkan ditentukan dari pengukuran viskositas berbagai
sampai 18 oC dan ditambahkan 27 mL larutan selulosa asetat dalam aseton dan
anhidrida asetat yang sudah didinginkan pada persamaan Mark-Houwink [η] = K x Mva
16 oC. Selanjutnya ditambahkan 0,6 mL asam dengan nilai K = 1,33 x 10 –3 dan a = 0,616
sulfat pekat dan 60 mL asam asetat glasial dan
diaduk selama 3,5 jam pada 40 oC. Kemudian 2.6. Pembuatan Membran Selulosa Asetat
ditambahkan 30 mL asam asetat 67 % (b/b) Membran datar dibuat dengan metoda inversi
setetes demi setetes selama 2 jam pada 40 oC fasa yang dikembangkan oleh Loeb dan
dan diaduk lagi selama 20 jam pada temperatur Sourirajan dengan prosedur yang telah
kamar. Larutan selulosa asetat yang diperoleh dilaporkan sebelumnya (Radiman (1998)).
(a) (b)
Gambar 1. Spektrum FTIR dari (a) selulosa Abaka (b) selulosa asetat Abaka
dan selulosa asetat komersial. Penentuan kadar berbeda dengan selulosa asetat komersial. Hasil
asetil berguna untuk menentukan jenis selulosa penentuan massa molekul relatif rata-rata
asetat yang diperoleh dari asetilasi. Selulosa viskositas (Mv) menunjukkan bahwa selulosa
monoasetat mempunyai kadar asetil kurang dari asetat Abaka mempunyai rantai polimer yang
35 %(b/b), selulosa diasetat 35-43,5 %(b/b) lebih pendek dibandingkan selulosa asetat
sedangkan selulosa triasetat 43,5-44,8 %(b/b). komersial. Hasil ini didukung oleh nilai derajat
Permeabilitas membran yang dihasilkan sangat kristalinitas selulosa asetat Abaka yang sedikit
tergantung pada derajat asetilasi selulosa asetat. lebih rendah dibandingkan selulosa asetat
Baker (2000) menyatakan bahwa membran komersial.
selulosa asetat komersial umumnya mempunyai
3.3. Pengaruh Komposisi Larutan Cetak
kadar asetil sebesar 40 %(b/b) yang merupakan
terhadap Kualitas Membran Selulosa Asetat
karakteristik selulosa diasetat. Hasil
Abaka
karakterisasi ini menunjukkan bahwa kondisi
Komposisi larutan cetak sangat menentukan
asetilasi yang digunakan dalam penelitian ini
kualitas membran yang dihasilkan. Seperti
menghasilkan selulosa diasetat yang layak
ditunjukkan pada Tabel 2, diperlukan
dipakai untuk proses pemisahan dengan
konsentrasi selulosa asetat minimal untuk
membran, karena nilainya yang tidak jauh
mendapatkan membran dengan sifat mekanik
Tabel 1. Perbandingan karakteristik selulosa asetat Abaka dan selulosa asetat komersial
Tabel 2. Kualitas fisik membran secara kualitatif dari berbagai komposisi larutan cetak
2
fluks(L/m 2.h) fluks (L/m .h)
45 3,5
40
3,0 air
35 air
2,5 deks.T-10
30 deks.T-10
2,0 deks.T-40
25 deks.T-40
20 deks.T-70 1,5 deks.T-70
15 deks.T-500 1,0 deks.T-500
10 deks.T-2000 0,5 deks.T-2000
5 0,0
0 0 20 40 60
0 20 40 60
waktu(menit)
waktu(menit)
(a) (b)
Gambar 3. Permeabilitas air dan dekstran (a) membran selulosa aseta Abaka dan (b) membran
selulosa asetat komersial
Tabel 3. Koefisien rejeksi membran selulosa asetat Abaka dan membran selulosa asetat komersial
yang sesuai untuk proses pemisahan yang bervariasi antara 1 x 104 hingga 2 x 106. Secara
memerlukan tekanan sebagai gaya dorong. umum dapat disimpulkan bahwa koefisien
Komposisi optimal diperoleh pada 14% (b/b) rejeksi membran selulosa asetat komersial lebih
selulosa asetat, 78% (b/b) aseton dan 8% (b/b) tinggi dari Abaka walaupun perbedaannya
formamida. sangat kecil.
3.4. Karakteristik Membran Selulosa Asetat Selektivitas membran dicirikan oleh nilai
Abaka dan Membran Selulosa Asetat molecular weight cut off (MWCO) yang
Komersial menggambarkan bahwa spesi dengan massa
Gambar 3 menunjukkan bahwa fluks air dan molekul relatif rata-rata jumlah sama dengan
larutan dekstran dari membran selulosa asetat MWCO dapat ditahan oleh membran dengan
Abaka jauh lebih tinggi dari fluks air dari koefisien rejeksi sebesar 90 %. Dari Gambar 4
membran selulosa asetat komersial. Fakta ini terlihat bahwa nilai MWCO membran selulosa
mengindikasikan bahwa membran komersial asetat Abaka dan komersial tidak jauh berbeda,
lebih rapat dibandingkan dengan membran yaitu 7,08 x 104 untuk membran selulosa asetat
Abaka. Mengingat bahwa komposisi larutan Abaka dan 6,31 x 104 untuk membran selulosa
cetak ke dua jenis membran tersebut sama, asetat komersial. Hal ini menunjukkan bahwa
maka panjang rantai polimer menjadi salah satu ukuran pori membran Abaka sedikit lebih besar
faktor yang berpengaruh terhadap kerapatan dari membran komersial. Bentuk kurva yang
membran. Hal ini didukung dari data pada landai menunjukkan bahwa distribusi ukuran
Tabel 1 yang memperlihatkan bahwa rantai pori pada ke dua jenis membran tersebut cukup
polimer selulosa asetat komersial 1,7 kali lebih lebar.
panjang daripada Abaka.
Gambar 5 menunjukkan foto SEM (Scanning
Tabel 3 menunjukkan perbandingan koefisien Electron Micrograph) permukaan membran
rejeksi membran selulosa asetat Abaka dan selulosa asetat Abaka dan komersial, Dari foto
komersial terhadap larutan dektran dengan permukaan membran tampak bahwa membran
massa molekul relatif rata-rata jumlah yang selulosa asetat Abaka mempunyai ukuran pori
100
95
90
%R
85
80
75
70
4,0 4,5 5,0 5,5 6,0 6,5
log Mv
membran Abaka
membran komersial
Gambar 4. MWCO membran selulosa asetat Abaka dan membran selulosa asetat komersial
(a) (b)
Gambar 5. Foto SEM permukaan (a) membran selulosa asetat Abaka dan (b) membran selulosa asetat
komersial
(a) (b)
Gambar 6. Foto SEM penampang lintang (a) membran selulosa asetat Abaka dan (b) membran selulosa
asetat komersial
5. Ucapan terima kasih Loske S., do Carmo Goncalves and Wolf B.A.
Tim peneliti menyampaikan terima kasih (2003), Fractionation of cellulose acetate for the
kepada Kementerian Riset Dan Teknologi investigation of molecular weight influences on the
Republik Indonesia yang telah mendanai morphology of membranes, J. Memb. Sci., 214, 223-
228.
sebagian dari penelitian ini melalui Riset
Unggulan Terpadu X. Radiman C.L., (1998), Pengaruh komposisi
koagulan terhadap karakteristik membran
6. Daftar Pustaka polisulfon, Malaysian J. Anal. Sci., 4(2), 214-220.
Baker R.W. (2000), Membrane Technology and
Applications, Mc.Graw-Hill, New York, hal. 194- Radiman C.L. dan Suendo V. (2002),
196. Perkembangan Sains dan Teknologi Membran,
Prosiding Seminar Kimia Bersama UKM-ITB ke-5,
Basta A.H., El-Saied H. and Elberry M. (2003), Melaka, 16-17 Julai 2002, jilid I, halaman 15-22.
Cellulose Membranes for Reverse Osmosis. Part II.
Improving RO membranes prepared from non-
woody cellulose, Desalination, 159, 183 – 196.
Abstract
2-Substituted 1,3-benzoxazin-4-ones has been investigated as new chiral auxiliaries. Racemic
2-(9-Anthracenyl)-1,3-benzoxazin-4-one as well as 2-((2,6)-dichlorophenyl)-1,3-benzoxazin-
4-one has been shown to induce excellent diastereoselectivity when used as an auxiliary in
aldol reactions. Details of the synthesis and first application of these new auxiliaries will be
presented.
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Proceeding
Fax : +62 (22) 2504154, Homepage of The 6th ITB-UKM Joint Seminar
: http://www.chem.itb.ac.id/jschem, on Chemistry
E-mail : jschem@chem.itb.ac.id
D. R. Abu Bakar, I. Ahmad, A. Ramli
Abstract
This paper reports on a new attempt for direct incorporation of natural fibre into a
thermosetting matrix resin to produce natural fibre/polyester composites comprising of
unsaturated polyester resin synthesized from glycolysed PET waste and kenaf fibre. The
mechanical properties (tensile and flexural properties, impact strength and hardness) of
kenaf/polyester composites, with respect to its fiber content, up to 10% by volume and thermal
degradation (TGA) are presented. Mechanical properties such as tensile strength and flexural
strength increase with the increment of fibre content as a result of reinforcement with kenaf
fibre, reaching optimum values at about 7.5% (v/v) fibre. It was found that the mechanical
performance of the kenaf/polyester composites gave satisfactory results, hence showed the
potential of this composite in a number of applications.
Keywords: Gycolysis, PET waste, PET recycling, polyester composites.
2. Experimental Testing
Unsaturated Polyester Resin Synthesis Tensile testing of the specimens has been
The preparation of unsaturated polyester resin carried out using an Istron 5567 as per ASTM
is based on the esterified glycolysed product of D-638-91 at a cross-head speed of 5 mm min-1
PET with maleic anhydride and ethylene and a gripping length of 100 mm. Specimens
glycol. The resin was first prepared by reacting were 100 x 15 x 3 mm in size.
the post-consumer PET soft drink bottles
Flexural tests were performed using the same
(washed, dried, grind) and ethylene glycol
instrument according to ASTM 790-91, under a
through glycolysis in a four-necked round
three-point-bend test. The specimens were 125
bottom flask of 1 L capacity, together with zinc
x 12.5 x 3 mm in size. A span of 75 mm was
acetate (0.5% based on weight of PET) as
employed, maintaining a 2.5 mm min-1 and a
catalyst under reflux in nitrogen atmosphere at
span-to-depth ratio of 16:1.
180-190 °C for 7 hrs. This is followed by a
polyesterification step between the glycolysed Impact test were performed using an
product and maleic anhydride at 190-210 °C impactometer (Ceast 6545/0000, Italy) in
for 4 hrs. Later, the liquid resin is allowed to accordance with ASTM 256-90b. The
cool down to 120 °C and 0.45% of PET weight specimens, sized 62.5 x 12.5 x 3 mm were
of hydroquinone added to prevent pre-mature unnotched as introducing a notch to the sample
curing. At 70 °C, the resin was intermixed with will result in further cracking to the notch area.
30% (w/w) styrene. Chemicals and solvents are The impact strength was calculated by dividing
of analar grade and are used without further the energy in kJ recorded on the tester with the
purification. cross-sectional area of the sample. All the
results are taken as the average of 5 samples of
Natural fibre (kenaf) each testing.
A bast fiber type taken from kenaf (Hibiscus
cannabinus L.) was cultivated and supplied by Hardness measurements were taken as in
the National Kenaf Research and Development ASTM D 2240-91 using Shore Scale D
Project, Rice and Industrial Crops Centre, Durometer.
Malaysian Agricultural Research and Thermogravimetric analysis (TGA)
Development Institute (MARDI). The fibres, measurement were performed under
being washed and dried were cut to a ~6mm of atmospheric conditions with a Mettler Toledo
length. To avoid fibres from aggregating, type instrument at a heating rate of 10 °C min-1
which futher leads to non-homogenous fibre and sample weights in the range of 5-10 mg.
distribution into the composite, the fibres are
sieved on a 1 mm grid sieve. 3. Results and Discussion
The performance of the obtained material
Composite processing composite in tensile strength and tensile
The resin were mixed with cobalt octoate modulus is presented in figure 1 and figure 2
(accelerator) and methyl ethyl ketone respectively. Although the formation of
peroxide/MEKP (catalyst) at a ratio of resin : entrapped gas is hard to be avoided during
MEKP : cobalt octoate of 100 : 1.5 : 0.5 and curing, the mechanical properties of the
thoroughly mixed. The fibres were dried in an specimens were acceptable. The both measured
oven at 100 °C for 6 h prior to use, and were tensile strength and modulus are with the kenaf
added to the resin and mixed with a mechanical fibre loading in the synthesized resin matrix,
stirrer for 30 min followed by pouring it into varied from 0 to 10% (v/v). This low volume
aluminium mold castings (~3 mm thickness). fraction is due to the high surface tension of the
The working surface is polished and a mold- synthesized resin and the aspect ratio of the
releasing agent is applied on the surface. All fibre itself.
samples were cured at 60 °C for 16 hrs and post
The synthesized resin alone (without fibre)
cured at 100 °C for another 2 hrs. The
showed a tensile strength of about 24.7 MPa.
demoulded sheets were trimmed and saw cut
While with the addition of about 7.5% (v/v)
for further testing.
fibre, tensile strength improved to about 22.2%
at 30.2 MPa. As accordingly to the general rule
of mixtures, the mechanical properties of the
Tensile Strength
35
30 30.2
20 20.6
15
10
Tensile Modulus
3.5
3.31
3.14 3.2
3
Tensile Modulus (GPa)
2.5
2.13
2
1.5
0.5
Flexural Strength
80
Flexural Strength (MPa)
70 68
60
50
47
40 41
38
30
20
10
0 0 2.5 5.0 7.5 10.0
Fibre Content % (v/v)
Flexural modulus
8
7 7
Flexural modulus (GPa)
6
5 4.94
4 4.19
3
2 2.12
1
0
0 2.5 5.0 7.5 10.0
Fibre Content % (v/v)
The flexural modulus results as shown in figure The variation of kenaf loading with its impact
4 were comparatively higher than the strength is as shown in figure 5. The impact
corresponding tensile modulus. At a similar strength of neat polyester is shown as 4.23 kJ
fibre content of 7.5% (v/v), the flexural m-2 and increased steadily i.e. 4.35-4.48 kJ m-2
modulus showed the highest at about 7 GPa. as the fibre loading increases. It can be
The optimum fibre content varies with the observed that at low fiber content (5%) the
nature of both fibre (chemical and structural impact strength decreases slightly and then
composition, fibre type etc.) and matrix increases for higher fibre content. This decrease
(chemical structure, surface tension, may due to the dilution factor where the ratio of
hydrophobicity with respond to the the fibre is too small with respect to its matrix,
hydrophylicity of natural fibre etc.), fibre thus causing the fibre to be localized at certain
aspect ratio, fibre/matrix interaction (interfacial points in the composite. Hence, at a higher
bonding etc.) and under a similar operative fibre loading, the fibre gets a better distribution
condition, it can be said that the above and as a result, increase in impact strength.
composite having around 7-8% (v/v) kenaf Hardness (Shore D) of the composites is as
fibre reached optimum mechanical properties. presented in figure 6.
Impact Strength
4.6 4.48
Impact Strength
4.35
4.4 4.23
(KJ/m2)
4.2
4 3.86
3.8
3.6
3.4
0 5 7.5 10
Fibre Content % (v/v)
Hardness
Hardness (Shore D)
86 85.1
85
84 82.8
83 82.3
82 81.3
81
80
79
0 5 7.5 10
Fibre Content % (v/v)
6. References
Table 1: TGA profiles of the composites [1] Paschun D., Spychaj T., “Chemical Recycling of
having 7.5% kenaf Poly(ethylene terephthalate)”, Ind. Eng. Chem. Res.
1997, 36: 1373-1383.
Total
IDT T50% FDT weight [2] Vaidya, U. R., Nadkarni, V. M., “Unsaturated
(°C) (°C) (°C) loss polyester resins from PET waste: Synthesis and
(%) characterization”, Ind. Eng. Chem. 1987, 26: 194-
28 345 515 78.35 198.
[3] Vaidya, U. R., Nadkarni, V. M., “Polyester
Polyols for Polyurethanes from PET Waste:
4. Conclusion Kinetics of Polycondensation”, J. Appl. Polym. Sci.
Recycling of PET waste through glycolysis was 1988, 35: 775-785.
successfully performed to obtain unsaturated
polyester resin suitable as matrix for natural [4] Rebeiz, K. S., “Precast use of Polymer Concrete
fiber in a natural fiber reinforced polyester using unsaturated polyester resin based on recycled
PET waste”. Construction and Building Material
composite. The composite produced properties
1996, 10(3): 215-220.
that are comparable to other natural fibre
reinforced thermosets product. In addition, [5] Kawamura, C., Ito, K., Nishida, R., Yoshihara,
there are numerous potential applications for I., Numa, N., “Coating Resins synthesized from
the composite which include furnishing for recycled PET”, Progress in Organic Coatings 2002,
45: 185-191.
interiors, panels and various building
application. [6] Aslan S., Immirzi, B., Laurienzo, P.,
Malinconico, M., Martuscelli, E., Volpe, M. G.,
5. Acknowledgement Pelino, M., Savini, L., “Unsaturated polyester resins
Appreciation is given to the Ministry of from glycolysed waste polyethyleneterephthalate:
Science, Technology and Innovation (MOSTI), synthesis and comparison of properties and
Malaysia for providing financial assistance performance with virgin resin”, Journal of Material
through research grant IRPA 09-02-02-0093- Science 1997, 32: 2329-2336.
EA237 and also to National Kenaf Research [7] Radenkov, Ph., Radenkov, M., Grancharov, G.,
and Development Project, Rice and Industrial Troev, K., “Direct usage of products of
Crops Centre, Malaysian Agricultural Research poly(ethylene terephthalate) glycolysis for
and Development Institute (MARDI) for kindly manufacturing of glass-fibre-reinforced plastics”,
supplying the fibre. The first author would also European Polymer Journal 2003, 39: 1223-1228.
like to thank MOSTI for awarding a NSF
Scholarship through her program in UKM.
Abstract
The compound propyl 2-amino-3-(1H-imidazol-4-yl)propanoate ester (1), 2-amino-N-(2-
hydroxyethyl)-3-(1H-imidazol-4-yl)propanamide (2), and propyl 2-amino-3-(1H-imidazol-4-
yl)propanoate ester (3) have been synthesized from 2-amino-3-(1H-imidazol-4-yl)propanoic
acid (histidine). The melting point and the chemical yield of compound 1, 2, and 3,
respectively, are 236oC – 238oC and 85,79% ; 274oC – 276oC and 45,29%; and 230oC –
232oC and 45,09%. The characterization of compound 1 and 3 using infra red spectroscopy
showed the peaks with wavelength number of C=O stretching vibration at 1700 – 1780 cm-1
and stretching vibration of C-O-C at 1000 – 1250 cm-1 significantly for ester group on
compound 1 and 3, which were not shown on infra red spectrum of histidine. The infra red
spectrum of compound 2 showed similar peaks of stretching vibration of N-monosubstituted
amide at 1630 – 1635 cm-1 and 1515 – 1566 cm-1, and the weak peak of bending vibration of
secondary amine at 1490 – 1580 cm-1, with the additional peak of stretching vibration of free
primary amine at wavelength number of 3300 – 3500 cm-1, which showed the presence of
ethylamine substituent attached to imidazole ring framework. The pH value of compound 1, 2,
3, and histidine are, respectively, 3, 8, 3 and 5. According to the pH value, the compound 2
are having more reasonable potent as corrosion inhibitor than compound 1, 3 and histidine.
This assumption was also confirmed by the measurements of inhibition activitiy of histidine,
compound 1, 2 , and 3 utilizing tafel Method, which showed the best inhibition activity that
belongs to compound 2, which given 85,79% inhibition activity. The increase in inhibitor
concentration, in this study concentration of compound 1, showed the better inhibition action
towards carbon steel in 1% NaCl solution.
Keywords: histidine, imidazole ring framework, corrosion inhibitor, Tafel Method
operational cost of oilfield mining in oilfield mining that is mainly carbon dioxide
(Hassanzadeh, 2004; Ruschau, 1999; Miksic, induced, is Oleic Imidazoline type corrosion
1998). Therefore many studies have been inhibitor (Popova, et.al., 2004; Ramachandran
carried to explore more effective and low cost et.al., 1997 and 1996; Edwards, et.al., 1994;
corrosion inhibitor to overcome the high Raicheva, et.al., 1992). Some oleic imidazoline
corrosion prevention cost in most of industries, derivative compounds have been synthesized in
especially oilfield mining (Roberge, 1999; order to determine the inhibition mechanism on
Raicheva, et.al, 1992). metal surface. One of the factors that have
made oleic imidazoline type inhibitor having
So far there is still a few studies have been
good inhibition activity is the “three big parts”
taken subjected to the correlation between
in its structure, which each of them having its
molecular structure of corrosion inhibitor
own function when interacted with the metal
compounds and their inhibitive performance.2, 3
surface (Ramachandran, 1999, 1997, 1996;
There are several studies involving the effect of
Edwards, et.al., 1994). Those “three big parts”
nitrogen and sulfur containing compounds
are: the ‘head’ part, the ‘anchor’ (or ‘pendant’)
towards the inhibition activity (Raicheva, et.al.,
part, and the ‘tail’ part. The ‘head’ part of oleic
1992). According to some literatures, generally
imidazoline, which is the imidazoline ring
there are three chemical groups that having
framework, can be attached to the metal surface
inhibition activity, which are: (i) amine; (ii)
through the electron pair of nitrogen of
nitrogen containing heterocycle compounds;
imidazoline ring. The ‘anchor’ part is the
and (iii) sulfur, amide, carbamide containing
alkylamine substituent of imidazoline ring that
compounds (Cao, et.al., 2003; Gomma, 1998;
can maintain the adsorption of imidazoline ring
Lewis, 1993; Edwards, et.al., 1994). One of
on metal surface. The ‘tail’ part of imidazoline
nitrogen containing heterocycle compound that
is the long hydrophobic alkyl chain as one of
has been widely used as commercial inhibitor,
substituent of imidazoline ring (Figure 1)
especially in minimizing the corrosion process
hydrocarbon chain ('tail')
NH2
N
N
H
N
H O
N
(Edwards, et.al., 1994). condenser reflux was attached and the reaction
mixture was refluxed for 5 minutes. Gradually
Histidine is one of essential amino acid that is
added 3 drops saturated HCl solution into the
commonly found in plant tissues as part of
reaction mixture and the reflux continued for 3
protein chain. Histidine is a unique amino acid
hours. The reaction progress was monitored by
in structure because it contains an imidazole
TLC using n-hexane : ethyl acetate (v/v) 5 : 1
ring framework and other substituents that
as eluent. The reaction mixture was extracted
might perform as corrosion inhibitor.
with ethyl acetate. The organic phase was
Therefore in this study we chose histidine as
collected and evaporated until small amount of
main material to be modified in order to gain
solvent remained. The reaction mixtured was
some of its derivatives that might have
gradually cooled to obtain white crystal and to
corrosion inhibitor potent. The imidazole ring
be recrystallized in ethyl acetate. The crystal
part of histidine might have the same function
was collected by Büchner funnel. The IR
as the ‘head’ part of oleic imidazoline type
spectrum of compound 1, wavenumber (cm-1):
corrosion inhibitor. The amine substituent of
3094, 3016, 2884, 1738, 1617, 1588, 1467,
histidine can play the role of ‘anchor’ part of
1384, 1353, 1215, 1118, 1084, 927, 809, 623,
oleic imidazoline, and the carboxylic part of
533.
histidine can be extended to become long chain
hydrophobic part of corrosion inhibitor (Figure C. Synthesis of 2-amino-N-(2-hydroxyethyl)-
2), because some studies has proven that the 3-(1H-imidazol-4-yl)propanamide (2)
longer the ‘tail’ part of imidazoline inhibitor, A mixture of 0.7348 g of Histidine.HCl.H2O
the higher its inhibition activity (Popova, et.al., and 4 mL ethanolamine was refluxed in three
2004; Raicheva, et.al., 1992). According to ways 100 mL boiling flask for 1 hour. The
these assumptions, the purpose of this study is reaction progress was monitored by TLC using
to modify the structure of histidine in order to n-hexane : ethyl acetate (v/v) 5 : 1 as eluent.
gain some of its derivatives that might have The reaction mixture was extracted by 2 x 12
potent as corrosion inhibitor. The investigation mL ethanol-ethyl acetate (v/v) 1 : 1. The
of the inhibition activity was performed by organic phase was collected and evaporated
Tafel method to understand the correlation until small amount of solution remained. The
between structure of histidine derivatives and reaction mixture was cooled gradually to obtain
their inhibition activity. white crystal to be recrystallized in ethyl
acetate. The crystal was collected using
2. Experimental
Büchner funnel. The characterization of
A. General Procedure
product utilizing FTIR spectroscopy. The IR
All of reagents used in this study are GR grade.
spectrum of compound 2, wavenumber (cm-1):
All of solvents were distilled before used. The
3009, 3411, 3000, 2856, 2750, 2500, 1634,
characterization of synthesized products was
1600, 1566, 1463, 1416, 1341, 1314, 1251,
analyzed using Shimadzu FTIR of Departemen
1147, 1063, 967, 923, 836, 776, 623, 537.
Kimia ITB for the determination of infrared
spectrums, and the determination of the melting D. Synthesis of ethyl 2-amino-3-(1H-
point of products utilizing the Electrothermal® imidazol-4-yl)propanoate (3)
Melt-Temp Apparatus. The determination of Into 10 mL of 95% ethanol in three ways
inhibition activity of synthesized products boiling flask was introduced 0.3807 g of
employing VoltaLab® apparatus with carbon Histidine.HCl.H2O and was stirred to dissolve
steel electrode as working electrode, SCE completely. To the solution was added 7 mL of
(Saturated Calomel Electrode) as reference acetic acid glacial. The reaction mixture was
electrode, platinum electrode as auxiliary stirred, then 5 drops of saturated HCl solution
electrode. was added to the reaction mixture. The
reaction mixture was refluxed for 2 hours. The
B. Synthesis of Ester propyl 2-amino-3-(1H-
reaction progress was monitored by TLC using
imidazol-4-yl)propanoate (1)
n-hexane : ethyl acetate (v/v) 5 : 1 as eluent.
A 0.3754 g of Histidine.HCl.H2O was
The reaction mixture was extracted by 2 x 10
dissolved into 15mL dry n-propanol (dried over
mL ethanol-ethyl acetate (v/v) 1 : 1. The
Na2SO4 anhydrous for 20 minutes) in 100 mL
organic phase was collected and evaporated
three ways boiling flask. Several drops of
until small amount of solution remained. The
pyridine was added into the solution. The
HOC H NH (1 eq)
2 ⎯
4 ⎯⎯2 ⎯⎯⎯⎯⎯⎯
⎯⎯ ⎯ ⎯ ⎯ ⎯ ⎯ o ⎯→ 2
N refluxed at 175 C, stirred for 1h
NH 1. In ethanol 95% , H +
2. C H C O O H glacial (1 eq)
⎯ ⎯ ⎯ ⎯ ⎯3 ⎯ ⎯ ⎯o⎯ ⎯ ⎯ ⎯ ⎯ ⎯ ⎯ ⎯⎯
→
refluxed at 110 C , stirred for 2h 3
2-amino-3-(1H-imidazol-4-yl)propanoic
acid (Histidine) (1 eq.)
Scheme 1
O O
N OH
N
O N
H
NH2 NH2
HN HN
1 2
O
N
O
NH2
HN
3
1 2 3
Figure 3. The structure of histidine derivative compounds and their 3D molecular model
nucleophile to attack the carbonyl group of Basic determination of inhibition activity based
acetic acid glacial. As the replacement, on Tafel method can be expressed in the
esterification reaction was proceeded between following equation:
carboxylic group of histidine and ethanol to
Iap = Icor{exp[2.3(E-Ecor)/βa - exp[-2.3(E-
give compound 3, ethyl 2-amino-3-(1H-
imidazol-4-yl)propanoate, which is an ester Ecor)/βc} + C(dE/dt) (3)
according to its IR spectrum. The similarity of with: Iap = the given current (in mA); Icor =
its melting point to the melting point of corrosion current (in mA); E = the given
compound 1 strengthens the conclusion of the potential (in mV); Ecor = potensial korosi (in
ester structure of compound 3. The structure of mV); C = interface capacity; β a dan β c = the
compound 1, 2, and 3, as well as their three anodic and cathodic Tafel coeffisien; dE/dt =
dimensional structure in their minimized rate of potensial change along with determined
energy state, is presented in Figure 3. time or scan rate, which is its ideal value is ~ 0.
The measurement of the inhibition activity of According to equation (3), the relationship
histidine, compound 1, 2, and 3 was utilizing between the given current and the output
the electrometry method that is Tafel method. potensial produced can be monitorized. In this
study, the basic calculation of each
Table 2. The measurement of inhibition activity of histidine and its derivatives utilizing Tafel Method
Corrosion
I cor of Corrosion
I cor of Blank Rate of
Sample Rate of Blank %
solution Sample
2 solution solution Inhibition
(mA/cm ) solution
(mA/cm2) (mm/Y)
(mm/Y)
Histidine.HCl.H2O 0.12 0.1184 1.404 1.385 1.35
Compound 1 0.7462 0.3854 8.727 4.508 48.34
Compound 2 0.7462 0.0807 8.727 0.944 89.18
Compound 3 0.1662 0.0985 1.944 1.152 40.74
60
52,92
50 48,34 47,68
% inhibition
40
30
25,34
20
10
0
6 8 12,8 20
Concentration (ppm)
Figure 4. The graphic of correlation between concentration and inhibition activity of compound 1
measurement of electrolite solution of sampel group, rather than ethyl group of compound 3.
was done automatically utilizing the
In order to investigate the correlation between
corresponding computer software, which is
inhibitor concentration and its inhibition
available in Voltalab® processor apparatus. In
activity, further measurement of inhibition
this measurement, each sample solution and
activity of compound 1 was carried using
blank solution (1% NaCl solution, which was
various concentration. Table 3 was a
freshly prepared before use) was prepared
representation of collected measurement data of
according to the procedure described. All of
compound 1 using the same method.
sample solution was prepared at concentration
of 8 ppm. The carbon steel to be tested has also According to data on Table 3, the increase in
been prepared to be set as working electrode. concentration of compound 1 gives the
The result of electrochemical measurement is improvement of its inhibition activity. Figure 4
presented in Table 2. The value of % inhibition shows better visualization of concentration
of each sample was calculated using equation effect to the inhibition activity of compound 1.
(1). According to some proposed inhibition
According to the data, the highest inhibition mechanism of oleic imidazoline type corrosion
activity was performed by compound 2, which inhibitor that have been reported previously,
has 89.18% inhibition. This result has a good the lone pair of nitrogen within imidazoline
correlation with the pH value of the compound. ring is a crucial part to be adsorbed on metal
Compound 2 has pH value of 8, which is one of surface. This lone pair of nitrogen would
requirement as a corrosion inhibitor to have a interact with the empty d orbital of transition
basic property. The basic property of metal, such as iron and copper those were
compound 2 came from the additional amide usually used as material of many industrial
group on the histidine system. The basic types of equipment (Ramachandran, et.al.,
condition of corrosion inhibitor is essential to 1999, 1997, 1996). This interaction between
prevent more corrosion of carbon steel. In the lone pair of nitrogen within imidazoline ring
case of histidine, compound 1 and compound 3, and metal (or metal ion) would form some kind
the correlation between pH value and % of monolayer of corrosion inhibitor on metal
inhibition did not work well. The low pH value surface (Ramachandran, et.al., 1996; Edwards,
of compound 1 and 3 possibly came from the et.al. 1994). This monolayer would prevent
ammonium cation of ester histidine that was metal surface from any interactions with any
formed because of the use of acid catalyst compounds that would cause corrosion process.
during the reaction. However, the % inhibition The hydrophobic part of corrosion inhibitor
of compound 1 and 3 were better than histidine would repel any water molecules and anything
itself, because of the presence of extended alkyl that dissolved in it from approaching to metal
group on compound 1 and 3. The longer the surface. This mechanism can also be applied to
alkyl chain as ‘tail’ part of corrosion inhibitor, the inhibition action of compound 1, 2, and 3
the higher its inhibition activity. In this study, towards carbon steel in this study. The lone
compound 1 has slightly higher inhibition pair of nitrogen within imidazole ring
activity than compound 3 because of its propyl framework in compound 1, 2, and 3 would
interact with metal surface. The additional lone the Corrosion Inhibitor Oleic Imidazoline,
pair of amine group within the group would Corrosion Science, 36(2), 315-325
also strenghten the interaction with metal, Gomma, G.K. (1998), Effect of Azole Compounds
which is similar to the anchor part action in on Corrosion of Copper in Acid Medium, Materials
many oleic imidazoline type corrosion Chemistry and Physics, 56, 27-34
inhibitions. Further study must be taken to Kanicky, J.R., Montilla, JC. L., Pandey, S., and
confirm the inhibition mechanism of histidine Shah, D.O. (2001), Surface Chemistry in the
and its derivative compounds. Figure 5 would Petroleum Industry, In: Handbook of Applied
show the illustration of monolayer formation of Surface and Colloid Chemistry edited by Krister
compound 2 on metal surface. Holmberg, Chapter 11, John Wiley & Sons, ISBN
0471490830, 251-267
4. Conclussion
The functional group transformation reaction of Lewis, M.L., Ledung, L., and Carron, K.T. (1993),
histidine gave compound 1, 2 and 3, which are all Surface Structure Determination of Thin Films of
have potent as corrosion inhibitor, with moderate Benzimidazole on Copper Using Surface Enhanced
chemical yields. According to the inhibition activity Raman Spectroscopy, Langmuir, 9, 186-191
measurement result utilizing Tafel method,
Miksic, B. A. (1998), Volatile Corrosion Inhibitors
compound 3 gave the highest inhibition activity of
Find a New Home, In: Materials Engineering
89.18%. The longer the alkyl chain as hydrophobic
Forum
‘tail’ part of corrosion inhibitor, the better its
inhibition activity. This rule was obeyed by all of Popova, A., Christov, M., Raicheva, S., and
three products of histidine derivative compounds. Sokolova, E. (2004), Adsorption and Inhibitive
The increase in concentration of solution compound Properties of Benzimidazole Derivatives in Acid
1 gave the relative improvement to the inhibition Mild Steel Corrosion, Corrosion Science, 46, 1333-
corrosion activity on carbon steel surface in 1% 1350
NaCl solution.
Raicheva, S.N., Aleksiev, B.V., Sokolova, E.I.
5. Aknowledgement (1992), The Effect of The Chemical Structure of
We would like to express our gratitude to Some Nitrogen- and Sulphur-Containing Organic
everyone who has supported this present works, Compounds on Their Corrosion Inhibiting Action,
especially the technicians, laborers and staffs of Corrosion Science, 34(2), 343-350
Departemen Kimia FMIPA ITB. The present Ramachandran, S., Jovancicevic, V.. (1999),
works were supported by Hibah RUT (periode Molecular Modelling of the Inhibition of Mild Steel
of 2005 – 2006) from The Directorate of Carbon Dioxide Corrosion by Imidazolines,
Higher Education of Indonesia (DIKTI) and Corrosion, 55(33), 259-267
Ministry of Research and Technology Ramachandran, S., Tsai, BL., Blanco, M., Chen, H.,
(Menristek) of Indonesia. All of the Tang, Y., and Goddard III, W.A. (1997), Atomistic
measurements equipments and facility were Simulations of Oleic Imidazolines Bound to Ferric
supported by Departemen Kimia FMIPA – Clusters, J. Phys. Chem. A, 101, 83-89
ITB, especially Laboratorium Kimia Organik Ramachandran, S., Tsai, BL., Blanco, M., Chen, H.,
Bahan Alam for the measurement of IR Tang, Y., and Goddard III, W.A. (1996), Self-
spectroscopy and Laboratorium Kimia Fisik Assembled Monolayer Mechanism for Corrosion
Material for the measurement of inhibition Inhibitor of Iron by Imidazolines, Langmuir, 12,
activity. 6419-6428
Optimasi pH dan Suhu pada Isolasi Minyak Atsiri dari Daun Nilam Pogostemon
cablin Benth dengan Fermentasi oleh Pseudomonas mendocina
Abstrak
Pada penelitian ini, dilakukan optimasi pH dan suhu pada isolasi minyak atsiri dari daun
nilam Pogostemon cablin Benth. Metoda yang digunakan adalah metoda fermentasi dengan
bantuan mikroorganisme isolat dari daun nilam, yaitu bakteri Pseudomonas mendocina.
Aktivasi inokulum menghasilkan umur optimum inokulum 12 jam. Setelah proses fermentasi,
dilakukan isolasi minyak atsiri untuk mengetahui rendemen minyak yang dihasilkan. Isolasi
minyak atsiri dilakukan dengan metoda ekstraksi cair-cair dengan pelarut n-heksana teknis
dengan perbandingan 1 : 3 sebanyak tiga kali. Optimasi pH dilakukan dengan fermentasi
daun nilam pada suhu kamar dengan variasi pH 5,5; 7,8; 8,0; 8,1; 8,2; dan 8,3. pH optimum
ditunjukkan dengan perolehan % yield minyak nilam tertinggi yaitu pada pH 8,0. Optimasi
suhu dilakukan dengan fermentasi daun nilam pada pH optimum dengan variasi suhu kamar,
30 °C, 40 °C, dan 60 °C. Suhu optimum ditunjukkan dengan perolehan % yield minyak nilam
tertinggi yaitu pada suhu 40 °C. Selanjutnya, dilakukan fermentasi daun nilam pada pH dan
suhu optimum untuk mendapatkan minyak nilam dengan % yield optimum. Minyak nilam yang
diperoleh dianalisa dengan menggunakan kromatografi gas cair.
Kata kunci : fermentasi, nilam, pH optimum, suhu optimum
dihasilkan. Untuk memperbaiki kualitas VFF 4/L.U.S/No. 344. Selama inkubasi proses
minyak, diperlukan proses yang bertujuan fermentasi daun nilam digunakan “Shaking
untuk menghilangkan warna gelap pada Incubator ROSI 1000 Reciprocating/Orbital
minyak. Ini berarti bahwa proses produksi Thermolyne” untuk pengocokan medium
minyak nilam bertambah. Kelemahan lain pertumbuhan. Untuk analisis kualitas minyak,
adalah rendahnya rendemen yang dihasilkan. digunakan alat Kromatografi Hewlett Packard
Maka dari itu, perlu dicari cara isolasi minyak 5890 SERIES II yang dilengkapi dengan HP
yang lebih efisien. Baru-baru ini telah 3396 SERIES II Integrator dengan kolom
ditemukan metoda alternatif untuk isolasi methylsilicone gum (SE 30) yang panjangnya
minyak atsiri yaitu metoda fermentasi (Yuliana, 30 meter dan gas pembawa nitrogen.
2003).
2.3. Cara kerja
Proses fermentasi memiliki beberapa Peralatan dan bahan yang tahan panas
keunggulan daripada proses destilasi. Pada disterilisasi dengan menggunakan autoklaf
proses destilasi, dibutuhkan bahan baku yang pada suhu 121 oC dan tekanan 15 lbs selama 15
cukup banyak dalam satu kali produksi minyak. menit. Sterilisasi untuk peralatan yang tidak
Pada proses fermentasi, jumlah bahan baku tahan panas dilakukan menggunakan alkohol
yang digunakan tidak dibatasi sehingga proses 70% dan sinar lampu UV.
produksi dapat berjalan terus tanpa harus
Isolasi dan identifikasi mikroorganisme
menunggu jumlah bahan bakunya terpenuhi.
Koloni mikroorganisme yang berasal dari daun
Selain itu, proses produksi dengan cara
nilam yang permukaannya sudah disapu dengan
fermentasi tidak memerlukan proses
etanol 70%, tumbuh pada permukaan medium
pengeringan sehingga mempersingkat waktu
agar nilam. Koloni ini diisolasi dan
yang dibutuhkan. Minyak nilam yang
diidentifikasi di Departemen Biologi ITB dan
dihasilkan dengan proses fermentasi juga
dikonfirmasi dengan panduan Bergey’s
memiliki rendemen yang lebih memuaskan
Manual.
daripada proses destilasi. Namun, perlu
dilakukan penelitian lebih lanjut mengenai Aktivasi inokulum
kondisi optimum proses fermentasi untuk Koloni tunggal mikroorganisme diinokulasikan
mengisolasi minyak. secara aseptik ke 10 mL medium 100% nilam.
Kemudian diinkubasi pada suhu kamar dengan
Penelitian ini bertujuan untuk melakukan
agitasi 150 rpm selama 12 jam sehingga
optimasi pH dan suhu pada isolasi minyak atsiri
diperoleh inokulum I. Inokulum ini digunakan
dari daun nilam Pogostemon cablin Benth.
sebagai starter untuk aktivasi inokulum dengan
Pada penelitian ini dilakukan identifikasi isolat
jumlah yang lebih besar, yaitu 50 mL dan 150
mikroorganisme dari daun nilam, penentuan pH
mL sehingga diperoleh inokulum III. Aktivasi
optimum, penentuan suhu optimum, penentuan
dilakukan dengan kondisi yang sama, yaitu
% yield minyak nilam pada pH dan suhu
diinokulasi secara aseptic sebanyak 5% v/v dan
optimum, dan penentuan kualitas minyak nilam
diinkubasi pada suhu kamar dengan agitasi 150
dengan analisa kromatografi gas cair.
rpm selama 12 jam. Inokulum III
2. Percobaan diinokulasikan ke 150 mL medium 100% nilam
2.1. Tempat dan bahan penelitian dan diinkubasi pada suhu kamar dengan agitasi
Penelitian dilakukan di Laboratorium Biokimia 150 rpm sehingga didapatkan inokulum IV.
Departemen Kimia ITB. Bahan baku penelitian Kemudian, dilakukan sampling dan isolasi
adalah daun nilam Manoco yang diperoleh dari minyak atsiri dengan interval waktu 3 jam
daerah Lembang. Mikroorganisme yang sebanyak 3 titik dan 6 jam sebanyak 4 titik
digunakan adalah isolat dari daun nilam. Bahan serta pengukuran pH sehingga diperoleh kurva
kimia yang digunakan berderajat kemurnian perumbuhan.
pro analisis (p.a) kecuali bila disebutkan lain.
Pada saat sampling, medium 100% nilam yang
2.2. Peralatan berisi inokulum sebagian disentrifugasi dengan
Peralatan yang digunakan adalah peralatan kecepatan 3000 rpm selama 10 menit dan
gelas yang umum digunakan dalam pekerjaan sebagian lagi difiltrasi dengan menggunakan
mikrobiologi. Pekerjaan aseptik dilakukan kertas saring Whatman 41. Endapan dan residu
dalam lemari steril Oliphant, Laminar Flow, dibuang sedangkan supernatant dan filtrat
disimpulkan bahwa isolat mikroorganisme dari mL. Dari aktivasi inokulum ini didapatkan
daun nilam adalah bakteri Pseudomonas kurva pertumbuhan yang merupakan aluran %
mendocina. Gambar 1 menunjukkan hasil yield / absorban dan pH terhadap waktu.
identifikasi mikroorganisme pada mikroskop.
Pada Gambar 2, terlihat bahwa pertumbuhan
3.2. Aktivasi inokulum optimum diperoleh pada waktu 12 jam. Hal ini
Biakan murni bakteri Pseudomonas mendocina dapat dilihat dari harga % yield / absorban
yang ditumbuhkan pada medium agar nilam tertinggi, yaitu 12,05%. Untuk fermentasi
diinokulasikan ke medium 100% nilam. selanjutnya dengan menggunakan inokulum ini,
Inokulum yang didapatkan dari inokulasi ini dipilih waktu 12 jam sebagai waktu fermentasi
digunakan sebagai starter untuk aktivasi optimum. Profil range pH yang didapatkan dari
inokulum dengan jumlah medium yang lebih pengukuran pH pada aktivasi inokulum
besar, yaitu mulai dari 10 mL, 50 mL, dan 150 digunakan sebagai dasar pemilihan variasi pH
14 8.25
12 8.2
10
% Yield / A
8.15
8
pH
8.1
6
8.05
4
2 8
0 7.95
0 5 10 15 20 25 30 35
Waktu (jam)
Gambar 2 Kurva pertumbuhan Pseudomonas mendocina, perolehan minyak nilam hasil isolasi, dan
profil pH medium
9
8
7
% Yield Minyak
6
5
4
3
2
1
0
5 5.4 5.8 6.2 6.6 7 7.4 7.8 8.2 8.6
pH
% Yield Minyak 4
0
0 10 20 30 40 50 60 70
Suhu ( °C )
.Stanbury, Peter F. and Whitaker, Allan, (1984). Yuliana, Delita. (2003). Alternatif Lain Isolasi
Principles of Fermentation Technology, Pergamon Minyak Atsiri dari Daun Nilam Pogostemon cablin
Press England, p. 1 – 8. Benth, Skripsi Sarjana Kimia ITB, Bandung.
Abstract
α-Amylases are widely used in industries that include foods, pharmaceutics, animal feed and
detergent. α-Amylases are produced by a wide range of organisms, such as bacteria, yeasts,
fungi, plants, insects and mammals. Saccharomycopsis fibuligera R-64 isolated from
Indonesian soil produces α-amylase. An ALP1 gene encoding for α-amylase had been
isolated by PCR method. The ALP1 gene had been subcloned into Escherichia coli expression
vector pET16b There was no α-amylase activity detected in E. coli BL21 Star DE3
harboring pET16b-ALP1. It is possible that the S. fibuligera R-64 α-amylases polypeptide
produced in E. coli could not fold properly. The ALP1 gene had also been subcloned into
Saccharomyces cerevisiae expression vector yEPSecretex. The expression of ALP1 gene was
regulated by GAL-PGK hybrid promoter. Yeast INVSc/[yEPSecretex-ALP1] secreted α-
amylase as an active enzyme.
Keywords: α-amylase, Saccharomycopsis fibuligera, Saccharomyces cerevisiae, disulphide
bonds
M 1 2 3 4 5 6 7
777 7
96 kDa
52 kDa
Figure 1. SDS-PAGE analysis of the purification of cell free extract of E. coli BL21 Star
DE3/[pET16b/K1]. Lanes 1, cell free extract; 2, flow through; 3, wash; 4, fraction 1; 5, Fraction
2; 6, Fraction 3; 7, Fraction 4.
Galactose Glucose
Figure 2. Secretion of α-amylase by yeast INVSc1-yEP Secretex ALP1. Incubation was at room
temperature for 48 h. A clear halo appeared around yeast cells secreting α-amylase.
unit of amylase activity was defined as the regulated by a hybrid promoter of PGK-GAL.
decrease of OD595 of 10% under the The vector contains an oligonucleotide
experimental condition. encoding a signal peptide of invertase.
3. Results and Discussion Secretion of ALP1 in INVSc1-yEP-Secretex-
Expression of ALP1 in Escherichia coli ALP1 was first analyzed by using a selective
E. coli BL21 Star DE3 was transformed with media agar containing approriate supplements
pET16b-ALP1/K1. Expression of ALP1 was and red amylopectin. After 48h of incubation at
induced by addition of 0.2 mM of IPTG for 2h. room temperature a clear halo appeared around
Cell free extract was purified by Ni–NTA yeast cells secreting ALP1. The halo was
Agarose. The molecular weight of amilase is larger in the yeast cells grown in medium
expected to be about ∼54 kDa. SDS-PAGE containing galactose compared to that of
analysis showed the presence of protein at glucose. It should be noted that S. cerevisiae
molecular weigh of much higher than the produce no α-amylase.
expected ∼54 kDa in fraction 2 and 3 (Figure 1, The ALP1 activity of INVSc1-yEP Secretex
lanes 5 and 6). The amylase activity was then ALP1 was then determined by the starch-iodine
determined by starch-iodine based assay as based assay as described in the Material and
described in the Material and Method. It was Method. The activity of culture filtrate of
found that OD595 of cell free extract and the INVSc1-yEP Secretex grown in 4.8% galactose
purified fractions was similar with that of media was 46.8 U/3OD600 while the activity in
control (buffer). It could be concluded that glucose media was 18.6 U/3OD600. This result
there were no α-amylase recombinant (ALP1) showed that the ALP1 had been successfully
detected in the E. coli BL21 Star expressed in S. cerevisiae as an active protein.
DE3/[pET16b-ALP1/K1]. The polypeptide
might not be able to fold properly or is possibly 4. Acknowledgements
very unstable, and hence could be degraded This work was funded by Hibah Bersaing IX
rapidly. Another possible explanation is that and The Royal Netherlands Academy of Arts
efficiency of translation the ALP1 mRNA is and Sciences Scientific Programme Indonesia-
low due to different codon preference. Netherlands
Expression ALP1 in the yeast Saccharomyces 5. References
cerevisiae INVSc1 Abarca, D., Fernandez-Lobato, M., Claros, M.
A yeast INVSc1 was transformed with yEP- G., Jimenex, A. 1989. Isolation and expression in
Saccharomyces cerevisiae of a gene encoding an
Secretex- ALP1 as described in Materials and
amylase from Schwanniomyces castellii. FEBS Lett.
Methods. The expression of ALP1 gene will be 255: 455-459.
Itoh, T., Hamashita, I., Fukui, S. 1987. Nucleotide Yanez, E., Carmona, T. A., Tiemblo, M.,
sequence of the amylase gene ALP1 in the yeast Jimenez, A., and Fernandez-Lobato, M. 1998.
Saccharomycopsis fibuligera. FEBS Lett. 219: 435- Expression of Schawanniomyces occidentalis SWA2
445. amylase in Saccharomyces cerevisiae: role of N-
glycosylation on activity, stability and secretion.
Janecek, S. 1997. α-Amylase family: molecular Biochem. J. 329: 65-71.
biology and evolution. Prog. Biophys. Molec. Biol.
67: 67-97.
1) Departemen Kimia FMIPA, Institut Teknologi Bandung, Jl. Ganesha 10. Bandung 40132, Indonesia. E-
mail: djulia@chem.itb.ac.id
2) Pusat Pengajian Sains Kimia dan teknologi Makanan, Fakulti Sains dan teknologi, University Kebangsaan
Malaysia, 43600 Bangi, Selangor Darul Ehsan
Abstrak
Senyawa kompleks besi(II) dengan ligan 3,6-di-2-piridil-1,2,4,5-tetrazin(DPTz) telah
disintesis dari garam besi(II) tetrafluoroborat dan perkhlorat. Kompleks yang berhasil
diisolasi merupakan kompleks berinti tunggal dengan rumus kimia [Fe(DPTz)2H2OEtOH] X2
dengan X = BF4- dan ClO4-. Kedua kompleks berupa padatan serbuk berwarna biru tua.
Keduanya memiliki sifat magnet yang unik, di mana pada temperatur ruang perbandingan
fraksi spin tinggi dan spin rendah diamati sekitar 3:7. Dengan pemanasan pada temperatur
sampai 60oC kedua kompleks menunjukkan sifat paramagnetik dengan fraksi spin tinggi
mencapai > 90%.
Kata kunci: besi(II), DPTz, magnet.
6H2O dan Fe(ClO4)2 6H2O. Ligan DPTz dihasilkan dari larutan kompleks ini dengan
diperoleh langsung dari Aldrich dengan rendemen sekitar 50-60%.
kualitas pa. Sebanyak 0,5 gram DPTz
3. Hasil dan pembahasan
dilarutkan dalam 60 mL ethanol dengan
Sintesis dilakukan dalam atmosfer argon untuk
bantuan pengadukan dan pemanasan. Ke
mencegah besi(II) teroksidasi menjadi besi(III)
dalam larutan panas ini dimasukkan 1,35 gram
dan pelarut yang digunakan sudah
Fe(BF4)2 6H2O yang telah dilarutkan dalam 10
dideoksigensai terlebih dahulu sebelum
mL aquadest. Setelah reaksi sempurna,
digunakan. Perbandingan mol ligan:ion logam
campuran reaksi ini dibiarkan pada suhu ruang.
digunakan 1:2 karena senyawa target semula
Produk diperoleh dalam bentuk padatan setelah
adalah kompleks berinti dua.
satu malam. Padatan ini disaring, dicuci
dengan etanol dan dikeringkan dalam desikator. Ligan DPTz memiliki keterbatasan pada
Untuk kompleks perklorat, prosedur yang sama kelarutannya dalam pelarut-pelarut yang
dilakukan dengan menggunakan 1,48 gram digunakan. Oleh karena itu ligan ini dilarutkan
Fe(ClO4)2 6H2O yang dilarutkan dalam 5 mL dalam volum yang relatif besar (60 mL) dan
etanol. Kedua senyawa kompleks yang dibantu dengan proses reflux. Ligan DPTz
dihasilkan direkristalisasi denga cara lebih mudah larut dalam aseton dibanding
dilarutkan dalam air sambil diaduk dan dalam etanol, tetapi kompleks besi(II) dengan
dipanaskan dalam alat reflux selama 1 jam. ligan ini memiliki kelarutan yang sangat besar
Setelah itu campuran disaring dalam keadaan dalam aseton, sehingga aseton bukan pelarut
panas untuk memisahkan pengotor dari larutan yang ideal untuk sintesis kompleks ini.
kompleks. Pelarut dalam larutan kompleks ini Sintesis kompleks ini dilakukan dalam keadaan
diuapkan sampai kira-kira 60% dari volum panas untuk mencegah ligan DPTz terkristalkan
semula dengan menggunakan alat rotary kembali dan kompleks yang terbentuk dapat
vapour. Padatan kristalin berwarna biru tua terkontaminasi dengan padatan kristalin ligan.
Kedua kompleks yang terbentuk berupa
Rumus Molekul Fe C H N
[Fe(DPTz)2H2OEtOH] (BF4)2 7,57(7,31) 40,87(40,75) 1,97(3,13) 19,44(21,94)
[Fe(DPTz)2H2OEtOH] (ClO4)2 7,32(7,08) 39,67(39,44) 3,26(3,03) 18,73(21,23)
padatan biru tua yang larut dalam air, maka Data analisis kedua kompleks ditunjukkan pada
rekristalisasi dilakukan dalam air disertai Tabel-1.
dengan proses reflux untuk meningkatkan
Pengukuran hantaran menunjukkan nilai
kelarutannya, tetapi setelah semua spesi kimia
hantaran molar kedua komplek mirip dengan
berada dalam bentuk larutan, ternyata padatan
hantaran molar larutan besi(II) perklorat
komplek sukar diisolasi secara sempurna, untuk
sehingga ion tetrafluoroborat dan perklorat
itu digunakan alat rotary vapour untuk
tetap berfungsi sebagai anion. Data hantaran
menurunkan volume pelarut sehingga sejumlah
molar kompleks dan senyawa ion standar
produk dapat diisolasi dari larutannya.
terangkum pada Tabel-2.:
Rendemen yang diperoleh untuk kompleks
Sifat magnet dari kedua senyawa kompleks ini
tetrafluroborat 0,37gram (51%) ternyata lebih
sangat unik. Pada temperatur ruang, kedua
rendah dari kompleks perklorat 0,47 gram
senyawa kompleks menunjukkan momen
(62%), ini difahami karena umumnya kompleks
magnet yang sesuai dengan perbandingan fraksi
tetrafluoroborat lebih bersifat higroskopik dari
spin tinggi dan spin rendah sekitar 3:7. Dengan
kompleks perklorat.
perlakuan pemanasan sampai 60oC kemudian
Kompleks yang terbentuk ternyata bukan dibiarkan pada temperatur ruang selama 30
kompleks berinti ganda melainkan kompleks menit ternyata terjadi peningkatan fraksi spin
berinti tunggal, dengan dua molekul ligan dan tinggi untuk besi(II). Perlakuan pemanasan
dua molekul pelarut terkoordinasi. pada kompleks ini mirip seperti yang telah
[Fe(DPTz)2H2OEtOH](BF4)2 dan dilakukan pada kompleks besi(II)-
[Fe(DPTz)2H2OEtOH](ClO4)2. Rumus molekul bithiazole(Onggo dan Goodwin, 2002) namun
ini diperoleh dengan pendekatan hasil analisis pada kompleks DPTz ini pemanasan dilakukan
ion logam besi(II), kadar C, H dan N walaupun pada dua tahap temperatur yaitu 40 dan 60oC,
hasil analisis unsur nitrogen yang diperoleh dan hasil pemanasan mengubah hamper semua
relatif lebih rendah dari perhitungan teoritis. fraksi spin rendah menjadi spin tinggi tetapi
tidak menunjukkan keadaan transisi-spin
seperti yang dialami pada kompleks besi(II)- ClO4-. Kedua kompleks berupa serbuk
bithiazole. Perubahan keadaan menjadi spin berwarna biru tua dengan sifat magnet yang
tinggi teramati sangat mencolok pada kompleks unik. Pada temperatur ruang teramati adanya
tetrafluoroborat. Data momen magnet dan fraksi spin rendah dan spin tinggi dengan
perhitungan fraksi spin rendah dan spin tinggi perbandingan sekitar 7:3. Pemanasan sampai
kedua senyawa kompleks dirangkum pada 60oC pada kedua senyawa kompleks
Tabel-3. menghasilkan perubahan fraksi spin rendah
menjadi spin tinggi.
Fraksi spin tinggi (Xst) dihitung dari hubungan
momen magnet teramati dengan limit momen 5. Ucapan terima kasih
magnet spin tinggi(µst) besi(II) dan limit Penulis mengucapkan terima kasih pada
momen magnet spin rendah(µsr) besi(II) sesuai Departemen Kimia FMIPA Institut Teknologi
dengan Persamaan-1 berikut: Bandung dan Universiti Kebangsaan Malaysia
atas dukungan pada penelitian ini.
Momen teramati µ = Xst µst + Xsr µsr
(Persamaan-1) 6. Daftar Pustaka
Bu, X. H., Morishita, H., Tanaka, K., Biradha, K..,
Dengan asumsi (µst) =5,4BM dan (µsr) =1,0 BM Furusho, S., Shionoya, M., (2000). A spontaneously
dan fraksi spin rendah (Xsr) = (1- Xst) maka resolved chiral molecular box: a cyclic tetranuclear
penentuan fraksi spin tinggi dapat Zn(II) complex with DPTz (DPTZ = 3,6-di-2-
disederhanakan sesuai dengan Persamaan-2 pyridil-1,2,4,5-tetrazine). Chem.Commun, 971-972
berikut: Campos, F. C.S., Clerac, R., Koomen, J. M.,
Russell, D. H., Dunbar, K. R., (2001). Fine-Tuning
Fraksi spin tinggi (Xst)= (µ -1)/4,4
the Ring-Size of Metallacyclophanes: A Rational
(Persamaan-2) Approach to Molecular Pentagons, J. Am Chem.
4. Kesimpulan Soc., 123, 773-774
Dari hasil penelitian tersebut, dapat Onggo, D. and Goodwin, H. A, (2002). Sintesis
disimpulkan senyawa kompleks besi(II) dengan Padatan Kompleks besi(II)-2,2’-bithiazole,
ligan DPTz merupakan senyawa kompleks Prosiding Seminar Kimia Bersama, UKM-ITB ke 5,
berinti tunggal dengan rumus kimia Melaka, Malaysia., 45-50
[Fe(DPTz)2H2OEtOH]X2 dengan X = BF4- dan
Modifikasi Pati Tapioka Dengan Asam Akrilat Dan Akrilamida Sebagai Flokulan
Abstrak
Modifikasi tepung tapioka untuk dimanfaatkan sebagai flokulan yang dapat mengalami
biodegradasi dilakukan dengan mencangkokan (grafting) monomer asam akrilat (AA),
akrilamida (AAm) dan campuran keduanya dengan berbagai komposisi. Inisiasi dilakukan
dengan radiasi pengion menggunakan metoda prairadiasi dalam udara. Proses
pencangkokan monomer dilakukan dalam atmosfer nitrogen. Pengaruh komposisi pelarut,
dosis total dan konsentrasi monomer dipelajari terhadap persen kopolimer yang dihasilkan.
Pencangkokan dilakukan pada suhu 50 °C selama 1 jam. Kopolimer dipisahkan dengan
pencucian dan hidrolisis menggunakan HCl. Pengujian sifat kopolimer sebagai flokulan
dilakukan dengan menggunakan koloid kaolin 0.25 %. Hasil percobaan menunjukkan bahwa
kondisi optimum pencangkokan diperoleh pada dosis total 7.5 kGy, konsentrasi monomer 30
% dalam pelarut 30 % metanol dalam air. Kadar kopolimer yang diperoleh adalah 4.72 %
dan 4.74 % masing-masing untuk P-g-AA (pati tercangkok oleh asam akrilat) dan P-g-AAm
(pati tercangkok oleh akril amida). Pencangkokan yang dilakukan dengan campuran asam
akrilat 30 % dan akrilamida 30 % dengan perbandingan 1:9, 3:7, 5:5, 7:3 dan 9:1
menunjukkan adanya kenaikan hasil pencangkokan 13.31 – 22.22 %. Karakterisasi
menggunakan spektroskopi FTIR menunjukkan terbentuknya pati termodifikasi, P-g-AA, P-g-
AAm dan P-g-AAmAA (pati tercangkok oleh akril amida dan asam akrilat). Pengujian sifat
flokulasi kopolimer pada pH 3.5 – 6.0 menunjukkan bahwa P-g-AAm merupakan flokulan
koloid kaolin yang efektif dibandingkan dengan P-g-AA dan P-g-AAmAA pada berbagai
komposisi.
Kata kunci: akrilamida, asam akrilat, flokulasi, iradiasi pati, kopolimerisasi cangkok
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Proceeding
Fax : +62 (22) 2504154, Homepage of The 6th ITB-UKM Joint Seminar
: http://www.chem.itb.ac.id/jschem, E-mail : on Chemistry
jschem@chem.itb.ac.id 245
Endang Asijati W, Winda Puspitasari, Yanti Sabarinah S
et al., 1997, 2000), penukar ion (Khalil et 2.2. Pengaruh Komposisi Pelarut
al.,1998), flokulan (Rath et al., 1997), dan Pengaruh pelarut dipelajari dengan
sizing agent untuk tekstil (Mostofa, 1995) menggunakan larutan 0 %, 10 %, 30 % dan 50
% metanol dalam air. Pencangkokan dilakukan
Modifikasi pati melalui pencangkokan
pada dosis total 10 kGy dan konsentrasi
monomer dan campuran monomer diharapkan
akrilamida 30 %.
menghasilkan kopolimer yang bersifat netral
polielektrolit maupun zwitter ion. Melalui 2.3. Penentuan kadar kopolimer
modifikasi ini kopolimer yang dihasilkan Pati tercangkok dipisahkan dari pati yang tidak
diharapkan dapat berperan sebagai flokulan tercangkok dengan merefluksnya dalam 50 mL
yang selanjutnya dapat dimanfaatkan untuk HCl 1.5 M selama 2 jam. Pati yang tidak
penjernihan air. terhidrolisis disaring, dicuci dengan air, dan
dikeringkan. Pati yang tidak terhidrolisis
Penelitian ini bertujuan untuk memodifikasi
merupakan pati tercangkok (kopolimer).
pati tapioka dengan mencangkokan monomer
asam akrilat, akrilamida, dan campuran Persen kopolimer = (berat kopolimer/berat
keduanya pada berbagai komposisi untuk substrat awal) X 100%
dimanfaatkan sebagai flokulan. Optimasi
2.4. Analisis FTIR
kondisi pencangkokan dilakukan dengan
Sampel pati asli, pati tercangkok, dan
mempelajari pengaruh komposisi pelarut, dosis
kopolimer masing-masing dicampur dengan
serap total dan konsentrasi monomer.
serbuk KBr, digerus sampai menjadi bubuk
Selanjutnya kopolimer yang dihasilkan diuji
yang halus dan merata. Selanjutnya dilakukan
sifatnya sebagai flokulan dengan menggunakan
pengukuran dengan spektrofotometer FTIR
larutan 0.25 % kaolin dalam air.
untuk mengetahui gugus-gugus fungsi yang
2. Percobaan terdapat dalam sampel.
2.1. Pencangkokan Pati
2.5. Pengujian sebagai Flokulan
Sebelum pencangkokan dimulai, tepung
Larutan suspensi yang digunakan adalah
tapioka dengan merk Alini sebanyak 5 gr
suspensi kaolin 0,25% dengan pH 3,5; 5,3; dan
dimasukkan ke dalam plastik dan ditutup rapat.
6,0. Konsentrasi flokulan divariasikan antara 5-
Sampel ini selanjutnya diiradiasi dengan sinar-γ 100 ppm. Campuran flokulan dan suspensi
(Co-60) dengan dosis tertentu. Larutan asam diaduk 1 menit dengan kecepatan 80 rpm,
akrilat dan akrilamida masing-masing dibuat dilanjutkan dengan 20 rpm pada 5 menit
dengan melarutkan asam akrilat pekat atau berikutnya. Campuran didiamkan 10 menit,
padatan akrilamida dalam pelarut 30 % kemudian larutan diatasnya diukur
metanol-air. Larutan asam akrilat dan kekeruhannya dengan spektrofotometer UV-
akrilamida dibuat dengan konsentrasi 10, 20, VIS pada panjang gelombang 420 nm. (Rath et
30, 40 % ( % v/v ). Campuran monomer asam al., 1997)
akrilat dan akrilamida dibuat dengan berbagai
perbandingan volume larutan asam akrilat : 3. Hasil dan Pembahasan
akrilamida (1 : 9, 7 : 3, 1 : 1, 3 : 7 dan 9 : 1). Pada penelitian ini, pemilihan komposisi
Selanjutnya sampel pati yang telah diiradiasi pelarut dan dosis total dipelajari dengan
direndam dalam 40 mL larutan monomer dalam menggunakan monomer akrilamida. Pemilihan
ampul. Pencangkokan dilakukan pada pelarut bertujuan untuk memperoleh
temperatur 50°C selama 60 menit sambil dialiri kompatibilitas monomer dengan pelarut dan
gas nitrogen selama reaksi berlangsung. kemampuan mengembangnya pati. Pengaruh
Selanjutnya P-g-AA dicuci dengan larutan dosis berhubungan dengan jumlah pusat aktif
etanol : air ( 4 : 1 ), P-g-AAm dengan larutan dan degradasi pati. Optimasi kondisi
metanol : air (1 : 1), dan P-g-AAmAA dengan pencangkokan selanjutnya dilakukan dengan
etanol : air (4:1). Setelah bersih dari memvariasi konsentrasi monomer asam akrilat
homopolimer, kopolimer disaring dan dan akrilamida.
dikeringkan dalam oven vakum pada 3.1. Pengaruh komposisi pelarut
temperatur 50-60°C. Air merupakan pelarut yang baik untuk asam
akrilat dan akrilamida. Namun, pemakaian air
sebagai pelarut mengakibatkan tingginya
6.63
6
4.74
4
2 1.46
0
0 2 4 6 8 10 12
Dosis Total (kGy)
Gambar 1. Pengaruh dosis total terhadap hasil pencangkokan (suhu 50 oC, waktu 1 jam,
konsentrasi akrilamida 30 % dalam pelarut 30 % metanol-air)
4
3
2 1.76 1.83
1 0.76
0
0 10 20 30 40 50
konsentrasi AA (%)
Gambar 2. Pengaruh konsentrasi asam akrilat terhadap hasil Pencangkokan (dosis total
7.5 kGy, suhu 50 oC, waktu 1 jam, pelarut 30% metanol-air)
4 4.14
3 2.74
2
1.62
1
0
0 10 20 30 40 50
konsentrasi AAm (%)
Gambar 3. Pengaruh konsentrasi akrilamida terhadap hasil pencangkokan (dosis total 7.5 kGy,
suhu 50 oC, waktu 1 jam, pelarut 30% metanol-air)
5 4.74 4.72
0
0 20 40 60 80 100
Gambar 4. Pengaruh campuran asam akrilat dan akrilamida terhadap hasil pencangkokan (dosis
total 7.5 kGy, suhu 50 oC, waktu 1 jam, pelarut 30 %metanol-air)
Gambar 5. Spektrum FTIR P-g-AA sebelum dan sesudah hidrolisis dengan HCl
Gambar 6. Spektrum FTIR P-g-AAm sebelum dan sesudah hidrolisis dengan HCl
Gambar 5 dan Gambar 6. Dari gambar 5 Setelah hidrolisis, terdapat puncak serapan
terlihat bahwa P-g-AA sebelum dan sesudah pada 1720.5 cm-1 yang merupakan serapan
hidrolisis keduanya mempunyai daerah serapan gugus karbonil asam karboksilat dan serapan
utama serupa. Serapan pada 3500 – 3200 cm-1 yang melebar pada daerah 3500 cm-1 yang
yang merupakan daerah serapan OH, dan merupakan serapan dari OH. Ini berarti telah
serapan pada 1737 cm-1 merupakan puncak terjadi hidrolisis sebagian dari gugus amida
gugus karbonil dari asam karboksilat tetap ada menjadi gugus karboksilat. Setelah hidrolisis
pada kedua spektrum. Namun setelah hidrolisis, juga terdapat perubahan serapan pada daerah
puncak serapan khas dari gugus C – O pati, 1140 – 1000 cm-1 yang merupakan daerah
yaitu pada daerah 1140 – 1000 cm –1, tidak streching ikatan C – O pati
terdapat lagi yang menunjukkan adanya
3.6. Uji Flokulasi
hidrolisis dari pati tidak tercangkok.
Pengujian pati tercangkok sebagai flokulan
Berbeda dengan spektrum P-g-AA, pada dilakukan dengan menggunakan koloid kaolin.
hidrolisis P-g-AAm terdapat perbedaan yang Pengujian dilakukan dengan menggunakan P-g-
berarti pada pati sebelum dan sesudah AAm, P-g-AA, P-g-AAmAA 7:3, P-g-AAmAA
hidrolisis. Sebelum hidrolisis terlihat adanya 5:5 dan P-g-AAmAA 3:7 dengan pati tidak
serapan pada daerah 3500 – 3400 cm-1 yang termodifikasi sebagai blanko. Kopolimer pati
merupakan serepan stretching –NH dari dengan akrilamida diharapkan menghasilkan
akrilamida yang tumpang tindih dengan polimer non ionik (tidak bermuatan),
serapan –OH dari pati. Pada 1675,2 cm-1 dan sedangkan kopolimer pati dengan asam akrilat
1596,8 cm-1 terdapat serapan gugus –C=O dan merupakan polimer anionik (bermuatan
vibrasi tekuk amina (-NH). Pada daerah 1140 – negatif) pada daerah pH netral. Kopolimer pati
1000 cm-1 terdapat serapan –C-O dari pati. dengan struktur bercabang diharapkan lebih
Pati-g-AA
30
(NTU)
20 Pato-g-AAmAA
7:3
10 Pati-g-AAmAA
5:5
0
Pati-g-AAmAA
0 20 40 60 80 100 120 3:7
Konsentrasi Flokulan (ppm)
Gambar 8. Hasil uji flokulasi pati tercangkok pada pH 3,5
efektif sebagai flokulan dibandingkan dengan adsorpsi polimer, rekonformasi polimer dan
struktur yang linier (Gambar 7). pembentukan flok (Elimelich et al., 1995).
Uji Flokulasi pada pH 3.5 menunjukkan terjadi P-g-AAm dan P-g-AA dengan panjang rantai
penurunan kekeruhan, terutama dengan tercangkok yang tidak terlalu panjang
penambahan P-g-AAm. Penambahan P-g-AA (berdasarkan persen kopolimer) menunjukkan
dapat menurunkan kekeruhan meskipun tidak sifat sebagai flokulan pada daerah asam. P-g-
seefisien P-g-AAm. Pengaruh adanya gugus AAm lebih efektif daripada P-g-AA. Ini
akrilat pada gugus amida menurunkan menunjukkan gugus fungsi lebih berperan
efisiensinya sebagai flokulan. Pada pH tersebut dalam menentukan efisiensi flokulasi. P-g-
baik koloid kaolin maupun kopolimer dengan AAmAA dengan rantai tercangkok yang lebih
berbagai komposisi cenderung tidak bermuatan. panjang menunjukkan hasil yang tidak berbeda
Dengan demikian penurunan kekeruhan dengan pati P-g-AA dengan rantai yang lebih
dimungkinkan akibat terjadinya adsorpsi pendek. Ini berarti panjang rantai tercangkok
partikel koloid oleh polimer yang menyebabkan kurang berperan dibandingkan dengan jenis
destabilisasi koloid. Sementara itu, bagian lain gugus fungsi. Dari hasil penelitian yang telah
dari polimer akan mengadsorpsi partikel koloid dilakukan dengan menggunakan satu macam
lain, membentuk flok. Mekanisme flokulasi monomer akrilamida (Singh, 2000), kopolimer
diduga berlangsung melalui pembentukkan cangkok dengan jumlah rantai yang lebih
flokulasi jembatan (Gambar 9). Flokulasi sedikit tetapi lebih panjang merupakan flokulan
jembatan terjadi karena satu rantai polimer yang lebih efektif.
dapat mengadsorbsi lebih dari satu partikel dan
Uji flokulasi pada pH 5.3 dan 6.0 menggunakan
menyebabkan bersatunya partikel-partikel
pati tercangkok dengan berbagai komposisi
tersebut. Proses flokulasi melalui pembentukan
menghasilkan kecenderungan yang sama.
jembatan, mengikutsertakan tahapan-tahapan
Namun, pada kedua pH hanya P-g-AAm yang
yang kompleks seperti pencampuran polimer,
Gambar 9. Pembentukan jembatan untuk destabilisasi koloid oleh polimer. (Elimelich et al., 1995)
60
50 Pati
(NTU)
pati-g-AAm
40
Pati-g-AA
30
pati-g-AAmAA 7:3
20
Pati-g-AAmAA 5:5
10
Pati-g-AAmAA 3:7
0
0 50 100 150
Konsentrasi Flokulan (ppm)
80 Pati-g-AAm
70
(NTU)
60 pati-g-AA
50
40 Pati-g-AAmAA
30 7:3
20 Pati-g-AAmAA
10 5:5
0 Pati-g-AAmAA
3:7
0 20 40 60 80 100 120
Konsentrasi Flokulan (ppm)
Gambar 11. Hasil uji flokulasi pati tercangkok pada pH 6.0
pada P-g-AAmAA kekeruhan semakin Methacrylates with starch. J. applied Polymer Sci,
meningkat terutama pada pH tinggi. Adanya vol. 25, Hal. 2285-2294.
gugus karboksilat pada kopolimer akrilamida Grulke E.A., (1994). Polymer Process Engineering.
tercangkok cenderung menstabilkan koloid. PTR Prentice Hall, Inc., New Jersey.
Dengan berkurangnya konsentrasi asam akrilat
Khalil M.I., Farag S., (1998). Utilization of Some
pada kopolimer tercangkok, berarti bentuk Derivates in Heavy Metal Ions Removal. J. Applied
anion dari gugus karboksilat berkurang dan Polymer Science, vol. 69, hal. 45-50.
menyebabkan muatan negatif pati tercangkok
berkurang. Hal ini menyebabkan meningkatnya Kiatkamjornwong S., Chomsaksakul S.W., Sonsuk
proses adsorpsi dan rekonformasi polimer yang M., (2000). Radiation Modification of water
Absorption of Cassava Starch by Acrylic
berakibat meningkatkan kekeruhan. Acid/Acrylamide. Radiation Physics and Chemistry,
Kesimpulan ini diperkuat dari data P-g-AAm vol. 59, hal. 413-427.
yang walaupun sebagian gugus amida
terhidrolisis menjadi karboksilat tetapi tetap Kiatkamjornwong S., Meechai N., (1997).
menampakkan sifatnya sebagai flokulan. Dari Enhancement of The Grafting performance of The
Water Absorption of Cassava Starch Graft
hasil ini memperkuat kenyataan bahwa hanya
Copolymer by gamma Radiation. Radiation Physics
sebagian kecil saja gugus akrilamida dari P-g- Chemistry, vol. 49, hal. 689-696.
AAm yang terhidrolisis menjadi karboksilat.
Mostafa M.K.H., (1995). Graft Copolymerization of
4. Kesimpulan Starch-AN Initiated by PotassiumPermanganate. J.
Sifat flokulasi terhadap koloid kaolin lebih Applied Polymer Science, vol. 56, hal. 263-269.
ditentukan oleh gugus fungsidari pada panjang
Rath & singh. (1997). Flocculation Characterization
rantai tercangkok. Pencangkokan gugus amida of grafted and Ungrafted Starch, amylose and
pada pati dapat mengefektifkan pati sebagai Amylopectin. J. Applied Polymer Science, vol. 66,
flokulan. hal. 1729.
5. Daftar Pustaka Singh R.P., Tripathy T., Karmakar G.P., Rath S.K.,
Elimelich M., Gregory J., Jia X., Williams R., Karmakar N.C., Pandey S.R., Kannan K., Jain S.K.,
(1995). Particle Deposition and Aggregation : Lan N.T., (2000). Novel Biodegradable Flocculants
Measurement, Modelling and Simulation, Baased on Polysaccharides, Current Science, vol.
Butterworth-Heinemann, Oxford. 78, no 7, hal. 798-803.
Fanta G.F., Burr R.C., Doane W.M., (1980).
Polymerization of Alkyl Acrylates and Alkyl
Abstrak
Proses degradasi pada produk-produk makanan yang terjadi selama proses pembuatan
ataupun penyimpanan, merupakan masalah yang penting di dalam industri makanan. Proses
degradasi ini menyebabkan menurunnya kualitas maupun kuantitas dari produk tersebut.
Terbentuknya senyawa 5-hidroksimetil furfural (HMF) pada produk-produk gula seperti
sukrosa, manisan kaleng, dan HFS (high Fructose Syrup), merupakan salah satu penyebab
menurunnya kualitas produk-produk tersebut. Hal ini ditandai dengan munculnya warna
kecoklatan pada produk yang berpengaruh pada menurunnya kualitas tampilan maupun
kandungan nutrien dari produk yang dihasilkan. Proses pencoklatan (browning) dapat terjadi
melalui dua mekanisme yang berbeda, yaitu secara enzimatik dan non-enzimatik. Penelitian
yang dilakukan sebelumnya, menunjukkan bahwa ion Ca2+ dan Mg2+ tidak berpengaruh
secara nyata terhadap pembentukan HMF, Sedangkan ion Fe3+ dan Cu2+ menunjukkan
pengaruh yang nyata terhadap pembentukan HMF. Penelitian ini bertujuan untuk melihat
proses pencoklatan secara non-enzimatik, yaitu pengaruh ion-ion logam Zn2+, Cr3+, Mn2+,
dan Sn2+ terhadap pembentukan HMF dalam high fructose syrup. Penentuan HMF dilakukan
dengan HPLC dengan detektor UV pada panjang gelombang 280 nm, kolom C-18, eluen
metanol 10% dengan laju alir 10 mL/menit, dan dilakukan secara isokratik. Hasil penelitian
menunjukkan bahwa ion logam Sn2+, terbukti mengkatalisis pembentukan HMF dalam larutan
sirup fruktosa, sedangkan ion logam lainnya tidak memberikan pengaruh secara nyata
terhadap pembentukan HMF.
Kata kunci: 5-hidroksimetil furfural, HMF, Fruktosa, HFS, .
1. Pendahuluan sukrosa.
Fruktosa merupakan monosakarida yang relatif
HFS dibuat dari bahan baku pati (tepung
sedikit ditemukan di alam. Secara alami,
tapioka, tepung kentang, ataupun tepung
fruktosa banyak ditemukan di dalam buah-
jagung), melalui 3 tahap proses enzimatik.
buahan dan madu, sehingga ia lebih sering
Tahap pertama disebut likuifikasi, dimana pati
disebut gula buah. Fruktosa merupakan gula
dilarutkan dalam air panas dan dicampur
yang memiliki rasa yang paling manis
dengan enzim α-amilase (EC 3.2.1.1, α-1,4-
dibandingkan gula-gula alam lainnya, sehingga
glukan glukanohidrolase). Pada tahap ini terjadi
banyak digunakan sebagai bahan pemanis di
hidrolisis secara acak sehingga dihasilkan
industri makanan dan minuman.
campuran glukosa, maltosa, maltotriosa, dan
Pada industri pembuatan bahan pemanis, oligosakarida lainnya. Tahap berikutnya adalah
fruktosa dibuat dalam bentuk sirup pekat (High tahap sakarifikasi yang menggunakan enzim
Fructose Syrup) yang memiliki kandungan glukoamilase (EC 3.2.1.3, α-1,4-glukan
fruktosa 42 – 85% terhadap berat kering. glukano-hidrolase). Proses sakarifikasi terjadi
Penggunaan HFS ini lebih disukai dalam secara optimal pada pH 4,5 menghasilkan sirup
industri makanan, karena tidak memerlukan glukosa 95–98%. Tahap ke tiga adalah proses
proses pelarutan seperti yang terjadi pada isomerisasi dengan menggunakan enzim
glukoisomerase yang akan merubah glukosa
menjadi isomernya yaitu fruktosa. Hasil dari sampai diperoleh larutan dengan kepekatan
tahapan ini adalah high fructose syrup dengan Brix 20 (refraktometer). Larutan yang
kandungan fruktosa maksimum 45% terhadap diperoleh kemudian disaring dengan kertas
berat kering. saring Whatman 42, selanjutnya diukur pH dan
konduktifitasnya dengan pH meter dan
Dalam proses pembuatan dan penyimpanan,
konduktometer. Larutan ini selanjutnya disebut
produk-produk makanan yang komposisi
larutan sampel.
utamanya karbohidrat, seperti: roti, susu,
sukrosa, sirup fruktosa (HFS), rentan terhadap Pengukuran kadar N total dalam HFS
reaksi degradasi dari gula/karbohidrat. Hasil Ke dalam labu Kyeldahl, dimasukkan 1 g HFS
dari degradasi gula tersebut adalah menurunnya Brix 77, sejumlah kecil kristal CuSO4.5H2O
kualitas penampilan produk, berupa perubahan dan Na2SO4, serta larutan H2SO4 pekat
warna, serta kandungan nutrisi produk sebanyak 10 mL. Campuran dipanaskan diatas
makanan tersebut. Akan tetapi, pada beberapa hot plate pada temperatur tinggi sampai
produk makanan, reaksi pencoklatan diperoleh larutan jernih. Larutan kemudian
merupakan salah satu tahapan penting di dalam didinginkan dan diencerkan dengan air bebas
proses produksi, contohnya pada perusahaan NH3 sampai 25 mL. Selanjutnya larutan
kopi, the, bir, dan roti. Reaksi pencoklatan akan dibasakan dengan penambahan NaOH pekat
meningkatkan penampilan dan rasa dari dan secara cepat didestilasi, destilat ditampung
produk-produk tersebut. Agar reaksi dalam larutan HCl 0,2 M. Garam amonium
pencoklatan dapat dikontrol dalam batas yang yang diperoleh dititrasi dengan larutan NaOH
tidak merugikan, maka sangatlah penting untuk 0,2 M menggunakan indikator fenolftalein.
mengetahui mekanisme reaksi yang terjadi.
Larutan standar HMF
Terdapat beberapa mekanisme pencoklatan Larutan standar HMF 100 ppm dibuat dengan
dalam makanan (ACS Symposium,1996), melarutkan 0,01 g HMF 99% (Aldrich) dengan
antara lain, reaksi Maillard, yaitu reaksi air demin hingga volumenya menjadi 100 mL.
pencoklatan akibat terjadinya terjadinya reaksi Larutan standar HMF 5; 10; 20; dan 40 ppm
kondensasi antara gugus amina dari asam dibuat dengan cara memipet 2,5; 5; 10; dan 20
amino atau protein dengan gugus karbonil dari mL larutan standar 100 ppm dan diencerkan
karbohidrat. Reaksi lainnya adalah dengan air demin hingga volumenya menjadi
karamelisasi, yaitu reaksi pencoklatan akibat 50 mL. Larutan HMF disiapkan setiap minggu
pengaruh panas yang menyebabkan dan disimpan pada suhu 4 oC.
terdekomposisinya molekul gula. Karamelisasi
Pengaruh pH terhadap pembentukan HMF
dipercepat bila larutan yang dipanaskan
dalam sampel
memiliki pH asam, atau terdapat ion-ion logam
Larutan sampel diatur pHnya sampai diperoleh
tertentu. Diduga mekanisme yang terjadi,
larutan dengan pH 3, 4, 5, 6, 7, 8, 9, dan 10.
terutama pada ion logam transisi, melibatkan
Masing-masing larutan kemudian diambil
transfer elektron yang mempercepat terjadinya
sebanyak 10 mL, lalu dipanaskan selama 60
dehidrasi gula.
menit pada suhu 80 oC. Larutan yang diperoleh
Penelitian ini bertujuan untuk menyelidiki kemudian diukur menggunakan HPLC dengan
pengaruh ion logam Zn2+, Cr3+, Mn2+, dan Sn2+ metode standar eksternal, menggunakan pelarut
terhadap pembentukan 5-hidroksimetil furfural metanol : air (4 : 6), elusi isokratik, laju alir 1
(HMF) dalam produksi high fructose syrup mL/menit, pada λ maksimum 280 nm, dan
(HFS). kolom C-18.
2. Percobaan Pengaruh waktu pemanasan terhadap
Pembuatan larutan sampel untuk analisis pembentukan HMF dalam sampel
Sirup fruktosa 55% dengan konsentrasi Brix 77 Larutan sampel diatur pHnya dengan
(77% gula + 23% air) diperoleh dari PT. penambahan buffer pH 4 menggunakan pH
Puncak Gunung Mas, Jl. Raya Poncol, Ciracas, meter sampai diperoleh larutan dengan pH 4.
Jakarta timur. Gula yang terkandung dalam Selanjutnya dipanaskan pada suhu 80 oC
sirup ini terdiri dari 55% fruktosa, 41% selama 0, 60, 120, dan 180 menit. Masing-
glukosa, dan 4% oligosakarida. Sirup masing larutan diukur kandungan HMFnya
diencerkan dengan menggunakan air demin dengan menggunakan HPLC dengan metode
12
0
3 4 5 6 7 8 9 10
pH Larutan
10,00
Konsentrasi HMF (ppm)
9,00
8,00
7,00
6,00
5,00
0 50 100 150 200
Waktu pemanasan (menit)
Gambar 2. Kurva pengaruh waktu pemanasan terhadap pembentukan HMF dalam larutan HFS.
Tabel 1. Pengaruh ion-ion logam terhadap pembentukan 5-hidroksimetil furfural (HMF) dalam
sampel high fructose syrup (HFS)
Konsentrasi Ion Logam (ppm) Konsentrasi HMF (ppm)
No.
Zn2+ Mn2+ Cr3+ Mn2+
1. 0 6,99 5,28 30,59 4,16
2. 10 6,37 4,89 30,73 5,81
3. 20 4,61 4,75 27,06 5,85
4. 30 5,65 4,20 30,66 5,92
5. 40 5,65 4,14 31,62 7,00
6. 50 5,06 3,47 32,86 11,23
ion Sn2+ cukup berpengaruh pada pembentukan lebih efektif mengkatalisis pembentukan HMF
HMF, dimana sampel yang mengandung 50 di dalam sistem gula dibandingkan dengan
ppm ion Sn2+ kandungan HMFnya naik hampir Fe2+. Hal ini menyiratkan bahwa tahap awal
3 kali lipat dibandingkan dengan kontrolnya dari proses katalisis tersebut adalah reaksi
(Tabel 1). oksidasi-reduksi antara ion logam dengan
senyawa gula pereduksi. Diperkirakan bahwa
Karakteristik dari logam-logam transisi adalah
mekanisme reaksi yang terjadi adalah seperti
kemampuannya berada dalam keadaan stabil
terlihat pada Gambar 5. Namun demikian
pada beberapa tingkat oksidasi, oleh karena itu
masih sulit untuk memprediksi mengapa hal ini
logam-logam ini dapat berfungsi sebagai katalis
tidak terjadi pada ion Cr3+ dan Zn2+. Masih
dalam reaksi-reaksi yang melibatkan transfer
diperlukan penelitian lanjutan untuk
elektron (Bender dan Brubacer, 1973). Menurut
mengetahui karakteristik ion-ion logam ini,
Eskin (ACS Symposium,1996), ion logam Fe3+
CHO HC OH CH2OH
HC OH C OH C O
HO CH HO CH HO CH
HC OH HC OH HC OH
HC OH HC OH HC OH
O O O
HC OH HC O HC O
C C C
O
HOH2C CHO
CH CH2 CH
HC OH HC OH HC
HC OH HC OH HC OH 5-hidroksimetil furfural
(HMF)
H2C OH H2C OH H2C OH
Gambar 4. Mekanisme Dehidrasi Gula Menghasilkan HMF
35
Konsentrasi HMF (ppm)
30
25
20 Zn2+
Mn2+
15 Cr3+
10 Mn2+
0
0 10 20 30 40 50 60
Konsentrasi Ion Logam (ppm)
Gambar 4. Pengaruh Ion-ion Logam terhadap pemebntrukan HMF dalam larutan HFS yang
dipanaskan selama 60 menit pada suhu 80 oC.
terutama ion-ion yang sama tetapi memiliki kemungkinan reaksi berjalan dengan
tingkat oksidasi yang berbeda, misal ion Cr6+ mekanisme yang berbeda.
dan Mn 4+ atau Mn7+. Kesulitan yang
mungkin dihadapi adalah karena ion-ion logam
ini dikenal bersifat oksidator kuat, sehingga
CH2OH HC OH HC O n+
M
C O C OH Mn+ C O
+ 2 H+
HO CH HO CH HO CH
HC OH HC OH HC OH
HC OH HC OH HC OH
HC O HC O HC O-
HC O
C O C O. C O.
C O
CH CH HO CH
CH
OH + HC OH HC OH HC OH
CH
HC OH HC OH HC OH
HC OH
CH2OH CH2OH CH2OH
CH2OH
M(n-1)+ + OH -
Mn+ + OH
Gambar 5. Mekanisme degradasi gula menjadi 5-hidroksimetil furfural dengan katalis logam
Abstract
Reaction of thiophene-2-carboxylic hydrazides, with either 2-hydroxyacetophenone (LH) or 5-
chloro-2-hydroxyacetophenone (LCl) has lead to formation of two new Schiff bases,
thiophene-2-carboxylic hydrazides (LH) and 5-chloro-2-hydroxyacetophenone LCl). Template
condensation of LH or LCl and zinc acetate in the presence of triethylamine have produced
two new zinc(II) complexes, bis{µ-O-[1-(2-oxidophenyl)ethylidene]benzohydrazido-
bis[(DMSO)-zinc(II)] (ZnLH) and bis{µ-O-[1-(5-chloro-2-oxidophenyl)-ethylidene]-
thiophene-2-carbohydrazidato}bis-[(pyridine)-zinc(II)] (ZnLCl). The x-ray structure of
ZnLCl, the IR, 1H and 13C NMR data indicate that the hydrazone ligands coordinate to zinc
centers in a tridentate manner via CN,CO and phenolic OH group. The x-ray crystallographic
study of ZnLCl indicates that the complex belongs to a monoclinic system with
centrosymmetric dimer atoms via Zn-O bridge. The Schiff bases and the two zinc (II)
complexes show strong cytotoxic activities against MCF-7 (human breast cancer cells) and
MES-SA (human uterus cancer cells) with IC50 values of 4.5 µg ml-1 and 9 µg ml-1 respectively
with reference to positive control tamoxifen. Further testing of these compounds with a series
of normal cell lines such as MRC-5 (normal lung) and Chang’s liver (normal liver) was also
being performed.
Keywords: biological activities, Schiff bases, x-ray structure and zinc complexes.
O O
Cl
S HN N S HN N
H3C H3C
HO HO
1
biological activities of thiophene-2-carboxylic H and 13C NMR spectra were carried out on
hydrazides with either hydroxyacetophenone or Lambda JEOL 400 MHz FT-NMR
chlorohydroxyacetophenone. spectrometer.
2. Materials and methods Culture of cells and cytotoxic assay
Materials The technique used was described by Freshney
Thiophene carboxylic hydrazide, 2- (2000) with some modification. MCF-7 (human
hydroxyacetophenone and 5-chloro-2- breast cancer cells) and SA-2 (human uterus
hydroxyacetophenone, metal acetate, ETOH, cancer cells) were seeded into 96 well plates at
Et2O were used without further purification. an initial cell density of approximately 5 X 105
Pyridine was pre-dried over activated cells cm-3. After 24 hours incubation for cell
molecular sieve before use. attachment and growth, the medium was
removed and replaced with fresh medium
Synthesis of ligands
containing varying concentrations of organic
A typical procedure for the preparation of
compounds. The compounds added were first
Schiff base ligand is as follows. A solution of
dissolved in DMSO at the required
0.1 mol thiophene-2-carboxylic hydrazide in 50
concentration. Subsequent 6 desirable
cm-3 ethanol was added slowly to a 0.1 mol
concentrations was prepared using growth
ethanolic solution of either 2-
medium. Control wells received only DMSO.
hydroxyacetophenone (LH) or 5-chloro-2-
Each concentration of the compound under
hydroxyacetophenone (LCl).
study was assayed in eight replicates. The assay
Synthesis of complexes was terminated after 24 hours incubation
The metal complexes were prepared by mixing period. Again, the medium was removed and
the solution of zinc acetate in ethanol with a the cell viability was determined after further 4
solution of thiophene carboxylic hydrazide and hours incubation with 5 mg cm-3 MTT [3-(4,5-
the corresponding ketone in a 1:2:2 molar ratios dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium]
with refluxing and stirring. The products bromide; also named as thiazol blue). DMSO
formed were filtered and recrystallized from was then added per well and the dissolving
pyridine mixture. formazan precipitate was read by using elisa
plate reader, Multiskan Multisoft Primary EIA
Physical measurements
Carbon, hydrogen and nitrogen analyses were V. 1.4-0 at 560 nm. For comparison studies,
carried out at Faculty of Science and tamoxifen was used as a positive control. IC50
Technology, Universiti Kebangsaan Malaysia. value is taken from the plotted graph of
The UV-vis (in DMSO) and IR spectra were percentage live cells compared to control (%)
recorded using Shimadzu 1600 spectrometer versus tested concentration of compounds (µg
and Perkin Elmer RX1 spectrometer as KBr ml-1). The IC50 value is the concentration
disks in the range 4000-370 cm-1), respectively. required for 50% growth inhibition. It
represents the growth inhibitory (cytostatic)
effects on cell viability of the compounds tested The 13C{1H} NMR spectra show that the (C=O,
(Wall et al., 1987). from 164.57 in ligand to 167.78 ppm in
complex) and (C=N, 158.46 to 161.74 ppm)
3. Results and Discussions
have shifted to higher frequency indicating
IR Spectra
participation of these groups in chelate
The Zn (II) complexes are light yellow in
formation.
colour, stable in the air. They are soluble in
DMSO, DMF or pyridine. All the complexes UV-vis of ligands and complexes
melt over 250 oC. The IR spectra of the The UVvis spectra of the DMSO solution of
complexes when compared to that of free the ligands recorded between 200-800 nm
ligand show that the ν (N-H) formerly at 3226 exhibited strong absorption bands between 267
cm-1 disappears in the spectra of the complexes to 285 nm assignable to π→ π* of the phenyl
supporting deprotonation of the ligand upon ring. The bands at 312-334 nm region is
complex formation. The ν(C=O) bands of 1650 attributed to π→ π* transition involving
cm-1 in the free ligand also disappears in the molecular orbital of the azomethine group
spectra of the complexes indicating destruction (C=N). The differences are observed in the
of the keto group presumably via enolisation visible spectra of the complexes compared to
and bonding of the ligand through the resulting that of the corresponding ligand. The π→ π*
enolate oxygen (Hapipah et al., 2004). The transition due to the C=N chromophores has
ligands also showed strong bands around 1600 undergone bathchromic shift upon coordination
cm-1, which are assigned as the ν(C=N) bands. ca. 400 nm. The π→ π* transition of the
In the metal complexes, this stretching band aromatic ring undergoes a shift to higher
has shifted to lower frequencies, due to the energy to the lower wavenumbers.
lowering of the ν(C=N) bond order as a result
X-ray study
of zinc-nitrogen bond formation. The shifting
The x-ray structure of one of the zinc (II)
of the ν (N-N) from 1030 cm-1 to 1082 cm-1
complexes, bis {µ-O- [1-(5-chloro-2-
wavenumbers further support coordination of
oxidophenyl)-ethylidene]-thiophene-2-
the ligand via the azomethine nitrogen atom.
carbohydrazidato} bis- [(pyridine)-zinc (II)] or
The ν (C-OH) bands of 1284 cm-1 in phenol
(ZnLCl) was elucidated successfully. The
have disappeared in Zn (II) complexes
molecule indicates that each zinc atom is
indicating coordination of OH to the metal
coordinated to a tridentate ligand via CN, CO
center. The new bands at ca. 590 and 430 cm-1
and phenolic OH group. The title complex
are tentatively assigned to ν (M-O) and ν (M-
belongs to a monoclinic system with
N) bands respectively.
centrosymmetric dimer atoms via Zn-O bridge
NMR Spectra (Hapipah et al., 2004).
The 1H NMR spectra of Zn (II) complexes do
Cytotoxicity
not exhibit the NH proton signal lending further
The results of cytotoxicity testing are presented
support to the infrared evidence that the
in Table 1. According to the United States
hydrazide ligand coordinates to the metal
National Cancer Institute, if the initial
center in its deprotonated form. The phenolic δ
cytotoxicity test on cancer cell lines gives IC50
(OH) peak has disappeared in the 1H NMR
value less than 20 µgml-1, this compound can
spectra of Zn (II) complex and has shifted to
be categorized as having a potential anticancer
136 ppm in 13C{1H} NMR indicating that zinc
activity.
atom has bonded to ligand via phenolic oxygen.
IC50 µg ml-1
Compounds MCF-7 SA-2 Chang’s
TCHHap 4.5 10.5 ac
TCHClHap 18.2 15.0 ac
Zn TCHHap 4.5 9.5 ac
Zn TCHClHap 4.0 9 ac
Tamoxifen 18.2 10.7 wbd
The Schiff base ligand, TCHHap is more The Schiff base, TCHHap is more sensitive
sensitive towards the MCF-7 cells (human towards the MCF-7 cells (human breast cancer
breast cancer cells) than the chlorinated ligand, cells)and SA-2 cells (human uterus cancer
TCHClHap with IC50 values of 4.5 and 18.2 µg cells) TCHClHap than the chlorinated ligand.
ml-1 respectively. However both Zn (II) However both Zn (II) complexes are very
complexes are very cytotoxic as compared to cytotoxic as compared to the well-known
the well known anticancer drug, tamoxifen. anticancer drug, tamoxifen. The presence of
The presence of sulphur atoms in the ligands sulphur atoms in the ligands, its conjugation
has enhanced the cytotoxic behaviour as is upon complexation and polarisibility of zinc
evident from the lower IC50 values of the atoms to the organic moiety has enhanced the
complexes. This is attributed to an increase in cytotoxic behaviour of the compounds.
conjugation of the ligand moieties upon
5. References
complexation as well as the dimer formations 1. Swiegers G.F., Malefetse T.J., Chem. Rev.,
of the complexes. Increase in cytotoxic active 2000, 100, 3483
sites in the dimmers might have increased the
cytotoxic activity. A similar pattern was shown 2. Vallina A. T., Stoeckli-Evans H.,
Polyhedron, 2002, 1177-1187.
by SA-2 cell line with TCHClHap and
tamoxifen gives a better performance as growth 3. Tarafder M.T.H., Kasbollah A., Crouse
inhibitory compound. K.A., Ali A.M., Yamin B.M., Fun H.K.,
Polyhedron, 2001, 2363-2370.
4. Conclusions
The new Zinc (II) complexes have been 4. Haiduc Y., Silvestru A., Coord. Chem.
successfully synthesized from condensation of Rev., 1990, 99, 253.
thiophene-2-carboxylic hydrazides, with either 5. Freshney, R.I. 2000. Culture of Animal
2-hydroxyacetophenone (LH) or 5-chloro-2- Cells: A Manual of Basic Technique, 4 th
hydroxyacetophenone (LCl) and zinc acetate. ed. John Wiley and Sons.
The x-ray structure of one of the zinc (II) 6. Wall, M.E., Taylor, H. & Wani, M. C. R.
complexes, bis {µ-O- [1-(5-chloro-2- 1987. Plants antitumor agents, 24. Rapids
oxidophenyl)-ethylidene]-thiophene-2- 7. KB Assay. J. Nat. Products, 50 (4): 764-
carbohydrazidato} bis- [(pyridine)-zinc (II)] or 766.
(ZnLCl) was elucidated. The molecule 8. Kikuzaki H., Nakatani N., J. Food Sci.,
indicates that each zinc atom coordinates to a 1993, 1407.
tridentate ligand via CN, CO and phenolic OH
group. The title complex belongs to a 9. Hapipah M. Ali, Mazliza Mohammad, M.
Sukeri M. Yusof and Bohari M. Yamin,
monoclinic system with centrosymmetric dimer Acta Cryst. 2004, E60, 123-125.
atoms through Zn-O bridges.
Muhammad I. Saleh1, Eny Kusrini1, Rohana Adnan1, Bahruddin Saad1, Abdussalam Salhin1,
Bohari M. Yamin2
Abstract
The reaction of Nd(NO3)3.6H2O with acyclic polyethers (tetraethylene glycol, EO4 and
pentaethylene glycol, EO5) in the presence of picrate anion produce
[Nd(pic)2(OH2)(EO4)] +(pic)-.(H2O) and [Nd(pic)2(EO5)] +(pic)- complexes. They have been
determined by single X-ray diffraction. The crystal system in EO4 complex is triclinic with
space group P1, a = 8.3472(13), b = 12.597(2), c = 18.837(3) Å, α = 104.740(3), β =
96.060(3) and γ = 95.009(3)°, V = 1891.3(5) Å3 and Z = 2. The crystal of EO5 complex is
monoclinic with space group P21/c, a = 18.7757(2), b = 9.03370(10), c = 24.0936(3) Å and β
= 109.1600(10)°, V = 3860.24(8) Å3 and Z = 4. The glycol ligands all exhibit a helical
wrapping pattern around the Nd(III) ions. In EO4 complex, the Nd atom is linked to all the
five oxygen atoms of the EO4 ring, one water molecule and two picrate ligands (one via
phenoxo oxygen atom and the other one with both phenoxo and nitro oxygen atoms in a
bidentate manner). While, in EO5 complex, the Nd atom is coordinated to EO5 ring via all the
six oxygen atoms and two picrate ligands is similar pattern with in EO4 complex. The average
bond lengths in EO4 complex namely Nd−O(ether) [2.523 (3)], Nd−O(phenolic) [2.368(3)],
Nd−O(nitro) [2.558(3)] and Nd−OH2 [2.453(3)] Å. All bond length observed is comparable to
the EO5 complex namely Nd−O(ether) [2.540(3)], Nd−O(phenolic) [2.353(3)], Nd−O(nitro)
[2.564(3)] Å. The mean deviation from pentadentate plane in EO4 complex [0.7657 Å] is
higher than hexadentate in EO5 complex [0.7166 Å]. The (O−C−C−O) torsion angles for EO4
moiety adopts the g− g+ g− g+, while that of EO5 moiety adopts a g− g− g+ g− g+ patterns.
The geometry of neodymium in the complexes is tricapped trigonal prismatic is stabilized by
intermolecular hydrogen bonding of the type C−H…O and O−H…O to form a three
dimensional network.
Keywords: Neodymium, Pentaethylene Glycol, Picrate complex, Tetraethylene Glycol
ligand (EO5) as well as another ligand called Perkin-Elmer 2000 FT-IR spectrometer. 1H
tetraethylene glycol (EO4 (Scheme 1) with NMR spectra were recorded using Bruker
neodymium picrate in order to observe any Spectrometer 400 MHz in DMSO solution.
significant trends by changing the atomic
X-ray analysis
number of the lanthanide as well the length of
The selected crystal was mounted on a glass
the glycol chain.
fiber with epoxy cement for the X-ray
crystallographic study. The reflection data was
collected with a 1K-SMART CCD
O OH
diffractometer using graphite-monochromator
Mo Kα radiation (λ = 0.71073 Å) with a
O detector distance of 5 cm and swing angle of -
35° at 293(2) K. A hemisphere of the reciprocal
( O OH
space was covered by combination of three sets
of exposure. Each set had a different θ angle
)n (0.88; 180°) and each exposure of 10 sec,
Scheme 1 if n = 1 = EO4 and n = 2 = covered 0.3° in ω. Crystal decay was monitored
EO5 by repeating fifty initial frames at the end of
data collection and analyzing the intensity of
2. Experimental duplicate reflections, and was found to be
All chemicals were used without further negligible. The data collected were reduced
purification. EO4 (97% purity) was purchased using the program SAINT [Sheldrick, 1996]
from Acros, USA. Picric acid and EO5 (97% and empirical absorption was carried out using
purity) were purchased from Fluka (Germany). SADABS [Sheldrick, 1996]. The structure was
Neodymium nitrate hexahydrate solved by direct methods and refined using the
[Nd(NO)3.6H2O] was purchased from Ward full-matrix least square on Fo2 using the
Hill. The preparations of the complexes were SHELXTL software package [Sheldrick, 1997].
carried out as described previously [Saleh et The positions of all remaining non-hydrogen
al., 2004]. atoms were obtained from successive Fourier
syntheses. The position of hydrogen atoms
Direct interaction of Nd(NO3)3.6H2O (0.434 g, were calculated using idealized geometry.
1 mmol) and picric acid (0.91 g, 3.97 mmol)
with EO4 (2.13 g, 11mmol) in 1 : 1 3. Results and Discussion
CH3CN/CH3OH produced the dehydrate Direct reactions of hydrated neodymium nitrate
[Nd(pic)2(OH2)(EO4)]+(pic)-.(H2O) complex salts with acyclic polyethers and picrate anion
(yield 26%). Microelement analysis, Calc.: C, produced the complex of 1:1 ratio. The IR
29.38, H, 2.35 and N, 11.87%. Found: C, spectra revealed that EO4 complex with Nd(III)
30.27; H, 2.31 and N, 11.62% with m. p. contained stoichiometric proportions of H2O as
200.4°C. evidenced by the appearance of more broad
band of OH groups. The differences in the IR
The second complex carried out by the spectra between the free ligand and its
interaction of Nd(NO)3.6H2O (0.434 g, 1 complexes are exhibited in Figure 1. The strong
mmol) and picric acid (0.91g, 3.97 mmol) with absorption bands at 3401 and 2873 cm-1 on the
EO5 (0.6 g, 2.52 mmol) in 3 : 1 EO5 spectrum correspond to the stretching of
CH3CN/CH3OH gave the the alcohol groups (OH) and C−H,
[Nd(pic)2(EO5)]+(pic)- complex (yield 27%). respectively. The absorption band
Microelement analysis, Calc.: C, 31.36; H, 2.52 corresponding to ν (C−O−C) on the ligand
and N, 11.76%. Found: C, 31.66; H, 2.41 and spectra were shifted by 51 and 18 cm-1 upon
N, 11.52% with m. p. 263.0°C. complexation as a clear evidence for the
Physical measurements involvement of the oxygen atoms on the ligand
Elemental analyses were carried out using framework in the coordination. The free picrate
Control Equipment Corporation Model 250- has νas (NO2) and νs (NO2) at 1555 and 1342
XA, USA. The IR spectra were recorded as cm-1, respectively, which splits into two bands
KBr pellets, in the range of 4000-400 cm-1 on a at 1575, 1537 cm-1 and 1362, 1332 cm-1 for
C
%T
Figure 1. The IR spectra of the EO4 (A) and EO5 (B) ligands and their complexes C:
[Nd(pic)2(EO5)]+(pic)- and D: [Nd(pic)2.(OH2)(EO4)]+( pic)-.(H2O)
Reflection collected / Unique 24338 / 8677 [Rint = 0.0244] 20074 / 11254 [Rint =
0.0288]
Refinement method Full-matrix least-squares on F2 Full-matrix least-squares on
F2
Data/Restraints/parameters 8677 / 0 / 590 11254 / 0 / 586
Final R index [I>2σ(I)] R1 = 0.0372, wR2 = 0.1002 R1 = 0.0436, wR2 = 0.1226
R indices (All data) R1 = 0.0390, wR2 = 0.1016 R1 = 0.0743, wR2 = 0.1647
Goodness of fit 1.103 1.074
atoms and two picrate ligands in a similar are significantly longer than the three
pattern as in EO4 complex without the Nd−O(ether) ones [mean 2.515(3) Å].
involvement of the solvated water. This atomic Comparing with the corresponding in EO5
arrangement facilitated the tricapped trigonal complex, the Nd−O(ligand) distances [mean
prismatic geometrical structure. Generally, both 2.540(3) Å] are of two types: the two terminal
the acyclic ligands formed a complex of cyclic- Nd−O(alcohol) distances [mean 2.518(3) Å]
like conformation as depicted in Fig. 3. are significantly shorter than the four
The selected bond lengths, bond angles and Nd−O(ether) ones [mean 2.552(3) Å]. The
torsion for the complexes are given in Tables 2 average Nd−O(ligand) is 2.540(3) Å, which is
and 3. The average value of bond lengths slightly shorter as compared with that in
between the neodymium atom and the [Nd(NO3)2(EO5)](NO3) [2.563(4) Å] [Rogers
coordinated oxygen atoms are [2.485(3)] and et al., 1991].
[2.501(3)] Å for the EO4 and EO5 complexes, The angles O−Nd−O for adjacent oxygen
respectively. The Nd atom in EO4 complex is atoms of the cyclic ring are a little larger than
closer to the oxygen donor atoms than EO5
60° except for that between the oxygen atoms
complex because of the different chain length.
(O1 and O5 [129.49(10)°]) and (O1 and O6
The average Nd−O(ligand) is 2.620(4) Å in the
[71.67(10)°]) in the terminal alcohol groups.
[Nd(NO3)3(EO4)] complex [Lu et al., 1997],
which is significantly elongated when The bigger angles of O1−Nd−O5 in EO4
compared with the [Nd(pic)2(OH2)(EO4)]+(pic)- complex is attributed to the longer distance
.(H2O) complex [mean 2.523 (3) Å]. The five between the two oxygen atoms compared with
those between the other oxygen atoms. The
Nd−O(ligand) distances [mean [2.523 (3) Å]
phenyl rings of the coordinated picrates are
are of two types: the two terminal
almost perpendicular and less than 90°. The
Nd−O(alcohol) distances [mean 2.535(3) Å]
(O−C−C−O) torsion angles in EO4 ring adopts
Table 2 Selected bond length (Å) and bond angles (°) in the complexes
Atom EO4 (Å) EO5 (Å) Atom EO4 (°) EO5 (°)
Nd−O1 2.548(3) 2.541(3) O1-Nd1-O2 61.87(9) 62.72(9)
Nd−O2 2.562(3) 2.576(3) O3-Nd1-O2 62.35(10) 60.89(10)
Nd−O3 2.491(3) 2.494(3) O3−Nd1−O4 62.94(10) 62.68(12)
Nd−O4 2.491(3) 2.565(3) O4−Nd1−O5 61.72(9) 61.82(13)
Nd−O5 2.522(3) 2.571(3) O6−Nd1−O5 69.21(10) 62.28(11)
Nd−O6 2.453(3) 2.495(3) O5-Nd1-O1 129.49(10) -
Nd−O7 2.334(3) 2.349(3) O6−Nd1−O1 65.50(10) 71.67(10)
Nd−O14 2.402(2) 2.356(3)
Nd−O20 2.558(3) 2.564(3)
the sequence g− g+ g− g+, while that of EO5 crown-5): synthesis and structures of
ring adopts a g− g− g+ g− g+. The only [pr(NO3)3 (stilbeno-15-crown-5)] and
[Nd(NO3)3(EO5)] (EO5 = tetraethylene
(C−O−C−C) torsion angle, which is not anti
glycol). Polyhedron 16, p. 1149-1156.
that is C2−O2−C3−C3 [-83.6(5)°] in EO5 chain
and it occurs between C−C torsion angles of 2. Saleh M. I., Kusrini E., Adnan R., Rahman I.
A., Saad B., Usman A., Fun, H.-K., Yamin
like sign and deviate toward g−.
B.M. (2004). The Crystal Structure and
The hydrogen bonding environment of Thermal Stability of [bis-
O−H…O and C−H…O to form a three picrate(pentaethylene glycol)]
dimensional network in the EO5 complex is praseodymium(III)picrate Complex. J. Chem.
Crystallogr. In Press, Corrected Proof.
much more extensive than in the EO4 complex.
Two alcohol oxygen atoms in EO5 chain form 3. Sheldrick G. M., SAINT V4. (1996).
H-bonds, while the only one alcohol group in Software Reference Manual Siemens
EO4 was used to forms H-bond. Analytical X-Rays System, Madison, WI,
USA.
4. Conclusion
4. Sheldrick, G.M., SADABS. (1996). Program
The structural results have shown that as the
for Empirical Absorption Correction of Area
number of donor atom increased in the ligand Detector Data, University of Gottingen;
framework the acyclic polyethers wrap closer Germany.
around the neodymium ion.
5. Sheldrick, G.M., SHELXTL97, Version 5.10.
5. Acknowledgements (1997). Bruker AXS, Inc. Madison, WI.
The authors would like to thank Universiti
6. Wang Y.-W, Liu W.-S, Tang N, Tan M.-Y.
Sains Malaysia and Universiti Kebangsaan (2004). Studies on 1H NMR, infrared and
Malaysian for the facilities provided and fluorescence spectra of rare earth complexes
Malaysian Government financial support with a new binaphthylamide. Spectrochimica
through research grants IRPA No. Acta A, 60, p. 2459-2463.
305/PKIMIA/612906, FRGS No
7. Rogers R. D., Rollins A. N., Henry R. F.,
304/PKIMIA/670006. Murdoch J. S., Etzenhouser R. D., Huggins
6. References S. E., Nunez L. (1991). Direct comparison of
1. Lu T., Ji L., Tan M., Liu Y., Yu, K. (1997). the preparation and structural features of
A structural change between the complexes crown ether and polyethylene glycol
of praseodymium and neodymium nitrates complexes of NdCl3.6H2O. Inorg. Chem. 30,
with (Z)-2,3-diphenyl-1,4,7,10,13- p. 4946-4954.
pentaoxacyclo-pentadec-2-ene(stilbeno-15-
Abstrak
Sejumlah senyawa fenol telah diisolasi dari beberapa spesies Moraceae. Genus Artocarpus
terutama mengandung jenis flavonoid terprenilasi pada posisi C-3, 6`, dan 8`. Prenilasi pada
C-3 menghasilkan anekaragam kerangka karbon seperti piran-, furan-, oksepin-, oksosin-,
dan jenis dihidrobenzosanton. Dan pola oksigenasi senyawa flavon dari Moraceae sangat
unik yakni pada posisi 2`,4` atau 2`,4`,5`. Sedangkan kandungan kimia satu dari 2 spesies
Genus Morus yang tumbuh di Indonesia yakni M. macroura menghasilkan sejumlah senyawa
fenol terutama dari jenis stilben, aril benzofuran dan adduct Diels Alder. Disamping itu,
sejumlah senyawa non fenol yakni steroid dan triterpen telah diisolasi pula dari kedua genus
ini. Beberapa senyawa yang dihasilkan dilaporkan memiliki bioaktivitas yang penting seperti
anti-tumor, anti-viral, anti-fungi dan anti-mikroba. Uji sitotoksik yang dilakukan terhadap sel
murin leukemia P 388 dari beberapa senyawa yang diisolasi seperti artoindonesianin,
artokarpin, mulberofuran-K, caplasin, dan morasin-M menunjukkan aktivitas yang sangat
tinggi dengan IC50 berturut-turut 0,2; 1,9; 1,9; 2,0; dan 2,4 ug/mL. Mengingat potensinya
yang sangat tinggi speses ini dikembangkan melalui kultur jaringan sebagai produsen
metabolit sekunder. Pada makalah ini akan dibahas mengenai metobolit sekunder yang
diisolasi dari kultur tunas, kultur akar dan pengaruh penambahan elisitor.
flavonoid, arilbenzofuran dan aduct Diels- dikaji pula metabolit sekunder yang dihasilkan
Alder. Beberapa diantaranya menunjukkan melalui kultur jaringan.
aktivitas farmakologis seperti antihipertensi,
Senyawa fenolik dari genus Artocarpus
antimikroba dan promoter anti-tumor.
Sekitar dua puluh spesies Artocarpus yang
[Nomura, 1988; Nomura, 1994]
tumbuh di Indonesia telah diselidiki kandungan
Dalam makalah ini akan dibahas mengenai pola kimianya di laboratorium kami. Metabolit
kimia beberapa spesies genus Artocarpus dan sekunder yang berhasil diisolasi dari genus ini
Morus yang tumbuh di Indonesia, serta meliputi senyawa fenolik terprenilasi dari jenis
hubungan struktur beberapa senyawa yang stilben, arilbenzofuran dan flavonoid disamping
dihasilkan dengan sitotoksisitasnya terhadap senyawa nonfenol steroid dan triterpen.
sel murin leukemia P 388. Disamping itu akan
Oksiresveratrol (1) merupakan senyawa stilben
HO HO HO
OH OH OH
OH OH
OH OH OH
1 2 3
Gambar.1. Stilben dari Artocarpus
OCH3
OH OH OH
HO O HO O O O
OH OCH3 OH
4 5 6
OH OH
HO O O O
OH OH
7 8
Gambar.2. Turunan 2-Arilbenzofuran dari Artocarpus
OH O
HO O
OH O OH O
9 10
yang paling sederhana dari genus ini, yang dari A. fretessi telah diisolasi artoindonesianin-
diisolasi dari Artocarpus dasyphyllus dan A. Y (7) dan artoindonesianin-X (8).[ (Soekanto,
gomezianus, sedangkan dua stilben terprenilasi 2003]
yakni artoindonesianin-F & N (2) & (3)
Berbeda dengan 2-arilbenzofuran, senyawa
ditemukan berturut-turut dari A. altilis dan A.
calkon terprenilasi banyak dilaporkan terdapat
gomezianus.
pada genus Artocarpus. Tiga senyawa
Senyawa turunan 2-arilbenzofuran sangat dihidrocalkon terprenilasi dilaporkan diisolasi
jarang ditemukan pada genus Artocarpus, dari A. communis, dan tujuh calkon terprenilasi
sejauh ini hanya artotonkin yang dilaporkan yakni paratokarpus A-G diperoleh dari A.
diisolasi dari A. tonkinensis. Namun sejumlah venenosa. Sedangkan dari hampir dua puluh
senyawa baru dari jenis arilbenzofuran spesies Artocarpus yang diselidiki di
terprenilasi telah diisolasi dari beberapa spesies laboratorium kami, hanya A. bracteata Hook
Artokarpus Indonesia yang kami selidiki, yakni yang mengandung senyawa jenis calkon
artoindonesianin-AN (4) dari A. altilis, terprenilasi yakni konzonol-C (9) dan
artoindonesianin-AR (5) dari A. gomezianus, artoindonesianin-J (10). Spesies ini dikenal
artoindonesianin-AJ (6) dari A. champeden dan dengan nama daerah cubadak hutan,
OH OH OH
HO O HO O HO O
OH
OH OGly OH
OH OH OH
11 12 13
H3CO O HO O H3CO O
OCH3 OCH3
OH O OH O OH O
14 15 16
Gambar.5. Flavanon dari Artocarpus
HO OH HO OH HO OH
HO O HO O HO O
OH O OH O OH O
17 18 19
HO OH HO OH HO OH
O O O O O O
OH OH
OH O OH O OH O
20 21 22
Gambar.6. Flavon dari Artocarpus
OH
OH OH OH
HO O HO O HO O
O O O
OH O OH O OH O
23 24 25
OH OH OH
H3CO O HO O H3CO O
O O O
OH O OH O OOH OH O
OH OOH
26 27 28
merupakan spesies yang endemik untuk paling sederhana yang merupakan precursor
Sumatera Barat.[ Ersam, 2002] untuk senyawa turunan flavon terprenilasi,
senyawa ini ditemukan pada banyak spesies
Senyawa turunan flavan yakni flavan-3-ol,
Artocarpus yakni A. champeden, A.
flavanon dan flavanonol banyak ditemukan
dasyphyllus, A. gomezianus, dan A. kemando.
pada Artocarpus. Demikian juga yang
Dari A. champeden juga ditemukan
diselidiki di laboratorium kami, tiga senyawa
siklokomunol (18) flavon tersubstitusi dengan
flavan-3-ol yakni afzelecin (11) diisolasi dari
satu isoprenil pada posisi C-3, kudraflavon (19)
A. reticulatus dan A. dasyphyllus, afzelecin-3-
flavon dengan dua isoprenil masing-masing
ramnosida (12) selain ditemukan pada dua
pada C-3 dan C-6, dan heterofilin (22) flavon
spesiaes tersebut terdapat pula pada A. dadah,
tersubstitusi tiga isoprenil berturut-turut pada
dan katecin (13) diisolasi dari A. reticulatus.
C-3, C-6 dan C-8. Selanjutnya dari A. altilis
Tiga senyawa turunan flavanon yakni diisolasi morusin (20) dan artonin-E (21)
artokarpanon (14), artoindonesianin-E (15) dan masing-masing dengan dua
heteroflavanon-A (16) telah diisolasi dari A. isoprenil.[Kurniadewi, 2001]
chempeden. Spesies ini termasuk Artocarpus
Substituen isoprenil pada posisi C-3
yang endemik untuk Indonesia, terdapat di
menyebabkan terjadinya diversifikasi kerangka
pulau Sumatra, Kalimantan, Sulawesi, Maluku
karbon melalui siklisasi gugus tersebut dengan
sampai Irian Jaya, di Jawa Barat dikenal
gugus hidroksil pada posisi C-2’ menghasilkan
dengan nama cempedak. Tumbuhan ini
piranoflavon seperti terlihat pada tiga senyawa
termasuk tumbuhan obat yang cukup populer,
yang diisolasi dari A. champeden, yakni
untuk digunakan sebagai obat malaria.[(Hakim,
albanin-A (23), artoindonesianin (24) dan
2001]
siklokomunin (25).; Oksepinofflavon
Senyawa turunan flavon merupakan komponen ditunjukkan oleh senyawa chaplasin (26),
yang dominan dalam genus Artocarpus. artoindonesianin-K (27) dan artoindonesianin-
Puluhan flavon terprenilasi telah dilaporkan di B (28), keitga senyawa ini diisolasi dari A.
literratur dengan ciri struktur yang sangat champeden. [Achmad, 1996; Hakim, 1999]
karakteristik, yakni pola oksigenasi cincin B
Siklisasi gugus isoprenil pada C-3 dengan
pada 2’,4’ atau 2’,4’,dan 5’. Sedangkan
dengan C-6’ menghasilkan kerangka
prenilasi terjadi pada posisi C-3, C-6, atau C-8.
dihidrobenzosanton seperti trelihat pada tiga
Norartokarpetin (17) merupakan flavon yang
HO OCH3 HO OCH3 HO OH
HO O H3CO O O O
OH OH OH
OH O OH O OH O
29 30 31
Gambar 9. Dihidrobenzosanton dari Artocarpus
HO OH HO OH
HO O HO O
O O
OH O OH O
32 33
Gambar 10. Furanodihidrobenzosanton dari Artocarpus
HO HO
OH OH
OH
34 OH 35
HO
OH
OH OH HO
OH O
H
OH OH HO OH
OH H
OH
36 OH OH
37
OH
Gambar 11. Stilben dari Morus macroura
OH
OH HO O
HO O
HO
OH
O O
OH
38 39 OH
OH OH
H3CO O O O
40 OCH3 41 OH
OH OH
OH
HO HO
OH OH
OH O H O H
HO H HO H
O
OH H OH H OH
OH OH
42 43
OH HO
HO O OH
OH
OH O H O
HO O H O H
HO O H
H OH
OH H
OH
44 45
Gambar 13. Aduct Diels Alder dari Morus macroura
OH O H
HOH2C O O OH
OH
OH
HO
OH OH
HO O O
OH O OH
46 47 48
pengobatan tradisionil, dan penyelidikan kimia endemik Indonesia dan hanya terdapat di
terhadap spesies ini telah banyak dilakukan. Sumatra Bart dan Jawa Barat yang dewasa ini
Sedangkan M. macroura merupakan spesies populasinya sudah sangat langka. Penyelidikan
HO HO
49 50
H H
HO O O
H H
51 52 53
H H H
HO AcO HO
54 55 56
.Gambar 15. Steroid dan triterpen dari Artocarpus
COOH
AcO HO
57 58
Gambar 16. Steroid dan triterpen dari Morus macroura
OH
OH
HO OH
HO OH
OH O
OH O
OH
HO
OH
HO
OH OH
OH R O
59 60 : R = H
61 : R = OH
OH HO
OH
HO OH
OH
O
OH O O
OH
OH
O HO O
HO
OH OH
62 63
Gambar 17. Aduct Diels Alder dari kultur akar Morus macroura
OH
HO OH
OH
HO OH O
OH
OH
HO
OH O
OH
64 OH O 61
OH
OH HO OH
HO
OH O
OH
OH O O
HO
OH
65 66
diena dengan dienofil isoprenilcalkon, memiliki pola kimia yang berbeda. Dimana
kuwanon-R (60) dan kuwanon-J (61) aduct Genus Artocarpus terutam mengandung stilben,
antara dehidroprenil calkon dengan 2-arilbenzofuran dan flavon yang umumnya
isoprenilcalkon, calkomorasin (62) dan terprenilasi kecuali flavanon. Dan adanya
mulberofuran-P (63) aduct antara isoprenil pada C-3 menyebabkan diversivikasi
dehidroprenil-2-arilbenzofuran dengan calkon. kerangka karbon membentuk pirano-,oksepino-
, oksosinoplavon serta dihidrobenzosanton dan
Penambahan elicitor abiotik Fe3+ terhadap
furano dihidrobenzosanton. Sedangkan
kultur akar ternyata meningkatkan kuantitas
senyawa fenol dari Morus macroura terutama
kuwanon-J, senyawa ini merupakan aduct
stilben dan 2-arilbenzofuran yang tidak
antara dua molekul moracalkon-A dimana
terprenilasi dan senyawa lainnya adalah aduct
moracalkon-A merupakan precursor dienofil
Diels-Alder dengan calkon tdk terprenilasi
untuk hampir semua aduct yang dihasilkan dari
sebagai dienofil.
kultur jaringan.
Kalau diperhatikan senyawa fenol yang
Dari kultur tunas spesies yang sama dalam
diisolasi dari tumbuhan inang M. macroura
media MS + 2,5 µmol benziladenin (BA)
baik stilben maupun 2-arilbenzofuran
diperoleh dua calkon terprenilasi yakni
umumnya tidak terprenilasi, demikian halnya
moracalkon-A (64) yang merupakan precursor
calkon sebagai dienofilnya untuk aduct Diel-
dienofil untuk hampir semua aduct Diel-Alder
Alder yang dihasilkan juga tidak terprenilasi.
yang diisolasi dari kultuir jaringan M.
Sedangkan metabolit sekunder dari kultur akar
macroura, dan isobavacalkon (65) merupakan
maupun kultur tunas terutama aduct
precursor diena untuk senyawa kuwanon-R
Diels_alder dengan calkon terprenilasi sebagai
(60). Disamping itu ditemukan pula dua aduct
doenofil. Selanjutnya pada tumbuhan inang M.
Diels-Alder kuwanon-J (61) dan calkomorasin
macroura tidak ditemukan calkon, sedangkan
(66).
dari kultur tunas ditemukan calkon yang
Sangat menarik, sejauh ini kalau dibandingkan merupakan precursor dari aduct yang diperoleh.
senyawa fenol yang diisolasi dari kedua genus Disamping itu dengan ditemukannya
Artocarpus dan Morus, masing-masing isobavacalkon disamping moracalkon-A maka
masih terbuka kemungkinannya ditemukannya Tokyo, Japan. Tak lupa terima kasih juga
aduct lain sebagai hasil sikloadisi disampaikan kepada Herbarium Bogoriensis
isobavacalkon dengan stilben dan 2- untuk bantuannya mengidentifikasi tumbuhan
aribenzofuran seperti halnya dengan sampel, dan terakhir kepada Prof. Ikram dan
moracalkon-A. Staff Jabatan Kimia, UKM yang dua tahun
terakhir ini banyak membantu dalam
Aktivitas Biologi
pengukuran spektrum NMR.
Beberapa spesies tumbuhan Moraceae sejak
lama digunakan sebagai obat tradisionil Daftar Pustaka
diberbai negara selain di Indonesia seperti Acmad, S.A., Hakim, E.H., Makmur, L.,
China dan Jepang (Nomura, 1988). Mujahidin, D., Juliawaty, L.D.,and Syah, Y.M.,
Discovery of natural products from indonesian
Sejumlah senyawa fenol yang diisolasi dari tropical rainforest plant: Chemodiversity of
Moraceae telah diuji sitotoksisnya terhadap sel Artocarpus (Moraceae). Bilge Sener (Eds),
murin leukemia P388 sebagai uji primer untuk Biodiversity: Biomoleculer Aspect of Biodiversity
aktivitas antitumor. Dan beberapa diantaranya and Utilization. Kluwer Academic/Plenum
menunjukkan aktivitas yang tinggi, seperti Publisher, London, 2002, 91-99
terlihat pada Tabel 1. Acmad, S.A., Hakim, E.H., Juliawaty, L.D.,
Kajian mengenai hubungan antara struktur Makmur, and Suyatno, Anew prenylated flevone
from Artocarpus chempeden, J. Nat. Prod., 59
dengan aktivitas dapat dinyatakan sbb. Adanya
(1996), 878-879
isoprenil pada turunan stilben meningkatkan
sitotoksisitas, demikian juga pada turunan 2- D.V. Banthorpe, Secondary Metabolism in Plant
arilbenzofuran dan flavon yang terprenilasi Tissue Culture: Scope and Limitations, Natural
pada C-3 menunjukkan aktivitas tinggi ,tapi Product Reports, 1994, 303-328
tidak untuk yang membentuk furanosanton dan Daigo, K., Inamori, Y., Tekemoto, Studies on
flavanon. Constituen of the Water Extract of the Root of
Mulberry Tree (Morus bombycis Koidz Chem.
Ucapan Terima kasih Pharm. Bull., 1986, 34, 2243-2246
Kepada berbagai fihak yakni: Kementrian
Pendidikan Nasional, Kementrian Riset dan Ersam, T., S.A. Achmad, E.L. Ghisalberti, E.H.
Hakim, L. Makmur, Y. M. Syah, “ A new
Terknologi, Center Grant, Que Project, dan
Isoprenylated Chalcone, Artoindonesianin J, from
Asahi Glass yang telah mendanai penelitian ini the Root and Tree Bark of Artocarpus bracteata”,
diucapkan terima kasih. Penulis juga ingin J. Chem. Res. (S), 186-187 (2002)
berterima kasih atas kerjasama Prof. Norio
Aimi dan staff, Chiba University, Japan, dan Fukai, T., Hano, Y., Hirakura, K., Nomura, T.,
Uzawa, J., Structur of Mulberrofuran H, a Novel 2-
Prof. Emilio Ghisalberti, University of Western
Arylbenzofuran Derivative from the Cultivated
Australia dan Prof, Koichi Takeya dari Tokyo Mulberry Tree (Morus Ihou (Ser.) Koidz), Chem.
University of Pharmacy & Life Science, Pharm. Bull., 1984, 32(2) 808-811
Hakim, E.H. Aripin, A., Achmad, S.A., Aimi, N., Kurniadewi, F., Hakim, E.H., Achmad, S.A.,
Kitajuma, M., Makmur, L., Mujahidin, D., Syah, Makmur, L., Mujahidin, D., Syah, Y.M.,
Y.M. and Takayama, H., Artoindonesianin E, A Oxyresveratrol and Norartocarpetin from
new flavanone derivatives from Artocarpus Artocarpus gomezianus Wall, Proceedings National
champeden, Proceedings ITB, 2001, 69-73 Seminar on Natural Product Chemistry, Jakarta,
Indonesia, 2001, 467-470
Hakim, E.H. Eliza, Kusumawati, Y., Achmad, S.A,
Makmur, L., Aimi, N., Takayama, H. and Kitajima, Lemmens, R.H.M.J., Soerianegara, I. And Wong,
M., Some phenolic compound from genus W.C. (Eds), Palnt Resources of South-East Asia,
Artocarpus, J. Mat. Sci., 34 (1999) 199-205 No. 5(2). Timber trees: Minor Commercial Timbers,
Prosea Foundation , Bogor, Indonesia, 1955, 57-71
Hakim, E.H., Fahriyati, A., Achmad, S.A., Makmur,
L., Mujahidin, D., Nomura, T. and Syah, Y.M., Nomura, T., Phenolic compounds of the mulberry
Artonin A, A Furanodihydrobenzoxanthone tree and related plants, Fortschr. Chem. Org. Narurst
derivatives from from Artocarpus champeden, J. ., 64 (1988) 87-201
Kimia Andalas (2000) 72-76
Soekanto, N.H., Achmad, S.A., Hakim, E.H., Syah,
Hakim, E.H., Fahriyati, A., Kau, M.S., Achmad, Y.M., Aimi, N., Kitajima, M., Takayama, H.,
S.A., Makmur, L., Ghisalberti, E.L. and Nomura, T., Umbeliferon Senyawa antifungal dari Tumbuhan
Artoindonesianin A and B, two new prenylated Andalas Morus macroura, Bull.Soc. Nat. Prod.
flavones from the root bark of Artocarpus Chem., Indonesia, 2000, 13-19
champeden, J.Nat. Prod., 62 (1999) 613-615
Soekamto, N.S., S.A.,Achmad, E.L. Ghisalberti,
Hakim, E.H., Makmur, L., Achmad, s.a., Aimi, N., E.H. Hakim, Y.M. Syah (2003). Artoindonesianin X
Ghisalbert, E.L., Kitajima, M., Mujahidin, D.,Syah, dan Y, two new isoprenylated 2-arylbenzofurans
Y.M. and Takayama, H., Rcent studies on from Artocarpus fretessi Hassk. (Moraceae),
biologically active natural producta from Artocarpus Phytochemistry. 64, p 831-834
species of Indonesian rainforest, In Atta-ur
Syah, Y.M., Achmad, S.A., Ghisalberti, E.L.,
Rahaman, M.I., Choudhary and K.M. Khan (Eds),
Hakim, E.H., and Mujahidin, D., Two new cytotoxic
Natural Products chemistry at the Turn of the
isoprenylated flavones, Artoindonesianin U and V,
Century, Prints, Karachi, 2002, 331-338
from the heartwood of Artocarpus champeden
Hakim, E.H., Marlina, E.V., Mujahidin, D., Spreng (Moraceae), Fitoterapia 75 (2004) 134-140
Achmad, S.A., Ghisalberti, E.L., and Makmur, L.,
Syah, Y.M., Achmad, S.A., Ghisalberti, E.L.,
Artocarpin and Heteroflavanon A, Two new
Hakim, E.H., Iman, M.Z.N., Makmur, L.,
bioactive flavonoids from Artocarpus champeden,
Mujahidin, D., Andalasin A. A New Stilbene Dimer
Proceedings ITB, 1988, 31-36
from Morus macrouara, Fitoterapi, 2000,71,630-635
Hano, Y., Miyagawa, Y., Yano, M., Nomura, T.,
Syah, Y.M., Achmad, S.A., Ghisalberti, E.L.,
Structures of Mulberofuran P and S, Two Novel 2-
Hakim, E.H., Makmur, L. Mujahidin, D.,
Arylbenzofuran Derivatives from the Cultivated
Artoindonesianin Q-T four new isoprenylated
Mulberry Tree, Heterocycles, 1989, 28(2), 745-750
flavones from Artocarpus champeden Spreng.
Heyne, K., The Useful Indonesian Plants, Research (Moraceae), Phytochemistry, 61 (2002) 049-953
and Development Agency, The Ministry of Forest
Syah, Y.M., Achmad, S.A., Ghisalberti, E.L.,
Forestry, Jakarta, Indonesia 1987
Hakim, E.H., Makmur, L. Mujahidin, D.,
Jarett,F.M., Studies in Artocarpus and allied genera, Artoindonesianin M, A new isoprenylated flavone
III. A revision of Artocarpus subgenus Artocarpus, from Artocarpus champeden, Bull. Soc. Nat. Prod.
J. Arnold Arbo. (1959) 1-298 Chem. (Indonesia) 2002, 31-36
Jarett,F.M., Studies in Artocarpus and allied genera,
IV. A revision of Artocarpus subgenus Pseudojaca,
J. Arnold Arbo. (1960) 73-320
Abstrak
Suatu senyawa kelompok diterpenoid alkaloid telah diisolasi dari fraksi etil asetat daun
Clerodendron serratum (Verbenaceae). Struktur senyawa aktif ditentukan berdasarkan data
fisika dan spektroskopi UV, IR, 1H, dan 13C-NMR. Uji aktivitas dari isolat dilakukan secara in
vitro pada konsentrasi 0,25 µg/µL terhadap spermatozoa tikus putih (Rattus novergicus).
Senyawa dapat menurunkan motilitas dan viabilitas, dan menaikkan abnormalitas
spermatozoa.
Kata kunci : senggugu, Clerodendron serratum, antifertilitas, tikus putih, Rattus novergicus,
diterpenoid alkaloid.
280
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Euis Julaeha, Supriyatna, Unang Supratman, dan Anas Subarnas
Laboratorium Herbarium, Departemen Biologi, Isolat K5234. Isolat diperoleh sebagai kristal
Institut Teknologi Bandung, Bandung. tak berwarna, t.l 120-122°C. UV (CHCl3), λ
Hewan Percobaan. Tikus putih (R. maks (log ε) : 240 nm. IR (KBr) Vmaks : 3416 (N-
novergicus) diperoleh dari Laboratorium H), 1701 (C=O), 1295 (C-O-C), 1906 (C-N).
1
Struktur dan Perkembangan Hewan, Jurusan H-NMR (CDCl3, 500 MHz) δ ppm : 1,02 (3H,
Biologi, Universitas Padjadjaran, Jatinangor, s), 1,05 (3H, s), 1,34 (4H, m), 1,71 (3H, s), 2,02
Sumedang. (4H, m), 2,35 (4H, m), 2,85 (1H, dd; dd; dd;
4,6; 5,4 ;6,1 Hz), 3,50 (1H, d, 10,4 Hz), 3,75
Uji Aktivitas. Sampel diujikan pada (1H, d, 10,9 Hz), 4,17 ; 4,20 (2H, d, 6,8 Hz),
konsentrasi 0,25 µg/µL terhadap spermatozoa 5,4 (1H, dd; dd; dd, 1,2; 1,2; 1,2 Hz), 7,27 (1H,
tikus putih secara in vitro. Spermatozoa s), 10,06 (1H, s). 13C-NMR (CDCL3, 125
dikumpulkan dari kauda epididimis. Suspensi MHz) δ ppm : 16,5 ; 18,0 ; 18,4 ; 20,6 ; 24,7 ;
spermatozoa disiapkan dalam 10 tetes NaCl 25,0 ; 26,7 ; 35,1 ; 35,5 ; 38,8 ; 40,9 ; 43,1 ;
0,9% kemudian diencerkan 1000 kali dalam 51,7 ; 59,2 ; 65,3 ; 24,3 ; 131,9 ; 138,1 ; 166,8 ;
NaCl 0,9%. Suspensi spermatozoa 193,0.
dicampurkan dengan sampel pada konsentrasi
0,25 µg/µL kemudian dianalisis motilitas, 3. Hasil dan Pembahasan
viabilitas, dan abnormalitas dengan Isolat K5234 diperoleh sebagai kristal amorf
menggunakan hemositometer improved tidak berwarna dengan titik leleh 118-120°C.
Neubeur dan mikroskop. Kontrol dianalisis Spektrum UV dalam metanol memberikan
dengan cara yang sama tanpa sampel. serapan maksimum pada 240 nm. Dari
spektrum UV diindikasikan adanya kromofor
Ekstraksi dan Isolasi. Daun C. serratum yang etilenik. Spektrum IR menunjukkan adanya
telah dikeringkan (600 gram) dimaserasi gugus fungsi N-H, ikatan rangkap C=C, C=O,
dengan metanol. Ekstrak metanol dikumpulkan C-H alifatik, dan C-N. Spektrum 13C-NMR
kemudian diuapkan pada tekanan rendah memberikan 20 sinyal karbon dan
diperoleh residu sebanyak 100 gram. Residu menunjukkan adanya karbon aldehid pada
kemudian dilarutkan dalam air dan dipartisi 193,0 ppm. Dari spektrum DEPT pada 135°C
dengan n-heksana. Fraksi n-heksana dipisahkan menunjukkan adanya 3 gugus metil (CH3), 9
dan fraksi air dipartisi kembali dengan etil gugus metilen (CH2), 2 metin (CH), dan
asetat. Fraksi etil asetat kemudian dikumpulkan diperoleh 5 karbon kuartener. Pada spektrum
dan dipekatkan, diperoleh residu berwarna 1
H-NMR menunjukkan adanya 3 gugus metil
coklat (5 gram). Fraksi etil asetat dipisahkan yang beresonansi pada 1,02 ppm (3H, s), 1,05
dengan kromatografi kolom ditekan ppm (3H, s), dan 1,71 (3H, s). Adanya gugus
menggunakan adsorben wakogel, pelarut N-H ditunjukkan pada 7,2 ppm (1H, s)
heksana : etil asetat : MeOH secara bertahap diperkuat dengan adanya sinyal pada 2,85 dari
dengan kenaikan 10% polaritas dimulai dari CH2 yang terikat pada N-H (CH2-NH) dan pada
heksana 100%, terkumpul 17 fraksi. Fraksi ke- 3,50 dari CH yang terikat pada N-H (CH-NH).
11 (K, 146,4 mg) dipisahkan kembali dengan Dari data-data yang terhimpun maka isolat
adsorben yang sama dan pelarut heksana : etil K5234 diduga merupakan suatu diterpenoid
asetat (3:2), terkumpul 12 fraksi. Fraksi ke-5 alkaloid dengan dugaan struktur sebagai
(K5, 31,8 mg) dipisahkan dengan adsorben berikut:
ODS dan pelarut MeOH : H2O (9:1) terkumpul
O
4 fraksi. Selanjutnya fraksi ke-2 (K52, 21,7
mg) dipisahkan dengan kromatografi cair HC
kinerja tinggi preparatif menggunakan kolom O
Tabel 1. Hasil uji antifertilitas ekstrak metanol, fraksi etil asetat, dan isolat K5234 terhadap
spermatozoa R. novergicus
% Rata-rata
Sampel Penurunan motilitas Penurunan viabilitas Kenaikan abnormalitas
Ekstrak metanol 37,70 34,00 8,45
F. Etil asetat 18,81 15,00 14,45
Isolat K5234 15,56 55,67 5,33
Hasil uji aktivitas pada ekstrak metanol, fraksi 2. Gupta, S. S., Bhagwat, A. W., and Modh,
etil asetat, dan isolat K5234 tertera pada Tabel P. R., (1971). Effect of Clerodendron
1. serratum Saponin on The Mast of Rat
Mesentery. Indian Journal Medicinal
Hasil perhitungan secara statistik menggunakan Science. 25 (1). 29-91.
uji t-student dan diikuti uji Newman-Keuls
3. Viswanathan, S., Vijayasekaran, V., and
membuktikan bahwa baik ekstrak metanol, Sukumar, E. (1998). Antinociceptipe,
fraksi etil asetat maupun isolat dapat Antiinflamatory and Antipyretic Effects of
menurunkan motilitas dan viabilitas, dan Ethanol Extract of Clerodendron serratum
menaikkan abnormalitas spermatozoa tikus Roots in Experimental Animals. Journal of
putih secara berarti. ethnopharmacology. 65 (3). 237-241.
4. Kesimpulan 4. Connolly J.D., Faulkner D.J., Mori K.,
Dari fraksi etil asetat daun C. serratum telah Nakanishi K., Gurrison G., Raphael R.A.,
ditemukan suatu senyawa golongan diterpenoid Shamma M., and Tamm Ch. 1994.
alkaloid. Senyawa tersebut menurunkan Dictionary of Natural Product. Vol 9. Type
of Compound Index. Chapman & Hall.
kualitas spermatozoa tikus putih. Pengukuran
London.
NMR 2 dimensi masih sedang dilakukan untuk
mempertajam dugaan struktur senyawa. 5. Gupta S.S. 1977. Prospects and
Perspectives of Natural Product in Medicine.
5. Ucapan Terima kasih Indian Journal of Pharmacology. 26.
Penulis mengucapkan terima kasih kepada Dr.
6. Grage, V. P., and Verma, S. C. (1967).
Tomoyuki Fujita dan Dr. Kohki Akiyama di
Chemicals Examination of Clerodendron
Laboratory of Natural Products Chemistry, serratum. Isolation and Characterization of
Division of Applied Biological Chemistry, D-mannitol. Journal of Pharmacology
Graduate School of Agriculture and Life science. 56 (5). 639-640.
Sciences, Osaka Prefecture University, 1-1
7. Dalimartha S. 2002. Atlas tumbuhan obat
Gakuen-cho, Sakai, Osaka 599-85312, Japan
Indonesia. Jilid I. Jakarta : Trubus
untuk pengukuran spektra NMR. Terima kasih Agriwidya. 133-135.
disampaikan pula kepada Direktorat Jenderal
Pendidikan Tinggi, Departemen Pendidikan 8. Grainge M. and Ahmed S. 1988. Handbook
Nasional, atas bantuan dana Hibah Bersaing of plant with pest-control properties.New
XII. York. John Wiley and Sons. 85.
6. Daftar Pustaka
1. Sachdev, K.C., Vasavada, S. A., and
Joseph, A. D. (1964). Indian Journal of
Pharmacy. 26 (4). 105-106.
Isolasi Dan Uji Kemampuan Lipolitik Bakteri Isolat Bak Biologis Pabrik
Penyamakan Kulit
Abstrak
Sistem biologis (campuran bakteri fakultatif) pada tahap akhir pengolahan limbah
penyamakan kulit kurang efektif digunakan pada limbah yang memiliki kadar lemak tinggi
yaitu setelah proses peminyakan (fat liquoring) pada pengolahan kulit lunak. Akibatnya
terjadinya peningkatan kadar lemak pada bak pengolahan, sehingga kadar H2S, BOD, COD,
dan pH meningkat dan menyebabkan kematian bakteri. Salah satu cara untuk mengatasi
masalah ini adalah dengan menambahkan bakteri lipolitik yang potensial ke dalam sistem
tersebut. Bakteri lipolitik potensial dapat diisolasi dari bakteri alam yang ada pada bak
biologis. Tujuan penelitian ini adalah mengisolasi bakteri dan menguji kemampuan lipolitik
isolat bak biologis pabrik penyamaan kulit. Penelitian dilakukan di laboratorium
Mikrobiologi dan Kimia UM Malang. Isolasi bakteri dilakukan pada media NA, uji
kemampuan lipolitik dilakukan pada media selektif dan limbah yang telah disteril. Hasil
penelitian menunjukkan bahwa dari 15 isolat yang berhasil diisolasi dari bak biologis, hanya
8 isolat yang memiliki kemampuan lipolitik potensial. Kemampuan lipolitik isolat bak biologis
pada media selektif lebih tinggi dibandingkan dengan isolat konsentrat. Beberapa isolat
menunjukkan kemampuan lipolitik yang signifikan pada limbah steril yang mengandung
lemak tinggi. Pemakaian 2,5% isolat 13 dan 5% isolat 11 dengan waktu inkubasi selama 8
jam pada suhu kamar mampu menurunkan kadar lemak hingga 37%.
Kata kunci: bakteri, lipolitik, isolasi, penyamakan kulit
Ciri Koloni Bakteri Berasal Dari Limbah Cair Penyamakan Kulit Sisa Hasil Proses Fat Liquoring (Bak Biologis)
1B 2B 3B 4B 5B 6B 7B 8B 9B 10B 11B 12B 13B 14B 15B 16B
Warna Koloni Putih Kuning Krem Krem Jernih Kuning Krem Putih Putih Kuning Putih Kuning Putih Kuning Putih Kunin
jernih mentega kekuni- jernih krem mentega g
ngan
Bentuk Koloni Bulat Bulat Bulat Bulat tak Bulat Bulat tidak Bulat Bulat Bulat Bulat Bulat Seperti Bulat Bulat Bulat Bulat
beraturan beraturan tidak tasbih tak
beratura beratura
n n
Tepi Koloni Licin Licin Licin Berombak Licin Berombak Beromb Licin Beromb Licin Bergelo Licin Licin Bergelo Licin Licin
ak ak mbang mbang
Elevasi Koloni Timbul Seperti Rata Rata Timbul Timbul Rata Rata Timbul Rata Timbul Seperti Timbul Rata Rata Timbu
Tetesan tetesan l
Respirasi a.o. a.f. a.f. a.f. a.o. a.f. a.f. a.f. a.f. a.f. a.f. a.f. a.f. a.f. a.f. a.f.
Jumlah koloni total TBUD TBUD 28 3 2 8 TBUD 19 75 1 5 8 33 29 42 10
pada semua tingkat
pengenceran
Kemampuan + + + + + + + + + + + - + + + +
lipolitik
Keterangan: a.f. = anaerob fakultatif, a.o. = anaerob obligatif, TBUD = Terlalu Banyak Untuk Dihitung
F.A. Asmuruf 1), R. SATO 2), N. ASANO 2), N. TAN 2), K. ORIHARA 2)
Abstract
Many different polymers have been shown to emit light under the application of an electric
field (electroluminescence, EL). Polyphenylvinylen and its derivatives are still the most
commonly used materials, but polythiophenes, polypyridines are now being used 1). The extent
application of Polymer based layered structure from cellular phone, flat panel display, loan
battery, organic transistor, printer pull circuit, etc, have been considering and investigating
to develop light emitting polymer device. Our research efforts in the area of polymer opt-
electronic devices focuses on build layered structure. Continously electronic luminance and
display colors of electronic device are depend on layered structure of built device.
PolyAlkylThiophene-6 and polyquinoline are conducting polymers with highly π-conjugated
main chain. It have attached much interest as optoelectronic materials, because of their high
performance and advantages in fabrication of large area thin films by spin-coating method in
the individual use. The basic structure of polymer electronic device (PED) are comprise of
glass substrate, ITO anode, polymer layers and cathode (Al or Ca) 2). Based on the basic
structure of PED, we propose the following structure which comprise of glass substrate, ITO
anode, PAT-6/PQ films as a polymer layers, Al cathode. The 0,5% polymer solution was made
by dissolving PAT-6 and PQ into chloroform. The polymer solution was dropped on the
surface of glasses and spun for 20 second to get films. The surface coated films are uniform
and smooth. These pictures are observed under digital microscope machine with 100,00
µm/div. of area width. The layered structure of spin coated films are showed clearly through
the cross-sectional areas which have thickness of films are about ± 10 µm.
Key Words : PED, spin-coated film, layered structure, the thicknesess of films
V- V
+
Al
PAT-6/PQ layers
ITO
Glass Substrate
on the basic structure of PED, we propose the film continues to thin slowly until the film
following structure which comprise of glass reaches an equilibrium thickness. The final
substrate, ITO anode, PAT-6/PQ films as a thinning of the film is then due solely to solvent
polymer layers, Al cathode. evaporation.
The aims of this research are To build layered The 0,5% polymer solution was made by
structure of PAT-6/PQ films and Observing dissolving PAT-6 and PQ into chloroform. The
the surface structure of films and cross polymer solution was dropped on the surface of
sectional areas of built device. ITO glasses and spun for 20 second to get
films. Observed the surface of spun glasses
2. Experimental
under digital microscope machine and the cross
The films are made by spin coating method.
sectional area under SEM machine.
Spin coating of polymers is a simple technique,
which is widely used for producing very thin 3. Result and Discussions
organic films by applying centrifugal force, The surface coated Films in figure 2 are
linear shear stress, and uniform evaporation of uniform and smooth. These pictures are
a polymer solution on a rotating disk or a observed under digital microscope machine
substrate. In the spin casting process, a with 100,00 µm/div. of area width.
solution of polymer is first deposited on the
Next, I am want to convince you about layered
substrate, and the substrate is then accelerated
structure we proposed compared with the films
rapidly to the desired rotation rate. During
we made. Based on proposed structure, in the
rotation, the polymer solution flows radially
figure 4 shows two different regions which are
outward owing to the action of centrifugal
polymer layered region and ITO region. Figure
force, its thickness being changed. Final film
6 is three dimensional picture of figure 4 and
thickness is based on the initial properties of
shows the unevenness surface structure. As you
the polymer, solvent, and spin speed; it is
see, there is a kind of border between polymers
independent of the size of the substrate. The
layered and ITO. Figure 5 shows the cross- The layered structure of spin coated films are
sectional of polymers layered and ITO-glass showed clearly through the cross-sectional
side. areas in figure 7. The films thickness are about
± 10 µm.
4. Conclussions 6. References
1. The layered structure of PAT-6/PQ films Burroughnes, J.H., Bradley, D. D. C., Brown,
have made by us successfully. A. R., Marks, R. N., Friend, R. H., and Gymer,
R. W., Chemical tuning of electroluminescent
2. The surface films which made by spin-
copolymers to improve emission efficiencies
coating method are uniform and smooth
and allow patterning. Nature 356 , 47-49
3. The thickness of films are ±10 µm. (1982)
5. Acknowledgemnets Orihara, K., Asano N., Dai Y., Kondo T., Ando
This research is the result of the efforts of the A., Oikawa A., Tan N., Hirooka T., Oki K.,
PED’s team of Yamagata University. Special Proced. FCFP-XIII, Quanzhoo, China, p.260
thanks is given to Prof. ORIHARA Katsuo who (2003)
has given me a great chance working in his
Holton, W. C., Light-emitting polymers:
laboratory. I want to thanks also to Papua’s
Increasing promise, Solid State Technology,
government which fund me for this research.
May, 163-169 (1997)
Fadhli Hadana Rahman1, Mohammad Kassim1, Rusli Daik1, Khuzaimah2 and Wan Ramli
Wan Daud2
1
School of Chemical Sciences and Food Technology, Faculty of Science and Technology,
Universiti Kebangsaan Malaysia, 43600, Selangor, Malaysia
e-mail: f_hadana04@yahoo.com, mbkassim@pkrisc.cc.ukm.my & rusli@pkrisc.cc.ukm.my
2
Department of Chemical and Process Engineering, Faculty of Engineering,
Universiti Kebangsaan Malaysia, 43600, Selangor, Malaysia
email: me140903@yahoo.com & wramli@eng.ukm.my
Abstract
The metathesis reaction of aqueous solutions of tetrapropylammonium bromide with
ammonium tetrathiotungstate in the absence of oxidizing agent afforded the mononuclear
tetrapropylammonium tetrathiotungstate complex, abbreviated as [(Pr4N)2(WS4)]. The
complex has been crystallographically and spectroscopically characterized. The crystal
adopted a monoclinic system with a = 15.4246(2) Å, b = 29.7390(1) Å, c = 16.5056(2) Å and
β = 114.11° and belong to the P2(1)/n space group. The characteristic W-S stretching mode
was detected at 446 cm-1. The crystal structure showed a highly disordered
tetrapropylammonium molecule involving the position of the C and N atoms. Results of
preliminary investigation on the reaction of [(Pr4N)2(WS4)] with ethylenedicarboxylate to
produce a precursor for tris(dithiolene) tungsten photocatalyst are presented.
Keywords: Tetrathiotungstate, photocatalyst, tungsten, water splitting, renewable energy
reactions. Another catalyst potential catalyst is ultraviolet spectral regions) and stable in strong
tungsten oxide (WO3) which shows very high electrolytes. The catalyst material should be
photocurrent generation efficiencies. A able to facilitate an efficient charge transfer
combination of this material with other between the semiconductor layer and the
molecules such as dithiolenes which has a good electrolyte.
tendency to absorb light energy will become a
Tetrapropylammonium tetrathiotungstate offers
promising photocatalyst for the future.
a number of advantages as a precursor for
The ability of tris(dithiolene) tungsten as photocatalyst (Fadhli 2004). The
photocatalyst has been demonstrated in a water tetrathiotungstate salt offers a shorter synthesis
splitting reaction (Samios el al. 1998). Based route for realizing the tri(dithiolene) tungstate
on the performance shown in the study it will photocatalyst. The synthetic approach also
be a capable candidate to be used as allows other analogues to be synthesized by
photocatalyst for hydrogen production from varying the alkyl/aryl groups attached to the
water using solar energy. Recent work on this ethylene backbone. In order to facilitate
area has shown that heterogenous catalyst is immobilization of the photocatalyst onto a
more efficient compared to homogenous photo active support such as TiO2 functional
catalyst (Serpone 1997). group such as carboxylate electrode will be
attached to the alkyl/aryl substituent.
An important step in producing this
photocatalyst is the synthesis of its precursor. 3. Experimental
Heterogenous photocatalyst such as Tetrapropylammonium tetrathiotungstate,
tris(dithiolene) tungsten is actively being [(Pr4N)2WS4], was prepared according to a
developed as an active material on a publish method (Umakoshi et al. 2000).A
photoelectrode. Significant effort has been solution of [(NH4)2WS4] (6 mmol) was added
taken to develop photocatalyst that can to an aqueous solution of [(Pr4N)Br] (43 mmol)
catalytically split water molecule with the help and the mixture was stirred for 5 minutes at
of electromagnetic radiation (Fadhli et al. 20˚C. The chemical reaction involved is
2003). The ability of homogenous showed below. The resulting orange solution
tris(dithiolene) catalyst to split hydrogen and was cooled in an ice bath overnight affording a
oxygen from water without the need to add yellowish orange precipitate. The solid was
consumable (sacrificial) donor is unique and filtered, washed thoroughly with diethyl ether
highly desirable. and dried in vacuo.
Water can be split by visible light into 2[(Pr4N)Br] + [(NH4)2WS4] Æ [(Pr4N)2WS4] +
hydrogen and oxygen, without the application 2[(NH4)Br]
of any external voltage, according to the
following schemes (Fujishima 1972): The precursor, was characterized by
spectroscopic techniques such Fourier
transform infra-red (FTIR) and ultra violet and
TiO2 + 2 hν Æ 2 e- + 2 p+ visible (UV/Vis). The carbon, hydrogen,
(excitation of TiO2 by light) nitrogen and sulfur (CHN-S) content of the
2 p+ + H2O Æ ½ O2 + 2 H+ (at the product was determined by elemental analysis.
TiO2 electrode/anode) A suitable crystal suitable for single crystal
diffraction studies by Bruker SMART APEX
2 e- + 2 H+ Æ H2 (at the diffractometer was obtained by a slow
platinum electrode/cathode) evaporation of the aqueous solution containing
Therefore, the overall reaction is: the product molecules.
1.8
1.6
1.4
Absorption / A 1.2
0.8
0.6
0.4
0.2
0
210 260 310 360 410 460 510 560 610 660
-1
wavenumber / cm
Figure 2. One of the [(Pr4N)2WS4] molecules in the unit cell (H atoms were omitted for clarity).
Infra-red spectrum of [(Pr4N)2WS4] shows the The ultra violet and visible spectra of
present of W-S stretching mode at 446 cm-1 [(Pr4N)2WS4] was recorded in methanol
(Table 1). In addition, the infrared spectra also solution. There are three main transition bands
exhibited the characteristic stretching corresponding to tetrahedral groups and these
frequencies for C-H aliphatic and ammonium bands were detected at 395.93, 278.68 and
group at 2900-3000 and at 1460-1480 cm-1, 218.52 nm (Figure 1).
respectively.
Serpone, N., (1997). Relative Photonic Efficiencies Srinivasan, R. B., Poisot M., Näther, C., & Bensch,
and Quantum Yields in Heterogeneous W. 2002. Ethylenediammonium
Photocatalysis. Journal of Photochemistry and tetrathiotungstate(VI), Acta Cryst. E60, i136-i138.
Photobiology, 104, 1-12.
Umakoshi, K., Nishimoto, E., Sokolov, M.,
Srinivasan, R. B., Dhuri, S. N., Näther, C., & Kawano, H., Sasaki, Y., Onishi, M., (2000).
Bensch, W. 2002. Ethylenediammonium Synthesis, Structure and Properties of Sulfide-
tetrathiotungstate(VI), Acta Cryst. E58, m622- Bridge Dinuclear Tungsten(V) Complex of
m624. Dithiolene. Journal of Organometallic Chemistry,
611, 370-375.
Fahimah Martak1), Djulia Onggo1), Mimin A. 1), Bohari M. Yamin2), Seik Weng Ng3)
Abstrak
Ligan di-2-piriridil keton (dpk) merupakan ligan bidentat dengan gugus karbonil diantara
dua cincin piridin. Reaksi antara ion besi(II) dengan ligan ini menghasilkan kompleks berinti
satu yang sangat bergantung pada jenis pelarut yang digunakan. Dengan pelarut etanol
dihasilkan kompleks besi(II) dengan dua molekul ligan terhidrasi. Rumus molekul kompleks
yang dihasilkan[Fe(dpkh)2](BF4). Ini dibuktikan dari data momen magnet sebesar 1,88 BM
yang sesuai dengan keberadaan ion besi(III) dengan keadaan spin rendah. Spektra infra
merah menunjukkan pita lebar pada 3200-3600 cm-1 yang sesuai dengan adanya gugus OH
ligan terhidrasi. Kristal tunggal kompleks [Fe(dpkh)2](BF4) telah berhasil ditumbuhkan dan
data difraksi sinar-X untuk kristal tersebut menunjukkan struktur oktahedral dengan ikatan
antara ion besi(III) dengan atom donor N dan O dari ligan terhidrasi.
Kata kunci: senyawa kompleks besi, sifat magnet, struktur kristal.
Kompleks R χg µ
[Fe(dpkh)2](BF4) 89 2,09.10-6 1,88
[Fe(dpkh)3](ClO4)2 965 12,51.10-6 5,10
Gambar 2. Struktur kristal kompleks [Fe(dpkh)2](BF4) dari difraksi sinar X kristal tunggal.
Spektra inframerah kompleks yang disintesis ion besi(II) teroksidasi menjadi besi(III).
dengan pelarut etanol menunjukkan gugus Struktur kristal kompleks [Fe(dpkh)2](BF4) dari
O─H pada bilangan gelombang 3200-3600 cm- difraksi sinar X kristal tunggal ditunjukkan
1
dan didukung oleh adanya vibrasi ulur C─O pada Gambar 2.
untuk C─OH pada 1084 cm-1. Adanya puncak
4. Kesimpulan
lemah pada bilangan gelombang 2922 cm-1
Kristal kompleks besi(II)-di-2-piridinketon
berasal dari vibrasi ulur C─H. Puncak serapan
yang disintesis dari pelarut etanol merupakan
C─H aromatik pada bilangan gelombang 1602,
kompleks bis ligan dengan formula
1523 dan 1447 cm-1. Puncak pada bilangan
[Fe(dpkh)2](BF4), kristal berwarna oranye dan
gelombang 1288 dan 1237 cm-1 berasal dari
bersifat spin rendah. Senyawa koordinasi
kombinasi antra vibrasi ulur C═C dan dengan
besi(II) dengan ligan di-2-piridinketon telah
vibrasi bending C─O. Puncak serapan yang
disintesis dengan pelarut aseton membentuk
berasal dari vibrasi ulur ikatan koordinasi
kompleks yang berwarna hijau tua, memiliki
Fe─N pada bilangan gelombang 666 cm-1.
formula [Fe(dpkh)3](ClO4)2, spin tinggi dan
Berdasarkan data diatas, senyawa koordinasi
bersifat paramagnet.
yang dihasilkan dengan menggunakan pelarut
etanol, ligan terhidrasi dan berkoordinasi 5. Daftar Pustaka
dengan ion logam. Vibrasi ulur ikatan Sumarna, O. (1996). Sintesis dan Karakterisasi
koordinasi Fe─N pada kompleks yang Senyawa Kompleks Besi(II), Kobalt(II) dan
dihasilkan dengan pelarut aseton pada bilangan Nikel(II) dengan Menggunakan Ligan-ligan
Turunan 2,2’bipiridin. Tugas Akhir, Departemen
gelombang yang lebih pendek yaitu 642 cm-1.
Kimia, Institut Teknologi Bandung.
Berdasarkan data tersebut kompleks yang
dihasilkan dengan pelarut etanol lebih stabil Suyanti, R.D. (1997). Sintesis dan Karakterisasi
dibandingkan kompleks yang disintesis dengan Senyawa Kompleks Tembaga(II) dengan Ligan-
pelarut aseton. Spektrum inframerah senyawa ligan Bidentat yang Mengandung Atom Nitrogen
kompleks [Fe(dpkh)2](BF4) disajikan pada Sebagai Atom Donor. Tugas Akhir, Departemen
Kimia, Institut Teknologi Bandung.
Gambar 1.
Feller, M.C., Robson, R., (1970). Complexes of D-
Telah ditumbuhkan kristal tunggal kompleks 2-piridil Keton, Australian Journal of Chemistry, 23,
Fe(II) dengan ligan di-2-piridinketon. Kristal 1997-2003.
berhasil disintesis dari larutan Fe(BF4)2.6H2O
dengan ligan di-2-piridinketon dalam pelarut Day, M.C., Selbin, J., (1969). Theoretical Inorganic
Chemistry, (2nd.Ed), Van Norstrand Reinhold
etanol. Kristal berwarna oranye tumbuh dalam
Company, 391-397.
waktu 1 minggu. Dari hasil analisis difrasi
sinar-X single kristal, ternyata ligan terhidrasi Huheey, J.E., (1983). Inorganic Chemistry,
membentuk ion ion negatif, ligan bersifat Principle of Structure and Reactivity, (3rd.Ed),
tridentat, jadi dua ligan yang terkoordinasi dan Harper and Row, Singapore, 359-441.
Shriver, D.F., Atkins, P.W., Longford, C.H., (1990). Angelici, R.J., (1977). Synthesis and Technicue in
Inorganic Chemistry, Oxford University Press, Inorganic Chemistry, W.B. Saunders Company,
Oxvford, 434-486. Philadelpia, 42-50.
Braun, R.D., (1987). Introduction to Instrumental Mabbs, F.E., (1973). Machnetism and Transition
Analysis, (2nd.Ed), McGraw-Hill International Metal Complexes, Chapman and Hall, London, 1-
Edition, New York, 932-941. 12.
Stroble, H.A., (1973). Chemical Instrumentation : A William, D.H., Fleming, I., (1980). Spectroscopic
Systematic Approach, (2nd.Ed), Addison-Wesley Methods in Organic Chemistry, (3rd. Ed), McGraw-
Publishing Company Inc., Philippines, 763-774. Hill Book Company, London.
Wendlant, W., (1986). Thermal Analysis, (3rd.Ed), Nakamoto, K., (1963). Infrared Spectra of Inorganic
John Wiley and Sons, Toronto, 56-57. Chemistry and Coordination Compounds, John
Wiley and Sons, Inc. New York, 5-7.
Skoog, D.A, West, D.M., Holler, F.J., (1992).
Fundamental of Analytical Chemistry, (6th.Ed), West, A.R., Solid State Chemistry and Its
Saunders College Publishing, New York, 616-632. Applications, John Wiley and Sons, Singapore, 104-
113.
Email : fabyff@pkrisc.cc.ukm.my
Abstract
The G. cingulata cutinase (GcCUTA) three-dimensional structure was predicted by
comparative modelling methods using the 3D cutinase structure of Fusarium solani f. pisi
(1CEX), as template. Sequence identity between these two cutinase is 53%. An initial model
of GcCUTA was built using Modeller6v2 before visualization and minimization were done
using modules in InsightII. The GcCUTA structure consists of 193 amino acid residues and
the root-mean-square (RMS) deviation of GcCUTA against 1CEX is about 0.265291 Å.
Evaluation of GcCUTA using ERRAT gives 99.5% residues below the 95% confidence limit.
The Ramachandran plot of the model showed that 89.6% of the residues are in the favoured
region. The final model showed that GcCUTA consists of five parallel strands and five
helices. Alignment and analysis of the amino acid sequence show that the catalytic triad of
GcCUTA corresponds to Ser105, Asp160 and His173 and the oxyanion hole corresponds to
Ser26 and Gln106. Several residues of GcCUTA have been postulated to be involved in
enzyme-ligand binding interaction. These targeted residues are being mutagenised and the
enzyme activity of these mutagenised products will be studied in silico and in vitro. This study
has been initiated in an effort to provide insight into the relationship between protein
structure and biological function.
Keywords : Cutinase, protein homology modeling, in silico mutagenesis, protein-ligand
interaction
Figure 1: Amino acid sequence alignment of F. solani f. pisi cutinase (1CEX) as template and G. cingulata
cutinase (GcCUTA) as target showed 53% sequence identity
Ser105 His173
Ser26
Asp160
Gln106
Lüthy, R., Bowie, J.U. and Eisenberg, D. 1992. Review Biophysics and Biomolecular Structure 29:
Nature 356: 83-85. 291-325.
Martinez, C., Geus, P., Lauwereys, M., Nicolas, A., Egmond, M., Verrips, T., de Vlieg, J.,
Matthyssens, G. and Cambillau, C. 1992. Nature Longhi, S., Cambillau, C. And Martinez, C. 1996.
356: 615-618 Biochemistry 35 : 398-410.
Martinez, C., Nicholas, A., van Tilbeurgh, H., Ring, C.S., Sun, E., McKerrow, J.H., Lee, G.K.,
Egloff, M. P., Cudrey, C., Verger, R. and Rossenthal, P.J., Kuntz, I.D. and Cohen, F.E. 1993.
Cambillau, C. 1994. Biochemistry 33: 83-89. Proc. Natl. Acad. Sci. USA 90: 3583-3587.
Marti-Renom, M.A., Stuart, A.C., Fiser, A.,
Sánchezz, R., Melo, F. and Sali. A. 2000. Annual
1) email: f4riati@telkom.net
1-3) Jurusan Kimia-FMIPA-Universitas Negeri Malang (UM)
Jl. Surabaya 6 Malang-East Java-Indonesia
4) Jurusan Biologi- FMIPA-Universitas Negeri Malang (UM)
Jl. Surabaya 6 Malang-East Java-Indonesia
Abstrak
Pengolahan limbah dengan menggunakan bakteri fakultatif menghasilkan limbah padat yang
mengganggu proses IPAL dan juga memerlukan ketersediaan lahan penimbunan yang luas.
Salah satu upaya pemecahan masalah tsb adalah pengolahan limbah padat yang kaya unsur
N sebagai bahan dasar pembuatan pupuk organik.Walaupun sudah dilakukan pembuatan
pupuk organik saat ini, namun kualifikasi pupuk lengkap organik (N, P, K) belum banyak
dilakukan. Tujuan penelitian ini, untuk mengkompos limbah padat pabrik penyamakan kulit
menjadi pupuk lengkap organik yang potensial sehingga dapat menggantikan pupuk buatan
yang akan memperbaiki sifat fisis tanah. Pembuatan pupuk pada penelitian ini dengan
pemilihan filler dan konsentrasi lumpur yang tepat. Hasil penelitian menunjukkan bahwa
pupuk mengandung unsur makro yang diperlukan tanaman (N, P, K), suhu rata-rata 270C dan
pH rata-rata=6,3 yang memenuhi standar pertumbuhan tanaman.
Kata kunci: limbah padat, pupuk lengkap organik, filler
kadar unsur makro (N, P, K) pada pupuk yang Perbandingan lumpur terbaik dicapai pada
dihasilkan. pemakaian 3 bagian lumpur baru seperti
ditunjukkan dari kadar N, P, K dan tampilan
Penentuan konsentrasi limbah lumpur
bokasih yang dihasilkan berikut ini:
untuk pupuk lengkap organik
Konsentrasi lumpur yang digunakan dengan Filler terbaik: campuran jerami: lumpur baru =
variasi: 0,00; 0,15; 25,00; dan 33,00%. 1:2 dengan rata-rata terdekomposisi 90%
Kemudian perlakuan sama dengan proses
3. Hasil degradasi limbah padat pabrik
pemilihan filler. Pupuk organik lengkap hasil
penyamakan kulit yaitu: pupuk lengkap organik
penelitian dianalisis N, P, dan K
padat yang mengandung unsur makro yang
3. Hasil dan Pembahasan diperlukan tanaman (N, P, K). Data hasil
1. Hasil Pemilihan filler untuk pupuk lengkap analisisnya ditunjukkan pada Tabel 3.
organik ditunjukkan pada Tabel 1.
Berdasarkan dosis pupuk yang dianjurkan
2. Penentuan konsentrasi limbah padat untuk untuk petani menurut BIMAS (1983): N = 90 –
pupuk lengkap organik ditunjukkan pada 170 Kg/ha, P2O5 = 30 – 160 Kg/ha, K2O = 0 –
Tabel 2 .
100 Kg/ha, sehingga 100g pupuk ke 2/tanaman 3. Lembaga Penelitian Universitas Negeri
sesuai dengan dosis pupuk anjuran Bimas. Malang (UM)
4. Kesimpulan Daftar Pustaka
Hasil Pemilihan filler untuk pupuk lengkap Anonim.(1999). Bokashi, Fermentasi Bahan
organik yaitu campuran jerami: lumpur baru = Organik dengan Teknologi
1:2 Efektif Mikroorganisme 4, Cara Pembuatan dan
Perbandingan lumpur terbaik dicapai pada Aplikasi. Jakarta: Sapta kreasi Group.
pemakaian 3 bagian lumpur baru dengan kadar Anonim (1983). Padi Palawija Sayur-Sayuran.
N = 1,15%, P = 0,64%, K = 0,735% Jakarta: Departemen Pertanian Satuan Pengendalian
BIMAS.
5. Ucapan Terima Kasih
1. Kementerian Riset Teknologi (KRT)- Fariati, Nugrahaningsih, Yudhi Utomo, Evi Susanti.
Proyek Riset Unggulan Kemitraan. (2004). Inovasi Pengolahan Limbah Pabrik
Penyamakan Kulit dan Pemanfaatannya Sebagai
2. PT Nasional Djawa Kulit (NDK) Pupuk Organik Lengkap. Laporan RUK 2003-2004.
Singosari-Malang-Jawa Timur- KRT-Proyek Riset Unggulan Kemitraan.
Indonesia
Perubahan Citarasa Dan Nilai Nutrisi Keju Tahu Dengan Penambahan Beberapa
Intermediet Metabolit Dan Kapang
Abstrak
Tahu merupakan salah satu sumber protein nabati yang nilai nutrisinya paling mendekati
protein hewani. Masalah waktu penyimpanan yang pendek diatasi dengan meengolah tahu
menjadi keju. Penelitian ini dilakukan untuk mempelajari pengaruh berbagai kapang dan
penambahan beberapa intermediate metabolit terhadap perubahan citarasa dan nilai nutrisi
keju tahu. Asam piruvat dan a-ketoglutarat dipilih sebagai senyawa-senyawa intermediet
metabolit, sedangkan Rhizopus oligosporus, Aspergilus niger, dan Penicillium roquefortii
dipilih sebagai inokulum.
Untuk keju yang berumur 3-4 minggu, perlakuan dengan berbagai inokulum dan metabolit
menyebabkan kenaikan kadar protein keju sekitar 5-12% % dibandingkan dengan tahu.
Sedangkan kadar lemak mengalami penurunan, kecuali oleh kapang A. niger. Khusus untuk
keju dengan penambahan metabolit, kadar lemak mengalami penurunan sampai keju berumur
1 bulan, tetapi dengan aging kadar lemak naik.
Keju yang dihasilkan secara visual dapat diterima, kecuali yang diinokulasi dengan A.niger.
Skor penilaian organoleptik dan tingkat kesukaan panelis terhadap keju yang diinokulasi
dengan P. roquefortii dan kombinasi P. roquefortii dan R. oligosporus memiliki derajat
kesukaan yang mirip dengan Brie cheese dan Gouda cheese. Sementara itu keju yang
diinokulasi dengan R. Oligosporus maupun yang diberi metabolit memiliki derajat kesukaan
yang mirip dengan Blue cheese..
Kata Kunci : keju tahu, Rhizopus oligosporus, Aspergilus niger, Penicillium roquefortii,
asam piruvat, alpha ketoglutarat, citarasa.
tahu mengkondisikan mikroba untuk dan lemak keju tahu pada masa aging. Keju
menggunakan kandungan lemak tahu sebagai tahu dengan penambahan asam piruvat (AP)
sumber energi. menunjukkan penurunan kadar protein pada
Tabel 1 Pengaruh berbagai kapang terhadap
masa aging hingga akhir bulan ke-5, sedang
kandungan protein dan lemak tahu terfermen-tasi keju tahu dengan penambahan alpha-
ketoglutarat (KG) juga menunjukkan
kapang yang
digunakan
[protein] (%) [lemak] (%) penurunan kadar protein tetapi pada akhir bulan
ke-5 aging kadar proteinnya ditemukan
Kontrol 18,503±0,093 3,545±0,022
kembali meningkat. Dikaitkan dengan sintesis
R. oligosporus 22,090±0,253 3,195±0,040 dan degradasi asam amino yang mempengaruhi
A. niger 22,410 ± 0,130 0,456 ± 0,012 kadar protein dalam sampel, dapat dikatakan
P. roquefortii 22,150±0,442 5,820±0,040 bahwa penambahan asam piruvat memicu
R. oligosporus + sintesis asam amino pada keju tahu pada masa
23,405±2,368 2,306±0,075
P roquefortii aging sedangkan panambahan alpha-
A. niger + P. ketoglutarat memicu degradasi asam amino
22,45 ± 0,12 0,442 ± 0,015 pada masa aging.
roquefortii
Keju komersial: Tabel 3 Pengaruh lama inkubasi terhadap
Soft chees kandungan lemak keju.
5,50 10,37
berperisa merica kapang yang [lemak] (%)
Brie 12,10 20,07 digunakan hari ke-4 minggu ke-3
Blue 20,36 4,54 R. oligosporus 3,195±0,040 0,350±0,004
Gouda 23,73 28,46 A. niger 0,456 ± 0,012 t.d
P. roquefortii 5,820±0,040 1,785±0,014
R. oligosporus
Data di atas berasal dari tahu yang terfermentasi selama 4 2,306±0,075 1,600±0,009
+ P roquefortii
hari. Data menyatakan nilai rata ± simpangan baku. A. niger + P.
0,442 ± 0,015 t.d
Piruvat dan asam a-ketoglutarat merupakan roquefortii
senyawa intermediet dalam jalur glikolisis dan t.d = tidak ditentukan
siklus asam trikarboksilat. Degradasi lipid
dipengaruhi oleh konsentrasi piruvat di dalam Tabel 4 Pengaruh penambahan asam piruvat dan
sel. Data percobaan pengaruh penambahan asam α-keto glutarat pada kandungan protein dan
piruvat dan asam a-keto glutarat dapat dilihat lemak keju
pada Tabel 4. Umur Kadar Protein (%) Kadar Lemak (%)
keju AP KG AP KG
Tabel 2 Pengaruh lama inkubasi terhadap
kandungan protein keju. 4 hari 18,24 16,85 3,99 3,66
kapang yang [protein] (%) 1 bulan 17,77 15,06 3,20 3,52
digunakan hari ke-4 minggu ke-3 2 bulan 16,33 14,62 3,07 3,50
5 bulan 15,68 18,79 8,67 6,35
R. oligosporus 22,090±0,253 23,275±0,158 AP= asam piruvat, KG= asam α-keto
A. niger 22,410 ± 0,130 t.d glutarat
P. roquefortii 22,150±0,442 23,330±1,389
Pengaruh penambahan asam piruvat dan α-
R. oligosporus 23,405±2,368 26,365±0,916
ketoglutarat memberikan kecenderungan yang
+ P roquefortii
sama, yaitu menurun selama masa inkubasi
A. niger + P. dan masa pemeraman hingga 2 bulan dan
roquefortii 22,45 ± 0,12 t.d ditemukan meningkat kembali di akhir bulan ke
t.d = tidak ditentukan 5 pemeraman. Dari hasil ini tampak bahwa
penambahan asam piruvat maupun alpha-
Tabel 4 menunjukkan bahwa penambahan asam ketoglutarat juga mempengaruhi metabolisme
piruvat maupun alpha-ketoglutarat menunjuk- lemak pada keju tahu oleh R.oligosporus.
kan pengaruh secara nyata pada kadar protein Dibandingkan dengan keju komersial,
kandungan protein keju tahu yang dihasilkan Selama masa aging, penampakan permukaan
tidak jauh berbeda, sedangkan kadar lemaknya keju tahu tidak mengalami perubahan yang
jauh lebih rendah dari pada keju komersial menunjukkan pertumbuhan miselium yang
berbahan dasar susu. sangat lambat pada masa ini. Tekstur bagian
dalam keju tahu berangsur-angsur menjadi
Analisa organoleptik
makin lunak selama proses aging berlangsung.
Tekstur dan kesan mata keju tahu
Kapang yang digunakan tumbuh subur pada Uji cita rasa.
permukaan keju, hal ini mempengaruhi
penampakan keju yang dihasilkan. Gambar 1 Hasil uji rasa dapat dilihat pada Tabel 5.
menunjukkan penampakan/kesan mata berbagai
Tabel 5 Hasil uji rasa berbagai umur keju dan
keju dengan berbagai variasi inokulum. berbagai perlakuan
Tingkat
Sampel Selang
kesukaan
P. roquefortii, umur 3
1,77< <2,51 Agak suka
minggu
R.oligospporus + P.
roquefortii, umur 3 2,26< <3,09 Agak suka
(a) (b) minggu
R. oligosporus, umur 3 Agak tidak
1,76< <2,48
minggu suka
R.oligospporus, umur
1,30< µ <2,07 Tidak suka
2 bulan
R.oligospporus, umur Agak tidak
1,90<µ<2,68
5 bulan suka
(c) (d) R.oligosporus + asam Agak tidak
1,64< µ <2,54
piruvat, umur 2 bulan suka
R.oligosporus + asam Agak tidak
1,84< µ <2,56
piruvat, umur 5 bulan suka
R.oligosporus+ -
(e) (f) ketoglutarat, umur 2 1,44< µ <2,10 Tidak suka
bulan
R.oligosporus + -
Agak tidak
ketoglutarat, umur 5 1,67< µ <2,28
suka
bulan
(g) Keju komersial:
Gambar 1 Penampakan keju tahu dengan berbagai Soft chees berperisa Agak tidak
1,60< µ <3,04
perlakuan merica suka
Keju tahu yang diinokulasi dengan (a)R.oligospo- Brie 2,33< µ <3,25 Agak suka
rus (b) P. Rouquefortii (c) A. niger (d) Gabungan Agak tidak
A. niger & P. Rouquefortii (e) Gabungan R. Blue 1,95< µ 3,00
suka
Oligosporus dan P. Rouquefortii, (f) Keju (a) Gouda 2,48< µ 3,53 Agak suka
dengan penambahan asam piruvat (g) Keju (a)
dengan penambahan α-keto glutarat.
Dari data pada tabel tersebut, keju dengan
Warna keju yang dihasilkan bergantung pada
perlakuan kombinasi kapang R. Oligsporus dan
kapang yang digunakan, akibat pertumbuhan
P. roquefortii berumur 3 minggu mendapatkan
spora dari kapang yang digunakan. Dari
berbagai kultur yang digunakan, keju yang skor tertinggi (2,26<µ<3,09), dengan tingkat
dihasilkan dengan fermentasi Aspergilus niger kesukaan ‘agak suka’, mirip dengan skor yang
agak tidak memberi kesan yang menarik. dimiliki oleh keju komersial Brie cheese dan
Karena itu uji rasa tidak dilakukan terhadap Gouda cheese.
keju dengan perlakuan A. niger. Keju dengan perlakuan lain, umumnya
menunjukkan makin bertambahnya umur keju,
skor kesukaan menigkat. Keju yang berumur 2 Penilaian yang .diberikan mirip dengan keju
bulan serta yang diberi tambahan metabolit, komersial berbahan dasar susu..
memilik derajat kesukaan yang mirip dengan
5. Daftar Pustaka
keju lunak berperisa merica, sedangkan keju Ariani S.R.D., 1997, Pembuatan Keju Kedelai yang
yang berumur 5 bulan memiliki skor penilaian Mengandung Faktor-2 sebagai Alternatif
yang mirip dengan keju komersial blue cheese. Pengembangan Hasil Olah Pangan dari Tahu. Tesis,
4. Kesimpulan Departemen Kimia, ITB.
Hasil penelitian ini menunjukkan: perubahan Lina, Hesti, 2003, Pembuatan Keju Tahu yang
tahu menjadi keju dapat meningkatkan kadar Mengandung Faktor-2 Menggunakan Kapang
protein dan menurunkan kadar lemak. Aspergilus niger dan Penicillium sp. Skripsi.
Perubahan keduanya cukup berarti, sehingga Departemen Kimia, ITB.
dari nilai gizi, perubahan tahu mejadi keju tahu Qomaiyah, Nurul, 2004, Pembuatan Keju Tahu
memiliki nilai gizi yang lebih baik. yang Mengandung 6.7.4’-trihidroksiisoflavon
Menggunakan Kapang Rhizopus oligosporus dan
Keju yang dihasilkan dengan berbagai Penicillium roquefortii. Skripsi. Departemen Kimia,
perlakuan di atas, umumnya memberi kesan ITB.
mata yang dapat diterima, kecuali oleh A.niger.
Umumnya panelis memberikan penilaian yang Ur-Rehman, Shakeel and Patrick F. Fox, 2002,
Effect of Added α-ketoglutaric acid, Pyruvic Acid
makin tinggi dengan bertambahnya umur keju.
or Pyridoxal Phosphate on Proteolysis and Quality
of Cheddar Cheese, Food Chemistry, 76, 21-26.
Firman AP
Abstrak
Enzim glukosa oksidase (β-D-glukosa : oksigen 1-oksidoreduktase EC 1.1.3.4) mengkatalisis
oksidasi β -D-glukosa menjadi asam glukonat dan peroksida. Umumnya preparat enzim
glukosa oksidase digunakan dalam klinis untuk penentuan kadar glukosa darah. Telah dikaji
pengaruh komposisi media, kecepatan aerasi dan agitasi terhadap produksi enzim glukosa
oksidase dari Aspergillus niger L 51 indigenus dalam fermentasi skala labu kocok dan
fermentor 2,5 L. Semua eksperimen dilakukan dalam suatu medium yang mengandung
glukosa dan NaNO3 sebagai sumber karbon dan nitrogen. Produksi enzim glukosa oksidase
dengan aktivitas yang optimum dicapai pada konsentrasi glukosa 100 g/L dan NaNO3 6 g/L
dengan waktu fermentasi 96 jam. Penambahan CaCO3 dan ion logam Mg +2 merngstimulasi
produksi enzim glukosa oksidase. Enzim glukosa oksidase yang diproduksi dalam media yang
mengandung CaCO3 20 g/L dan MgSO4.7H2O 0,5 g/L mempunyai aktivitas katalitik
berturut turut sebesar 44,67 Unit/mL dan 32,94 Unit/mL, sedangkan produksi enzim glukosa
oksidase dalam media tanpa penambahan CaCO3 dan ion Mg +2 aktivitasnya hanya sebesar
9,48 Unit/mL dan 29,44 Unit/mL. Pada kecepatan aerasi 1,0 vvm dan agitasi 300 rpm
diproduksi enzim glukosa oksidase dengan aktivitas 51,15 Unit/mL. Dari hasil-hasil
penelitian tersebut di atas membuktikan bahwa isolat fungi Aspergillus niger L 51 indigenus
memiliki potensi untuk dikomersialkan sebagai penghasil enzim glukosa oksidase.
Kata kunci: Aktivitas, Aspergillus niger L 51, enzim glukosa oksidase
dilakukan (Firman dan Soedigdo, 1994). 2.2 Pengaruh kecepatan aerasi dan agitasi
terhadap produksi enzim glukosa oksidase
Identifikasi mikroba penghasil enzim enzim
pada skala fermentor 2 L
glukosa oksidasedari fungi galur lokal juga
Ke dalam labu erlemeyer 250 mL yang berisi
telah pula dilaporkan. Beberapa isolat fungi
200 mL media pertumbuhan dengan komposisi
yang diperoleh aktif memproduksi enzim enzim
terdiri dari (g/L): glukosa 40, pepton 3,
glukosa oksidase diantaranya: Penicillium sp-3,
FeSO4.7H2O 0,01, KH2PO4 1, NaNO3 4, dan
Penicillium sp-M, Aspergilluis niger BT-1, A.
pH media 7, diinokulasi dengan spora biakan
niger BT-2, A. niger B-1, A. niger III, A.niger
A.niger L 51 kemudian dikocok pada kecepatan
DDL, A. niger 2, A. niger 3 (Firman dan
150 rpm selama 48 jam pada suhu kamar.
I.Nyoman P.A, 2002, Nur Umriana dan Firman,
Selanjutnya 10% inokulum aktif dipindahkan
2004). Pada penelitian ini telah dikaji pengaruh
ke dalam fermentor yang berisi 1,5 L media
komposisi media, kecepatan aerasi dan agitasi
basal dengan komposisi (g/L) : glukosa 80,
terhadap produksi enzim glukosa oksidase dari
pepton 3, FeSO4.7H2O 0,01, KH2PO4 1, NaNO3
Aspergillus niger L 51 indigenus dalam
5, CaCO3 2, pH media 7, kemudian dikocok
fermentasi skala labu kocok dan fermentor 2 L.
dengan kecepatan agitasi 200 rpm pada suhu 30
o
2. Percobaan C , kecepatan aerasi 0,5 – 1,5 vvm selama 72
2.1 Produksi enzim glukosa oksidase pada jam. Pengaruh variasi kecepatan agitasi
berbagai konsentrasi glukosa dengan terhadap produksi enzim glukosa oksidase
fermentasi skala labu kocok dilakukan dengan eksperimen yang sama.
Ke dalam labu erlemeyer 250 mL yang berisi
3. Hasil dan Pembahasan
200 mL media pertumbuhan dengan komposisi
Telah dilakukan kajian optimasi produksi
terdiri dari (g/L): glukosa 40, pepton 3,
enzim glukosa oksidase skala labu kocok dan
FeSO4.7H2O 0,01, KH2PO4 1, NaNO3 5, dan
fermentor dari A niger L 51. Hasil penelitian
pH media 7, diinokulasi dengan spora biakan
menunjukkan bahwa produksi enzim glukosa
A.niger L 51 kemudian dikocok pada kecepatan
oksidase dengan aktivitas yang optimum (
150 rpm selama 48 jam pada suhu kamar.
25,03 Unit/mL) berlangsung pada konsentrasi
Selanjutnya 5% inokulum aktif dipindahkjan ke
glukosa 100g/L (Tabel 1). Pada konsentrasi
dalam labu erlemeyer 500 mL yang berisi 200
glukosa (40g/L) dengan waktu pertumbuhan 48
mL media basal dengan variasi konsentrasi
jam dihasilkan enzim glukosa oksidase dengan
glukosa 40 g/L – 100 g/L (komposisi g/L :
aktivitas 14,08 Unit/mL sedangkan pada
glukosa 40 – 100 , pepton 3, FeSO4.7H2O 0,01,
konsentrasi glukosa 60g/L dengan waktu
KH2PO4 1, NaNO3 5, CaCO3 30 dan pH media
pertumbuhan 48 jam dihasilkan enzim glukosa
7) kemudian dikocok dengan shaker inkubator
oksidase dengan aktivitas 22,42 Unit/mL.
pada kecepatan 150 rpm suhu kamar selama 48
Sementara itu hasil penelitian yang dilaporkan
- 96 jam. Miselium yang telah tumbuh
oleh Petruccioli dan Federici (1993)
dipisahkan dengan cara filtrasi kemudian dicuci
menunjukkan bahwa glukosa dan mannosa
beberapa kali dengan air suling dan selanjutnya
merupakan sumber karbon yang paling baik
dilakukan isolasi enzim. Pengaruh konsentrasi
untuk produksi enzim glukosa oksidase dari
NaNO3 , ion logam (Fe dan Mg) dan CaCO3
Penicillium variabile P16. Pada konsentrasi
terhadap produksi enzim glukosa oksidase
glukosa 80 g/L diproduksi enzim glukosa
dilakukan dengan ekperimen yang sama. Uji
oksidase dengan aktivitas yang optimum (5,37
aktivitas enzim glukosa oksidase dilakukan
Unit/mL).
sebagai berikut: ke dalam kuvet diisi larutan
glukosa 18%, bufer fosfat 0,05 M pH 6,0, Pengaruh garam NaNO3 terhadap produksi
aminoantipirin 0,01 M, fenol 0,02 M, enzim glukosa oksidase dapat dilihat pada
peroksidase 1 unit dan enzim glukosa oksidase, Tabel 2. Pada konsentrasi NaNO3 6 g/L
lalu serapan hasil reaksi dibaca setiap menitnya diproduksi enzim glukosa oksidase dengan
pada panjang gelombang 510 nm (Firman dan aktivitas tertinggi yaitu 33,62 Unit/mL
Aryantha, 2002). Kadar protein enzim Aktivitas enzim glukosa oksidase yang rendah
ditentukan menurut metode Lowry et al. (28,66 Unit/mL) diproduksi pada konsentrasi
(1951). Unit aktivitas adalah jumlah enzim NaNO3 4g/L. Menurut Gorniak dan
yang dapat mengkatalisis pembentukan 1 Kaczkowski (1973) penambahan NaNO3 dalam
mikromol peroksida pada kondisi uji.
Tabel 1. Pengaruh konsentrasi glukosa terhadap aktivitas enzim glukosa oksidase dari A. niger L51
Konsentrasi Waktu pH Media Volume Aktivitas
Glukosa Pertumbuhan Setelah Enzim (mL) enzim
(g/L) (jam) Pertumbuhan (Unit/mL)
40 48 5,5 8,0 14,08
60 48 5,5 8,9 22,42
60 72 5,3 8,0 20,78
80 72 5,2 8,0 24,08
100 96 5,2 8,0 25,30
Keterangan: Media tanpa MgSO4.7H2O, konsentrasi CaCO3 30 gram, kecepatan aerasi 150 rpm, suhu
pertumbuhan 30oC.
Tabel 2. Pengaruh berbagai konsentrasi NaNO3 terhadap aktivitas glukosa oksidase dari A.niger L51
NaNO3 Waktu pH media setelah Volume Enzim Aktivitas
(g/L) Pertumbuhan pertumbuhan (mL) enzim
(jam) (Unit/mL)
4 72 5,0 5,0 33,40
6 72 4,7 5,0 33,62
8 72 4,9 5,0 28,66
10 72 5,0 5,0 30,26
Keterangan: Media tanpa MgSO4.7H2O, konsentrasi CaCO3 30 gram, kecepatan aerasi 150 rpm, suhu
pertumbuhan 30oC.
Tabel 3 Pengaruh ion logam (Mg dan Fe) terhadap aktivitas glukosa oksidase dari A.niger L 51
FeSO4. 7H2O pH Media Volume Enzim Aktivitas Enzim
MgSO4.7H2 (g/L) Setelah (mL) (Unit/mL)
O Pertumbuhan
(g/L)
MB MB 6,0 7 32,42
0 0 4,5 7 29,44
0,5 0 5,6. 7 32,94
0 0,01 6,1 7 18,18
0 0,02 6,0 7 31,92
0,25 0,01 5,4 7 31,0
Keterangan: Komposisi media basal (MB) terdiri dari (g/L): glukosa 80, pepton 3, MgSO4.7H2O 0,5,
FeSO4.7H2O 0,01, KH2PO4 1, NaNO3 5, CaCO3 30 dan pH media 7, kecepatan aerasi 150 rpm, suhu
pertumbuhan 30oC dan waktu fermentasi 72 jam.
7 50
6
Aktivitas GOD
40
5
(Unit/mL)
pH media
4 30
3 20
2
10
1
0 0
0 10 20 30 40 50 60 75
Konsentrasi CaCO3 (g/L)
Gambar 1. Pengaruh CaCO3 dalam media pertumbuhan terhadap produksi enzim glukosa
oksidase. Aktivitas enzim ( n ) pH media ( g )
25 4
Aktivitas GOD
20 3
pH media
(Unit/mL)
15
2
10
5 1
0 0
0.1 0.2 0.3 0.4 0.5 1 1.5 2 2.5
Gambar 2. Pengaruh CaCl2 dalam media pertumbuhan terhadap produksi enzim glukosa
oksidase. Aktivitas enzim ( n ) pH media ( g )
disebabkan ion klorida menghambat produksi pada A niger dari jalur glikolisis ke jalur lain
enzim (Gambar 2) (Syafaa dan Firman, 2004). (oksidasi lansung D-glukosa menjadi asam
glukonat) atau jalur pentosa fosfat (D-glukosa
Peningkatan aktivitas enzim glukosa oksidase
menjadi glukosa-6-fosfat kemudian menjadi
disebabkan karena (1) CaCO3 dapat
glukonat-6-fosfat) seperti terlihat pada Gambar
mengimbangi/mempertahankan pH media
3.
selama pertumbuhan sehingga tidak terjadi
penurunan pH secara drastis (2) induksi CaCO3 Produksi enzim glukosa oksidase skala
disertai dengan pergeseran jalur metabolisme fermentor dilakukan dengan variasi kecepatan
glukosa dari jalur glikolisis ke jalur oksidasi aerasi (0,5 vvm – 1,5 vvm ) dan agitasi (200 –
lansung glukosa menjadi D-glukono-lakton. 500 rpm) pada berbagai waktu pertumbuhan.
Pada jalur ini sintesis enzim glukosa oksidase Pada kecepatan aerasi 1,0 vvm dihasilkan
diinduksi untuk mengoksidasi D-glukosa enzim glukosa oksidase dengan aktivitas 27,69
menjadi D-glukonolakton. Hasil eksperimen Unit/mL dan asam glukonat sebesar 16,17
lain (data tidak dilaporkan) menunjukkan (Tabel 4).
bahwa konsentrasi asam glukonat yang
Jadi kondisi optimum produksi enzim glukosa
terbentuk selama produksi enzim glukosa
oksidase adalah pada kecepatan aerasi 1,0 vvm.
oksidase dalam media yang mengandung
Hasil eksperimen pada Gambar 5 menunjukkan
CaCO3 lebih tinggi dibandingkan dengan
bahwa pada kecepatan agitasi 200 rpm dengan
media tanpa CaCO3. Dengan demikain hasil
waktu pertumbuhan 24 jam dihasilkan enzim
eksperimen tersebut di atas memperkuat
glukosa oksidase dengan aktivitas 8,76
dugaan bahwa penambahan CaCO3
Unit/mL. Enzim glukosa oksidase dengan
menyebabkan pergeseran metabolisme glukosa
GOD
Glukosa D-glukonolakton + H2O2
Fruktosa-6-fosfat Glukonat-6-fosfo
PFK
Fruktosa-1,6-bifosfat Keterangan: PFK (Fosfat-fruktokinase)
EMP or HMP : Glukosa-6-fosfat isomerase
Gambar 3. Jalur metabolisme glukosa yang berkenaan dengan adanya CaCO3 dan tanpa CaCO3
dari Aspergillus niger (Liu et al., 2001, Syafaa dan Firman, 2004)
Tabel 4. Pengaruh kecepatan aerasi (vvm) terhadap produksi gukosa oksidase dan asam glukonat
Kecepatan pH Aktivitas
Aerasi (vvm) Setelah Fermentasi GOD (Unit/mL)
0,5 5,5 18,03
1,0 5,2 27,69
1,5 5,0 22,95
Keterangan: Waktu fermentasi 72 jam, kecepatan pengadukan 200 rpm dan suhu pertumbuhan 30oC
60
Aktivitas GOD
50
y1
(Unit/mL)
40
y2
30
20
y3
10 y4
0
0 24 48 72 96 120 144
Waktu pertumbuhan
(Jam)
Assesment of River Water Quality Status By Using a New Developed Water Quiality
Index System
Abstract
The assessment of river water pollution is usually conducted by a comparison between the effective
water quality and the standards regulated by law. The water quality standards are fixed both on water
utilization purposes and on consideration of water quality degradation. The water quality index is
usually assigned through an evaluation of the water condition by classification into several categories.
This paper elaborates a tool for water quality evaluation by the application of a software system to
define the water quality index. The assignment of the index is fixed from index-1 to index-5 according to
water degradation taking account of an indicated value of water quality parameter concentrations.
Index-1 means a category of excellent quality of unpolluted water and index-5 is a category of very
polluted water.
Around 150 water quality parameters of comparable nature and impact on environment are grouped
into 15 alterations that are: temperature, color, suspended particles, oxidized organic matters, nitrogen
matters, nitrate, phosphorous matters, mineralization, acidification, inorganic micro-pollutant for raw
water, inorganic micro-pollutant for bryophytes, pesticide for raw water, organic micro-pollutant non-
pesticides for raw water, micro-organisms, and phytoplankton. Index determination consists of 3 stages:
- starting with a selection of the biggest limit value of parameter in each alteration according to the
index classification, - following by a selection of the highest index of alteration, and finally, terminating
by fixation of the water quality index.
The application of the index system has been conducted to 2 rivers, the Citarum River in West Java and
the Brantas River in East Java. The assessment of the water quality for the Citarum River was based on
data from 10 sampling point locations and by evaluating 33 parameters, which were monitored in the
dry season period in 2003. The result indicates the index-5 for the upstream region of the Citarum River
due to high concentration of suspended particles and phosphorous. The index-5 always was still present
along the middle stream, due to receiving the effluents coming from domestic and industrial wastes,
indicated by high concentrations of organic matters and bacteria indicators. After the water passed the 3
cascade reservoirs (Saguling, Cirata and Jatiluhur), the index-3 was found, and in the downstream
region of the Citarum River close to the sea the index-5 was observed again, due to contamination by
industrial and domestic wastes. The assessment of the water quality for the Brantas River was done for 5
sampling points selected from 51 monthly monitoring locations of data collection in 2003 and by
evaluating 22 to 28 parameters. The data were selected by application of the rule of 90% and the result
shows the index-5 for water quality along of the Brantas River due to high concentration of suspended
particles, phosphorous and inorganic micro-pollutants.
Key words: evaluation, index, pollution, water quality.
governments, the technical arrangement for pollutant matters as well as the organic micro-
water quality management and pollution pollutant non-pesticides that it really has not
control as well as the classification of national been considered under the assessment
water quality criteria, and for supporting the framework mechanism of water quality in
real operational in field of this government Indonesia. This method will be predictable
regulation needs to be more detail translated by adapted for advances in space science and
each provincial governments through their technology. And, by using the similar method,
regional regulations. The water quality index in 2003 the Directorate General of Water
system is developed to answer the desire of all Resources have been developed the water
regions in Indonesia on the classification of in- quality assessment system and implemented for
stream water quality degradation degree by two in-stream water rivers in Indonesia,
using a national standard mechanism and than Rapport of internal study (2003).
of course can be followed up by each
2. Methodology and Architecture of the
provincial government taking account as a tool
Water Quality Index System
for assessment of the status of water quality
Several steps on assessment of the water
regarding the process of preparation the priority
quality index system
of action plan on water quality management
and pollution control as well as the formulation The several steps are commonly used to assess
of the regional regulation on water quality the classification of water quality degradation
standards for each river segment areas located degree, called the evaluation system of water
in their administrative regions. quality index, as follows:
According to the results of field inventory for classifying the water quality parameters
some cases indicating that the high water into 15 alterations which have a
pollution in the rivers and lakes due to the high comparable nature and impact on
increasing of social and economic activities and environment;
industrial developments. Although the impact
evaluating the appropriate limit value for
of economic development in the regions
each water quality parameters into 5 index
produces some unusable materials such as
classes respectively representing by blue,
waste solids and wastewater as well as
green, yellow, orange, and red for
industrial waste gazes. The industrial and
excellent quality of unpolluted water, good
domestic wastewaters are really, after or before
water quality, moderate water quality, bad
passing in a wastewater treatment plant, ejected
water quality, and unusable water quality
to the river and lakes. Actually, the sources and
of very polluted water;
types of pollutant are not correctly monitored
yet and of course regarding for this reason it formulating the water quality index classes
really needs to be developed a comprehensive for all parameters of each alterations with
method for evaluation of the water pollution mentioning the range of 0 to 20 for index-
degree. Ahead, this method could be 1, of > 20 to 40 for index-2, of > 40 to 60
considered to following up by the regional for index-3, of > 60 to 80 for index-4, and
government maybe in issuing the regional of > 80 to 100 for index-5;
government regulation or the governor decree.
A new method of water quality assessment
fixing the water quality index by
evaluating of all parameters in each
system have been developed in 1999 by the
alterations and choice of the very bad
Agence de l’eau Loire- Bretagne, Oudin at. al
value of the water quality parameter as the
(1999) and, after an evaluating to the method
representative for the index of alteration
on considering of the specific country climate
and following by choice of the very bad
and of the habitually water quality parameters
alteration as the representative for the
monitoring, it can be appropriate widely
water quality index.
implemented in Indonesia taking account of
some modifications needed, Fulazzaky (2000). Classification of the water quality
Because the system consists a comprehensive parameters into 15 alterations
classification of the water quality parameters, The in-stream water quality of a river segment
including the complex and rigorous alterations area is designated by the monitored value of the
such as the pesticides and inorganic micro-
Table 1. Example, the oxidized organic matter parameters of water quality index classification
Alteration Parameter Unity Limit value of parameter for index classification
Index-1 Index-2 Index-3 Index-4 Index- 5
Dissolved mg/l O2 8 6 4 3 <3
Oxidized oxygen
organic Oxygen % O2 90 70 50 30 < 30
matters saturation
COD mg/l O2 20 30 40 80 > 80
BOD mg/l O2 3 6 10 25 > 25
DOC mg/l C 5 7 10 12 > 12
+
NH4 mg/l NH4 0.5 1.5 2.8 4 >4
NTK mg/l N 1 2 4 6 >6
Note: COD as chemical oxygen demands; BOD as biochemical oxygen demands; DOC as dissolved
organic carbons, NH4+ as ammonium, and NTK as nitrogen total Kjeldahl.
water quality parameters, although for polluted in-stream water and representing by
generalizing the water quality status in the red.
common sense it is necessary classified around
Method for determination of the water
of the 150 parameters of comparable nature and
quality index
impact on environment into 15 alterations, as
Every parameter around of 150 water quality
following: 1. temperature; 2. color; 3.
parameters that including in the 15 alterations
suspended particles; 4. oxidized organic
has a limit value for each index category, for
matters; 5. nitrogen matters; 6. nitrate; 7.
evaluating the result of water quality
phosphorous matters; 8. mineralization; 9.
monitoring can be started by selecting one of
acidification; 10. inorganic micro-pollutant for
the water quality parameter of each alterations
raw water; 11. inorganic micro-pollutant for
that having the highest index category as the
bryophytes; 12. pesticides for raw water; 13.
representative of the parameters and than to be
organic micro-pollutant non-pesticides for raw
continued by comparing the index among of the
water; 14. micro-organisms; and 15.
alterations and selecting one of the alteration
phytoplankton.
that having the highest index category as the
Category of water quality index according representative of the alterations and finally
the water quality degradation degree fixing the highest index as the water quality
The assignment of the index of water quality is index for the selected location of sampling
fixed by 5 categories, as showing in Table 1 for point of the in-stream water of rivers or lakes.
oxidized organic matters for instance,
3. Study on temperature as a sensitive
according to the water quality degradation
parameter to assess the water quality index
degree taking account of an indicated limit
for the tropical country
value of the water quality parameters selected
In the literature, Oudin at. al (1999), indicated
from 15 alterations, as following: the index-1
that for the temperature parameter categories, if
means a category of excellent quality of
the value of temperature is below of 21.5 o C
unpolluted in-stream water and representing by
the water quality of in-stream water categorized
blue color; the index-2 assigns a category of
by index-1, and than successively following by
good quality of in-stream water and
limit values of the temperature of > 21.5 to
representing by green; the index-3 indicates a
23.5 o C for index-2; of > 23.5 to 25 o C for
category of moderate quality of in-stream water
index-3; of > 25 to 28 o C for index-4; and
and representing by yellow; the index-4 assigns
finally for the value of temperature over of 28 o
a category of bad quality of in-stream water
C categorized by index-5. This category is not
and representing by orange; and the index-5
suitable applied to the tropical country like
means a category of unusable quality of very
Indonesia regarding the risk of classification
the natural water quality in several regions into Determination of water quality index for
a very bad category of the index-5 and the the Citarum River
reality in field showed that the in-stream water The 10 sampling point locations for the
indicated by the temperature over than 28 o C is Citarum river is applied for running the model
also appropriate for several uses as well for by using the data monitored on August 2003,
irrigation and also for natural biology where 3 sampling points (Curug, Walahar and
functions. According to the same literature, it Tanjungpura) located in the down-stream and 7
seems that the deviation of temperature other locations (Wangisagara, Majalaya, Sapan,
monitored at the down-stream of an ejected Cijeruk, Dayeuhkolot, Brujul, and Nanjung)
pollutant location is resulted by deducting the located in the up-stream of the 3 cascade
effective temperature measured at the down- reservoirs (Saguling, Cirata and Jatiluhur) as
stream to the temperature at the up-stream, and showed in Figure 1.
the value of temperature’s deviation can be
used to representing the temperature parameter. The application of model test, for instance, to
Although it needs for a sampling point location be selected for the Nanjung sampling point
to be compared by the historical temperature located at the up-stream region of the Citarum
data indicating that it is more applicable used river taking account of the river segment
for the tropical climate country such as for received a very high pollutant coming from
Indonesia. The water quality index category industrial and domestic wastewaters of the
indicated by the temperature’s deviation is for Bandung city and Bandung district areas, and
the value of temperature’s deviation bellow of the result of evaluation just for oxidized
1.5 o C indicated by index-1 and successively organic matters as showing in Table 2 indicated
following by the limit value of temperature’s the index-5 of water quality status. The result
deviation of > 1.5 to 2 o C indicated for index-2; of evaluation for the 33 water quality
of > 2 to 2.5 o C for index-3; of > 2.5 to 3 o C for parameters which classified into 13 alterations,
index-4; and for the deviation value of where two alterations: pesticides and micro-
temperature over of 3 o C is categorized by pollutant organic non-pesticides were not be
index-5. Of course, in the case of this study the evaluated due to absent of data, showed that the
application of temperature’s deviation is more index-5 was founded for suspended particles,
realistic and adaptable to be selected. oxidized organic matters, and phosphorous
alterations indicated by high values of
4. Implementation of the water quality index suspended solids, dissolved oxygen,
system for two selected rivers in Indonesia biochemical oxygen demands, total
Data selection from two important rivers phosphorous, and soluble phosphorous as well
In implementation of the water quality index as for inorganic micro-pollutant for raw water
system for assessment of the in-stream water and micro-organisms. The impact of pollution
has been selected for two important rivers, due is really mentioned in field by appearing the
to the reason of the economic development eutrophicated phenomena in the Saguling
purposes in Indonesia, located in Java island, reservoir located in the down-stream of the
that is the Citarum River in West Java and the Nanjung station in where has been installed a
Brantas River in East Java, where in both the biggest hydropower in Indonesia.
water resources is managed by the Jasa Tirta
Public Corporation and the water quality The analysis of 10 sampling point locations
monitoring has been routinely programmed on along the Citarum River by evaluating the 33
their annual budget activities. Among the data water quality parameters showed in Table 3,
collection of the two rivers 10 locations of with application of the similar method such as
sampling point of the Citarum River monitored for evaluation of the water quality index at the
on August 2003 and 5 locations selected from Nanjung location given the values of all index
51 sampling point locations of the Brantas of 13 alterations for each locations as well as
River monitored along the period of time series the water quality index of the in-stream water
of 9 months of the year of 2003 were applied quality. All locations have the excellent quality
for running the system. of temperature and nitrate but it was very
polluted phosphorous matters except at the
Bendung Curug, Bendung Walahar and
Tanjungpura sampling points where located at of the 3 cascade reservoirs: the Saguling, Cirata
the down-stream of the 3 cascade reservoirs. and Jatiluhur, where located in the up-stream of
the sampling locations. The polluted
According the result of analysis for water
parameters of the Citarum River were exactly
quality degradation status as showing in Table
dominated by the phosphorous matters,
3, the in-stream water of the Citarum River
oxidized organic matters, micro-organisms as
from up-stream to down-stream is very polluted
well as by the suspended particles.
water that indicated by the index-5 except the
Bendung Curug and Bendung Walahar Determination of water quality index for the
locations which indicated by the index-3. The Brantas river
moderate water quality for some segments of The implementation of the water quality index
the Citarum River as mentioned by the index-3 system for in-stream water of the Brantas River
at the two locations, although a lot of industries to be done after passed the process of selection
and urban areas founded at the up-stream of the data via the rule of 90%, Oudin at. al
region, it is probably indicated the presenting (1999), F = (i-0.5)/N or i = 0.9 x N + 0.5,
of the self-purification phenomena for in- where: i is the number of applicable monitored
stream water of the Citarum due to the presence water sample; N is the number of monitored
Table 2. Example, water quality index evaluation for the oxidized organic matters
Water quality parameter of Unity Value Class of Water quality
oxidized organic matters parameter index index
Dissolved oxygen mg/l O2 0 5
COD mg/l O2 75 4 5
BOD mg/l O2 30 5
+
NH4 mg/l O2 0.955 2
Remarks : location Nanjung; date of monitoring August 21, 2003
Table 3. Result of water quality index evaluation for the Citarum River
Types of alteration Index of alteration
01a 01b 01c 01 03a 03b 03 08 09a 09
Temperature 1 1 1 1 1 1 1 1 1 1
Color 2 2 4 3 3 3 4 2 3 2
Suspended particles 5 4 5 5 3 4 5 2 2 3
Oxidized organic matters 2 5 5 5 4 5 5 2 2 2
Nitrogen matters 3 1 3 3 3 3 3 3 1 3
Nitrate 1 1 1 1 1 1 1 1 1 1
Phosphorous matters 5 5 5 5 5 5 5 2 2 3
Mineralization 3 1 3 2 1 1 2 1 1 2
Asidification 1 1 4 1 1 1 3 1 1 1
Inorganic micro-pollutant for raw 3 3 4 3 4 4 5 1 1 1
water
Inorganic micro-pollutant for 1 1 1 1 1 2 3 1 1 1
bryophytes
Pesticides for raw water
Organic micro-pollutant non-
pesticides for raw water
Micro-organisms 3 5 5 5 5 5 5 3 3 5
Phytoplankton 1 1 4 1 1 1 3 1 1 1
Water quality index 5 5 5 5 5 5 5 3 3 5
Number of parameter analysis 33 33 33 33 33 33 33 33 33 33
Remarks: 01a Wangisagara, 01b Majalaya, 01c Sapan, 01 Cijeruk, 03a Dayeuhkolot, 03b Brujul, 03
Nanjung, 08 Bendung Curug, 09a Bendung Walahar, 09 Tanjungpura.
water sample; and F = 0.9 is percentile of monitored water quality along the Brantas
applied data. It can be really used this rule, of River both by manual collected water sample
course, by considering one of the major for the 51 stations and by automatic real time
activities for the water resources management monitoring system for the 23 stations as
in the Brantas River basin that the Jasa Tirta 1 showed in Figure 2.
Public Corporation has been frequently
The evaluation of the 22 to 28 parameters is
Table 4. Result of water quality index evaluation for the Brantas River
Number of applicable result and index of alteration
Types of alteration 0160 0940 1020 1100 2600
i index N index N index N index N index
Temperature 9 1 8 1 9 1 10 1 9 1
Color
Suspended particles 9 5 3 5 9 5 10 5 9 5
Oxidized organic 9 4 8 4 9 4 10 5 9 5
matters
Nitrogen matters 9 3 8 3 9 5 10 3 9 3
Nitrate 9 3 7 2 9 2 10 2 8 2
Phosphorous matters 9 4 8 5 9 4 10 5 9 5
Mineralization 9 1 8 1 9 1 10 1 9 2
Asidification 9 1 8 1 9 1 10 1 9 1
Inorganic micro- 9 5 1 5 7 5 8 5 7 5
pollutant for raw water
Inorganic micro- 9 4 5 1 7 3 10 1 7 3
pollutant for
bryophytes
Pesticides for raw
water
Organic micro-
pollutant non-
pesticides for raw
water
Micro-organisms
Phytoplankton 9 2 8 3 9 3 10 2 9 4
Water quality index 5 5 5 5 5
Number of parameter 28 22 25 26 25
analysis
Location remarks: 0160 Kedung Pedaringan; 0940 Jembatan Ploso; 1020 Jembatan Perning; 1100 Ngagel;
2600 Jembatan Porong
classified into 11 alterations due to the absence coming from industrial wastewater or from
of three alterations: color, pesticides for raw mountainous eruption sludge and so, of course,
water and organic micro-pollutant non- it is necessary to be followed up by a detail
pesticides for raw water as well as the micro- research program.
organisms under the annual water quality
The index-4 of oxidized organic matters as well
monitoring program as showed in Table 4.
the phosphorous matters in the up-stream and
According to the result of the data analysis by
middle stream of the Brantas River and also the
implementing the water quality index system
index-5 in the down-stream indicating of
showing that the index-5 representing by
polluted and very polluted water quality along
suspended particles and inorganic micro-
the river due to high amount of direct or
pollutant on raw water was founded for all
indirect ejected of the industrial wastewater and
selected locations along the Brantas River, at:
also stimulated by charging the direct ejected
the Kedung Paderingan, Ploso, Perning, Ngagel
domestic wastewater coming from some
and Porong. The high concentration of
households of several cities close the river.
suspended solids showing the progressively
increasing of the rate of sediment transport in 5. Conclusion
the river as a cumulative impact of land erosion The water quality index system as an indicator
due to deforestation and degradation of the of water pollution can be widely used to assess
watershed catchment area, since 1998, in the the in-stream river water in Indonesia although
upper of the Brantas basin. The high the application of the system on the in-stream
concentration of copper and mercury in the lake water must be evaluated more detail by
stream of the Brantas River may be either studying the quality of water of each different
Gatot Trimulyadi R, Kadariah, Anik Sunarni, Isni Marlianti dan Dian Iramani
Abstrak
Telah dilakukan penelitian pengaruh iradiasi pada khitosan terhadap pertumbuhan (Growth
promoters) tanaman cabe (Capcinum annum). Khitosan diiradiasi dengan sinar gamma
yang berasal dari 60Co dengan dosis 0, 25, 50 dan 100 kGy. Khitosan yang digunakan
dengan derajat deasetilasi 81,5 %, hasil isolasi dari kulit udang putih dan kemudian
dilakukan proses deasetilasi dengan 50 % larutan NaOH. Khitosan yang telah diencerkan
dengan air dan dengan kepekatan 50 ppm disiramkan pada tanaman cabe sebanyak 300
mL/tanaman setiap 2 hari sekali. Hasil iradiasi menunjukkan bahwa iradiasi mempengaruhi
massa molekul relatif khitosan dari 1,650 104 menjadi 5,88 102 Dalton dan kelarutan
khitosan pada 1 % asam asetat dari 0,045 sampai 0,146 g/mL pada dosis 0 sampai 100 kGy.
Hasil pengujian khitosan iradiasi terhadap pertumbuhan tanaman cabe memperlihatkan
bahwa penyiraman tanaman dengan larutan yang mengandung 50 ppm khitosan dapat
meningkatkan tinggi tanaman sebesar 79,2 % dengan derajat peningkatan pertumbuhan
sebesar 97,5 % pada umur 3 bulan.
Kata kunci : Khitosan, iradiasi, induksi pertumbuhan, tanaman cabe.
Tabel 2 memperlihatkan kelarutan khitosan dosis iradiasi pada khitosan, tanaman cabe
pada beberapa variasi dosis iradiasi. makin tinggi sesuai dengan makin besarnya
dosis iradiasi. Di atas dosis iradiasi 50 kGy
Tabel 2. Hasil analisis kelarutan khitosan persentasi peningkatan pertumbuhan
dalam asam asetat
menunjukkan lebih dari 50 %. Hal ini di
No Dosis Kelarutan
karenakan dengan bertambah besarnya dosis
iradiasi (g/mL)
(kGy) iradiasi, khitosan massa molekulnya lebih
rendah sehingga lebih mudah diserap oleh
1 0 0,045 tanaman. Hasil ini menunjukkan bahwa
2 25 0,107 khitosan iradiasi dapat berfungsi sebagai bahan
3 50 0,120 penginduksi pertumbuhan tanaman cabe.
4 100 0,146
Derajat peningkatan pertumbuhan (%)
Dari Tabel 2 tampak bahwa kelarutan khitosan Derajat peningkatan pertumbuhan dihitung dari
dalam 1 % khitosan berkisar antara 0,045 berat rata-rata tanaman dengan perlakuan
sampai 0,146 g/mL. Di sini terlihat adanya dikurangi berat rata-rata tanpa perlakuan
hubungan antara dosis iradiasi dengan (kontrol) kemudian dibagi dengan berat rata-
kelarutan, makin besar dosis iradiasi yang rata tampa perlakuan (kontrol) dikalikan
digunakan, sifat kelarutannya juga makin besar. dengan 100 %. Perhitungan setelah masa
Hal ini dapat dijelaskan dengan bertambahnya tanam 3 bulan ditunjukkan pada Tabel 4.
dosis iradiasi yang digunakan massa molekul Hasilnya menunjukkan bahwa dengan
khitosan menurun dan jumlah ikatan hidrogen meningkatnya dosis iradiasi presentasi derajat
yang ada menjadi lebih sedikit, sehingga peningkatan pertumbuhan makin meningkat.
kelarutannya akan meningkat. Pada dosis iradiasi 100 kGy menunjukkan
Pengaruh pemberian khitosan iradiasi peningkatan yang cukup tinggi, yaitu sebesar
terhadap tinggi tanaman cabe. 97,5 %. Hal ini dikarenakan dengan
Hasil pengujian khitosan iradiasi terhadap penambahan oligo khitosan pada air siraman
tinggi tanaman cabe setelah berumur 3 bulan akan meningkatkan jumlah akar pada tanaman.
disajikan pada Tabel 3. Dengan jumlah akar yang banyak dan sehat,
tanaman akan besar dan tumbuh lebih baik
Hasilnya menunjukkan bahwa makin besar
Tabel 3. Pengaruh pemberian khitosan iradiasi terhadap tinggi tanaman cabe setelah berumur 3 bulan
Dosis Tinggi tanaman (cm) Rata-rata Peningkatan
No irdiasi No tanaman tinggi tanaman (%)
(kGy) 1 2 3 4 5 6 7 8 9 10 (cm)
1 0 10,8 31,7
2 25 12,2 48,7
3 50 15,8 92,6
4 100 16,2 97,5
Tampa perlakuan (kontrol) 8,2 0,0
0 kGy 25 kGy
Gambar 1. Pengaruh dosis iradiasi terhadap banyaknya akar pada tanaman cabe
dibandingkan dengan jumlah akar yang sedikit. Hasil pengujian khitosan iradiasi sebagai bahan
penginduksi pertumbuhan pada tanaman cabe,
Pengaruh penambahan oligo khitosan pada air
memperlihatkan bahwa penyiraman tanaman
penyiraman terhadap banyaknya akar tanaman
dengan air yang mengandung 50 ppm khitosan
cabe ditunjukkan pada Gambar 1.
setiap 2 hari sekali menunjukkan peningkatkan
4. Kesimpulan tinggi tanaman sebesar 79,2 % dengan derajat
Dari hasil penelitian dapat disimpulkan bahwa peningkatan pertumbuhan 97,5 % pada umur 3
dosis iradiasi sangat berpengaruh terhadap bulan.
massa molekul dan kelarutan khitosan. Pada
dosis iradiasi 100 kGy didapatkan massa
molekul khitosan 5,88 102 Dalton dan
kelarutannya pada 1 % asam asetat 0,146 g/mL.
Gede Wibawa
Abstract
In this work, four group contribution models (UNIFAC-FV, Entropic-FV, UNIFAC-ZM and
ASOG-FV) were evaluated based on an extensive database that covers solvent activities
containing alkane and cycloalkane, aromatic and polar solvents. For the three type solvents
studied, the investigation showed that all models studied gave the best prediction results for
systems containing aromatic solvents. Errors were highest for systems containing polar
solvents. For the overall results, Entropic-FV model was the best model with the average
absolute deviation (AAD) between experimental and predicted solvent activities of 15.3%
while AADs of UNIFAC-FV, UNIFAC-ZM and ASOG-FV models were 15.9, 23.8 and 33.6 %,
respectively.
Table 1 AAD between experimental and predicted solvent activities by group contribution models (Eq. A =
UNIFAC-FV, Eq. B = Entropic-FV, Eq. C = UNIFAC-ZM and Eq. C = ASOG-FV)
AADa [%]
Polymer alkane & cycloalkane aromatic polar
Eq.A Eq.B Eq.C Eq.D Eq.A Eq.B Eq.C Eq.D Eq.A Eq.B Eq.C Eq.D
PI 27.7 21.5 18.4 22.8 18.4 17.1 15.7 20.2 20.6 19.7 38.1 47.0
PIB 8.1 13.7 25.0 14.2 9.4 9.0 10.2 31.7 21.4 19.6 30.9 58.6
PBMA 6.4 9.2 6.8 23.7 8.9 9.7 11.3 40.8 14.3 15.6 33.3 25.2
PVAc 24.4 27.2 29.9 80.7 16.4 13.4 12.0 24.1 22.3 12.2 47.1 31.2
PS 6.9 16.7 5.7 35.2 8.4 4.8 3.3 15.5 11.9 19.7 10.2 60.6
PPO 7.0 5.0 7.8 18.4 41.5 24.4 32.4 16.6
PMMA 6.7 10.4 8.4 13.2 6.9 8.0 9.2 5.9
PEO 2.0 1.0 5.3 9.2 66.0 27.0 49.7 41.6
PE 9.3 18.5 28.5 2.4
PDMS 7.3 4.8 30.8 3.8 4.2 25.5 0.0 18.0 18.1 11.3
PCS 15.2 14.1 6.8 17.9
PBD 12.8 19.7 12.0 21.4 16.1 15.5 18.6 28.2 12.9 17.8 25.9 53.4
PαMS 4.7 2.6 5.2 5.3
PH 9.0 5.8 10.2 7.5
PDD 15.9 11.8 6.0 9.7
PD 6.3 3.2 12.6 9.2
Overall 12.1 14.9 21.4 26.3 11.1 9.7 11.1 22.0 20.0 17.9 31.2 42.6
Table 3 AAD between experimental and predicted group contribution models for each category of systems
AADa [%]
Solvent/
Model
UNIFAC-FV Entropic-FV UNIFAC-ZM ASOG-FV
Additionally, the models used the residual term AAD was calculated in ordinary way by
for accounting efects of enthalpy of mixing assigning each system the same weight. This
with group interaction parameters were procedure was applied because the number of
optimized from low molecular fluid substances. systems varies for each polymer. For systems
containing PDMS, solvent activity calculations
3. Result and Discusion
using ASOG-FV model could not be made
Group contribution models (UNIFAC-FV,
because of unavailability of its group
Entropic-FV, UNIFAC-ZM and ASOG-FV)
interaction parameters. From three categories
were evaluated using database ranging from
of solvents studied, the four models gave the
systems containing nonpolar to strongly polar
best prediction results for systems containing
solvents. All databases considered in this work
the aromatic solvents, however, the worse
were split up into three categories that are
results were obtained for systems containing
systems containing alkane and cycloalkane,
the polar solvents. From four group
aromatic, and polar solvents. The results were
contribution models studied, ASOG-FV model
presented in Table 1, which shows average
gave the poorest prediction results for all
absolute deviation (AAD) between predicted
system categories. For systems containing
and experimental solvent activities. The overall
alkane and cycloalkane solvents, UNIFAC-FV
1
propanol - PVAc (353.2 K)
0.8
solvent activity [ - ]
0.6
0.4
UNIFAC-FV
Entropic-FV
0.2 UNIFAC-ZM
ASOG-FV
Exp. data
0 0.1 0.2 0.3
model gave the best prediction result with 12.1 AADs of UNIFAC-FV, UNIFAC-ZM and
% AAD and for systems containing aromatic ASOG-FV models were 15.9, 23.8 and 33.6 %,
and polar solvents, Entropic-FV model gave the respectively.
best prediction result with 9.7 and 17.9 %
5. Literature cited
AAD, respectively. Chen C. C and Mathias P. M., (2002). Applied
Table 2 is summary of Table 1 that shows AAD Thermodynamics for Process Modeling, AIChE J.,
between experimental and predicted group 48, p. 194-200.
contribution models for each category of H. S. Elbro, Aa. Fredenslund and P. Rasmussen,
systems. From the table shows that Entropic- Macromolecules, (1990). A New Simple Equation
FV model gave the best performance for for Prediction of Solvent Activities in Polymer
overall systems studied with overall AAD of Solutions, 23, 4707-4714.
15.3%. Overall AADs of Entropic-FV, Fredenslund, Aa., Jones, R. L. and Prausnitz, J. M.,
UNIFAC-ZM and ASOG-FV models were (1975). Group Contribution Estimation of Activity
15.9, 23.8 and 33.6 %, respectively. However Coefficients in Nonideal Liquid Mixtures, AIChE
UNIFAC-ZM model should be considered J., 21, 1085-1099.
when accurate polymer molar volume Oishi, T. and Prausnitz, J. M., (1978). Estimation of
unvaliable. Ilustration of accuracy of predictive Solvent Activities in Polymer Solutions Using a
group contribution models represented in Fig 1 Group Contribution Method , Ind. Eng. Chem.
for propanol-PVAc systems at 353.2 K. Process Des. Dev., 17, 333-339.
4. Conclusion Tochigi, K., (1998). Prediction of Vapor-Liquid
The investigation showed that all models Equilibria in Non-polymer and Polymer Solutions
studied gave the best prediction results for Using an ASOG-based Equation of State
systems containing aromatic solvents. Errors (PRASOG), Fluid Phase Equilib., 144, 59-68.
were highest for systems containing polar Tochigi K., Tiegs D, Gmehling J and Kojima K.,
solvents. For three catagory solvents studied, (1990). Determination of New ASOG parameters, J.
ASOG-FV gave the poorest results. For the Chem. Eng. Jpn. 23, 453-463.
overall results, Entropic-FV model was the best Wen H., Elbro H. S., Alessi P. (1992). Polymer Data
model with AAD between experimental and Collection Part 1, DECHEMA Chemistry Data
predicted solvent activities of 15.3% while Series; DECHEMA Frankfurt am Main, Germany.
Wohlfarth C., (1994). Vapour-Liquid Equilibrium solvents in four polymers using the piezoelectric-
Data of Binary Polymer Solutions: Vapour- quartz sorption method, J. Chem. Eng. Data, 47 (3),
Pressures, Henry’s Constants and Segment Molar 518-524.
Excess Gibbs Free Energies, Elsevier B. V.,
Wilson G. M. and Deal C. H., (1962). Activity
Amsterdam, The Netherlands.
coefficients and molecular structure, Ind. Eng.
Wibawa G., Hatano R. Sato Y. and Masuoka H., Fundamen., 1, 20-23.
(2002a). Solubility of 11 polar organic solvents in
Zhong C., Sato Y., Masuoka H. and Chen X.,
four polymers using the piezoelectric-quartz
(1996). Improvement of predictive accuracy of the
sorption method, J. Chem. Eng. Data, 47 (4), 1022-
UNIFAC model for vapor-liquid equilibria of
1029.
polymer solutions, Fluid Phase Equilib., 123, 97-1
Wibawa G., Takahashi M. Sato Y. and Masuoka H.,
(2002b). Solubility of seven nonpolar organic
Polymer symbols
PI : polyisoprene PS : polystyrene
PIB : polyisobutylene PαMS : poly(α-methyl styrene)
PBMA : poly(n-butyl methacrylate) PBD : polybutadiene
PVAc : poly(vinyl acetate) PEO : poly(ethylene oxide)
PE : polyethylene PPO : poly(propylene oxide)
PH : polyheptene-1 PMMA : poly(methyl methacrylate)
PD : polydecene-1 PCS : poly(4-chloro styrene)
PDD : polydodecene-1 PDMS : poly(dimethyl siloxane)
List of symbols
a : activity ( - )
amn : group interaction parameter ( K )
F : objective function ( - )
N : number of data point ( - )
q : group surface parameter ( m2/mol )
R : group size parameter ( m3/mol )
r : molecular size parameter ( m3/mol )
r′ : molecular size parameter ( m3/kg )
T : temperature ( K )
V : molar volume ( m3/mol )
v : specific volume ( m3/kg )
w : weight fraction ( - )
x : mole fraction ( - )
z : coordination number (z = 10)
θ : surface area fraction ( - )
φ : volume fraction ( - )
φ′ : modified volume fraction ( - )
Ψmn : group interaction parameter ( - )
Superscripts
C : combinatorial term
FV : free volume term
R : residual term
Subscripts
1, 2 : solvent, polymer
cal. : calculated value
exp. : experimental value
i, k : component or segment
M : mixture
w : van der Waals
Taburan Pb, Cr dan Cu dalam batuan syal Formasi Mahang dan hasil luluhawanya
di kawasan Sungai Merbok, Kedah
Program Geologi, Pusat Sains Sekitaran dan Sumber Alam, Fakulti Sains dan Teknologi, Universiti
Kebangsaan Malaysia, 43600 Bangi, Selangor, Malaysia
Abstrak
Formasi Mahang terdiri daripada batuan syal, sabak merah, sabak kelabu dan sabak hitam.
Unit batuannya di kawasan Sungai Merbok, Kedah telah mengalami luluhawa kimia yang
tinggi dan bertukar menjadi tanih. Kepekatan Pb, Cr dan Cu dalam batuan syal Formasi
Mahang dan hasil luluhawanya dikaji bagi mengenalpasti sebaran logam-logam berat
tersebut apabila batuan bertukar menjadi tanih. Sebanyak 40 sampel batuan dan tanih telah
digunakan bagi tujuan tersebut. Kandungan unsur major dan kepekatan Pb, Cr dan Cu
dalam batuan dan tanih ditentukan menggunakan kaedah pendarfluor sinar-X (XRF). Kajian
petrografi dilakukan terhadap 10 sampel terpilih bagi menentukan komposisi mineral dalam
batuan syal. Kajian ini mendapati taburan Pb, Cr dan Cu bergantung kepada komposisi
kimia batuan syal. Batuan syal merah mengandungi kepekatan Pb, Cr dan Cu yang lebih
tinggi berbanding batuan syal kelabu kerana ia mempunyai kandungan matriks yang lebih
tinggi. Pb tertabur dalam batuan syal yang mengandungi banyak MnO. Cr terkandung
dalam mineral filosilikat dan oksida besi manakala Cu hadir bersama-sama dengan oksida
besi. Akibat luluhawa, kandungan Al2O3, TiO2, K2O dan Cr meningkat, SiO2 dan Pb
menyusut manakala Fe2O3 dan Cu tidak berubah. Dalam tanih, Pb, Cr dan Cu berasosiasi
dengan mineral lempung dan oksida Al dan Fe. Sebahagian daripada Cr masih berada
dalam mineral filosilikat. Taburan Pb, Cr dan Cu dalam batuan syal Formasi Mahang
berlaku sewaktu proses pembentukannya di persekitaran laut dalam. Apabila luluhawa
berlaku, logam berat tersebut tersebar semula dan terhimpun bersama-sama dengan mineral
dan bahan sekunder yang lebih stabil dalam tanih.
th
338 Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Habibah HJ Jamil, Wan Fuad Wan Hassan & Mohamad MD Tan
Fuad (2002) mendapati beberapa jenis logam terpilih bagi menentukan komposisi mineral
berat dalam batuan syal Formasi Mahang dalam batuan syal. Kandungan mineral dalam
mengalami pengayaan ataupun penyusutan di batuan dan tanih syal dianalisis menggunakan
sepanjang profil luluhawa. Perbincangan yang teknik belauan sinar-X (XRD).
lebih khusus diperlukan bagi memahami
3. Keputusan
taburan logam berat dalam batuan syal dan
Batuan syal Formasi Mahang.
sebarannya apabila batuan mengalami luluhawa
Batuan syal Formasi Mahang berbutir halus
kimia yang tinggi. Bagi tujuan tersebut, tiga
dan mempunyai isihan yang baik. Komposisi
jenis logam berat telah dipilih iaitu Pb, Cr dan
utama batuan syal ditunjukkan dalam Jadual 1.
Cu. Penekanan diberikan kepada taburan Pb,
Batuan syal merah terdiri daripada kuarza (40-
Cr dan Cu dalam batuan syal merah dan syal
15%), matriks (40-45%) dan oksida besi (15-
kelabu serta hubungannya dengan komposisi
20%). Berdasarkan ujian belauan sinar-X
kimia batuan tersebut. Taburan Pb, Cr dan Cu
(XRD), batuan syal merah terdiri daripada
serta asosiasinya dengan unsur major dalam
kuarza, muskovit dan kaolinit. Oksida besi
tanih juga dikenalpasti bagi memahami sebaran
tertabur di antara butiran kuarza dan mineral
logam berat tersebut apabila batuan terluluhawa
filosilikat dalam matriks. Pada beberapa
menjadi tanih.
tempat, ia terhimpun lalu membentuk laminasi
2. Bahan dan Kaedah oksida besi. Batuan syal merah mempunyai
Kandungan unsur major dan kepekatan Pb, Cr kandungan Fe2O3, Al2O3 dan K2O yang lebih
dan Cu ditentukan daripada 40 sampel batuan tinggi berbanding dengan syal kelabu (Jadual
dan tanih syal Formasi Mahang menggunakan 2). Kandungan Fe2O3 dalam batuan syal merah
teknik pendarflour sinar-X model PW 1480 lebih tinggi kerana ia mengandungi oksida besi
mengikut kaedah Norrish & Hutton (1969). yang lebih banyak. Al2O3 merupakan salah
Kajian petrografi dilakukan terhadap 10 sampel satu komponen utama yang membentuk
Jumlah 100 100 100 100 100 100 100 100 100 100
* syal merah
Jadual 2 Keputusan ujian Mann-Whitney menunjukkan perbandingan di antara peratus unsur major serta
kepekatan Pb, Cr dan Cu dalam tanih syal di Ladang United Pillai berbanding dengan batuan induknya (N=40).
20
18
16
14
12 r= 0.721
Al2O3 (%)
10
4
syal merah
2
syal kelabu
0
0 20 40 60 80 100 120
Cr (ug/g)
Rajah 1a Korelasi di antara Cr dengan Al2O3 dalam batuan syal di Ladang United Pillai.
mineral lempung (Alloway 1995: Rose et al. sampel iaitu UP2, UP2D, UP15, UP16 dan
1979). Kandungan Al2O3 yang lebih tinggi UP16D, kepekatan Pb didapati meningkat yang
dalam batuan syal merah menunjukkan mana masing-masing berkepekatan 193 ug/g,
kandungan lempung yang tinggi dalam batuan 205 ug/g, 188 ug/g 353 ug/g dan 322 ug/g.
tersebut. Kandungan K2O yang tinggi pula Sampel-sampel tersebut didapati mengandungi
disebabkan oleh kehadiran mineral filosilikat peratusan MnO yang lebih tinggi berbanding
dalam batuan syal merah. dengan sampel-sampel lain.
Batuan syal kelabu terdiri daripada kuarza (65- Kepekatan Cr dalam batuan syal merah juga
70%) dan matriks (25%). Ujian belauan sinar- lebih tinggi berbanding dengan syal kelabu
X (XRD) menunjukkan hampir keseluruhan iaitu masing-masing sebanyak 92 µg/g dan 44
batuan syal kelabu terdiri daripada kuarza. µg/g. Nilai Cr menunjukkan hubungan positif
Batuan tersebut juga mengandungi SiO2 yang signifikan (P<0.05) dengan Al2O3 dan TiO2
tinggi berbanding dengan batuan syal merah. (Rajah 1a dan 1b). Hubungan ini menunjukkan
SiO2 merupakan unsur major yang menjadi kepekatan Cr dalam batuan syal meningkat
komponen utama kuarza (Alloway 1995; Rose seiring dengan peningkatan unsur-unsur major
et al. 1979). yang membentuk mineral filosilikat iaitu Al2O3
dan TiO2 (Tebbens et al. 2000). Kepekatan Cr
Taburan Pb, Cr dan Cu dalam batuan syal
dalam batuan syal merah lebih tinggi kerana
Formasi Mahang.
mengandungi mineral filosilikat yang lebih
Batuan syal merah mempunyai kepekatan Pb
banyak berbanding dengan syal kelabu. Nilai
yang lebih tinggi berbanding dengan batuan
Cr juga berkorelasi positif signifikan (P<0.05)
syal kelabu iaitu masing-masing sebanyak 59
dengan Fe2O3 (Rajah 1c). Ini menunjukkan
µg/g dan 29 µg/g. Kepekatan Pb dalam batuan
kepekatan Cr dalam batuan syal meningkat
syal tidak menunjukkan sebarang korelasi
seiring dengan peningkatan oksida besi.
dengan mana-mana unsur major. Hubungan
Sebaliknya, Cr berkorelasi negatif signifikan
tersebut menjelaskan bahawa taburan Pb dalam
dengan SiO2. Ini bermakna, kandungan Cr
batuan syal tidak dipengaruhi oleh mana-mana
dalam batuan syal merah meningkat apabila
mineral dalam batuan tersebut. Pada beberapa
kandungan kuarza berkurangan.
1.0
0.9
0.8
0.7
0.6
0.5
0.4 r= 0.632
0.3
0.2
syal merah
0.1
syal kelabu
0.0
0 20 40 60 80 100 120
C r ( ug/ g)
Rajah 1bKorelasi di antara Cr dengan TiO2 dalam batuan syal di Ladang United Pillai.
16
14
r= 0.628
12
10
Fe2O3 (%)
2 syal merah
syal kelabu
0
10 30 50 70 90 110 130
Cr (ug/g)
Rajah 1c Korelasi di antara Cr dengan Fe2O3 dalam batuan syal di Ladang United Pillai.
Berbanding dengan batuan syal kelabu, batuan Nilai Pb dalam batuan syal tidak menunjukkan
syal merah mengandungi kepekatan Cu yang sebarang hubungan dengan Cr dan Cu.
lebih tinggi. Kepekatan Cu dalam batuan syal Sebaliknya, Cr didapati berkorelasi positif
merah dan syal kelabu masing-masing signifikan dengan Cu. Hubungan tersebut
sebanyak 44 µg/g dan 39 µg/g. Nilai Cu menunjukkan taburan Pb dalam batuan syal
didapati berkorelasi positif signifikan (P<0.05) tidak dipengaruhi oleh faktor yang mengawal
dengan Fe2O3 dalam batuan syal. Ini taburan Cr dan Cu.
menunjukkan kepekatan Cu dalam batuan syal
meningkat seiring dengan peningkatan oksida
besi.
Jadual 3 Jadual korelasi antara unsur major dengan Pb, Cr dan Cu dalam batuan dan tanih syal di Ladang United
Pillai (N=40)
Tanih syal Formasi Mahang dengan SiO2, K2O, MgO dan TiO2. Ini
Tanih syal Formasi Mahang berwarna kuning menunjukkan taburan Cu dalam tanih syal tidak
kecoklatan hingga kemerahan. Hasil ujian dipengaruhi oleh komponen unsur major yang
XRD menunjukkan mineral dalam tanih syal membentuk mineral kuarza (SiO2) dan mineral
terdiri daripada kuarza, muskovit dan kaolinit. filosilikat (K2O, MgO dan TiO2).
Beberapa unsur major iaitu Al2O3, K2O, MgO
Kajian ini mendapati, kepekatan Pb, Cr dan Cu
dan TiO2 menunjukkan pengayaan manakala
dalam tanih syal berkorelasi positif signifikan
SiO2 pula mengalami penyusutan. Kandungan
di antara satu sama lain (Jadual 3). Ini
Fe2O3 pula didapati tidak berbeza secara
menunjukkan Pb, Cr dan Cu dalam tanih syal
signifikan berbanding dengan batuan induknya.
cenderung untuk tertabur bersama-sama.
Taburan Pb, Cr dan Cu dalam tanih syal
4. Perbincangan
Formasi Mahang
Dalam batuan syal Formasi Mahang, Pb, Cr
Tanih syal Formasi Mahang mempunyai
dan Cu didapati berasosiasi dengan komposisi
kepekatan Pb lebih rendah berbanding batuan
kimia yang berlainan dalam batuan tersebut.
induknya iaitu sebanyak 35 µg/g. Pb dalam
Kepekatan Pb tidak tertumpu secara khusus
tanih syal didapati berasosiasi dengan mineral
dalam mana-mana mineral seperti kuarza,
lempung dan oksida Fe dan Al berdasarkan
mineral filosilikat ataupun oksida besi.
korelasinya yang positif signifikan (P<0.05)
Sebaliknya ia tertabur secara rawak di dalam
dengan Al2O3 dan Fe2O3. Dalam tanih syal,
batuan syal. Ia cenderung untuk terhimpun
kepekatan Cr menunjukkan peningkatan iaitu
dalam beberapa sampel batuan syal merah yang
sebanyak 108 µg/g. Nilai Cr juga berkorelasi
mengandungi pemendakan amorf manganese
positif signifikan (P<0.05) dengan Al2O3,
oksida yang tinggi. Asosiasi di antara Pb
Fe2O3, TiO2 dan MgO. Hubungan tersebut
dengan bintil manganese oksida berlaku secara
menunjukkan terdapat asosiasi di antara Cr
tabii iaitu sewaktu pengendapan sedimen di
dengan komponen unsur major yang
laut dalam (Chester & Hughes 1967; Salomons
membentuk mineral filosilikat (Al2O3, TiO2,
& Förstner 1984). Menurut Salomons &
MgO), mineral lempung (Al2O3) dan oksida
Förstner (1984), pengelompokan Pb bersama-
besi (Fe2O3).
sama bintil manganese boleh berlaku secara
Kepekatan Cu dalam tanih syal tidak penjerapan ion logam daripada air laut
menunjukkan perbezaan yang signifikan (hidrogenus), pergerakan semula ion logam
dengan batuan induknya iaitu sebanyak 39 daripada turus sedimen (diagenetik),
µg/g. Nilai Cu menunjukkan hubungan positif pengangkutan ion logam daripada sedimen atau
signifikan dengan Al2O3 dan Fe2O3. batuan dasar akibat pemanasan oleh aktiviti
Sebaliknya, Cu berkorelasi negatif signifikan gunung berapi (hidroterma) dan luluhlarut
bahan piroklas oleh air laut (halmirolitik). berbanding dengan batuan syal kelabu.
Kepekatan Pb dalam tanih syal didapati Kepekatan Cu dan Fe2O3 dalam tanih syal tidak
menyusut kerana ia telah terbebas ke alam berbeza secara signifikan berbanding dengan
sekitar apabila batuan syal dan pemendakan batuan induknya. Secara umum, batuan syal
manganese oksida mengalami luluhawa dan Formasi Mahang mengandungi jumlah ferik
terurai. Ini ditunjukkan oleh peratusan MnO oksida yang tinggi. Luluhawa kimia di
yang kecil (<0.1%) dalam tanih syal. Pb kawasan kajian tidak banyak mengubah jumlah
kemudiannya berasosiasi dengan oksida Fe dan oksida besi dalam batuan kerana ia tahan
Al dan mineral lempung berdasarkan terhadap luluhawa. Dalam tanih syal, Cu
korelasinya yang baik dengan Fe2O3 dan Al2O3. berasosiasi dengan laterit iaitu bintil-bintil ferik
oksida yang tertabur di dalam tanih. Kajian
Dalam batuan syal, Cr didapati tertabur dalam
oleh Xie & Dunlop (1998) dan Cairns et al.
kekisi mineral filosilikat. Ini ditunjukkan oleh
(2001) menunjukkan Cu cenderung untuk
korelasi positif signifikan di antara Cr dengan
berasosiasi dengan bahan berbesi (ferrugenous
unsur-unsur major pembentuk mineral
material) seperti goetit, hematit dan maghemit.
filosilikat iaitu Al2O3, TiO2, K2O dan MgO
Cu yang berasosiasi dengan ferik oksida dalam
(Tebbens et al. 2000). Mineral filosilikat
batuan syal tidak terbebas setelah batuan
tertabur di bahagian matriks, iaitu di antara
terluluhawa. Sebaliknya ia berkumpul dan
butiran kuarza dan oksida besi. Cr juga
mengalami pemekatan dalam bintil-bintil ferik
didapati tertabur bersama-sama dengan oksida
oksida yang membentuk laterit di kawasan
besi berdasarkan korelasinya yang baik dengan
kajian. Sebahagian daripada Cu juga didapati
Fe2O3. Kepekatan Cr lebih tinggi dalam batuan
berasosiasi dengan mineral lempung.
syal merah kerana ia mengandungi peratusan
Fe2O3 yang banyak berbanding dengan syal 5. Kesimpulan
kelabu. Cr cenderung untuk termendak Taburan Pb dan Cu dalam batuan syal Formasi
bersama-sama dengan ferik oksida sewaktu Mahang di kawal oleh proses pembentukannya
pengendapan sedimen di sekitaran laut dalam iaitu sewaktu pengendapan sedimen di
(Chester & Hughes 1967). Apabila batuan persekitaran laut dalam. Pb cenderung untuk
terluluhawa, Cr mengalami pengayaan. Ia berasosiasi dengan manganese oksida manakala
didapati berasosiasi dengan mineral filosilikat, Cu pula dengan ferik oksida. Ini bermakna,
mineral lempung dan oksida besi. Keputusan batuan yang mempunyai peratusan MnO dan
XRD menunjukkan tanih syal terdiri daripada Fe2O3 yang banyak seperti syal merah
kuarza, muskovit dan kaolinit. Kajian oleh mengandungi kepekatan Pb dan Cu yang lebih
Islam et al. (2002) mendapati muskovit dan tinggi berbanding dengan syal kelabu. Dalam
mineral lempung (kebanyakannya ilit) bertukar batuan syal, Cr lebih tertumpu dalam kekisi
menjadi kaolinit apabila batuan sedimen mineral filosilikat dan oksida besi. Setelah
mengalami luluhawa di kawasan beriklim batuan terluluhawa, Pb yang terbebas daripada
subtropika dan tropika. Luluhawa batuan batuan telah berasosiasi dengan oksida Al dan
sedimen dalam Formasi Semantan pula Fe serta mineral lempung. Cr pula berasosiasi
menunjukkan perubahan klorit, ilit dan dengan mineral filosilikat, mineral lempung
muskovit menjadi kaolinit (Kamal Roslan et al. dan oksida Fe dan Al. Cu mengalami
1990). Pertukaran muskovit menjadi kaolinit pemekatan dalam bintil-bintil laterit yang
tidak dapat dipastikan dengan jelas dalam banyak tertabur dalam tanih syal di kawasan
kajian ini kerana kandungan kedua-dua mineral kajian.
tersebut dalam tanih dan batuan syal hampir
6. Penghargaan
sama banyak. Keadaan ini mungkin
Penghargaan diberikan kepada Prof. Madya Dr.
disebabkan oleh sifat muskovit yang lebih
Anizan Isahak atas sumber kewangan (geran
tahan terhadap luluhawa berbanding dengan ilit
penyelidikan Universiti Kebangsaan Malaysia
dan klorit (Islam et al. 2002).
2/99) ketika menjalankan kerjalapangan.
Dalam batuan syal, Cu hadir bersama-sama
7. Rujukan
dengan mendakan ferik oksida. Ini ditunjukkan Alloway, B. J. 1995. Heavy metals in soils. Ed. ke-
oleh korelasi yang baik di antara Cu dan Fe2O3. 2. London: Chapman & Hall.
Kandungan Cu juga lebih tinggi dalam batuan
syal merah yang mengandungi peratusan Fe2O3
Cairns, C. J., McQueen, K. J. & Leah, P. A. 2001. Jones, C. R. 1973. lower Paleozoik. Dlm. Gobbett,
Mineralogical controls on element dispersion in D. J. & Hutchison, C. S. (pynt.). Geology of the
regolith over two mineralized shear zones near the Malay Peninsula, hlm. 25-60. New York: Wiley-
Peak, Cobar, New South Wales. Journal of Interscience.
Geochemical Exploration. 72: 1-21.
Kamal Roslan, M., Che Aziz, A., Uyop, S., Kadderi,
Chester, R. & Hughes, M. J. 1967. A chemical M. D. & Ibrahim, K. 1990. Formaasi Semantan:
technique for the separation of ferro-manganese aspek geologi kejuruteraan. Proc. Sains Bumi dan
minerals, carbonate minerals and adsorbed trace Masyarakat, hlm. 63-80.
elements from pelagic sediments. Chemical
Norrish, K. & Hutton, J. T. 1969. An accurate X-
Geology. 2: 249-262.
ray spectrographic method for the analysis of a wide
Habibah, J. & Wan Fuad, W. H. 2002. Komposisi range of geological samples. Geochim. Cosmochim.
unsur surih dan major di sepanjang profil luluhawa Acta 33: 431-453.
Formasi Mahang di Sungai Merbok, Kedah. Pro.
Perkhidmatan Kajicuaca Malaysia. 1996. Ringkasan
Annual Geological Conference 2002, hlm. 59-63.
tahunan pemerhatian kajicuaca 1996.
Islam, M. R., Lahermo, P., Salminen, R., Rojstaczer,
Rose, A. W. Hawkes, H. E. & Webb, J. S. 1979.
S. & Peuraniemi, V. 2000. Lake and reservoir water
Geochemistry in mineral exploration. (Ed. ke-2).
quality affected by metals leaching from tropical
London: Academic Press.
soils, Bangladesh. Environmental Geology. 39(10):
1083-1089. Salomons, W. & Förstner, U. 1984. Metals in
hydrocycle. Berlin: Apringer-Verlag.
Abstrak
Suatu flavanon telah diisolasi dari kulit batang Cryptocarya costata. Isolat diperoleh dari
fraksi kloroform, setelah fraksinasi dengan teknik kromatografi yang dilanjutkan dengan
rekristalisasi dalam heksan dan etilasetat, dihasilkan kristal jarum berwarna kuning dengan
titik leleh 153-155oC, dengan putaran optik - 4. Elusidasi struktur isolat berdasarkan
spektrum ultra violet, inframerah, massa dan resonansi magnit inti, maka dapat ditetapkan
bahwa senyawa isolat adalah 7-hidroksi-5,6,8-trimetoksi flavanon.
Kata kunci : flavanon, Cryptocarya costata
5’
6’
OCH3 4’
1 H
8 1’
HO O 3’
7 2 2’
Heq
6 3
H3CO 5 Hax
4
OCH3 O
Bishara, R.H., Schiff, P.L. 1970. The isolation of Juliawaty, L.D., Kitajima, M., Tokayama, H.,
Some Sterols and Protocatheuic acid from Ahmad, S.A., Aimi Norio. 2000. 6-Subtituted-5,6-
Cryptocarya faveolata . Lyodia, 33 (4), 477-481. dihydro-2-pyrone rom Cryptocarya
Strictifolia. Phytochemistry. 54, 989 – 993.
Bisset, N.G. 1955. A Phytochemical Survey of
Some Plants from the South Moluccas, Treub Juliawaty, L.D., Kitajima, M., Tokayama, H.,
Laboratory, Kebun Raya Bogort, 125. Achmad, S.A., Aimi Norio. 2000. A New Type of
Stilbene-Related Secondary Metabolite
Collins, D.J., Culvenor, C.C.J., Lamberton, J.A.,
Indenburgene from Cryptocarya Indenburgenensis.
Loder, J.W., Price, J.R. 1990. Plants for Medicine.
Chem. Pharm. Bull. 48, 11, 1726-1728.
CSIRO, Melborne, Australia.
Juliawaty, L.D., Achmad, S.A., Makmur, L., akim,
Dumontet, V., Hung, N.V., Adeline, M.T., Riche,
E.H. 1993. Investigation of the Chemical
C., Chiaroni, A., Seven, T. and Gueritte, F. 2004.
Constituent of Cryptocarya Laevigata Bl and
Cytotoxic Flavonoids and α-pyrones from
Cryptocarya Nutans and its Relation to the
Cryptocarya obovata J. Nat. Prod. 67, 858 - 862
Taxonomy of Lauracea.Biotrop Spec.Publ.No.23, 1-
Fu, X., Sevenet, T., Remy, F., Pais, M., Hadi, A.H., 9
Zeng, L.M. 1993. Flavanone and Chalcone
Juliawaty, L.D., Kitajima, M., Takayama, H.,
derivatives from Cryptocarya kurzii. J. Nat. Prod.
Achmad, S.A., Aimi, N. 2000. A new type of
56 (7), 1153 - 1163.
stilbene related secondary metabolite,
Gellert, E.1959.The Constituents of Cryptocarya idenburgene, from Cryptocarya idenburgensis.
pleurosperma. Aust.J.Chem.22, 90 – 96. Chemical & Pharmaceutical Bulletin 48(11),
1726-1728.
Gottlieb,O.R.1972.Chemosystematik of the
Lauraceae. Phytochemistry, 11, 1537 – 1570. Kostermans, A.J.G.H. 1957. Lauraceae. Comm.
Forest Res. Inst. Indonesia, 57, 1-64.
Gottlieb, O.R. 1985. Micromolecular Evolution,
Systematics an Ecology. Berlin Heidelberg. New Lee, S.S., Chen, C.H., Liu, Y.C. 1990.
York. Neocaryachine, a new pavine alkaloid from
Cryptocarya chinensis, and NMR spectral
Hakim, E.H., Achmad, S.A., Buchari dan
properties of related alkaloids. Journal of
Pramutadi, S. 1994. Ilmu Kimia Tumbuhan Natural Products. 53(5), 1267-71.
Lauraceae Indonesia X ; Alkaloid
Benzeilisokuinolin dari Litsea Cassiaefolia. Lee, S.S., Chen, C.H., Liu, Y.C., 1993.
Proceedings ITB. Bandung Vol.27, No.3. Additional alkaloids from Cryptocarya chinensis
Pharm. Journal of Natural Products, 56 (2),
Hakim, E.H., Achmad, S.A., Buchari dan 227-32.
Pramutadi, S. 1994. Ilmu Kimia Tumbuhan
Lauraceae Indonesia, XI; Alkaloid Aporfin dan Lin, F.W., Wang, J.J., Wu, T.S. 2002. New pavine
Oksoaporfin dari Litsea Excelsa. Proceedings ITB. N-oxide alkaloids from the stem bark of
Bandung Vol.27, No.3. Cryptocarya chinensis Chemical & Pharmaceutical
Bulletin 50 (2), 157-159.
Hakim, E.H., Achmad, S.A. 1991. Isolation of
Actinodaphnine from Litsea Diversifolia.ACGC Lin, L.F., Wu, T,S., Wu,T.S. 2001. Alkaloids
Chem. Res. Comm. 1.(1). from the leaves of Cryptocarya chinensis
Hemsl. Chemical & Pharmaceutical Bulletin 49
Hakim, E.H., Achmad, S.A., Effendy, (10), 1292-1294.
Ghisalberti, E.L., White, A.H. 1993. Structural
Studies of Three Sesquiterpenes from Litsea sp. Michael, L., Anissa, R., Andre, C., Henri, M. 1989.
Aust. J.Chem, 46. 1355-1362. Velucryptine, a new isoquinoline alkaloid from
Cryptocarya velutinosa. Journal of Natural
Heyne, K. 1987. Tumbuhan Berguna Indonesia. Products 52 (3), 516-521.
Yayasan Sarana Wanajaya, Jakarta.
Michael, L., Andre, C., Anissa, R.,Henri, M 1989,
John, R.J. 1987. The Flowering Plants of
Cryptowolinol and cryptowolidine, new
Papua, Dicotyledone Part 1. Forestry
dibenzopyrrocoline type alkaloids.Canadian
Departement, Papua New Guinea, hal 87 Journal of Chemistry . 67(5), 947-952.
Joseph, H., Dori, J. L., Sterling, J.T., Jack R.C. Saad, J.M., Soepadamo, E., Fang, X.P., Mc.
1978. Cryptopleurine, cytotoxic agent from
Laugghlin, J.L. 1991. (-) Grandisin from
Boehmeria caudata (Urticaceae) and Cryptocarya
Cryptocarya crassinervia. J.Nat. Prod., 54 (6),
laevigata (Lauraceae). Phytochemistry, 17(8), 1681-1683.
1448.
Wu, T.S., Lin, F.W. 2001. Alkaloids of the Natural Products 64 (11), 1404-1407.
wood of Cryptocarya chinensis. Journal of
Hapipah Mohd Ali1, Siti Nadiah Abdul Halim1, Nurul Fadhilah K. Aripin1,Wan Jefri
Basirun1, Sharifudin M. Zain1, Endom Ismail2, Nordin Hj Lajis3, Bohari M. Yamin2 and Seik
Weng Ng1
1
Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur, Malaysia,
2
School of Chemical Sciences and Food Technology, Universiti Kebangsaan Malaysia, Bangi,Malaysia.
3
Laboratory of Natural Products, Institute of BioScience, University Putra Malaysia, 43400, Serdang,
Selangor.
hapipahali@yahoo.com, Fax: 603-79674193.
Abstract
The new zinc(II), nickel(II), cadmium(II) and copper complexes have been prepared in
ethanol by template condensation of 4-nitrobenzhydrazide, 5-chloro-2-hydroxyacetophenone
with metal acetate in the presence of triethylamine. The x-ray crystallographic study of Ni(II)
complex of 5-chloro-2-hydroxyacetophenone 4-nitrobenzoylhydrazone is monomeric while
Cd(II) and Cu(II) are dinuclear complexes with a center of invasion. Both (Ni(II) and Cd(II)
complexes display distorted octahedral geometry around the central metal atoms with solvent
of recrystalization, pyridine molecules occupying both axial and equatorial positions. The
Cu(II) complex adopts square planar geometry. Each metal atom is chelated to ONO atoms
of the Schiff base ligand in a tridentate manner. The phenolic hydroxyl O-atom functions as a
bridging site to furnish the dinuclear Cd(II) complex. The dimeric hydrazonate is not
commonly encountered and represents the early examples of the dinuclear spesies. The Schiff
base ligands are essentially planar and the structural dimensions are in normal range. The
IR, and UV spectra of ligand and complexe were also obtained.. The cyclic voltammetry of
the nickel complexes exhibited irreversible oxidation process. The Schiff base ligand, LNO2Cl
was more sensitive towards the MCF-7 cells (human breast cancer cells) with IC50 values of
4.5 µg ml-1 than the unsubstituted ligand, HapBh. The nitro and chloro-substituents might
have contributed to a mark increase in the cytotoxicity of the ligand. However on
coordination to nickel, the activity has reduced the activity to the same level as the positive
control drug, tamoxifen. The antioxidant properties of the Schiff base ligand (using the FTC
method) exhibited higher activity than vitamin E or Quercetine. However the activity is lower
than the unsubstituted Schiff base ligand or the commercial antioxidant agent, BHT (butylated
hydroxytoluene).
Keywords: Schiff bases, metal complexes, x-ray structure, antioxidant activity and
cytotoxicity.
imine-N and amide-O. The Zn(II) and Cd(II) and growth, the medium was removed and
complexes of hydrazone are rare and only a replaced with fresh medium containing varying
few examples were reported. With the aim in concentrations of organic compounds. The
participating further in this research field, we compounds added were first dissolved in
have synthesized the substituted DMSO at the required concentration.
benzoylhydrazide-hydroxyaceyophenone Subsequent 6 desirable concentrations was
ligands and determine their coordination to prepared using growth medium. Control wells
metal atoms to nickel and cadmium. The effect received only DMSO. Each concentration of
of substituentes on the cototoxicity and the compound under study was assayed in six
antioxidant activity of the ligands and the replicates. The assay was terminated after 24
complexes are investigated. hours incubation period. Again, the medium
was removed and the cell viability was
2. Experimental section
determined after further 4 hours incubation
All reagents were commercially available from
with 5 mg cm-3 MTT [3-(4,5-dimethylthiazol-
Fluka or Aldrich and were used without further
2-yl)-2,5-diphenyl tetrazolium] bromide; also
purification.
named as thiazol blue). DMSO was then added
2.1 Ligand per well and the dissolving formazan
The Schiff base ligand was prepared by precipitate was read by using elisa plate reader,
condensation of ethanolic solution of 4-nitro- Dynatech MR5000 at 570 nm. For comparison
benzhydrazide with equimolar amounts of studies, tamoxifen.was used as a positive
either 5-chloro-2-hydroxyacetophenone. The control.
structure of the ligand is depicted in Fig.1.
IC50 value is taken from the plotted graph of
The complexes were synthesized by stirring percentage live cells compared to control (%)
versus tested concentration of compounds (µg
cm-3). The IC50 value is the concentration
Cl
required for 50% growth inhibition. It
represents the growth inhibitory (cytostatic)
O
effects on cell viability of the compounds tested
N [8].
N
2.2.2 Antioxidant assay
O 2N
H 3C OH
Ferric thiocyanate (FTC) method
The antioxidant properties were assessed at
Fig.1: 5-chloro-2-hydroxyacetophenone 4- Laboratory of Natural Products, Institute of
nitrobenzoylhydrazone Bioscience, University Putra Malaysia,
Serdang, Selangor. This assay was carried out
and refluxing of the Schiff base ligand with as described in the modified method of
metal acetate in ethanol in the presence of Kikuzaki and Nakatani [9]. A mixture of 2 mg
triethylamine for 5 hours. The dark red solid of the test sample in 4 ml of 99.5% ethanol, 4.1
was filtered and recrystallized from pyridine. ml of 2.51% linoleic acid in 99.5% ethanol, 8.0
ml of 0.02 M phosphate buffer (pH 7.0) and 3.9
2.2. Bioactivity ml of distilled water contained in screw-cap
Cytotoxicity activity was evaluated at
vial (∅ 38 x 75 mm) was placed in an oven at
Universiti Kebangsaan Malaysia, Bangi,
40°C in the dark. To measure the extent of
Selangor.
antioxidant activity, 0.1 ml of the reaction
2.2.1. Culture of cells and cytotoxic assay mixture was transferred to a test tube (∅ = 13 ,
Cytotoxicity Assay h = 150 mm) and followed by addition of 9.7
The technique used was described by Freshney ml of 75% (v/v) aqueous ethanol, 0.1 ml of
[7] with some modification. 30% aqueous ammonium thiocyanate and 0.1
MCF-7 (human breast cancer cells) were ml of 0.02 M ferrous chloride in 3.5%
seeded into 96 well plates at an initial cell hydrochloric acid. Three min after the addition
density of approximately 5 X 105 cells cm-3. of ferrous chloride to the reaction mixture, the
After 24 hours incubation for cell attachment absorbance of red colour (conversion to Fe3+)
was measured at 500 nm. The measurement 430 cm-1 are tentatively assigned to ν(M-O)
was taken every 24 h interval one day after and ν(M-N ) bands respectively.
absorbance of the control reached its maximum
3.2. UV-vis of ligands and complexes
value.
UV spectra of all studied compounds are taken
3. Results and Discussions and assigned in DMSO. To help with the
The Ni(II) and Cd(II) complexes are red-brown assignments, UV spectra of all the studied
in colour, non-hygroscopic and stable in air. compounds are calculated by employing PM3
They are insolouble or sparingly soluble in level configuration interaction calculation
common organic solvents and quite soluble in (single excitation). Assignments are given in
DMSO and pyridine. All the complexes melt table 3.
over 250 oC.
Most ligand absorption are seen to be shifted to
3.1. IR Spectra the red upon complexation. The LNO2Cl ligand
The IR spectra of the complexes when absorption at 340nm is an n – π* transition
compared to that of free ligands show that the based on the lone pairs of the carbonyl oxygen
ν(N-H) of the free ligand disappears in the and the bridging nitrogen atoms with a small
spectra of the complexes supporting character of a π – π* transition.
deprotonation of the ligand upon complex
This absorption is red shifted upon
formation. The ν(C=O) bands of the free ligand
complexation to 452nm. The second transition
also disappears in the spectra of the complexes
for the Cd(II) complex is a π – π* absorption
indicating destruction of the keto group
involving only the –NO2 substituted phenyl
presumably via enolisation of the ligands and
ring.
facilitates the formation of metal complexes.
The ligands also showed strong band at 1602 The Ni(II) complex exhibits two π – π*
cm-1 which are assigned as the ν(C=N) bands. transition. The first absorption (439nm)
In the metal complexes, this stretching band involves only the π orbitals of the phenyl ring
has shifted to lower frequencies, due to the with –NO2 substituent. The second absorption
lowering of the ν(C=N) bond order as a result is a more generalized π – π* transition
of metal-nitrogen bond formation. The shifting involving the pyridine ligands.
of the ν(N-N) to higher wavenumbers further The differences are observed in the visible
support coordination of the ligand via the spectra of the complexes compared to that of
azomethine nitrogen atom. The ν(C-OH) bands the corresponding ligand. The π→ π* transition
of the phenol in the Cd(II) complex has due to the C=N chromophores has undergone
disappeared indicating coordination of OH to bathchromic shift upon coordination ca. 400
the metal center. The new bands at ca. 590 and nm. The π→ π* transition of the aromatic ring
Fig.2a: [Ni(LNO2Cl)(py)3].py
HapBh 10.0
LNO2Cl 4.5
[Zn(LNO2Cl)] Not available
[Ni(LNO2Cl)(py)3] 18.2
[Cd(LNO2Cl)(py)2] 2 Not available
[Cu(LNO2Cl)(DMSO)] 2 Not available
Tamoxifen 18.2
(+ve control)
Abstrak
Davidiol A, suatu trimer resveratrol telah diisolasi untuk pertama kalinya dari ekstrak aseton
kulit batang tumbuhan Shorea rugosa. Struktur molekul dan konfigurasi relatif senyawa
tersebut telah ditetapkan berdasarkan data spektroskopi UV, IR, 1H NMR, 13
C NMR dan
perbandingan dengan data sejenis yang telah dilaporkan.
Kata Kunci : Dipterocarpaceae, trimer resveratrol, davidiol A, Shorea rugosa.
Tumbuhan tersebut diidentifikasi oleh staf Davidiol A (1) diperoleh berupa serbuk coklat
Herbarium Bogoriense, Bogor. memperlihatkan serapan maksimum pada λmaks
229, dan 284 nm, yang mengalami pergeseran
Ekstraksi dan Isolasi. Serbuk kering kulit
batokromik pada penambahan pereaksi geser
batang S. rugosa 4 kg diekstraksi dengan
NaOH. Sementara itu spektrum IR senyawa ini
aseton. Ekstrak aseton selanjutnya dipekatkan
menunjukkan adanya gugus hidroksil (νmaks
pada tekanan rendah dan diperoleh gum
3340 cm-1), aromatik (1613, 1511, dan 1455
berwarna coklat gelap (198 g). Ekstrak aseton
cm-1) dan 1,4-disubstitusibenzena (831 cm-1)
tersebut, selanjutnya dilarutkan kembali dalam
yang merupakan ciri khas oligomer resveratrol
campuran MeOH-dietileter sehingga
yang telah memodifikasi kerangka oligomer
menghasilkan fraksi terlarut MeOH-dietileter,
resveratrol. Spektrum 1H NMR (Tabel 1)
yang juga berupa gum berwarna coklat gelap
memperlihatkan sejumlah sinyal aromatik
(178 g). Fraksi MeOH-dietileter yang beratnya
yang sesuai dengan adanya tiga unit p-
81 gram kemudian difraksinasi dengan
hidroksifenil (δH 7,17 ; 6,97; 6,76; 6,57; 6,71
kromatografi vakum cair (KVC), (adsorben Si-
dan 6,58 ppm), satu unit 3,5-dihidroksifenil (δH
gel, eluen campuran heksan-etilasetat (6:4-
6,42 dan 6,15), satu pasang proton kopling-
etilasetat 100%, MeOH 100%)) menghasilkan
meta dari unit 1,2,3,5-tetrasubstitusibenzen (δH
5 fraksi utama C1-C5 (masing-masing 15,3;
7,16 dan 6,07), dan satu proton aromatik untuk
15,4; 15,2; 2,0 dan 3,7 g). Pemisahan fraksi C
unit pentasubstitusibenzen (δH 6,01). Selain itu,
dengan kromatografi radial (Si-gel,
spektrum 1H NMR juga menunjukkan adanya
kloroform:metanol = 9:1) menghasilkan
enam sinyal proton alifatik, dua diantaranya
davidiol A (25 mg).
khas untuk 2,3-disubstitusi-2,3-
Davidiol A, diperoleh berupa padatan dihidrobenzofuran (δH 6,07 dan 4,40).
berwarna coklat dengan t.l. 209-211 oC dan Unit-unit struktur tersebut mempunyai derajat
[α]D20 -238 o (c 0,1 MeOH). Spektrum UV kesesuaian yang tinggi dengan struktur davidiol
(MeOH) λmaks (log ε) 229 (5,08), dan 284 nm A.
(4,42). Spektrum IR (KBr) ν maks 3340 cm-1
Spektrum 13C NMR (APT) mendukung struktur
(gugus -OH), 1613, 1513, dan 1455 cm-1 (C=C
davidiol A dari senyawa hasil isolasi, yang
aromatik), dan 831 cm-1 (p-disubstitusifenil).
memperlihatkan 34 sinyal untuk 42 karbon.
Spektrum 1H NMR senyawa hasil isolasi
Sinyal-sinyal tersebut terdistribusi kedalam 9
menunjukkan adanya enam proton -OH fenolik
karbon oksiaril, 8 karbon kuarterner aromatik,
(δH 7,17; 6,97 (2H); 6,76; 6,57 (2H); dan 6,71;
18 karbon metin aromatik, dan 6 karbon metin
6,58 (2H)). Spektrum 13C NMR senyawa hasil
alifatik, termasuk dua karbon dari cincin
isolasi menunjukkan adanya 18 C kuarterner (
dihidrobenzofuran. Konformasi lebih lanjut
δC 127, 98 - 158, 90 ); 9 C-O oksiaril (δC 154, terhadap struktur davidiol A diperoleh dari
84 - 159, 25 ); C - H alifatik (δC 36,46 - 85, hasil pembanding parameter NMR dengan yang
77 ) (Tabel 1). dilaporkan untuk senyawa ini sebagaimana
3. Hasil dan Pembahasan dinyatakan pada tabel 1. Dengan demikian
Struktur dapat disimpulkan bahwa senyawa hasil isolasi
HO adalah davidiol A, yang diisolasi dari S. rugosa
A1 H untuk pertama kalinya.
O OH
7 B2 Pembahasan lebih lanjut bahwa senyawa
H H
HO 8
7 C1 OH
davidiol A telah ditemukan pada tumbuhan
A2 8 8 H famili Leguminosae yaitu pada spesies Sophora
7 davidi (Tanaka, 2000). Selain itu juga
H
OH H C2 OH ditemukan pada tumbuhan famili
B1 Dipterocarpaceae terutama genus Shorea; yaitu
HO S. hemsleyana (Ito, 2000), S. guiso (Muharini,
OH 2002) dan S. parvifolia (Kholifatu Rosyidah,
(1) 2005). Khusus genus Shorea, senyawa davidiol
A pada S. rugosa adalah penemuan yang ke
empat pada tumbuhan famili Dipterocarpaceae.
5. Ucapan Terima kasih. Kami mengucapkan Kitanaka, S., Ikezawa, T., Yasukawa, K.,
terima kasih kepada Depdiknas Dikti yang Yamanouchi, S., Takido, M., Sung, H –K., dan Kim,
telah memberikan beasiswa BPPs, Pimpinan L-H., 1990, (+)-α-Viniferin, an antiinflammatory
compound from Caragana chamlaga Root, Chem.
dan staf Universitas Muhammadiyah Surakarta,
Pharm. Bull, 38(2), 432-435.
serta staf Herbarium Bogoriense, Bogor, yang
telah mengidentifikasi tumbuhan untuk Kholifatu Rosyidah, Syah,Y.M; Achmad, S.A;
digunakan dalam penelitian ini. Hakim, E.H; Makmur, L; Juliawaty,L.D, 2005, (+)-
(α)-Viniferin dan davidiol A, suatu trimer stilbenoid
6. Daftar Pustaka dari kulit batang Shorea parvifolia Dyer, Seminar
Ashton, P. S., 1983, Flora Malesiana, Series 1. Nasional Obat Tradisional Senyawa Alam, Unika
Spermatophyta Vol.9, Martinus Nijhoff, London, Widya Mandala, Surabaya.
436 – 552.
Muharini, R.; Hakim, E.H.; Achmad, S.A.; Aimi,
Bokel, M., Diyasena, M.N.C., Gunatilaka, A.A.L., N.; Makmur, L.; Syah, Y.M.; Juliawaty, L.D.;
Kraus, W., Sotheeswaran, S., 1988, Caliculatol, an Kitajima, M.; Takayama, H., 2002, Davidiol A, a
antifungal resveratrol trimer from Stemonoporus stilbenoid derivative from tree bark of Shorea guiso
canaliculatus, Phytochemistry, 27, 377 - 380. Blume, Bull. Soc.Nat. Prod. (Indonesia), 2, 37-40.
Dai, J.R., Hallock, Y.F., Cardellina, J.H.H., and Sotheeswaran, S., and Pasupathy, V., 1993,
Boyd, M.R., 1988, HIV-Inhibitory and cytotoxicity Distribution of resveratrol oligomer in plants,
oligostilbenes from leaves of Hopea malibato, Phytochemistry, 32, 1083 – 1092.
J.Nat.Prod., 61,351-353.
Tanaka, T., Ito, T., Nakaya, K., Iinuma, M., Riswan,
Hirano, Y., Kondo, R., Sakai, K., 2001, Compounds S., 2000, Stilbene in roots of Shopora davidii,
inhibitory to rat liver 5α- reductase from tropical Phytochemistry, 53, 1009 – 1014.
commercial wood species: resveratrol trimers from
melapi (Shorea.sp) heartwood, Japan Wood
Science, 47, 308 – 312.
δH ( multiplisitas, J dalam Hz ) δC
No. C 1 1* 1 1*
1a - - 134, 9 134, 4
2a,6a 7, 17 ( d, 8, 4 ) 7, 21 ( d, 8, 8 ) 128, 0 128, 1
3a,5a 6, 76 ( d, 8, 8 ) 6, 78 ( d, 8, 8 ) 116, 0 116, 6
4a - - 155, 8 155, 8
7a 6, 07 ( d, 3,3 ) 6, 08 ( d, 2, 9 ) 85, 8 85, 8
8a 4, 40 (d, 9, 9 ) 4, 40 ( m ) 50, 3 50, 4
9a - - 146, 9 147, 1
10a - - 117, 8 118, 1
11a - - 158,0 157, 8
12a 6, 38 ( d, 2, 2 ) 6, 44 ( brs ) 101, 3 101, 3
13a - - 156,9 156, 8
14a 6, 53 ( d, 2,2 ) 6, 55 ( brs ) 103,7 104, 0
16 - - 137, 3 137, 5
2b,6b 6, 97 ( d, 8, 4 ) 7, 04 ( d, 8, 8 ) 129, 5 129, 6
3b,5b 6, 57 ( d, 8, 8 ) 6, 60 ( d, 8, 8 ) 115, 3 115, 4
4b - - 158, 2 158, 1
7b 5, 24 ( brs ) 5, 27 ( brs ) 36, 5 36, 5
8b 4, 14 ( d, 11, 7 ) 4, 23 ( d, 11, 7 ) 51, 9 51, 4
9b - - 143, 1 143, 1
10b - - 118,9 119, 2
11b - - 159, 2 159, 4
12b 6, 01 ( s ) 6, 02 ( s ) 95, 8 96, 0
13b - - 154, 8 154, 7
14b - - 122, 2 122, 2
1c - - 134, 2 134, 1
2c,6c 6, 71 ( d, 8, 8 ) 6, 76 ( d, 8, 3 ) 129, 7 129, 9
3c,5c 6, 58 (d, 8, 8 ) 6, 61 ( d, 8, 3 ) 115, 4 115, 6
4c - - 156, 5 156, 6
7c 4, 36 ( d, 8,0 ) 4, 38 (d, 9, 8 ) 55, 9 56, 2
8c 2, 92 ( dd, 11, 7, 8, 0 ) 2, 97 (dd, 11, 7, 9, 8 ) 67, 4 67, 5
9c - - 143, 9 143, 9
10c 6, 42 ( d, 2, 2 ) 6, 42 (d, 2, 9 ) 108, 2 108, 3
11c - - 158, 9 158, 9
12c 6, 16 ( t, 1, 8 ) 6, 19 ( t, 2, 9 ) 101, 9 102, 0
13c - - 158, 9 158, 9
14c 6, 42 ( d, 2, 2 ) 6, 42 ( d, 2, 9 ) 108, 2 108, 3
* Tanaka, T., dkk., 2000
1 = hasil isolasi ; 1* = davidiol A standar
Abstract
Studies on some Curcuma plants of Malaysia and Sumatera have led us to the isolation of
several interesting compounds chemically and biologically. Among them are several classes
of sesquiterpenoids and diarylheptanoids. The orange rhizome Curcuma contain orange
pigments, curcumin and its derivatives as the major constituents. Most of the rhizomes of
Curcuma species investigated contain high yield of essential oils. They are mainly consist of
sesquiterpenoids with the exception of C. mangga, a mango flavoured Curcuma contains high
amounts of monoterpenoid, myrcene. Some of the rhizomes oil and isolated compounds have
been found to be cytotoxic against brine shrimps, antioxidant, and antimicrobes. The
chemistry of the major sesquiterpenoid constituent of C. xanthorrhiza has been transformed to
several interesting bisabolane-type sesquiterpenoids.
Key word index: Curcuma, Zingiberaceae, sesquiterpenes, diarylheptanoids
th
Departement of ChemistryProceeding of The
ITB, Jl. Ganesha ITB-UKM
10,6Bandung 40132,Joint
PhoneSeminar
: +62 (22)on Chemistry
2502103 ext 101, 361
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Hasnah M. Sirat, Shajarahtunnur Jamil, Lee Lay Meng and Ngai Mun Hong
sesquiterpenes, isofuranodiene (1), germacrone were obtained from Padang, Sumarea Only the
(2), furanogermenone (3) and zederone (4). rhizome parts were studied.
Curcuma ceruginosa produced six
Isolation and Identification : The dried-
sesquiterpenes, isofuranodiene (1),
powdered rhizomes were each extracted with
furanodienone (5), dehydrocurdione (6),
chloroform in a Soxhlet apparatus for 20 hr.
curzerenone (7), 13-hydroxygermacrone (8),
The fresh rhizomes were hydrodistilled in an all
curcumenone (9) and zedoarol (10). Curcuma
glass apparatus for 8 hr. The crude extracts
xanthorrhiza gave two sesquiterpenes ar-
were fractionated using vacuum column
curcumene (11) and xanthorrhizol (12)) and
chromatography on silica gel with petroleum
diarylheptanoid, curcumin (13), whereas
ether and ether gradient as eluents. The
Curcuma domestica gave sesquiterpene, ar-
fractions were recombined based on TLC Rf
turmerone (14) together with curcumin (13).
values and were then subjected for further
Curcuma phaeocaulis yielded two
purification using column chromatography or
sesquiterpenes, isofuranodiene (1) and
preparative tlc several times. Pure compounds
germacrone (2) and a diarylheptanoid 1-(4'-
were then identified by spectroscopic
hydroxy-3'-methoxyphenyl)-7-phenyl-3-
techniques.
heptanone (15). Curcuma heyneana gave
curcumanolides A (16) and B (17), Isofuranodiene (1) - The crude extract of C.
isocurcumenol (18), curcumenol (19), and ochrorhiza (15.0 g) was fractionated using
curcumenone (9). Curcuma sp. A contained VCC on silica gel with petroleum ether and
bisucurone (20), ar-curcumene (11), curzerene ether gradient as eluents to give 15 fractions.
(21), and ar-turmerone (14), whereas Curcuma Fraction 1 (2.50 g) was washed with MeOH
sp. B contained isofuranodiene (1), and the solids was then washed with a mixture
germacrone (2) and curzerenone (7). PE-Et2O and recrystallized with Et2O to give
isofuranodiene (1) (0.20 g) as colourless
Most of the essential oils tested were very toxic
crystals, m.p. 63.3 - 64.0 °C, lit. [15] 65 - 67 °C
against brine shrimps especially C.
xanthorrhiza ( IC50 33.14) and C. heyneana and lit. [16-17] 66 °C; νmax cm-1 : 2930, 1455,
(46.61). Xanthorrhizol was the compound 1375; NMR 1H : δ 1.28 (3H, s, H-15), 1.60
responsible for the activity with IC50 25.91 (3H, s, H-14), 1.92 (3H, s, H-13), 2.00 - 2.30
(5H, m, H-2, H-3 and H-4), 3.08 (2H, br.d, J
Xanthorrhizol the major sesquiterpenoid from 7.1 Hz, H-6), 3.50 (2H, AB quartet, J 16.0 Hz,
C. xanthorriza has been modified to several H-9), 4.73 (1H, t, J 7.5 Hz, H-5), 4.94 (1H, dd,
derivatives, including epoxide, acetyl and J 6.0 and 11.0 Hz, H-1), 7.06 (1H, s, H-12);
methoxyl. Xanthorhizol has also been used as MS: m/z 216 [M+] C15H20O.
the starting material to prepare several natural
sesquiterpenoids, curcuhydroquinone isolated Germacrone (2) - Fraction 3 (2.50 g) was
from Gorgonian coral, Pseudoterogorgia rigida purified by repeated CC using PE - Et2O (9:1)
[18], 12,13-dihydro-12,14- as an eluent to give germacrone (2) (0.90 g) as
dihydroxyxanthorrhizol [19], and helibisabonol colourless crystals; νmax cm-1 : 2917, 1672,
A from Helianthus annus [20]. 1439, 1383; NMR 1H: δ 1.42 (3H, s, H-14),
1.64 (3H, s, H-15), 1.74 (3H, s, H-13), 1.78
3. Experimental (3H, s, H-12), 2.00-2.40 (4H, m, H-2 and H-3),
The NMR experiments were performed on 2.80-3.00 (3H, m, H-6 and H-9), 3.41 (1H, d, J
either a Bruker AM 400 or Varian 300 FT- 10.0 Hz, H-9), 4.70 (1H, dd, J 3.0 and 11.3 Hz,
NMR spectrometers. MS were recorded on an H-5), 5.00 (1H, br.d, J 10.0 Hz, H-1); RMN
HP GC-MS spectrometer. IR were recorded or 13
C: δ 207.82, 137.36, 134.99, 132.70, 129.38,
a Perkin Elmer FT spectrophotometer. 126.79, 126.48, 55.94, 38.16, 29.26, 24.17,
Samples of Curcuma : Curcuma domestica, C. 22.34, 19.90, 16.76, 15.62; MS : m/z 218 [M+]
xanthorrhiza were purchased locally, C. C15H22O.
ochrorhiza and C. aeruginosa were provided Furanogermenone (3).- Fraction 3 (2.50 g)
by Mr. Ahmad A. Rahman (a botanist from was also purified many times using CC on
UPM), and C. phaeocaulis was collected from silica gel with PE-Et2O (9:1) to give
Langkawi, Malaysia. C. heyneana and two furanogermenone (3) (30 mg) as an unstable
more Curcuma sp. A and B (Kunyit A and B)
oil. νmax cm-1 : 1710, 1435, 1382; NMR 1H : δ
1.11 (3H, d, J 7.0 Hz, H-14), 1.71 (3H, s, H- H-12), 2.00 - 2.20 (4H, m, H-2 and H-3), 2.40
15), 1.90 (3H, s, H-13), 3.20 (2H, k AB, J 17.0 (1H, m, H-4), 3.05 - 3.12 (4H, m, H-6 and H-
Hz, H-6), 3.50 (2H, AB quartet, J 17.0 Hz, H- 9), 5.08 (1H,br. t, J 6.0 Hz, H-1); NMR 13C : δ
9), 5.18 (1H, m, H-1), 7.10 (1H, s, H-12); MS: 210.97, 207.12, 136.92, 132.92, 129.80,
m/z 232 [M+] C15H20O2. 129.24, 56.95, 46.54, 43.36, 34.12, 26.36,
Zederone (4) - Fraction 4 (2.50 g) was purified 22.05, 20.95, 18.35, 16.22; MS: m/z 234 [M+]
using CC on silica gel PE-Et2O (9:1) to provide C15H22O2.
200 fractions. Fractions 49-63 were Curcumenone (7) - Fraction 5 (0.80 g) was
recombined, followed by evaporation of chromatographed on silica gel with PE-Et2O
solvent to give semi solids sample (0.25 g) (8:1) as an eluent to provide curcumenone (7)
which was then washed with Et2O, to give (40 mg) as pale yellow oil, νmaks cm-1 : 2925,
zederone (4) (60 mg) as colourless needles; 1714, 1678, 1442, 1368; NMR 1H: δ 0.44 (1H,
m.p. 151.6 - 152.8 °C, lit. [4-9] 153.5 - 154.0 dt, J 4.6 and 7.1 Hz, H-1), 0.66 (1H, q, J 4.6
°C; νmax cm-1 : 3420, 2933, 1662, 1426, 1371; Hz, H-5), 1.12 (3H, s, H-15), 1.60 (2H, q, J 7.1
NMR 1H : δ 1.33 (3H, s, H-14), 1.60 (3H, s, H- Hz, H-2), 1.79 (3H, s, H-13), 2.08 (3H, s, H-
15), 2.10 (3H, s, H-13), 2.30 (2H, m, H-3), 2.60 12), 2.13 (3H, s, H-14), 2.46 (2H, t, J 7.1 Hz,
(2H, m, H-2), 3.70 (2H, AB quartet, J 16.5 Hz, H-3), 2.54 (2H, m, H-9), 2.80 (2H, br.s , H-6);
H-9), 3.80 (1H, s, H-5), 5.48 (1H, dd, J 4.0 and NMR 13C: δ 208.20, 201.20, 146.00, 128.00,
12.0 Hz, H-1), 7.10 (1H, s, H-12); RMN 13C : δ 48.90, 43.80, 29.90, 27.90, 24.00, 23.40, 23.20,
192.22, 157.09, 138.09, 131.24, 131.08, 19.00; MS: m/z 234 [M+] C15H22O2 .
123.29, 122.27, 66.56, 63.96, 41.91, 38.03,
13-hydroxygermacrone (8) - Fraction 7 (0.40
24.67, 15.74, 15.18, 10.27; MS : m/z 246 [M+]
g) was purified using CC on silica gel (70.0 g)
C15H18O3.
with a mixture of PE-EtOAc (10:1) as an eluent
Isofuranodiene (1) - Crude extract of C. to give 13-hydroxygermacrone (8) (40 mg) as
aeruginosa (19.0 g) was fractionated using brownish oil; νmaks cm-1 : 3424, 2924, 1677,
VCC on silica gel with PE and Et2O as an 1438, 1386; 1H NMR: δ 1.32 (3H, s, H-14),
eluent to give 7 fractions. Fraction 2 (2.50 g) 1.40 (3H, s, OH), 1.62 (3H, s, H-15), 1.82 (3H,
was purified with repeated CC to give s, H-12), 2.00 - 2.40 (4H, m, H-2 and H-3),
isofuranodiene (1) (10 mg) as colourless oil; 2.96 (2H, m, H-6), 3.44 (2H, d, J 10.0 Hz, H-
IR, MNR 1H and MS were identical with te 9), 4.22 (2H, AB quartet, J 12.0 Hz, H-13),
data of previously isolated compound from C. 4.66 (1H, dd, J 6.0 and 9.0 Hz, H-5), 4.99 (1H,
ochrorhiza. br.d, J 12.0 Hz, H-1); NMR 13C : δ 206.96,
Furanodienone (5) - Fraction 3 (1.40 g) was 139.54, 135.53, 132.84, 131.10, 126.06,
purified using CC on silica gel with PE-Et2O 124.69, 62.53, 55.26, 37.81, 28.37, 23.82,
(9:1) as an eluent to furanodienone (5) (160 17.54, 16.38, 15.36; MS : m/z 234 [M+]
mg) as pale yellow oil; νmaks cm-1 : 2930, 1648, C15H22O2.
1426, 1375; NMR 1H: δ 1.30 (3H, s, H-15), Zedoarol (9) - Fraction 3 (0.40 g) was further
1.99 (3H, s, H-14), 2.20 (3H, s, H-13), 2.20 - purified by CC on silica gel (80.0 g) and was
2.60 (4H, m, H-2 and H-3), 3.69 (2H, s, H-9), eluted with PE -: Et2O (9:1) to give zedoarol
5.16 (1H, dd, J 4.8 and 11.1 Hz, H-1), 5.80 (9) (60 mg) as pale yellow oil; νmaks cm-1 :
(1H, s, H-5), 7.08 (1H, s, H-12); NMR 13C : δ 3447, 2961, 1654; NMR 1H : δ 1.20 (3H, d, H-
190.01, 156.72, 145.99, 138.30, 135.62, 14), 1.40-2.00 (7H, m, H-2, H-3 and H-13),
132.68, 130.76, 123.94, 122.41, 41.92, 40.89, 2.20 (s, OH), 2.50 (1H, m, H-4), 3.00 (1H, m,
26.68, 19.21, 16.02, 9.80; MS : m/z 230 [M+] H-1), 3.70 (2H, AB quartet, H-9), 5.18 (1H,
C15H18O2. br.s, H-15), 5.30 (1H, br.s, H-15), 7.10 (1H, s,
Dehydrocurdione (6) - Fraction 4 (3.00 g) was H-12); MS: m/z 246 [M+] C15H18O3.
purified by CC on silica gel (150 g) with PE Curzerenone (10) - The essential oil was
dan Et2O (9:1) as an eluent to produce chromatographed on silica gel to afford
dehydrocurdione (6) (130 mg) as pale yellow curzerenone (10) (230 mg); υmax cm-1 : 2928,
oil; νmaks cm-1 : 2921, 1709, 1688, 1454, 1373; 1675, 1562; NMR 1H (CDCl3): δ 1.2(3H, s,
NMR 1H: δ 1.00 (3H, d, J 6.0 Hz, H-14), 1.65 Me), 1.8(3H, s, Me), 2.2(3H, s, Me), 2.8(2H, s,
(3H, s, H-15), 1.75 (1H, s, H-13), 1.78 (3H, s,
CH2), 2.9(1H, s, CH), 4.5-5.0(4H, m, 2x 0.94 (3H, d, J 6.0 Hz, H-14(107)), 1.55 (3H, s, H-
=CH2), 5.4-5.9(1H, dd, J 11 and 6 Hz , olefinic 15(107)), 1.70 (3H, s, H-15(106)), 1.81 (6H, s, H-
H), 6.9 (1H, s, furan H) ; MS: m/z 230 [M+] 13(106), (107)), 2.21 (6H, t, J 2.0 Hz, H-12(106),
C15H18O2. (107)), 2.43 (3H, s, H-6(106) dan H-6a(107)), 1.5-
2.35 (10H, m, H-2(106), (107), H-3(106), (107) ad H-
The other species were studied in the same
4(106), (107)), 2.8-2.90 (3H, m, H-1(106), (107) and H-
manner and the compounds isolated were listed
6b(107)), 4.73 (2H, s, H-9a(106), (107)), 4.85 (1H, s,
below: α-curcumene (11), xanthorrhizol (12)
H-9b(107)) and 4.92 (1H, s, H-9b(106)); RMN 13C
and curcumin (13) from C. xanthorrhiza; ar-
(CDCl3): δ 13.0 (C-14(107)), 13.1 (C-14(106)),
turmerone (14) and curcumin (13) from C.
19.8 (C-15 (107)), 19.9 (C-15 (106)), 21.9 (C-13
domestica; isofuranodiene (1), germacrone (2)
(107)), 23.1 (C-3 (106)), 23.9 (C-13 (106)), 24.4 (C-
and 1-(4‘-hydroxy-3’-methoxyphenyl)-7-
12 (106), (107)), 26.3 (C-2 (106)), 27.4 (C-6 (107)),
phenyl-3-heptanone (15) from C. phaeocaulis.
27.5 (C-6 (106)), 30.8 (C-3 (107)), 33.8 (C-2 (107)),
Ar-Curcumene (11) - υmax cm-1 : 2960, 2925, 42.7 (C-4 (106)), 45.2 (C-4 (107)), 52.1 (C-1 (106)),
1520; NMR 1H (CDCl3); δ 1.17 (3H, d, J 7Hz, 56.0 (C-1 (107)), 89.6 (C-5 (106)), 91.6 (C-5 (107)),
Me) 1.5(3H, s, Me), 1.60(3H, s, Me), 1.67(3H, 112.7 (C-9 (106)), 114.0 (C-9 (107)), 120.7 (C-
m, CH2 & CH), 2.31 (3H, s, Me), 2.69(2H, m, 7(106), (107)), 143.7 (C-11 (106)), 145.3 (C-11 (107)),
CH2), 5.14 (1H, t, J 7Hz, olefinic H), 7.07 (4H, 149.3 (C-10 (106), (107)) and 169.8 (C-8(106), (107));
S, aromatic H). m/z 202, C15 H22. MS: m/e (%) 234 (33) [M+, C15H22O2], 178
(50), 165 (80), 164 (100) and 152 (85).
Xanthorrhizol (12) - υmax cm-1: 3420, 2962,
1620, 1590; NMR 1H (CDCl3): δ 1.22(3H, d, J Isocurcumenol (18) - Fractions (105-118) were
7 Hz, Me), 1.52(3H, S, Me), 1.66(3H, S, Me), combined and solvent was evaporated to give
1.84(3H, m, CH2 and CH), 2.21(3H, s, Me), sticky oil which was then repeatedly washed
2.58(2H, m, CH2), 4.72(1H, br.s, OH), with petroleum ether to give isocurcumenol
5.08(1H, t, J 7Hz, olefinic H), 6.65(1H, s, (54.8 mg, 7.31 %) as colourless crystals, m.p.
aromatic H), 6.85(2H, A2B2, ArH), M+ 218, 145-147°C (lit. [21] 144-146°C) and Rf 0.63
C15H22O. (PE:Et2O / 3:2). IM (CHCl3) IR υmaxs cm-1:
3405, 2928, 1644, 1453, 1373 and 1216; 1H
Curcumin (13) - υmax cm-1 : 3425, 1630, 1601,
NMR (CDCl3): δ 0.98 (3H, d, J 6.4 Hz, H-14),
1511, NMR 1H (DMSO-D6): δ 3.86(6H, s, 1.54 (3H, s, H-13), 1.77 (3H, s, H-12), 1.6-2.00
2xOMe), 3.9-4.1 (2H, br. 2xOH) 6.03(1H, br.s, (6H, m, H-2, H-3 and H-6), 2.19 (1H, t, J 14.0
CH=COH), 6.61-7.62(10H, m, 6 aromatic and Hz, H-4), 2.4-2.60 (2H, m, H-9), 2.65 (1H, d, J
4 styril protons), 9.60(1H, br.s, OH). 14.0 Hz, H-1), 2.78 (1H, s, OH), 4.71 (1H, t, J
Ar-turmerone (14) - υmax cm-1 : 2928, 1675, 2.0 Hz, H-15a) and 4.75 (1H, t, J 2.0 Hz, H-
1562 ; δ(CDCl3):1.24(3H, d, J 6Hz, Me), 1.84 15b); 13C NMR(CDCl3): δ 12.4 (C-14), 18.9
(3H, d, J 1Hz, Me), 2.08 (3H, d, J 4Hz, Me), (C-13), 22.5 (C-12), 28.3 (C-2), 30.8 (C-3),
2.28(3H, s, Me Ar), 2.68(1H, m, CH), 3.30(2H, 36.2 (C-9), 38.9 (C-6), 41.6 (C-4), 52.8 (C-1),
m, CH2CO), 6.05(1H, br.s, olefinic H), 7.10 87.1 (C-5), 104.0 (C-8), 112.2 (C-15), 126.9
(4H, s, aromatic H); m/z 216 C15H20O. (C-11), 133.9 (C-7) and 145.1 (C-10); MS: m/e
(%) 234 (3) [M+, C15H22O2], 191 (35), 121 (48),
1-(4’-hydroxy-3’-methoxyphenyl)-7-phenyl-3- 105 (100), 67 (55) and 41 (87).
heptanone (15) - υmax cm-1: 3400, 2920, 1720,
1600 and 1500; 1H NMR (CDCl3): δ 2.0- Curcumenol (19) – Combined fraction (127-
2.9(12H, m, 6xCH2), 3.6(34, s, OMe), 5.2(1H, 159) was concentrated to give a mixture of
s, OH), and 6.3-7.1 (8H, m, aromatic H). crystals in sticky oil. This mixture was washed
repeatedly with PE to give curcumenol (19)
Curcumanolide A (16) and Curcumanolide B (45.6 mg, 6.08 %) as colourless needles, m.p.
(17) - Fractions (64-82) were combined and the 113-115°C (lit. [21] 114-116°C) and Rf 0.55 in
solvent was evaporated to give a mixture of PE:Et2O (3:2). IR (CHCl3) IR υmaxs cm-1: 3378,
curcumanolide A (16) and curcumanolide B 2957, 2873 and 1653; 1H NMR (CDCl3): δ 0.98
(17) (76.6 mg, 10.21 %) as yellow oil with Rf (3H, d, J 6.4 Hz, H-14), 1.55 (3H, s, H-15),
0.53 in PE:Et2O (4:1). IR υmaxs cm-1: 2959, 1.61 (3H, s, H-13), 1.77 (3H, s, H-12), 1.8-2.00
1744, 1666, 1449, 1376 dan 1269; 1H NMR (6H, m, H-2, H-3 and H-6), 2.07 (1H, d, J 15.6
(CDCl3): δ 0.84 (3H, d, J 6.8 Hz, H-14(106)), Hz, H-1), 2.61 (1H, d, J 15.6 Hz, H-4), 3.05
(1H, s, OH) and 5.71 (1H, s, H-9); 13C NMR 2. B. K. Euans, K.C. James and D.K.
(CDCl3): δ 11.8 (C-14), 20.9 (C-15), 18.9 (C- Luscombe, J. Pharmacol. Sci., 1978, 67, 277.
13), 22.3 (C-12), 27.5 (C-2), 31.2 (C-3), 37.1 3. M. Grainage and S. Ahmad. Handbook of
(C-6), 40.3 (C-4), 51.2 (C-1), 85.7 (C-5), 101.5 Plants with Pest-Control properties, John
(C-8), 122.1 (C-11), 125.8 (C-9), 137.2 (C-10) Wiley, N.York 1988.
and 139.0 (C-7); SJ: j/c (%) 234 (15) [M+, 4. H. Hikino, C. Konno & T. Takemoto,
C15H22O2], 189 (26), 147 (30), 133 (38), 105 Chem. Pharm. Bull., 1972, 20, 987.
(100) and 91 (38).
5. Y. Shiobara, Y. Asakawa, M. Kodoma and
Bisacurone (20) - Fraction 4 from fractionation T. Takemoto, Phytochemistry, 1986, 25, 1351.
gave bisacurone (20) (9.1 mg, 0.13 %) as
6. H. Shibuya, Y. Yamamoto, I. Miura and I.
yellow liquid with Rf 0.25 in PE:Et2O (1:4). IR Kitagawa, Heterocyles, 1982, 17, 215.
(CHCl3) υmaxs cm-1: 3414, 2930, 1682, 1614,
1447, 1377 and 1047; 1H NMR (CDCl3): δ 0.88 7. J.F. Gao, T.ohkura, K. Halimays, M.
Hikichi, T. Kawanata, W.X. Ying, Y. Iitaka
(3H, d, J 6.4 Hz, H-15), 1.27 (3H, s, H-14),
and S. Inayama, Chem. Pharm. Bull., 1986, 34,
1.86 (3H, s, H-13), 2.11 (3H, s, H-12), 1.7-2.50 5122.
(6H, m, H-1, H-2, H-7 dan H-8), 3.76 (1H, dd,
J 2.8 and 7.2 Hz, H-3), 5.62 (2H, s, H-5 and H- 8. M. Kuroyanagi, A. Ueno, K. Ujiie and S.
6) and 6.04 (1H, s, H-10). Sato, Chem. Pharm. Bull., 1987, 35, 53.
9. I. Kouno, and N. Kawano, Phytochemistry,
Curzerene (21) - Fraction (23-24) were
1984, 24, 1845.
combined to give isofuranogermacrane
(curzerene) (22.2 mg, 0.32 %) as pale yellow 10. C. Pandji, C. Grimm, V. Wray, L.Witte and
oil with Rf 0.87 in PE. IR (CHCl3) υmaxs cm-1: P. Proksch, Phytochemistry, 1993, 34, 415.
2922, 1643, 1450, 1377 and 889; 1H NMR 11. H.W.D. Mathes, B. Luu and G. Ourisson,
(CDCl3): δ 1.04 (3H, s, H-15), 1.72 (3H, s, H- Phytochemistry, 1980, 19, 2643.
14), 1.90 (3H, s, H-13), 2.2-2.70 (5H, m, H-5, 12. R. Nakayama, J. Jamura, H. Yamanaka, H.
H-6 and H-9), 4.73 (1H, s, H-3a), 4.84 (1H, s, Kikuzaki and N. Nakatani, Phytochemistry,
H-3b), 4.95 (1H, d, J 10.8 Hz, H-2a), 4.97 (1H, 1993, 33, 501.
d, J 17.6 Hz, H-2b), 5.85 (1H, dd, J 10.8 and
13. S. Toda, T. Miyase, H. Arichi and Y.
17.6 Hz, H-1) and 7.03 (3H, s, H-12); 13C NMR Takino, Chem. Pharm. Bull., 1985, 33, 1725.
(CDCl3): δ 8.1 (C-13), 19.5 (C-14), 24.1 (C-6),
24.4 (C-15), 36.1 (C-9), 40.1 (C-10), 49.9 (C- 14. H. Kikuzaki and N. Nakatani, J. Food Sci.,
5), 110.9 (C-2), 112.7 (C-3), 116.5 (C-7), 119.3 1993, 58(6), 1407.
(C-11), 137.1 (C-12), 147.1 (C-1), 147.2 (C-4) 15. B. F.Bowden, J. Braekman, J. C. Coll, S. J.
and 149.5 (C-8). Mitchell, Aust. J. Chem., 1980, 33, 927.
4. Acknowledgements 16. G. Rucker, G. A. Assis Brasil E Silva, L.
The authors would like to thank Dr. Andrew Baeur, Phytochemistry, 1971, 10, 221.
Heaton of the Department of Chemistry, 17. P. Weyersahl, H. M. Weyerstahl, C.
University of Western Sydney, Australia for Christiansen, B. O. Oguntimein and A. O.
hosting one of us (HMS) recording the NMR Adeoye, Planta Med., 1988, 54, 546.
spectra, Dr. Hiroshi Morita of Tokyo College 18. F. J. Mcenroe, and W. Fenical,
of Pharmacy, Japan Prof Norio Aimi and Dr. Tetrahedron, 1978, 34,1661.
Mariko Kitajima of Chiba University, Japan for
the help of high field NMR, Mr. Ayob Jabal of 19. M. I. Aguilar, G. Delgado, M. L.
Hernandez and m. L. Villarreal, Nat. Prod.
the Dept. of Chemistry, Universiti Teknologi
Lett., 2001, 15, 93.
Malaysia, for the help of mass spectra,
Research and Development Unit for financial 20. F. A. Macais, A. Torres, J. L. G. Galindo,
assistance and School of Graduate Studies for R. M. Varela, J. A. Alvarez and J. M. G.
scholarship to one of us (SJ). Molinillo, Phytochemistry, 2002, 61, 687.
21. K. Firman, T. Knoshita, A. Itai and U.
5. References
Sankawa, Phytochemistry, 1988, 27, 3887.
1. I. H. Burkill, A dictionary of the economic
products of the Malay Peninsular, Ministry of
Cooperatives and Agriculture, 1966, vol. 1.
O O O
O O O
O O
O
O
(4) (5) (6)
O O
O
O
OH
H
OH O
OH
O
H
O
O O
MeO OMe
O
HO OH
(13)
(14)
O
MeO
OH
(15)
15 9 15
15 9
10 Η 10
2 9
10 Ο Ο
Ο Ο 2 1 1
1 8 3 Ο ΟΗ
2 8 8
5 12
5 12 3 7 4 5
3 7 4 6 11 7
4 6 11 6
14 14 11 13
14 13
13 12
15 14
Η 4
ΟΗ
ΟΗ 15
2 9 1 9
10 5 8 Ο
1 3
3 Ο ΟΗ 2 10
8 6 2 1
Ο 12 3 5
4 5 1 11
7 Η 7
6 4 6
14 12
Η
11 15 7 9 11 13 13
8 10 14
13
Hasnah Muin
Abstrak
Linear Low Density Polyethylene (LLDPE) merupakan salah satu jenis plastik yang banyak
digunakan sebagai bahan pengemas. Senyawa ini bersifat inert dan sangat sulit untuk
diuraikan oleh mikroba tanah. Saat ini , sampah LLDPE merupakan salah satu masalah
lingkungan yang cukup serius. Penelitian terdahulu menunjukkan bahwa oksidasi LLDPE
dengan KMnO4 dalam suasana netral dapat menghasilkan gugus fungsi yang dapat
terhidrolisa dan teroksidasi lanjut, sebagai langkah awal pembuatan plastik yang dapat
terbiodegradasi. Untuk mempercepat proses biodegradasi,pada penelitian ini telah dilakukan
reaksi antara hasil oksidasi LLDPE dengan KMnO4 dalam suasana netral dengan pati yang
telah ditambah aditif. Analisa FTIR dan UV menunjukkan terjadi reaksi antara hasil oksidasi
dengan pati.Dibandingkan dengan hasil oksidasi LLDPE , film dari campuran hasil oksidasi
dengan pati mempunyai derajat kristalinitas yang lebih rendah, dan analisa SEM
menunjukkan tidak ada kerusakan pada permukaan LLDPE. Diharapkan penelitian ini
merupakan salah satu cara untuk memodifikasi polimer sintetik guna membentuk materi
polimer yang kemungkinan dapat terbiodegradasi.
Kata Kunci: LLDPE, OKSIDASI, KMnO4 , Pati
(a)
1717
%T 1607
1653
1382
λ=
(b)
1717
(c)
Angka Gelombang
Gambar 1. Spektra FTIR: (a) Hasil Oksidasi LLDPE + KMNO4, (b) Pati,
(c) Campuran hasil oksidasi dengan pati.
Tabel 1 Analisa Gugus Fungsi Hasil Oksidasi,Pati dan Hasil Oksidasi Tambah Pati
Sample Angka Gelombang (cm)-1 Tafsiran Gugus Fungsi
1717,9 -C=O
1607,8 -C=O dalam bentuk enol C=C-
a
1559,6 OH
3500
1653,8 -OH pati + air
1382 -C-O-C-dari pati
b
1155 -C-O-C- dari pati
1717,5 -C=O
c
1155 -C-O-C- dari pati
Tabe2 Perubahan Indeks Karbonil Akibat Pencampuran Hasil Oksidasi dengan Pati
Sample Angka gelombangg ( cm)-1 A IC
a 1717,9 0,0945 0,0705
1462,3 1,3979
b 1717,5 0,1445 0.2042
1462,3 0,7076
λ = 226 A = 1.0499286
226 A = 2.323420
230
234
λ = 280
λ = 278 A = 1.268799
λ = 206
λ
λ
Gambar 2. Spektra UV: (a) Hasil Oksidasi LLDPE + KMNO4 (b) Campuran hasil oksidasi dengan pati.
OH O
1. –CH2 – C = HC – C – CH2- + ROH –CH2 – C – CR – C – CH2 –
O O
21.6
0
Intensitas hamburan
Intensitas hamburan
22.20
24.60
0
23.8
100 130 160 200
0
36.6
0 0
10 20
Gambar 4. Foto SEM (a) Hasil Oksidasi LLDPE + KMnO4, (b) Pati,
(c) Campuran hasil oksidasi dengan pati.
Elektrode Kawat Terlapis Perak/Perak Iodat Sebagai Elektrode Selektif Ion Iodat
Abstract
Ion iodat dalam suatu sampel dapat dianalisis dengan menggunakan elektrode perak/perak
iodat (Ag/AgIO3) yang dipersiapkan dengan metode kawat terlapis. Pembuatan elektroda
Ag/AgIO3 dilakukan dengan mengelektrolisis kawat perak di anoda dalam larutan kalium
ioda jenuh, pada potensial tetap (0,75 - 0,85 Volt). Pada penelitian ini dipelajari pengaruh
lama elektrolisis dan konsentrasi larutan NaCl terhadap harga bilangan Nernst, sebagai
elektroda pembanding digunakan Ag/AgCl. Hasil penelitian menunjukkan bahwa harga
bilangan Nernst meningkat dengan bertambahnya lama elektrolisis, namun pada waktu
elektrolisis di atas 30 menit harga bilangan Nernst menurun kembali. Lama elektrolisis
optimum adalah 30 dengan harga bilangan Nernst sebesar 51,6 mV/dekade, pada kisaran
konsentrasi iodat sebesar 10-3 M hingga 0,4 M. Adanya NaCl dalam larutan analit dapat
menurunkan bilangan Nernst yang sangat signifikan.
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Proceeding
Fax : +62 (22) 2504154, Homepage of Joint Seminar on Chemistry
: http://www.chem.itb.ac.id/jschem, ITB-UKM
E-mail VI 2005
: jschem@chem.itb.ac.id
Suyanta
Abstrak
Teknik injeksi alir (Flow Injection Analysis, FIA) yang merupakan dasar metode analisis
otomatis telah berhasil dikembangkan dan dimofikasi untuk penentuan tiosianat secara
kontinyu. Dalam metode ini, sistem FIA dimodifikasi menjadi sistem alir kontinyu dan
digabungkan dengan sell difusi gas (Gas Diffusion Cell) sehingga sampel tidak diinjeksikan
tetapi dialirkan secara kontinyu ke dalam sistem. Proses pemipetan, pengocokan dan
pengukuran dilakukan dalam satu tahap dalam sistem alir melalui pipa kapiler yang didorong
oleh sistem pompa tiga channel. Dengan demikian, waktu analisis, jumlah reagen, dan jumlah
sampel bisa ditekan sampai antara 50-100 kali lebih efisien. Sampel tiosianat (channel-1)
dialirkan dan direaksikan dengan reagen pengoksidasi, Cerium(IV) dalam asam sulfat,
(channel-2) membentuk asam sianida dalam aliran donor sell difusi gas. Asam sianida ini
akan berdifusi melalui membran semipermeabel menuju aliran akseptor yang berisi reagen
Nikel(II) beramoniak (channel-3) membentuk kompleks tetrasianonikelat(II) yang dapat
dideteksi secara spektrofotometri pada panjang gelombang 267 nm. Metode ini telah
dioptimasi terhadap parameter operasioanal, seperti panjang koil, kecepatan alir, serta
parameter kimiawi, meliputi konsentrasi Cerium(IV), asam sulfat, dan Nikel(II). Hasil
penelitian menunjukkan bahwa metode yang dikembangkan mempunyai linieritas terhadap
tiosianat sampai 100 ppm dengan limit deteksi 0,3 ppm. Metode ini juga telah diaplikasikan
pada sampel alami, yaitu sampel urine perokok aktif, limbah fotografi, dan limbah industri
emas dan dibandingkan dengan metode standar dengan hasil yang memuaskan.
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Proceeding of Joint Seminar on Chemistry ITB-UKM VI 2005
H. Yohandini, F. Madayanti, P. Aditiawati, dan Akhmaloka
Abstrak
Sumber-sumber air panas dengan kondisi fisik dan kimia berbeda yang banyak ditemukan di
Indonesia memiliki potensi besar bagi keanekaragaman mikroba termofilik yang tinggi. Pada
penelitian ini, telah dilakukan upaya analisis keanekaragaman mikroba termofilik melalui
pendekatan tradisional dan molekuler dari kawah-kawah di sekitar Kawah Hujan 1, Kawah
Hujan 2, Kawah Huajn 3, dan Kawah Hujan 4. Sampel dari Kawah Hujan 1 berhasil
ditumbuhkan dalam media sintetik ½ LB, media Sulfolobus, dam media pereduksi-sulfat. Dari
Kawah Hujan 2 diperoleh kultur dalam media sintetik Termus, ½ LB, NB, dan media
Spirocetes, sedangkan dari Kawah Hujan 4 diperoleh kultur dalam media sintetik ½ LB.
Untuk keperluan analisis secara molekuler telah diperoleh hasil amplifikasi gen16S rRNA
dengan cara touchdown PCR, berukuran sekitar 390 pb, yang mengandung daerah variabel
V9 dari mikroba yang dikulturkan. Hasil amplifikasi selanjutnya akan digunakan untuk
analisis DGGE.
analisis komunitas mikroba pada habitat pada temperatur 50-55°C selama 30 menit.
alaminya, seperti DGGE/TGGE Selanjutnya, ditambahkan larutan III (K-asetat
(denaturating/temperature gradient gel 3M, asam asetat 5M) dan disentrifugasi selama
electrophoresis), SSCP (single-stranded 5 menit pada kecepatan maksimum. Filtrat
conformation polymorphism), dan T-RFLP dipindahkan ke dalam tabung yang baru,
(terminal-restriction fragment length kemudian dilakukan presipitasi etanol
polymorphism). Pada umumnya, melalui (Sambrook, 2001).
teknik-teknik ini, pemisahan secara fisik
terhadap keseluruhan produk gen komunitas Amplifikasi gen 16S rRNA.
Primer PCR yang digunakan didesain untuk
yang diamplifikasi memungkinkan untuk
mengamplifikasi gen 16S rRNA dari domain
dilakukan (Egert, et.al., 2003). Pada penelitian
Bacteria (Ferris, 1996). Salah satu primer
ini telah dilakukan upaya analisis
komplemen dengan daerah conserved pada
keanekaragaman mikroba pada sumber air
domain Bacteria (posisi 1055-1070 pada
panas Kawah Hujan dengan menggunakan
Escherichia coli, dengan urutan primer 5’-
teknik PCR berbasis gen 16S rRNA dan akan
ATGGCTGTCG TCAGCT-3’) dan primer
dilanjutkan dengan analisis DGGE, serta upaya
yang lain komplemen dengan daerah conserved
pembuatan kultur mikroba yang terdapat pada
universal yang dirangkaikan dengan 40 basa
sumber air panas tersebut.
CG clamp (posisi 1392-1406 pada E. coli,
2. Percobaan dengan urutan 5’-
Pengambilan sampel. CGCCCGCCGCGCCCCGGGCCCGGCCCG
Sampel diambil dari empat tempat di sekitar CCGCCCCCGCCCCACGGGCGGTGTGTAC
Kawah Hujan, Kamojang Jawa Barat, yang -3’). Secara teoritis, pasangan primer ini akan
selanjutnya disebut sebagai Kawah Hujan 1 mengamplifikasi 323 pb segmen gen 16S
(90°C, pH 2.6), Kawah Hujan 2 (>80°C, pH rRNA, termasuk daerah V9 yang sangat
7,2), Kawah Hujan 3 (90°C, pH 1,8), dan variabel.
Kawah Hujan 4 (88°C, pH 3,5). Pengambilan PCR dilakukan dengan menggunakan enzim
sampel untuk analisis langsung dan kultivasi DNA polimerase Pfu sesuai dengan prosedur
dilakukan dalam waktu yang bersamaan. yang disarankan pabrik (Stratagene, La Jolla,
Untuk keperluan analisis langsung, sekitar 5 Calif.). Kondisi sari siklus PCR adalah 1 menit
liter air kawah dimasukkan ke dalam wadah denaturasi pada temperatur 94°C, 1 menit
yang ditempatkan dalam cooler berisi es yang annealing, dan 3 menit pemanjangan rantai
digunakan untuk mendinginkan sampel selama
pada temperatur 72°C. Selama siklus
dalam perjalanan. Setelah sampai di
touchdown awal, temperatur annealing
laboratorium, sampel disentrifugasi, untuk
diturunkan dari 53° sampai 43°C dengan
memisahkan lumpur, dan kemudian difiltrasi
dengan menggunakan filter berukuran 0,22 interval 1°C per siklus; 20 siklus annealing
mikron. selanjutnya dilakukan pada 43°C.
Pemanjangan rantai terakhir dilakukan selama
Untuk keperluan kultivasi, 50 ml sampel air 10 menit. Hasil PCR diamati cara
kawah dimasukkan dengan siring ke dalam 50 elektroforesis pada gel agarosa dengan etidium
ml media sintetik dua kali pekat yang telah bromida sebagai penanda.
disterilkan. Temperatur dijaga tetap panas
selama dalam perjalanan dan setelah sampai di 3. Hasil dan Pembahasan
laboratorium sampel dalam media sintetik Pada penelitian ini, biodiversitas mikroba pada
diinkubasi pada temperatur 60° atau 70° C. Kawah Hujan diamati melalui dua cara, yaitu
cara langsung dan dengan kultivasi.
Ekstraksi DNA Pengamatan mikroba dengan cara langsung
Masing-masing sampel yang telah dipeletkan dilakukan dengan mengisolasi mikroba
dihomogenkan dalam bufer Tris-Cl 10 mM pH langsung dari air kawah dengan cara filtrasi
8 yang mengandung Lisozim 0,8 mg/ml, menggunakan membran berukuran 0,22
diinkubasi pada temperatur 37°C selama 1 jam. mikron. Bagian yang tersaring membran
Bufer lisis (2% SDS, 200 mM EDTA, maupun endapan (lumpur) kemudian
proteinase K 0,8 mg/ml) dengan volum yang diperlakukan sebagai sampel mikroba dan
sama ditambahkan dan kemudian diinkubasi dianalisis dengan cara isolasi DNA kromosom,
Kawah Hujan 1
Kawah Hujan 2
Kawah Hujan 4
Media ½
amplifikasi daerah gen 16S rRNA dan analisis keberhasilan amplifikasi. Untuk itu, pemurnian
DGGE. DNA kromosom mikroba dari kedua DNA kromosom perlu dilakukan lebih lanjut.
bagian tersebut dapat diisolasi. Hal ini
Kultivasi mikroba isolat Kawah Hujan berhasil
menunjukkan bahwa sebagian mikroba ikut
dilakukan dengan menggunakan beberapa jenis
terendapkan ketika dilakukan pengendapan
media sintetik. Dari Kawah Hujan 1, mikroba
lumpur.
berhasil dikulturkan dalam media ½ LB, media
Dengan metoda isolasi kromosom yamg Sulfolobus (Atlas, 1993), dam media
digunakan, pita DNA yang diperoleh relatif pereduksi-sulfat (Atlas, 1993). Dari Kawah
tipis dan tingkat kemurniannya masih rendah, Hujan 2 diperoleh kultur dalam media sintetik
dilihat dari warna ekstrak kasar DNA yang Termus (Castenhold D; 0,1 % yeast ekstrak dan
kecoklatan dan masih terdapat endapan protein. tripton), ½ LB, NB, dan media Spirocetes
Amplifikasi gen 16S rRNA dilakukan terhadap (Atlas, 1993), sedangkan dari Kawah Hujan 4
semua sampel DNA dan tidak diperoleh produk diperoleh kultur dalam media sintetik ½ LB.
PCR. Menurut penelitian yang dilakukan oleh Pada umumnya, mikroba yang berhasil
Zhou dkk. (1996), tingkat kemurnian DNA dikulturkan adalah bakteri berbentuk batang
kromosom yang diisolasi dari tanah (lumpur) (Gambar 1). Beberapa kultur mikroba tersebut
mempengaruhi keberhasilan amplifikasi. telah berhasil dimurnikan. Mikroba yang
Adanya senyawa-senyawa organik tanah tumbuh dalam media Termus Kawah Hujan 2
(humic substances) yang ikut terekstraksi dengan suhu pertumbuhan 70° C, paling sedikit
menginhibisi enzim DNA polimerase yang terdiri dari 2 jenis mikroba dilihat dari
digunakan dalam proses PCR. Selain itu, perbedaan bentuk koloni dan juga
kemungkinan masih adanya Dnase dalam morfologinya ketika dilihat di bawah
ekstrak kasar DNA juga mempengaruhi mikroskop. Bentuk koloni yang berbeda
teramati pula pada mikroba yang tumbuh pada
1 2 3 4
1419 pb
517 pb
396 pb
media Spieocetes Kawah Hujan 2. Mikroba- hot springs. FEMS Microbiology Letters. 200: 103-
mikroba yang berada dalam media Termus 109.
maupun Spirocetes Kawah Hujan 2 tidak Bergey’s Manual of Determinative Bacteriology
tumbuh ketika diinkubasi pada temperatur 37° (1994), 9th edition, edited by John K. Holt (et.al.),
C, sehingga kemungkinan besar mikroba- Williams & Wilkins, USA.
mikroba tersebut merupakan kelompok Egert, M., and M.W. Friedrich (2003) Formation of
termofilik. Pseudo-Terminal Restriction Fragment, a PCR-
Produk PCR telah diperoleh dari amplifikasi Related Bias Affecting Terminal Restriction
Fragment Length Polymorphism Analysis of
DNA kromosom kultur mikroba yang tumbuh
Microbial Community Structure. Appl. Environ.
dalam media Termus Kawah Hujan 2. Hasil Microbiol. 69(5): 2555-2562.
amplifikasi memiliki ukuran sekitar 390 pb
(Gambar 2). Ukuran yang diharapkan untuk Ferris, M.J, G. Muyzer, and D.M. Ward (1996)
hasil amplifikasi daerah gen 16S rRNA yang Denaturating Gradient Gel Electrophoresis Profiles
diamplifikasi adalah sekitar 362 pb. Produk of 16S rRNA-Defined Populations Inhabiting a Hot
Spring Microbial Mat Community. Appl. Environ.
amplifikasi dengan ukuran yang sama juga
Microbiol. 62(2): 340-346.
diperoleh dari hasil amplifikasi DNA
kromosom mikroba yang telah dimurnikan. Ferris, M.J., S.C. Nold, N.P. Revsbech, and D.M.
Ward (1997) Population Structure and
4. Kesimpulan Physiological Changes within a Hot Spring
Mikroba termofilik isolat Kawah Hujan telah Microbial Mat Community following Disturbance.
berhasil dikulturkan dalam beberapa media Appl. Environ. Microbiol. 63(4):1367-1374.
sintetik. Beberapa diantaranya sudah berhasil Huber, R., H. Huber, and K.O. Stetter (2000)
dimurnikan dan diamplifikasi daerah gen 16S Toward the ecology of hyperthermophile: biotopes,
rRNA-nya untuk dilanjutkan dengan analisis new isolation strategies and novel metabolic
DGGE. Sedangkan DNA kromosom hasil properties. FEMS Microbiology Review 24: 615-
isolasi langsung belum bisa diamplifikasi 623.
karena tingkat kemurnian DNA-nya yang Klijn, N., A.H. Weerkamp, W.M. De Vos (1991)
masih rendah. Identification of Mesophilic Lactic Acid Bacteria by
5. Daftar Pustaka Using Polynerase Chain Reaction-Amplified
Amann, R.I., W. Ludwig, and K.H. Shleifer (1995) Variable Regioans of 16S rRNA and Specific DNA
Phylogenetic Identification and In Situ Detection of Probes. Appl. Environ. Microbiol. 57(21): 3390-
Individual Microbial Cells without Cultivation. 3391.
Microbiol. Rev. 59(1): 143-169. Kusumadinata, K (1979) Data Dasar Gunung Api
Atlas, R.M. (1993) Handbook of Microbiological Indonesia (Catalogue of References on Indonesian
Media. Edited by L.C. Parker. CRC Press. Volcanoes with Eruptions in Historical Time).
Direktorat Vulkanologi, Direktorat Pertambangan
Baker, G.C., S. Ghaffar, D.A. Cowan, A.R. Suharto Dasar, Departemen Pertambangan dan Energi RI,
(2001) Bacterial Community analysis of Indonesian Bandung.
Pace, N.R. (1997) A Molecular View of Microbial Molecular Mechanisms for Thermostability.
Diversity and the Biosphere. Science. 276: 734-740. Microbiol. Mol. Biol. Rev. 65(1): 1-43.
Raysenbach, A.L., M. Ehringer, K. Hershberger Ward, D.M., M.J. Ferris, S.J. Nold, and M.M.
(2000) Microbial diversity at 83°C in Calcite Bateson (1998) A Natural View of Microbial
Springs, Yellowstone National Park:another Diversity within Hot Spring Cyanobacterial Mat
environment where the Aquaficales and Communities. Microbiol. Mol. Biol. Rev . 62(4):
“Korarchaeota” coexist. Extremophile. 4: 61-67. 1353-1370.
Raysenbach, A.L., and S.L. Cady (2001) Zhou, J, M.A. Bruns, and J.M. Tiedje (1996) DNA
Microbiology of ancient and modern hydrothermal Recovery from Soils of Diverse Compotition. .
systems. TRENDS in Microbiology. 9(2): 79-86. Appl. Environ. Microbiol. 62(2): 316-322.
Vielle, C., and G.J. Zeikus (2001)
Hyperthermophilic Enzymes: Sources, Uses, and
Abstrak
The MCM-41 and MCM-48 membranes were prepared by hydrothermal methode on the alpha
alumina support by using surfactant (C16TAB) as a template, tetraethylortosilicate (TEOS),
deionized water and NaOH. In general the hydrophilic membrane was able to be changed to
hydrophobic membrane by employing a silylation process. The process had been carried out
at 120 ˚C during 2 hours. The membranes produced were characterized by X-ray diffraction,
gas permeation, and permporometry. They have a narrow pore size distribution and symilar
Kelvin diameter about 2,4 nm. The permeation mechanism of pure gases is considered to obey
the Knudsen diffusion and no contribution of viscous flow occurred to the total permeation.
Kata kunci: Hydrophilic, Hydrophobic, M41S, Silica membrane, Vapor Infiltration.
211
220
After silylation
Before silylation
0 1 2 3 4 5 6 7 8
2-Theta [degree]
Tampak atas
Tampak samping
a b
dari trimethyl chlorosilane. Proses tersebut sekitar pori membran telah disubstitusi dengan
mengakibatkan diameter pori mengecil sekitar gugus –CH3 yang berasal dari trimethyl
0,5 nm. Hal yang serupa terjadi pada membran chlorosilane. Pembuktian lebih kuat dengan
MCM-41 seperti terlihat pada gambar 4. cara melewatkan gas carrier (He) yang telah
jenuh dengan uap air pada membran dan
Uji tetes air pada kedua membran menunjukkan
dianalisis secara online menggunakan gas
hasil bahwa sebagian air terserap di daerah
kromatografi. Pada membran silika hidrophilik
sekitar permukaan membran yang bersifat
MCM-41 maupun MCM-48 terdeteksi adanya
hidrophilik (Gambar 5.a). Pada membran
uap air yang melewati membran. Sedangkan
hidrophobik (Gambar 5.b), air tidak dapat
membran yang telah dilakukan proses sililasi
meresap ke dalam membran. Gugus –OH yang
berubah menjadi hidrophobik dan tidak
berasal dari Si – OH atau Al – OH pada daerah
3
-
[ x 10 mol m s Pa
H2
-1
-2
2
He
-7
CH4
N2
Permeance
1 CO2
]
1
0
0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8
-1/2 1/2 -1/2
M [ mol g ]
Permeance [ x 10 mol m s Pa ]
-1
-1
Before silylation
-2 3
After silylation
-8
Gambar 7. Permeasi gas Nitrogen pada membran sebelum dan sesudah sililasi
Burggraaf A.J., L. Cot, (1996), Fundamentals of and characterization by gas diffusion of 5 nm pore
Inorganic Membrane Science and Technololgy, size anodic alumina membranes, Journal of
Elsivier, Amsterdam. Membrane Science, (143), 375-387.
Gestel, T.V., Vandecasteele, C., Buekenhoudt, A., Nakao W.I., (1994), Determination of pore size and
Dotremont, C., Luyten, J., Leysen, R., Bruggen, pore size distribution 2. dialysis membranes, Journal
Maes, (2002), G.,Alumina and titania multilayer of Membrane Science, (96), 131-136.
membranes for nanofiltration : preparation,
Nishiyama, N., A. Koide, Y. Egashira, K. Ueyama,
characterization and chemical stability, Journal of
(1998), Mesoporous MCM-48 membrane
Membrane Science, (5268), 1-17.
synthesized on a porous stainless steel support,
Gilron, J, A. Soffer, (2002), Knudsen in Chem. Commun, 2147-2148
microporous carbon membranes with molecular
Nishiyama, N., D.H. Park, A. Koide, (2001), A
sieving character, Journal of Membrane Science,
mesoporous silica (MCM-48) membrane:
(210), 339-352.
preparation and characterization, J. mem. Sci. 182,
Hoppe, R., A. Ortlam, J. Rathousky, G. Schulz- 235-244.
Ekloff, A. Zukal, (1997), Synthesis of titanium-
Nishiyama, N., Saputra, H., Park, D.H., Egashira,
containing MCM-41 mesoporous molecular sieves
Y., Ueyama, K., (2003), Zirconium-zontaining
in teh presence of zinc phthalocyanine and
Mesoporous Silica Zr-MCM-48 for Alkali Resistant
rhodamine B, Microporous Material, (8), 267-273.
Filtration Membranes, Journal of Membrane
Huang P., N. Xu, J. Shi, Y.S. Lin, (1996), Science, (218), 165-171.
Characterization of asymmetric ceramic membranes
Saputra, H., (2003), Synthesis ang Characterization
by modified permporometry, Journal of Membrane
of Zirconium-containing Nanoporous Silica
Science, (116), 301-315.
Membranes, Master Thesis, Osaka Unitersity,
Kaneko D., (1994), Review determination of pore Osaka, Japan.
size and pore size distribution 1. adsorbent and
Saputra, H., (2002), Penelitian Pembuatan
catalysis, Journal of Membrane Science, (96), 91-
Membran Silikat Sistem Aliran Tiga Dimensi
130.
(MCM-48), Pengkajian Industri, 18 (VII), 87-92.
Kresge, C.T., M.E. Leonowicz, W.J. Roth, J.C.
Saputra, H., Rosjidi, M., (2002), Alat
Vartuli, J.S. Beck, (1992), Ordered mesoporous
Permporometry untuk Analisis Distribusi Ukuran
molecular sieves synthesized by a liquid-crystal
Pori Aktif Membran, Pengkajian Industri, 16(VII),
template mechanism, Nature (359), 710-712.
86-91.
Lee, D., S.T. Oyama, (2002), Gas permeation
Tsuru, T., Hino, T., Yoshioke, D., Asaeda, M.,
characteristics of a hydrogen selective supported
(2001). Permporometry characterization of
silica membrane, Journal of Membrane Science,
microporous ceramic membranes, Journal of
(210), 291-306.
Membrane Science, (96), 131-165.
Lira, H.L., R. Peterson, (2002), New and modified
anodic alumina membranes part III. Preparation
Abstract
Stigmasterol and 18 Sesquiterpenes were isolated from the n-hexane extract of the stem bark
of Saccopetalum horsfieldii Benn. The sesquiterpene components were α-Cubeben, α-
Ylangen, Copaen, β-Elemen, Calaren, α-Bergamoten, α-Humulen, Alloaromadendren, β-
Muurolen, Caryophylen, γ-Cadinen, Calamanen, α-Muurolen, 3,4-dihydro-5-ethyl-1-
tetralone, Caryophylenoxide, Humuleneoxide, α-Calarocene, (4- β)-verrucarol trihotec-9-ene.
The molecular structures of sesquiterpenes were analyzed by GC-MS and compared to library
data. The structures of stigmasterol was elucidated on the basis of spectral evidence.
Key words: Saccopetalum horsfieldii Benn, sesquiterpenes, stigmasterol.
2954.14, 2953.92, 2868.41, 1466.03, and 204; 18.1, 204; 18.642,220; 19.017, 220;
1055.16; EI-MS m/z: 414 [M+]; 1H-NMR 19.575. 200; 19.825, 198; 21.058, 266;
(CDCl3, 400 MHz) δ: 1.23 (m, 4H), 1.64 – 1.67 21.142, 266.
(m, 12H), 3.51 (s, 1H), 1.95 (m, 2H), 5.34 (m,
Discussion
1H), 1.85 (s, 1H), 1.01 (s, 2H); 13C-NMR
The purity test of the crystal of fraction A2 was
(CDCl3, 400 MHz) δ: 1.83, 18.76, 19.03, 19.36,
conducted by TLC using 3 different mobile
19.79, 21.06, 23.05, 24.27, 26.10, 28.21, 31.88,
phases and its melting point. For each mobile
33.93, 36.12, 36.46, 37.24, 39.76, 40.45,
phase, only one spot was observed on the TLC
42.29, 45.82, 50.13, 56.21, 56.75, 56.76, 56.84,
plate. From both observations, it can be
71.72, 121.61, 129.26, 138.27, 140.75.
deduced that the isolate crystal was pure.
Oily liquid of fraction A1: GC-MS [Rt
The EI-MS m/z 414 [M+], together with the 1H
(minutes), m/z]: 15.075, 204; 15.467, 204;
and 13+C NMR spectra prompted the molecular
15.583, 204; 15.758, 204; 16.242, 204; 16.408,
formula C29H50O, supported by the
204; 16.817, 204; 17.325, 204; 17.400, 204;
phytochemical screening which indicated that
17.492, 204; 17.642, 204; 17.758, 204; 17.950,
the isolated compound was a steroid. The mass ppm. The 1H NMR spectrum displayed signals
spectrum is shown in figure 1. at 2.26 – 1.01 ppm, representing the methylene
and methyne group, whereas intensive signals
Its IR spectrum displayed vibration peaks at
at 0.92 – 0.70 ppm represented the methyl
(cm-1) 3441.32, 2953.92 and 16300.00,
group. The signal at δ 5.34 (m) indicated a
suggesting the presence of hydroxyl, -CH2- and
proton attached to C=C double bond, whereas
>C=C< group. The IR spectrum of the crystal
the signal at δ 5.12 (2H, dd, J= 7.6 Hz and J=
is shown in figure 2.
14.8 Hz) represented protons attached to double
The presence of the hydroxyl group was also bond (-CH=CH-) (Friebolin, 1993). The 1H
supported by the signal of the 1H NMR NMR spectrum of the isolated crystal is
spectrum at δ 3.51 (s) and 13 C NMR at δ 71.72 displayed in figure 3.
29
28
21 22
20 26
19 24
23 25
12
11 13 17 27
18
1 16
2 9 14 15
10 8
3
5 7
HO 4 6
Figure 5. Structure of stigmasterol
Zhe-Ming, G., Xin-Ping, F., Riesser, M.J., Yu-Hua, Annonaceae Acetogenin: Bullatanocine and cis- and
H., Miesbaur, R.l., Smith, L.D., Wood, K.V., trans- Bullatanocinone from Annona bulata,
McLaughlin, L.J., 1992, New Cytotoxic Tetrahedron, 49, 747-757.
Ibrahim Baba1), Yang Farina Abdul Aziz2) dan Abdul Hamid Othman3)
Abstrak
Penyelidikan sebatian ditiokarbamat di UKM telah berjaya menemui pelbagai kaedah sintesis
dan sebatian baru daripada pelbagai jenis amina. Lebih daripada dua ratus sebatian
ditiokarbamat baru telah berjaya diasingkan menggunakan pelbagai kaedah sintesis dan
pencirian untuk mengetahui ketulenan dan strukturnya. Sintesis menggunakan kaedah
metatesis dan kondensasi telah berjaya menghasilkan sebatian ditiokarbamat daripada jenis
M[S2CNR′R″] n dan RmSn[S2CNR′R″] 4-m (n dan m = 2 atau 3 ; R = alkil dan fenil ; R′ = alkil
primer, sekunder atau hidroksi; R″ = alkil primer, sekunder atau hidroksi ; M = logam). Di
samping itu aduk sebatian ditiokarbamat dengan 2,2’-bipiridil dan 1,10-fenantrolin juga telah
berjaya dihasilkan menggunakan kaedah yang sama. Sebatian ditiokarbamat terbitan N-
metilglisina dengan formula umum M[S2CN(CH3)CH2COOH] n (M = logam; n = 2 atau 3)
juga telah berjaya disintesis dan dicirikan yang menunjukkan stoikiometri nisbah logam:ligan
adalah 1:2. Di samping itu sebatian organostanum(IV) ditiokarbamat terbitan N-metilglisina,
alanina dan hidroksiprolina juga telah berjaya disintesis dengan formula umum
R2Sn[(S2CNR’CH2CO2)] 2 (R = CH3, C4H9 dan C6H5; R’ = H dan CH3). Secara umumnya,
majoriti sebatian ditiokarbamat yang berjaya diasingkan telah menggunakan kaedah
kondensasi secara in-situ dalam pelarut etanol, metanol atau air pada suhu rendah. Ujian
kestabilan terhadap terma menunjukkan kesemua sebatian ditiokarbamat stabil di bawah
suhu 900C. Di samping itu lebih daripada lima puluh hablur tunggal sebatian ditiokarbamat
telah berjaya diketahui strukturnya dengan menggunakan kaedah kristalografi sinar X.
Kajian awal sifat anti-mikrob telah menunjukkan kebanyakan sebatian ditiokarbamat
sederhana aktif terhadap beberapa jenis fungi. Ujian sitotoksisiti pula menunjukkan
sebahagian sebatian ditiokarbamat aktif terhadap sel leukemia HL-60 dengan nilai CD50 di
bawah 5 µg/mL. Ujian terhadap polimer untuk sifat antioksida dalam adunan NR:LLDPE
terhadap penuaan haba telah menunjukkan pengekalan kekuatan tegangan sehingga 60%
berbanding kawalan sebanyak 32% selepas penuaan lapan hari dalam ketuhar.
Kata kunci : ditiokarbamat, sintesis dan ujian aplikasi
(-)
S S S
1 2 1 2 1 2
M C NR R M C NR R M C NR R
S S S (-)
(a) (b)
(a) (b)
(a) (b)
(a) (b)
zink(II) metiletanolditiokarbamat (2.1 cm) atau ianya mempunyai kereaktifan yang tinggi
stibium(III) dietanolditiokarbamat (3.4 cm) terhadap bahan polimer sebagai antioksida jika
terhadap bakteria S. aureus SKUK 73 dan dibandingkan dengan logam lain. Contohnya,
kadmium(II) dietanolditiokarbamat (1.6 cm) empat sebatian ditiokarbamat yang dipilih
terhadap bakteria S. typhi SKUK 60. adalah zink(II) etilbutil-, sikloheksilisopropil-,
etilisopropil- dan isopropiletanolditiokarbamat
Ujian Sitotoksik. Hampir kesemua sebatian
serta antioksida komersial yang dibekalkan
ditiokarbamat yang mudah larut telah dilakukan
dicampurkan dalam formulasi adunan
ujian awal sitotoksik. Ujian penyaringan
NR:LLDPE (Getah asli:Polietilena linear
aktiviti sitotoksik terhadap sel leukemia
berketumpatan rendah) pada kepekatan (%
manusia jenis “promyelocytic” (HL-60) telah
berat) yang berlainan. Formulasi ini
dijalankan terhadap beberapa sebatian
dibandingkan dengan formulasi tanpa
ditiokarbamat pilihan. Penunjuk aktiviti
antioksida (kawalan) yang digunakan untuk
sitotoksik berdasarkan kepada nilai CD50, iaitu
mengkaji kesan pelbagai antioksida pada
kepekatan sebatian yang diperlukan untuk
kepekatan berlainan ke atas sifat mekanikal
mengurangkan pertumbuhan sel kanser pada
bagi adunan NR-LLDPE sebelum dan selepas
paras 50%.
penuaan ketuhar.
Hasil kajian untuk beberapa sebatian
Ujian menunjukkan kesemua sebatian
organostanum ditiokarbamat, contohnya
ditiokarbamat yang diuji dapat melindungi
trifenilstanum(IV) ditiokarbamat menunjukkan
adunan NR:LLDPE terhadap penuaan haba.
aktiviti sitotoksik yang lebih baik jika
Sebagai contohnya, adunan yang mengandungi
dibandingkan sebatian dibutilstanum(IV).
zink(II) etilisopropilditiokarbamat dan zink(II)
Kesemua sebatian dibutilstanum(IV) dan
isopropiletanolditiokarbamat boleh
trifenilstanum(IV) dikategorikan sebagai
mengekalkan kekuatan tegangan masing-
sebatian yang mempunyai keaktifan yang tinggi
masing sebanyak 54, 55, 55 dan 59%
terhadap sel leukemia HL-60 kerana nilai CD50
berbanding dengan adunan tanpa antioksida
nya adalah < 5.0 µg/mL (0.17 –0.92 µg/mL).
(kawalan) yang hanya dapat mengekalkan
Ini bersesuaian dengan kajian yang dilakukan
kekuatan tegangan sebanyak 32% sahaja
oleh Crowe (1987) melaporkan kebanyakan
selepas penuaan selama 8 hari dalam ketuhar.
sebatian organostanum terutamanya sebatian
Nilai ini menunjukkan bahawa sampel polimer
triorganostanum telah menunjukkan ciri-ciri
yang mengandungi sebatian ditiokarbamat
sitotoksik yang kuat terhadap beberapa sel
mempunyai jangka hayat yang lebih panjang
tumor.
jika dibandingkan dengan antioksida komersial.
Ujian Antioksida. Sebatian ditiokarbamat
2% Zink(II) sikloisopropilditiokarbamat > 1%
daripada logam zink sahaja telah dipilih untuk
Zink(II) etilbutiditiokarbamat > 1% Zink(II)
ujian ini kerana kajian terdahulu menunjukkan
sikloheksilisopropilditiokarbamat > 2% WSP >
Berdasarkan ujian awal ujian aktiviti biologi Bradley, D.C. & Gitlitz, M.H. (1969). Preparation
and properties of N,N-dialyldithiocarbamates of
dan antioksida menunjukkan terdapat beberapa
early transition elements. J. Chem. Soc. (A): 1152-
sebatian ditiokarbamat yang menunjukkan 1156.
potensi yang positif sebagai agen antimikrob,
antikanser dan antioksida. Namun begitu ujian Casas, J.S., Castaño, M.V., Freire, C., Sánchez, A.
lanjut harus dilakukan terhadap sebatian Sordo, J., Castellano, E.E. & Zukerman-Schpector,
J. (1994). Dithiocarbamates of
tersebut untuk memastikan keberkesanannya.
dimethylthallium(III). Crystal structure of
6. Penghargaan dimethyl(di-n-propyldithiocarbamato)thallium(III).
Setinggi penghargaan diberikan kepada Inorg. Chim. Acta 216: 15-20.
Kerajaan Malaysia melalui MOSTE untuk gran Crowe, A.J. (1987). The chemotherapeutic
IRPA - IRPA 02-07-03-017, 09-02-02-0010, properties of tin compounds. Drug Future 12: 55-
IRPA 09-02-02-0096 dan 09-02-02-0048- 275.
EA144. Kepada pelajar siswazah Normah Farina, Y., Othman, A.H., Baba, I., Sivakumar, K.,
Awang, Kamariah Muda, Sukeria Ibrahim, Lai Fun, H.K. & Ng, S.W. (2000). Bis(N,N-
Fook Chuan, Low Kean Yong, Karimah bisdihydroxyethyldithiocarbamato)dimethyltin(IV).
Kassim, Yong Soon Kong dan Indah Raya Acta Cryst. E56: e84-e85.
Frank, N., Christmann, A. & Frei, E. (1995). Radha, K., Aravamudan, G., Rajalakshmi, A., Rout,
Comparative studies on the pharmacokinetics of G.C. and Seshasayee M., (1986). Synthesis and
hydrophilic prolinedithiocarbamate, properties of tris(bis(2-hydroxyethyl)-
sarcosinedithiocarbamate and the less hydrophilic dithiocarbamato)halotellurium(II) (‘halo’=SCN-, Br-
diethyldithiocarbamate. Toxicology 95: 113-122. , I-) and the crystal structure of the thiosyanato-S
complex, [Te2{(HOCH2CH2)2NCS2}3SCN]. Aust. J.
Glinskaya, L.A., Klevtsova, R.F. & Zemskova, S.M.
Chem. Soc. 39: 847-854.
(1992). Crystal and molecular structures of volatile
complexes formed by Schubart, R. (1985). Dithiocarbamic acid and
bis(diethyldithiocarbamato)cadmium with 1,10- derivatives. Bayer AG, Leverkusen, Federal
phenanthroline and 2,2’-bipyridyl. J. Struct. Chem. Replublic of Germany. Ulmann’s Encyclopedia of
33(1): 106-114. industrial chemistry A9: 1-27.
Ivanchenko, A.V., Gromilov, S.A., Zemskova, S.M. Sharma, C.P., Kumar, N., Khandpal, M. C.,
& Baidina, I.A. (2000). Investigation of complexes Chandra, S. & Bhide, V.G. (1981). Studies on the
of zinc(II) and cadmium(II) di-n- preparation and characterisation of bis-
butyldithiocarbamate with 2,2’-bipyridyl. J. Struct. dithiocarbamato derivatives of di-n-butyl- and di-n-
Chem. 41(1): 88-95. hexyl Sn(IV). J. Inorg. Nucl. Chem. 43: 923-930.
Jian, F.F., Wang, Z.X., Bai, Z.P., You, X.Z., Fun, Thirumaran, S., Venkatachalam, V., Manohar, A.,
H.K. & Chinnakali, K. (1999). Structure of Ramalingam, K., Bocelli, G. & Cantoni, A. (1998).
bis(dipropyldithiocarbamate) cadmium(II), [Cd2(n- Synthesis and characterization of bis(N-methyl-N-
Pr2dtc)4] (dtc = dithiocarbamate). J. Chem. ethanol-dithiocarbamato)M(II) (M = Zn, Cd, Hg)
Crystallogr. 29(2): 227-231. complexes and bis(N,N-
(iminodiethylene)bisphthalimidedithiocarbamato)M
Low, K.Y., Baba, I., Farina, Y., Othman, A.H.,
(II) (M = Zn, Cd, Hg) complexes. Single crystal X-
Ibrahim, A.R. & Fun, H.K. (2001). Crystal
ray structure of bis(di(2-hydroxyethyl)-
structures of tris(2-
dithiocarbamato)zinc(II). J. Coord. Chem. 44: 281-
hydroxyethylisopropyldithiocarbamato)antimony
288.
and tris(2-
hydroxyethylisopropyldithiocarbamato)bismuth Thorn, G.D. & Ludwig, R.A. (1962). The
hemihidrates. Main Group Metal Chem. 24(7): 451- dithiocarbamates and related compounds.
452. Amsterdam-New York: Elsevier Publishing
Company.
Nomura, R., Takabe, A. & Matsuda, H. (1987).
Facile synthesis of antimony dithiocarbamate Van Gaal, H.L.M., Diesveld, J.W., Pijpers, F.W. &
complexes. Polyhedron 6(3): 411-416. Vander Linden, J.G.M. (1979). 13C NMR spectra of
dithiocarbamates. Chemical shifts, carbon-nitrogen
Okamoto, K., Kirchhoff, J.R., Ho, D.M. and
stretching vibration frequencies, and π bonding in
Deutsch, E. (1993). Preparation, characterization
the NCS2 fragment. Inorg. Chem. 18(11): 3251-
and electrochemical properties of technetium(II)
3260.
complexes with 1, 2-bis(diethylphosphino) ethane
(DEPE) and dithiocarbamate ligands. Single crystal Xu, L.Z., Zhao, P.S. & Zhang, S.S. (2001). Crystal
analysis of [Tec{(CH3)2NCS2}(DEPE)2(PF6)]. structure and characterization of Pd(II)
Polyhedron 12(12): 1559-1568. bis(diisopropyldithiocarbamate) complex. Chinese
J. Chem. 19(4): 436-440.
Elektroda Pasta Karbon yang Dimodifikasi dengan Xilenol Oranye untuk Analisis
Timbal
Abstract
Pada penelitian ini elektroda pasta karbon yang dimodifikasi dengan xilenol oranye (XO)
telah dikembangkan untuk analisis ion Pb2+ di dalam beberapa matriks air. Xilenol oranye
menunjukkan kemampuan untuk mengakumulasi ion Pb2+ lebih banyak di permukaan
elektroda sehingga pengukuran menjadi lebih sensistif. Elektroda ini memiliki daerah linier
hingga konsentrasi ion Pb2+ terendah 1 ppb. Kebolehulangan pengukuran elektroda sangat
baik dengan standar deviasi pengukuran 6,5%. Analisis spike sampel dalam matriks air laut,
air sungai dan air mineral menunjukkan bahwa elektroda ini memberikan akurasi
pengukuran yang sangat baik dengan persen perolehan kembali berkisar antara 97 – 103 %
pada daerah konsentrasi ion Pb2+ antara 0,01 – 10 ppm. Akurasi pengukuran sedikit
berkurang pada konsentrasi yang lebih rendah.
Abstrak
Poli(hidroksibutirat-co-valerolakton) P(HB-co-VL) telah disintesis secara kimia melalui
kopolimerisasi pembukaan cincin monomer (R,S)-β -butirolakton rasemik dengan δ-
valerolakton pada berbagai komposisi monomer dengan menggunakan
tetraisobutildialuminoksan sebagai katalis. Pada makalah ini dilaporkan studi lebih lanjut
mengenai struktur kopolimer berdasarkan analisis distribusi sekuen diad kopolimer melalui
penentuan intensitas puncak resonansi gugus karbonil (RMN 13C). Dari analisis faktor
kereaktifan monomer terhadap katalis yang digunakan telah ditunjukkan bahwa kereaktifan
monomer δ-valerolakton (δ-VL) lebih tinggi dibandingkan kereaktifan monomer β-
butirolakton (β-BL) (rVL = 7,89, dan rBL = 0,65). Dari hasil tersebut telah diperkirakan bahwa
kopolimer hasil sintesis tersusun dari campuran homopolimer PVL dan PHB dengan sekuen
PVL lebih panjang dari sekuen PHB. Dari analisis distribusi sekuen diad kopolimer diusulkan
bahwa kopolimer hasil sintesis tersusun dari kopolimer blok dengan ukuran blok bervariasi.
Berdasarkan analisis sifat termalnya, kopolimer memiliki temperatur transisi glass tunggal
yang berada diantara temperatur transisi glass homopolimer murninya. Hasil ini dapat
mendukung hasil analisis faktor kereaktifan monomer dan distribusi sekuen diad kopolimer
bahwa kopolimer hasil sintesis merupakan campuran polimer kompatibel.
Kata Kunci : Sintesis, kopolimer, aluminoksan, butirolakton, valerolakton
hidrogen methilen (CH2) untuk unit VL (Gb.2). komonomer dari masing-masing unit (BL dan
Hasil-hasil tersebut menunjukkan bahwa VL), juga terdapat pengaruh taktisitas dari unit
komposisi komonomer dalam kopolimer BL sendiri.
hampir identik dengan komposisi awal
Spektra RMN 13C pada 50,3 MHz untuk
monomer (Tabel 1). Pada studi sebelumnya
kopolimer P(HB48-co-VL52) dapat dilihat
berdasarkan analisis faktor kereaktifan
pada Gb.4a. Dalam analisis ini, daerah puncak
monomer yang dihitung dari data komposisi
resonansi yang khusus diperhatikan adalah
awal monomer (fB) dan data komposisi
puncak resonansi karbon karbonil disekitar
komonomer dalam kopolimer (FB) berdasarkan
169,19–173,18 ppm (Gb.4b). Dalam daerah
metode Fineman-Ross diperoleh besarnya
tersebut terlihat dua puncak resonansi
faktor kereaktifan masing-masing monomer
tambahan pada 170,13 dan 172,25 ppm
dalam kopolimer P(HB-co-VL) adalah rBL =
disamping puncak resonansi kabon karbonil
0,65 dan rVL = 7,89 (Arcana et al., 2004). Hasil
yang berhubungan dengan homopolimer PHB
ini menunjukkan bahwa kedua pusat aktif
dan PVL yang masing-masing terletak pada
perpanjangan rantainya (⎯VL* dan ⎯BL*) 169,19 ppm dan 173,18 ppm. Adanya dua
dalam kopolimerisasi lebih cendrung mengikat puncak resonansi tambahan dapat disebabkan
monomer δ-VL dibandingkan monomer β-BL, oleh adanya pengaruh diad sekuensial akibat
sehingga cenderung terbentuk homo-polimer lingkungan karbon karbonil dalam rantai
PVL dan PHB atau kopolimer blok dengan polimer berbeda. Jadi 4 sekuen diad
panjang sekuen blok bervariasi. komonomer dapat terdeteksi dimana dua
Berdasarkan analisis termal dengan DSC telah puncak resonansi berhubungan dengan karbon
ditunjukkan bahwa kopolimer memiliki karbonil dari unit BL : [BL-BL] dan [BL-VL]
temperatur transisi glas bervariasi dari 2oC dan dua lainnya berhubungan dengan karbon
sampai -62oC sesuai dengan komposisi karbonil dari unit VL : [VL-VL] dan [VL-BL].
komonomernya, dimana makin tinggi
Sekuen diad komonomer [BL-BL] dan [VL-
komposisi VL dalam kopolimer temperatur
transisi glasnya semakin menurun. Dari analisis VL] masing-masing terdistribusi pada puncak
tersebut telah diperlihatkan adanya satu resonansi untuk homopolimer PHB pada
temperatur transisi glass yang berada diantara 169,19 ppm dan untuk PVL pada 173,18 ppm.
temperatur transisi glass dari PVL dan PHB Jadi secara logika puncak resonansi untuk
(Gb.3), dan temperatur transisi glass hasil sekuen diad komonomer [BL-VL] pada 170,13
perhitungan menurut persamaan Fox dan ppm terletak dekat dengan puncak resonansi
Cauchman-Karasz ternyata terdapat kesesuaian sekuen diad [BL-BL] yakni pada 169,19 ppm.
dengan temperatur transisi glass yang diperoleh Dengan cara yang sama, maka puncak
langsung lewat termogram DSC (Arcana et al., resonansi pada 172,25 ppm dapat
2004). dihubungkankan untuk sekuen diad
komonomer [VL-BL].
Pada makalah ini akan disampaikan hasil studi
lebih lanjut mengenai struktur kopolimer Perluasan puncak resonansi karbon karbonil
berdasarkan distribusi sekuen diad kopolimer untuk BL (Gb. 4b) memperlihatkan tiga puncak
dengan analisis RMN 13C yang memungkinkan utama untuk diad komonomer [BL-BL] dan
akan lebih jelas memperkirakan struktur dua puncak untuk diad [BL-VL] Adanya
kopolimer sebenarnya. puncak-puncak resonansi tersebut mungkin
dapat dihubungkan karena adanya pengaruh
Untuk menentukan distribusi komonomer
taktisitas dari unit BL. Puncak pada 169,15
dalam kopolimer P(HB-co-VL) digunakan
ppm untuk diad [BL-BL] ditandai sebagai
spektroskopi RMN 13C . Studi ini sangat
puncak resonansi sekuen diad isotaktik yakni
menarik untuk mengetahui struktur kopolimer
dengan cara membandingkannya dengan
hasil sintesis, apakah kopolimer tersebut
puncak resonansi karbon karbonil dari
merupakan kopolimer selang-seling
homopolimer PHB sintetik, dan puncak pada
(alternating copolymer), kopolimer statistik
169,25 ppm ditandai sebagai puncak resonansi
atau kopolimer blok. Akan tetapi spektra RMN
13 sekuen diad sindiotaktik. Dari integrasi puncak
C untuk kopolimer tersebut cukup komplek
resonansi tersebut diperoleh fraksi diad
karena disamping adanya pengaruh
isotaktik sebesar 50 %. Nilai tersebut identik
Perlu diperhatikan bahwa lingkungan α dan β Tabel 3 memperlihatkan nilai fraksi sekuen
karbon karbonil untuk unit sentral BL adalah diad komonomer hasil perhitungan dan hasil
identik untuk masing-masing dua sekuen triad observasi langsung dari pengukuran puncak
(BL-BL-BL) dan (VL-BL-BL) dan dua sekuen resonansi karbon karbonil spektrogram RMN
13
triad (BL-BL-VL) dan (VL-BL-VL). Dengan C untuk kopolimer P(HB-co-VL) yang
cara yang sama untuk unit sentral VL. disintesis dengan katalis distanoksan. Secara
Kemudian diasumsikan bahwa pergeseran umum terdapat kesesuaian antara fraksi diad
kimia karbon karbonil dalam unit sentral dari hasil perhitungan dengan fraksi diad hasil
sekuen triad (BL-BL-BL) dan (VL-BL-BL) observasi langsung dari puncak resonansi
adalah identik atau sangat berimpit. Dari karbon karbonil pada 169,2 ppm - 173,2 ppm.
hipotesis ini, maka dapat ditentukan bahwa Akan tetapi fraksi sekuen diad (BL-BL) hasil
sekuen diad (BL-BL) mencakup dua sekuen observasi sedikit lebih besar dibanding fraksi
triad (BL-BL-BL) dan (VL-BL-BL). Dengan sekuen diad hasil perhitungan, sedangkan fraksi
cara yang sama diperoleh sekuen diad lainnya sekuen diad (BL-VL), (VL-BL), dan (VL-VL)
sebagai berikut: cendrung lebih kecil (Tabel 3). Hasil ini
menunjukkan bahwa dalam kopolimer
* *
(BL-BL-BL) (BL-BL-VL) cenderung lebih banyak mengandung blok BL
(BL-BL) (BL-VL)
*
(VL-BL-BL) *
(VL-BL-VL) dan blok VL dibandingkan kopolimer statistik
seperti yang diharapkan.
Lampiran
CH3 O O
Gambar 2. Spektra RMN 1H pada 400 MHz untuk Gambar 3. Termogram DSC untuk P(HB-co-VL)
P(48HB-co-52VL) sebagai fungsi komposisi PHB/PVL
Gambar 4a. Spektra RMN 13C pada 100 MHz untuk Gambar 4b. Perluasan puncak resonansi karbon
P(48HB-co-52VL) karbonil pada spektra RMN 13C pada 100 MHz
untuk P(48HB-co-52VL)
Jurusan Pendidikan Kimia, FPMIPA, IKIP Negeri Singaraja, Jalan Udayana Singaraja, Bali 81117
e-mail: wayanmuderawan@yahoo.com.au
Abstrak
Telah dilakukan penelitian sintesis terhadap forbazol dan turunannya. Forbazol B, baru dan
turunannya dapat disintesis melalui 4 tahap reaksi dari sinton A dan B dengan rendemen
yang tinggi.
Sinton A, 1-(p-tosil)pirol-2-karbonil klorida, dapat disintesis dari pirol melalui dua langkah
reaksi yaitu : (i) reaksi substitusi atom hidrogen dengan gugus tosil menghasilkan p-tosil
pirol dan (ii) reaksi asilasi Fridel-Crafts terhadap p-tosil pirol untuk menghasilkan 1-(p-
tosil)pirol-2-karbonil klorida. Sedangkan sinton B, suatu garam fenasil amonium klorida,
dapat disintesis dari asetofenon melalui tiga tahap reaksi yaitu : (i) reaksi brominasi dengan
menggunakan dioksan dibromida menghasilkan fenasil bromida dan turunannya, (ii) reaksi
substitusi dengan menggunakan heksametilenatetramina menghasilkan suatu garam amonium
kuaterner dan (iii) reaksi pembentukan garam fenasil amonium klorida.
Kerangka dasar forbazol dan turunannya dapat disintesis dari sinton A dan B melalui tiga
tahap reaksi yaitu: (i) reaksi penggabungan kedua sinton tersebut dalam piridin untuk
menghasilkan suatu amida, (ii) siklodehidrasi senyawa amida dengan menggunakan pereaksi
fosforoksiklorida menghasilkan senyawa oksazol terproteksi dan (iii) hidrolisis senyawa
oksazol terproteksi dengan basa NaOH dalam metanol menghasilkan kerangka dasar forbazol
dan kerangka dasar turunannya.
Selanjutnya forbazol dan turunannya dapat disintesis langsung dari kerangka dasarnya
melalui reaksi substitusi elektrofilik aromatik, SEAr, dengan menggunakan pereaksi sulfuril
klorida.
Kata kunci : forbazol, reaksi penggabungan, siklodehidrasi, hidrolisis, klorinasi.
dkk. 1994). Keempat forbazol ini, A-D, cukup Tulisan ini menguraikan sintesis forbazol baru
unik karena belum pernah ditemukan di alam dan turunannya.
dan keempat forbazol ini mengandung
2. Percobaan
kerangka dasar sama, hanya berbeda satu sama
Sinton A dan B dibuat sesuai dengan prosedur
lainnya dalam substitusi atom klor sepanjang
yang dilaporkan oleh Loughlin dkk (1999).
kerangka dasar tersebut, Gambar 1.
2.1 Reaksi penggabungan sinton A dan B.
R2
R1
Sinton A 2 (0,02 mol) dan sinton B 5 (0.02
R3 N mol) dilarutkan dalam piridin (20 mL) dan
diaduk pada suhu kamar selama 48 jam. Air (50
R4 N O mL) ditambahkan pada campuran reaksi dan
R lapisan airnya diekstrak dengan kloroform (3 x
OR 50 mL). Gabungan lapisan organiknya dibilas
(A) R = R4 = H; R 1 = R2 = R3 = Cl
dengan larutan jenuh Na2CO3 dan larutan jenuh
(B) R = R1 = H; R 2 = R3 = R4 = Cl
NaCl, kemudian keringkan dengan Na2SO4
(C) R = R1 = R4 = H; R 2 = R3 = Cl
anhidrat, dan pelarutnya diuapkan dengan
(D) R = R1 = R3 = R4 = H; R 2 = Cl
rotavapor vakum. Residu yang diperoleh
Gambar 1. Struktur molekul forbazol A- direkristalisasi dengan menggunakan pelarut
D diklorometana-heksana sehingga diperoleh
Keempat senyawa tersebut diekstrak dari spong senyawa amida berupa kristal berwarna coklat.
Phorbas aff. clathrata dengan pelarut etil asetat Titik leleh senyawa 6a: 116-119oC; senyawa
dan satu sama lainnya dipisahkan dengan 6b: 142 - 143oC.
kromatografi flash vakum dan kolom sephadex
LH-20 dari ekstrak etil asetatnya, dan diperoleh 2.2. Reaksi siklodehidrasi
forbazol A (2,5 %), forbazol B (0,25 %), Senyawa karboksamida 7 hasil penggabungan
forbazol C (0,025 %) dan forbazol D (0,01%) (0,01 mol) dilarutkan dalam fosfor oksiklorida
(Rudi dkk. 1994). Keempat forbazol tersebut (50 ml) yang baru didistilasi dan direfluks
telah ditentukan strukturnya dengan difraksi selama 2 jam pada suhu 110oC, kemudian
sinar-X dan teknik resonansi magnet inti 1D dibiarkan suhunya turun hingga mencapai suhu
dan 2D. Penelitian pendahuluan menunjukkan kamar dan diaduk lebih lanjut selama 2 jam.
bahwa forbazol memiliki efek Kelebihan fosfor oksiklorida diuapkan dengan
imunomodulatori. Karena kadarnya yang evaporator di bawah pengurangan tekanan,
sangat sedikit dan menunjukkan sifat aktivitas sehingga diperoleh suspensi coklat gelap. Ke
biologis maka perlu usaha untuk dalam suspensi tersebut ditambahkan dengan
mensintesisnya di laboratorium sehingga air (25 mL) dan larutan amoniak sehingga
tersedia dalam jumlah yang cukup untuk larutan menjadi basa. Larutan dalam air yang
keperluan penelitian tentang uji bioktivitas dan diperoleh diekstrak dengan diklorometana (3 x
keperluan lainnya. 50 mL), dan hasil ekstraksi dikeringkan dengan
Na2SO4 anhidrat. Diklorometana diuapkan
Fragmen terpenting dari struktur dasar forbazol dengan evaporator sehingga diperoleh padatan
adalah sistem oksazol, karena itu dalam usaha yang selanjutnya direkristalisasi dengan pelarut
untuk mensintesis forbazol yang terpenting diklorometana-heksana untuk mendapatkan
adalah mencari metode sintesis untuk membuat kristal coklat. Titik leleh senyawa 7a: 108-
sistem oksazol tersebut. Usaha untuk 109oC; senyawa 7b: 152-153oC.
mensisntesis senyawa forbazol telah dilakukan
oleh beberapa peneliti. Loughlin dkk (1999) 2.3 Reaksi hidrolisis
telah berhasil mensintesis keranngka dasar Senyawa oksazol 7 hasil siklisasi (7,6 mmol)
oksazol dari karbonil klorida dan fenasil amina. dan sodium hidroksida (15 mL, 5M) dalam
Sedangkan Radspieler dan Liebscher (2001) metanol (25 mL) dipanaskan dan direfulks
berhasil mengembangkan metode sintesis selama 3,5 jam, kemudian metanolnya
senyawa klorooksazol dari asil sianida, aldehid diuapkan dengan evaporator sehingga diperoleh
dan hidrogen klorida, dan menggunakan residu. Residu dalam air diekstrak dengan etil
metode tersebut untuk mensintesis isomer asetat (3 x 25 mL) dan ekstrak yang diperoleh
forbazol A, akan tetapi gagal menggunakan dibilas dengan larutan natrium klorida,
metode tersebut untuk mensintesis forbazol A. dikeringkan dengan Na2SO4 anhidrat, dan
O
-
Cl+H3N
R R R
H R
N N N
O O O +
O
N O
N H N Ts
Ts N
Cl
Ts
Skema 1. Retrosintesis forbazol
1. K/THF AlCl3/(COCl)2
O
N 2. p-TsCl N DCM N
Cl
H Ts Ts
(1) (2)
O H
O
- +
Cl H3N N
piridin
+ R
N N
Cl O O
Ts R Ts
(2)
(5a) R = OSO2CH3 (6a) R = OSO2CH3 (72,4 %)
(5b) R = OCH3 (6b) R = OCH3 (78,0 %)
POCl3
N N
NaOH
O MeOH O
N R N R
H Ts
(8a) R = OH (68,8 %) (7a) R = OSO2CH3 (69,0 %)
(8a) R = OCH3 (96,0 %) (7b) R = OCH3 (89,1 %)
SOCl2, yang memberikan campuran produk merupakan Csp2, ini berarti struktur senyawa
yang kompleks atau tidak memberikan hasil kerangka dasar forbazol dan turunannya
reaksi. mendekati bidang datar. Hal ini sesuai dengan
model struktur tiga dimensi yang dibuat dengan
Deproteksi atau penghilangan gugus pelindung
menggunakan program software
nitrogen pirol dan metanasulfonil dari kerangka
ACD/Chemsket Versi 5.2, Gambar 2. Sudut
forbazol terproteksi 7a diperlukan untuk
torsi (torsion angle) antara bidang yang
menghasilkan kerangka dasar forbazol.
dibentuk oleh cincin pirol dengan cincin
Deproteksi gugus tosil pada senyawa 7a dapat
oksazol dan cincin oksazol dengan cincin
dilakukan melalui reaksi hidrolisis dengan
benzena masing-masing sekitar 1o dan -9o. Ini
natrium hidroksida (NaOH) dalam air-metanol
berarti sudut torsi antara bidang yang dibentuk
pada kondisi refluks selama 3,5 jam, dan
oleh cincin pirol dengan bidang yang dibentuk
dihasilkan kerangka dasar forbazol 8a (R =
oleh cincin benzena sekitar 10o. Ini berarti pula
OH), Skema 4. Dengan metode yang sama,
struktur kerangka dasar forbazol mendekati
maka dapat disintesis kerangka dasar turunan
bidang datar, dan ini memungkinkan terjadinya
forbazol 8b (R = OCH3) dari sinton A 2 dan
delokalisasi elektron atau konyugasi pada
sinton B 5b dengan rendemen masing-masing
semua bagian kerangka dasar forbazol. Dari
reaksi cukup tingi, Skema 4.
data dan analisis tersebut menunjukkan bahwa
Penentuan struktur kerangka dasar forbazol dan struktur senyawa yang diperoleh adalah benar
turunannya dilakukan dengan menggunakan dan sesuai dengan yang diharapkan.
spektrometer resonansi magnet inti (RMI), baik
3.3 Sintesis Forbazol dan Turunannya
proton (1H) dan karbon (13C) selain UV-Vis
Forbazol dan turunanya disintesis dengan
dan IR. Semua resonan atau signal hidrogen
mereaksikan kerangka dasarnya dengan
pada kerangka dasar forbazol dan turunannya
pereaksi sulfuril klorida, SO2Cl2. Dengan
muncul pada daerah downfild ini menunjukkan
menggunakan 1 mol ekivalen SO2Cl2 diperoleh
bahwa semua atom hidrogen yang terikat
hasil mono klorinasi, Skema 5. Hal ini dapat
langsung pada kerangka dasarnya terikat pada
dilihat dari hilangnya satu signal H pada hasil
Csp2. Sedangkan resonan hidrogen pirol
klorinasi menunjukkan telah terjadi mono
muncul jauh pada downfild yang menunjukkan
klorinasi.
bahwa hidrogen tersebut bersifat asam. Data
RMI 13C juga menunjukkan bahwa semua Klorinasi merupakan reaksi substitusi
karbon kerangka dasar forbazol dan turunannya elektrofilik pada sistem pirol dan ternyata
(a)
(b)
Gambar 2. Struktur tiga dimensi (a) senyawa 8a (R = OH) (b) senyawa 8b (R = OCH3).
N 4
N
3'
1,0 eq SO 2Cl2 2 5
2'
O 4' O
DCM, 0oC-rt
N 5' N
H R R
Cl H
(8b) OH (9b) OH (88,6 %)
(8a) OCH3 (9a) OCH3 (85,3 %)
Skema 5. Sinthesis forbazol dan turunannya.
N N 4
Cl
3' 2 5
3,5 eq SO 2Cl2 2'
O 4'
Cl O
N DCM, 0 oC-rt
5' N
H R R
Cl H
(9c) OH (9c) OH (88,5 %)
(9d) OCH3 (9d) OCH3 (87,7 %)
substitusi terjadi pada atom karbon nomor 5’. mono klorinasi pada C5’ sistem pirol. Dengan
Hal ini dapat diketahui dari analisis struktur demikian forbazol dan turunannya yang
molekulnya dengan menggunakan RMI. Pada diperoleh melalui sintesis ini merupakan
spectrum RMI 1H senyawa kerangka dasar senyawa baru dimana klor terikat pada
forbazol maupun turunannya 8 memiliki tiga C5’dalam sistem kerangka dasarnya dan
jenis resonan untuk H pada sistem pirolnya, berbeda dengan ke empat forbazol sebelumnya
yaitu H3’, H4’ dan H5’. Setelah klorinasi signal yang ditemukan oleh Rudi, dkk., dimana pada
H5’ lenyap sedangkan signal H3’ dan H4’ pada C5’ adalah terikat atom H dan klor tersebar
senyawa hasil klorinasi 9 masih. Ini berarti pada C3’ dan 4’. Perbedaan data RMI 1H juga
reaksi substitusi elektrofilik memberikan hasil didukung oleh data RMI 13C setelah
Asalan Batuan Serpentinit Di Sepanjang Sempadan Jalur Tengah Dan Jalur Barat
Semenanjung Malaysia
Abstrak
Singkapan-singkapan kecil jasad serpentinit di sepanjang sempadan Jalur Tengah dan Jalur
Barat Semenanjung Malaysia membentuk jajaran pada arah antara U340oT-U350oT.
Singkapan yang paling besar meliputi 7 km x ½ km yang didapati di Ceruh. Jajaran ini
dikenali sebagai Garisan Bentong Raub atau Sutura Bentong. Jasad-jasad serpentinit
tersebut tersingkap di Bukit Rokan Barat, Kampung Selaru, Petasih (Negeri Sembilan),
Cheruh-Bentong (Negeri Pahang) dan Kelantan barat. Jasad-jasad serpentinit ini
mempamerkan struktur-struktur yang dapat menjelaskan sejarah canggaan (deformasi) yang
berlaku di sepanjang sempadan Jalur Tengah dan Jalur Barat Semenanjung Malaysia.
Daripada data sesar didapati bahawa jasat-jasad serpentinit tersebut pernah mengalami
empat fasa canggaan. Hasil analisis kimia dengan kaedah “XRF”, menunjukkan bahawa
batuan serpentinit ini mempunyai kandungan SiO2 antara 40.51% hingga 46.05 %. Jasad
serpentinit ini kemungkinan berasalan dari batuan ultra bes peridotit yang merupakan batuan
bahagian dari kerak samudra.
Kata kunci; Jasad serpentinid, canggaan, dan peridotit
granitoid Gunung Noring dan Gunung Camah batuan serpentinit ini menghasilkan kandungan
merupakan pemisah daripada kelanjutannya Si02 ialah 41.04%.
iaitu di tepi barat Negeri Pahang dan boleh
Lokaliti Kampung Selaru
ditandai dengan Sungai Berias - Kuala Betis -
Panjang keseluruhan singkapan kurang lebih
Ulu Sungai Nenggiri - Sungai Telom - Cheroh
150 meter dan lebar 30 meter. Singkapan segar
- barat Raub - Teranum - Bentong - Karak. Dari
sepanjang 10 meter tersingkap di tepi jalan
Karak arah taburan batuan bertukar kepada
Selaru-Petasih, berwarna segar hijau tua-putih,
selatan-tenggara mengikuti Sungai Telemong -
terpotong-potong ricih sehingga terbentuk
Durian Tipus - Pertang - Kuala Pilah dan
struktur boudinage yang pada permukaannya
Bahau - Air Kuning - Jasin. Dekat Pertang dan
nampak licin seperti sabun dan mengadungi
Air Kuning dan dianjak ke kiri sejauh 10-20
gores yang jelas. Jasad serpentinit ini
km sepanjang ruas Zon Sesar Kuala Lumpur
membentuk liniasi antara N340oE-N350oE,
yang berjurus N110o – 120oE.
selari dengan jurus dan kemiringan foliasi
Pata pada Rajah 1 menunjukkan lokaliti batuan filit-syis yang melingkupinya iaitu
pengambilan sampel untuk dianalisis di N345oE/60o, struktur tersebut terpotong oleh
sepanjang sempadan antara Jalur Barat dan sesar dengan kedudukan N165oE/30o berupa
Jalur Tengah Semenanjung Malaysia. sesar mendatar kanan songsang (naik), seperti
terlihat pada Tabel 1. Dari contoh batuan
Observasi Lapangan
serpentinit ini memperlihatkan hampir semua
Observasi lapangan dilakukan pada singkapan-
mineral asal sudah terubah menjadi mineral
singkapan serpentinit di sepanjang sempadan
serpentin (Rajah 2B). Hasil analisis kimia
(batas) Jalur Tengah dan Jalur Barat
dengan metoda “XRF” daripada batuan
Semenanjung Malaysia, antara lain Bukit
serpentinit ini menghasilkan kandungan Si02
Rokan Barat, Kampung Selaru, Petasih,
ialah 41.39%.
Cheruh-Bentong dan Kelantan Barat, seperti
ternampak pada Rajah 1. Lokaliti Petasih
Diskripsi singkapan serpentinit adalah segar
sLokaliti Bukit Rokan Barat
dengan panjangnya 15 meter dan lebar 5 meter,
Diskripsi singkapan serpentinit : Singkapan
dijumpai di belakang dewan sekolah
segar sepanjang 30 meter dan lebar 10 meter,
kebangsaan Petasih. Singkapan ini berwarna
berwarna hijau tua-putih terletak di tepi jalan
hijau tua dengan permukaan yang licin dan
masuk ke kampung Bukit Rokan Barat
memperlihatkan gores . Pada kekar tensi terisi
Singkapan serpentinit nampak terpotong-
mineral karbon. Kedudukan foliasi batuan filit-
potong oleh ricih yang kuat sehingga terbentuk
syis N320oE/80o. Jasad serpentinit di sini
boudinage yang pada permukaannya nampak
membentuk liniasi antara N315oE-N320oE/80o
licin seperti sabun dan mengadungi gores yang
dan merakam empat generasi sesar seperti
sangat jelas. Struktur am : Secara am jasad
terlihat pada Tabel 1. Sayatan nipis dari contoh
serpentinit miring ke arah timur dengan dip
batuan serpentinit ini memperlihatkan hampir
antara 60o-70o selari dengan jurus dan
semua mineral asal sudah terubah menjadi
kemiringan foliasi filit-syis yang
mineral serpentin (Rajah 2C). Analisis kimia
melingkupinya iaitu N330oE/45o. Ricih
dengan metoda “XRF” daripada batuan
berkedudukan antara N330oE – N350oE/60o –
serpentinit ini menghasilkan kandungan Si02
70o, kemiringan dan liniasi gores-garis antara
ialah: 46.05% (selengkapnya seperti terlihat
30o-45o, N180oE – N190oE. dan merupakan
pada Tabel 2)
hasil dari sesar mendatar kanan songsang
Seluruh struktur ini dipotong oleh sesar Lokaliti Cheruh-Bentong
mendatar kanan N20oE/80o. Struktur minor di Diskripsi singkapan serpentinit di sini beberapa
dalam jalur ricih ternampak lipatan berskala kilometer, berupa bukit memanjang dengan
kecil dengan tunjaman 30o kearah N300oE liniasi N350oE, berwarna segar hijau tua-putih.
sebagai hasil daripada pergerakan sesar Kedudukan foliasi batuan filit-syis N320oE-
mendatar kiri songsang. Sayatan nipis dari N350oE/80o selari dengan kedudukan Jasad
contoh batuan serpentinit ini memperlihatkan serpentinit yang membentuk liniasi antara
hampir semua mineral asal sudah terubah N315oE-N320oE/80o dan banyak merakam
menjadi mineral serpentin (Rajah 2A). Hasil sesar. Sayatan nipis dari contoh batuan
analisis kimia dengan metoda “XRF” daripada serpentinit ini memperlihatkan sebahagian
daripada mineral asal sudah terubah menjadi mineral antigorit, swalerit, talk, walframit.
mineral serpentin dan sebahagian yang lain Contoh 4 kawasan Cheroh-Bentong
masih menunjukkan mineral batuan asal yang mengandungi mineral aktinolit, antigorit,
mengandungi olivine lebih dari 10% dan magnesium aluminium silikat, hidromagnesit.
memperlihatkan struktur opitik (Rajah 2D). Sedangkan contoh 5 kawasan Kelantan Barat
Analisis kimia : hasil analisis kimia dengan mengandungi mineral antigorit.
metoda “XRF” daripada batuan serpentinit ini
Dari hasil analisis kimia dengan metode “XRF”
menghasilkan kandungan Si02 : 40.51%
kelima contoh batuan serpentinit selanjutnya
(selengkapnya seperti terlihat pada Tabel 2)
kandungan unsur majornya dimasukkan dalam
Lokaliti Kelantan barat program CIPW Norm (Barker,1983) seperti
Diskripsi singkapan serpentinit adalah segar yang ternampak pada Tabel 3A-3E, maka untuk
dengan lebar 10 meter dijumpai pada keratan contoh batuan 1 kawasan Bukit Rokan Barat
jalan highway Gua Musang-Cameron Highland menghasilkan kandungan mineral: albit, akmit,
berwarna segar hijau tua-putih. Singkapan telah diopsit, enstatit, hipersten, fosterit, olivin,
tericih kuat. Kedudukan foliasi batuan syis-filit magnetit, hematit, ilmenit, dan apaiti. Contoh
yang meligkupi serpentinit N340oE- batuan 2 kawasan Kampung Selaru
o o
N350 E/75 . Jasad serpentinit di sini menghasilkan kandungan mineral: kuarza,
membentuk liniasi selari dengan liniasi filit- korundum, albit, akmit, enstatit, hipersten,
syis dan banyak merakam sesar (Rajah 2E). magnetit, ilmenit, hematit, dan kalsit. Contoh
Hasil analisis kimia dengan metoda “XRF” batuan 3 kawasan Petasih menghasilkan
daripada batuan serpentinit ini menghasilkan kandungan mineral: albit, akmit, diopsit,
kandungan Si02 ialah 40.51% (selengkapnya enstatit, hipersten, fosterit, olivin, magnetit,
seperti terlihat pada Tabel 2. ilmenit, hematit, dan apatit. Contoh batuan 4
kawasan Cheroh-Bentong menghasilkan
2. Hasil Kajian
kandungan mineral: albit, anortit, diopsit,
Batuan serpentinit yang merupakan salah satu
fosterit, olivin, ilmenit, hematit, titanit,
ciri sempadan antara Jalur Tengah dan Jalur
perovskit, dan apatit. Sedangkan Contoh batuan
Barat Semenanjung Malaysia merakamkan
5 kawasan Kelantan Barat menghasilkan
empat kali canggaan (Tabel 1). Caggaan
kandungan mineral: albit, anortit, diopsit,
pertama adalah hasil daripada tegasan daripada
enstatit, hipersten, fosterit, olivin, magnetit,
arah utara-timurlaut. Cangaan kedua dihasilkan
ilmenit dan hematit.
oleh canggaan dari arah timurlaut diukuti oleh
canggan dari timur dan akhir sekali daripada Analaisis ini disokong dengan sayatan nipis
timurlaut. batuan serpentinit seperti pada Rajah 2A-2E,
yang secara umum menunjukkan bahawa
Metode yang digunakan dalam analisis contoh
kandungan mineral pada batuan asal telah
batuan serpentinit iaitu dengan XRF” dan
terubah menjadi serpentinit pada contoh yang
“XRD”. Metode “XRF” digunakan untuk
diambil di kawasan Bukit-Rokan Barat,
mengetahui unsur major dan unsur surih pada
Kampung Selaru, Petasih dan Kelantan Barat.
masing-masing sampel batuan, sedangkan
Sedangkan contoh ang diambil di kawasan
metode “XRD” dipergunakan untuk
Cheroh-Bentong masih memeperlihatkan
mengetahui kandungan mineral utama pada
kenampakan mineral asalnya berupa olivine,
contoh batuan serpentinit yang dianalisis.
harburgit (peridotit), serpentinit, dan clino-
Hasil analisis kimia dengan kaedah “XRF”, pirosen yang menunjukkan struktur opitik.
menunjukkan bahawa batuan serpentinit pada
3. Pembahasan
kelima contoh ini mempunyai kandungan SiO2
Hasil analisis dengan metode “XRF” yang
antara 40.51% hingga 46.05 % Seperti yang
menghasilkan kandungan SiO2 antara 40.51%
ternampak pada Tabel 2. Sedangkan hasil
hingga 46.05 % jika dibandingkan dengan
analisis kimia dengan metode “XRD” yang
model analisis unsur utama dan Norm CIPW
dari kelima contoh batuan serpentinit
(O.B. James, 1971) maka asalan batuan
mengandungai mineral utama utuk contoh 1
serpentinit ini adalah peridotit.
kawasan Bukit Rokan Barat: lizardit. Contoh 2
kawasan mengandungi mineral antigorit. Dari kenampakan karakteristik menampakakan
Contoh 3 kawasan Petasih mengandungi bodi singkapan berupa tabuar-lentikuler, jenis
Ibrahim Abdullah
Abstrak
Gabungan getah asli (NR) dengan termoplastik (TP) secara kimia atau fizik telah dapat
menghasilkan satu bahan komposit (TPNR) yang mempamirkan ciri kedua bahan: impak
tinggi elastomer dan dapat diproseskan secara teknologi termoplastik. Umumnya NR yang
terdiri daripada 99% poliisoprena adalah tidak serasi dengan TP disebabkan mikrostruktur
rantai yang berbeza. Tegangan permukaan yang tinggi akan terjadi diantara dua fasa dalam
adunan dan membawa kepada ketidakhomogen campuran berlaku. Bagaimanapun
penyebatian dapat dilakukan dengan berbagai cara seperti menggunakan pengserasi kimia
atau pemodifikasian kepada molekul polimer NR atau TP, mencampur agen modifikasi
kelikatan kepada adunan semasa pengadunan dan memvariasi suhu serta kadar pengadunan.
Modifikasi kelikatan leboran kedua komponen agar menjadi setara membolehkan
pencampuran dan penghomogenan berlaku. Leboran NR, yang umumnya rendah daripada TP
semasa pengadunan, dapat diubahsuai dengan penambahan agen pematang atau pengisi
seperti dicumil peroksida, karbon hitam dan lain lain. Kaedah pengserasian adunan NR-
Polietilena dan NR-polistirena akan dibincangkan.
melalui perubahan dalam kaedah pemprosesan polimer dan keserasian juga rendah, adunan
adunan atau parameter pemprosesan seperti menunjukkan sifat fizik dan mekanik yang
suhu dan kadar percampuran. memuaskan tanpa sebarang aditif. Adunan
yang sempurna dan homogen akan terhasil jika
2. Elastomer Termoplastik
terdapat interaksi dan keserasian atau tanpa
Elastomer termoplastik(TPE) adalah satu kelas
sebarang ketegangan permukaan antara fasa
bahan berasaskan pengadunan antara elastomer
getah dan termoplastik. Kehomogenan fasa
sintesis dan termoplastik. Dalam industri
selalunya dikaji berdasarkan perubahan nilai
plastik TPE merupakan sektor yang
suhu peralihan kaca, Tg, dan pemeriksaan
berkembang pesat dari aspek penyelidikan dan
morfologi daripada mikrograf imbasan
penggunaan. Kebaikan yang paling ketara
elektron.
adalah pemprosesan bahan melibatkan perlatan
pemprosesan plastik umum tanpa memerlukan Amnya interaksi permukaan akan terjadi jika
pemvulkanan atau pemajmukan dan sebarang mikrostruktur polimer poliisoprena dan polimer
sisa boleh dikitar semula. Tujuan utama termoplastik adalah serasi dari aspek
pengadunan elastomer dengan termoplastik pengkutuban molekul dan kumpulan berfungsi
adalah bagi memasukkan sifat daya tahan yang akan bertindak menghalang pendekatan
terhadap hentaman dan kemuluran dalam yang intim antara polimer. Mikrostruktur
termoplastik seperti yang terjadi dalam poliisoprena dan polietilena adalah;
polistirena dan polipropilena terkukuh.
Umumnya adunan TPE membentuk sistem
CH3 H
multifasa terdiri daripada domain keras dan
lembut. Pembentukan mikrodomain ini
C===C
membolehkan pembentukan senibina molekul
tertentu dengan sifat yang unik dan berguna
------ CH2 CH2------
untuk teknologi tertentu. Kebanyakan TPE
olefin adalah adunan getah etilena-propilena
(EPR) atau getah etilena-propilena-diena
NR ( cis-poliisoprena)
monomer (EPDM) dengan polipropilena (PP).
Morfologi unik adunan dicapai melalui
pematangan separa fasa getah dan sifat
------ CH2----CH2 -------
mekanik yang menarik terhasil. Pembentukan
taut-silang separa dalam fasa getah diaruh oleh
agen pematang yang dicampur semasa
PE (rantai asas)
pemprosesan adunan.
Gabungan antara getah asli dan termoplastik
menghasilkan satu kelas bahan TPE dengan ciri Dalam NR ketidaktepuan ikatan karbon
kimia dan fiziknya lebih meluas yang dikenali menjadi kumpulan berfungsi yang akan
sebagai getah asli termoplastik (TPNR) 3. menentukan tahap interaksi dengan PE.
Penyelidikan dan pembangunan TPNR bermula Kehadiran rantai cabangan dengan berbagai
sejak tahun 1960an di Malaysian Rubber saiz dan cabang, akan menentukan
Producers’ Research Association (MRPRA), penghampiran antara fasa dalam adunan.
London berasaskan kemajuan dalam adunan Kekuatan regangan dan modulus adunan
EPDM-PP. Keserasian adunan dan menunjukkan tahap interaksi antara getah asli –
kebolehprosesan bahan menjadi objektif utama polietilena berketumpatan rendah linear (NR-
kajian kearah menghasilkan suatu bahan serba LLDPE) > getah asli - polietilena
boleh dan mempunyai potensi penggunaan berketumpatan tinggi (NR-HDPE) > getah asli
yang luas. - polipropilena (NR-PP) > getah asli –
polietilena berketumpatan rerndah (NR-LDPE)
3. Getah Asli Termoplastik 4
. Keberkesanan LLDPE berinteraksi dengan
Kebanyakan kajian yang dilaporkan terfokus
NR paling tinggi adalah dirasionalkan sebagai
kepada sistem adunan NR-poliolefin iaitu NR-
akibat daripada rantai cabangan yang mininum
Polipropilena dan NR-Polietilena (berbagai
dan, jika wujud pun, saiznya amatlah kecil.
jenis PE). Walaupun tiada interaksi antara
Adunan NR-PP merupakan sistem binari yang Kehomogenan fasa selalunya dikaji
telah mendapat perhatian diperingkat awal dan berdasarkan nilai suhu peralihan kaca, Tg, dan
meluas. PP dianggap pemilihan terbaik untuk pemeriksaan morfologi daripada mikrograf
diadun dengan NR berdasarkan takat imbasan elektron adunan.
lembutnya yang tinggi, ~ 150oC dan takat
NR dan PE, dan NR dan PP adalah pasangan
peralihan kaca yang rendah, ~ -60oC.
yang tidak serasi disebabkan mikrostruktur
Dijangkakan gabungan dua polimer akan
rantai polmer adalah tidak sepadan. Suatu
menghasilkan termoplastik serbaguna yang
serakan stabil zarah NR dalam matriks PP atau
berpotensi diaplikasikan dalam julat suhu yang
PE atau disebaliknya boleh terbentuk akibat
luas. Adunan berkomposisi NR melebihi 40%
daripada parameter penglarutan yang hampir
akan membentuk TPNR lembut, manakala
sama. Parameter pengadunan lebor NR/PP
yang lain akan bervariasi daripada semitegar ke
adalah suhu 175 ke 185oC, kadar percampuran
tegar bergantung kepada peningkatan dalam
40 ke 60 rpm dan julat masa 8 ke 15 minit 5.
kandungan PP.
Adunan NR/PE boleh diadun pada suhu yang
4. Pemprosesan lebih rendah iaitu 135 ke 160oC 6. Suhu yang
Pengadunan lebor pada suhu hampir kepada tinggi akan menggalakkan pengoksidaan bahan,
takat lebor poliolefin menjadi kaedah pilihan terutamanya NR dan sifat mekanik adunan
percampuran NR-poliolefin. Saling melarut akan menurun. Selain itu, bau tidak
antara getah dan termoplastik akan menentukan menyenangkan dan sifat penuaan yang rendah
sifat mekanik dinamik, manakala saiz fasa, adalah kesan terus daripada pengoksidaan
daya kohesif dalam fasa getah dan lekatan bahan.
antara berbagai fasa mempengaruhi sifat
5. Modifikasi Kelikatan
hentaman. Dengan itu sifat mekanik dan fizik
Percampuran yang sempurna akan terjadi jika
bahan bergantung kepada tiga parameter utama:
kelikatan leboran komponen adalah hampir
komposisi adunan, parameter pemprosesan dan
sama dan keadaan ini boleh dicapai secara
agen pematangan yang di tambah. Suhu, kadar
meningkatkan kelikatan leboran NR atau
percampuran atau pengaliran dan masa
menurunkan kelikatan leboran PP. Polimer
pengadunan merupakan parameter
poliisoprena adalah lebih aktif daripada PP dan
pemprosesan terpenting. Secara dinamik,
dengan itu kelikatan NR lebih mudah
percampuran optimum hanya akan berlaku jika
dimanipulasi menerusi penambahan agen
kelikatan leboran getah dan termoplastik adalah
pematang. Taut-silang separa dalam fasa NR
hampir setara.
akan berlaku dan meningkatkan kelikatan
Kelikatan leboran yang bergantung kepada leboran yang seterusnya meningkatkan
suhu akan meningkat dengan suhu. Suhu yang interaksi antara fasa getah dan termoplastik.
rendah akan menyebabkan kesukaran jisim Pembentukan koplimer graf juga akan
bergerak dan dengan itu ricihan meningkat. meningkatkan interaksi antara fasa NR dan PP.
Akibatnya degradasi polimer akan berlaku Proses ini berlaku semasa pengadunan dan
semasa pengadunan. Kelikatan yang rendah dikenali sebagai pengadunan reaktif atau
pada suhu tinggi menyebabkan percampuran pemvulkanan dinamik. Agen pemvulkanan
sukar berlaku. Kadar percampuran atau separa lain adalah sulfur atau penderma sulfur
pengacauan dan julat masa memberi kesan pada kepekatan rendah seperti tiuram disufida
keatas penyerakan fasa. Kadar dan masa atau ditiobismorpholin (DTM), terbitan di-
pengacauan yang tinggi boleh membawa isosianat dan tetrametiltiuram disulfida
kepada degradasi polimer dan, jika terlalu (TMTD).
rendah menyebabakan pengadunan tidak
Peroksida organik juga dilaporkan dapat
berlaku. Amnya kadar pengacauan rendah
meningkat sifat mekanik dan fizik adunan
memerlukan masa yang panjang untuk
NR/PP dan NR/PE 7. Penambahan agen
menghomogenkan adunan dan disebaliknya.
peroksida seperti dikumil peroksida (DCP)
Bagitu juga kadar percampuran yang tinggi
telah meningkatkan kekerasan, modulus,
diperlukan pada suhu rendah. Dengan itu
kekuatan dan keelastikan TPNR terutama
perhubungan diantara ketiga parameter ini:
dalam sistem yang kaya dengan komponen
suhu, kadar dan masa, perlu ditentukan dahulu
getah. Pembaikan dalam sifat mekanik
sebelum pengadunan dapat dilakukan.
menunjukan kehomogenan dalam serakan fasa
Abstrak
Tsunami yang melanda pantai di beberapa negara sekitar Lautan India pada 26 Disember
2004, berpunca daripada gempabumi berukuran 9.0 pada skala Richter berepipusat di pantai
barat Sumatra Utara, merupakan bencana alam paling dayshat pernah berlaku pada abad
ini. Beberapa negara, terutamanya Malaysia dan Thailand, tidak pernah menduga bahawa
tsunami boleh melanda perairan mereka. Angka kematian akibat bencana ini sehingga 12
Februari dilaporkan berjumlah 285,995 orang, di Malaysia jumlahnya ialah 68 kematian,
menjadikannya angka kematian terbesar dalam sejarah bencana tabii di negara ini.
Walaupun manusia tidak dapat menghindarkan sepenuhnya bencana alam, tetapi usaha untuk
meminimumkan impak terhadap kematian dan kemusnahan harta boleh dilakukan jika
pengetahuan saintifik mengenai punca, cirian dan kelakuan bencana diselidiki dan digunakan
untuk formulasi dasar dan perancangan pembangunan masyarakat. Bencana tsunami
26.12.2004 telah memberikan banyak pengajaran, khususnya di Malaysia bahawa maklumat
sains sedia ada tidak mampu dimanfaatkan sepenuhnya untuk kesejahteraan masyarakat.
Kertas ini akan menghuraikan pelbagai isu berkaitan pendidikan dan kesedaran masyarakat
yang terjelma berasaskan impak tragedi ini.
Kata kunci: Bencana Tsunami, Kesedaran Awam, Pandidikan Masyarakat
th
424 Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Ibrahim Komo, Mazlan Othman
Rajah 1 : Kedudukan gempabumi 26.12.2004 yang berukuran 9 pada skala Richter dan gempa bumi
susulan 12 jam berikutnya (USGS, 2005)
Gempabumi dan Pecahan Kepingan Utara) hingga Pulau Andaman (14o Utara). Ini
Maklumat mengenai gempabumi 26.12.2004 ditunjukkan oleh kedudukan dan taburan
dan mekanisme pecahan kepingan telah gempabumi susulan (aftershocks) yang telah
dijelaskan oleh US Geological Survey (2005). direkodkan selepas berlakunya gempabumi
Gempabumi berkedalaman cetek jenis utama.
sungkupan berlaku sepanjang sempadan antara
Kebanyakan gempabumi berskala besar berlaku
kepingan India dan kepingan Burma apabila
disebabkan mega-sungkupan (megathrust) di
tenaga keterikan dibebaskan secara serta merta
sepanjang kepingan lautan yang menusuk
akibat pecahan (patahan) kepingan. Tenaga
masuk ke bawah kepangin benua. Antaranya
keterikan yang tinggi telah terkumpul
yang terbesar ialah: magnitud 9.5 1960
sepanjang sempadan kepingan ini disebabkan
gempabumi Chile; magnitud 9.2 1964
kepingan India bergerak ke arah timurlaut pada
gempabumi Prince William Sound, Alaska;
kadar sekitar 5 cm per tahun menusuk ke
magnitud 9.1 1957 gempabumi Andreanof,
bawah kepingan Burma. Tenaga keterikan yang
Alaska; dan magnitud 9.0 1852 gempabumi
dibebaskan dipercayai berpunca daripada
Kamchatka. Gempabumi utara Sumatera yang
gelinciran (sesaran) sepanjang lebih 1200 km
bermagnitud 9.0 ini merupakan gempabumi ke-
sempadan kepingan dari utara Sumatera (3o
5 terbesar pernah direkodkan dalam 100 tahun
terakhir ini, dan ditafsirkan telah menyebabkan Kuala Muda hampir satu jam kemudiannya.
pecahan (rupture) sepanjang satah gelinciran Akibat daripada landaan ini 68 orang terkorban
lebih 1200 km panjang, lebih 100 km lebar dan dengan kerosakan pelbagai harta benda awam
dengan anjakan sekitar 15 m (USGS 2005a). dan persendirian.
Mega-sungkupan ini telah menyebabkan
3. Maklumat Saintifik Global
permukaan batuan di dasar laut pada zon
Salah satu isu pokok yang diutarakan oleh
pecahan terangkat beberapa meter yang
pelbagai pihak mengenai peristiwa tsunami ini
menjadi punca kepada pembentukan tsunami.
ialah mengapa tiada ‘sistem amaran awal’
Tsunami dan Impaknya dikeluarkan bagi membolehkan sebahagian
Akibat daripada pengangkatan serta merta daripada mangsa terselamat daripada
permukaan batuan di dasar laut pada zon malapetaka ini? Hakikatnya, walaupun the
pecahan, badan air lautan teranjak ke atas lalu Pacific Warning Center di Hawaii ada
membentuk gelombang seismos laut (seismic melaporkan kemungkinan berlaku tsunami 15
sea waves) atau lebih dikenali sebagai dan 65 minit selepas kejadian gempabumi,
‘tsunami’. Tidak seperti kebanyakan tsunami maklumat ini tidak dapat dikomunikasikan ke
sebelum ini yang berpunca daripada pusat rantau Lautan India. Antara sebab utama ialah
gempabumi, tsunami 26.12.04 berpunca masih belum tersedia rangkaian sistem amaran
daripada garisan pecahan sepanjang lebih 1200 awal tsunami di rantau ini. Seorang pegawai
km, umumnya bergerak dalam bentuk elip daripada USGS National Earthquake
dengan tenaganya yang lebih tinggi bergerak ke Information Center, Waverly Person, melalui
arah timur-barat (Rajah 2). Di lautan dalam laman-webnya (USGS 2005b) menyatakan:
tsunami bergerak dengan kelajuan antara 500 – “most of those people could have
800 km per jam, sampai ke persisiran Sri been saved if they had had a tsunami
Langka dan India sekitar 2 jam; Australia 5 warning system in place or tide
jam; Madagascar 8 jam; dan persisiran gauges”, dan beliau juga menambah
Antarctica. Semakin jauh dari puncanya, tenaga “because large tsunami or seismic
tsunami beransur berkurangan walaupun sea waves are extremely rare in the
tsunami kali ini boleh dirasai di seluruh Dunia. Indian Ocean, people were never
tought to flee inland after they felt the
Di persisiran Sumatera Utara kerana jaraknya tremors of an earthquake.”
kurang daripada 300 km dari punca
gempabumi, tsunami melanda dalam masa Maklumat saintifik mengenai gempabumi dan
yang singkat dan bertenaga sangat tinggi telah tsunami 26.12.04 telah tersebar dengan pantas
menyebabkan bencana alam yang luarbiasa. dan meluas sebaik sahaja bencana ini berlaku.
Sehingga Februari 12, 2005, sekurang- Hanya beberapa minggu selepas bencana ini,
kurangnya 232,732 orang telah terkorban pelbagai aspek saintifik – penjelasan, teori,
akibat tsunami (sebahagian kecil gempabumi) model dan animasi tsunami telah diedarkan
di Indonesia. Di Thailand tsunami melanda oleh beberapa agensi kerajaan dan pertubuhan
persisiran Puket dan kawasan sekitarnya kira- bukan kerajaan melalui laman-web masing-
kira 2 jam selepas gempabumi, akibatnya masing. US Geological Survey merupakan
seramai 5,393 orang terkorban yang agensi kerajaan paling aktif menerbitkan
kebanyakannya sedang bercuti atau beriadah di pelbagai aspek saintifik mengenai peristiwa ini
kawasan pantai. dengan kemaskini maklumatnya hampir setiap
Di Malaysia tsunami melanda persisiran pantai minggu. Mereka telah memberikan tumpuan
barat Semenanjung Malaysia, i.e. di Kedah terhadap penyampaian maklumat yang relevan
khususnya di Kepulauan Langkawi dan Kota kepada masyarakat secara bersistem dan
Kuala Muda, di Pulau Pinang dan persisiran bijaksana.
Perak dan Selangor. Kita bernasib baik kerana Kenyatan Person seperti catatan di atas penting
lautan Selat Melaka yang cetek telah banyak dikupas dengan lebih mendalam. Dari satu
memperlahankan halaju ombak serta aspek beliau menyatakan banyak nyawa boleh
mengurangkan tenaga rempuhannya. Tsunami diselamatkan, tetapi pada nada yang berbeza,
melanda Kepulauan Langkawi sekitar 12.40 beliau menyatakan masyarakat mungkin tidak
waktu tempatan (lebih 3 jam selepas akan mengambil tindakan menyelamat diri
gempabumi) dan tiba di Pulau Pinang dan Kota
kerana peristiwa seumpama ini amat langka • kurang kepakaran tempatan yang
dan belum pernah mereka alami. Hal yang menerokai pengetahuan mengenai bencana
sama boleh dilanjutkan mengenai kepentingan tabii sehingga maklumat tidak terkumpul
maklumat saintifik ‘gempabumi dan tsunami’ secara bersistem dan sebarannya kepada
untuk faedah masyarakat. Walaupun maklumat masyarakat sangat terbatas; dan
yang tersedia banyak dan meluas, pengetahuan
ini masih sukar diterjemahkan untuk faedah • kelangkaan kejadian bencana tabii
masyarakat di beberapa negara Asia Tenggara, menyebabkan masyarakat tiada atau
khususnya di Malaysia kerana beberapa kurang berpengalaman mengharunginya
kekangan berikut: dan tidak mampu menerima hakikat
bahawa mereka boleh terimpak oleh
• anggapan bahawa negara bebas dari bencana sedemikian.
ancaman bencana tabii, khususnya
gempabumi dan tsunami, menyebabkan Bencana gempabumi dan tsunami 26.12.04
pengetahuan saintifik mengenai hal ini diharap dapat memberikan pengajaran baru
kurang relevan dan jarang diambilkira kepada masyarakat di beberapa negara Asia,
dalam perancangan negara; terutamanya masyarakat Malaysia bahawa
bencana alam berskala besar umumnya bersifat
rantauan atau global, dan tiada negara yang tempatan) secara tersendiri sebagai
bebas daripada ancamannya. maklumat awam atau bahan berita;
4. Maklumat Saintifik Tempatan • kesedaran masyarakat yang rendah
Maklumat saintifik tempatan mengenai terhadap hubungkait antara maklumat
gempabumi dan tsunami sangat terbatas atau saintifik dan bencana menyebabkan
boleh dikatakan hampir tiada. Satu-satunya tuntutan untuk memperolehi maklumat
jabatan yang diberikan mandat untuk merekod saintifik yang tepat, menyeluruh dan
gempabumi ialah Jabatan Kajicuaca Malaysia. pantas kurang mendasak;
Jabatan ini mempunyai sejumlah seismogram
yang ditempatkan di Semenanjung Malaysia, • bencana lebih mudah dikaitkan dengan
Sabah dan Sarawak bertujuan untuk penderitaan masyarakat, tindakan pihak
merekodkan peristiwa gempabumi sebagai berkepentingan untuk mengatasi isu pasca-
sebahagian daripada jaringan gempabumi bencana serta aktiviti memberikan bantuan
global. Maklumat yang terkumpul jarang kemanusiaan menyebabkan kebanyakan
digunakan atau disebarkan kepada masyarakat berita tertumpu kepada aspek ini; dan
awam kerana dianggap tidak relevan untuk • aspek komersial media massa menuntut
kegunaan tempatan. ruangan yang lebih terhadap isu-isu
Di institusi penyelidikan dan pusat pengajian sensasi, hiburan, politik dan perniagaan
tinggi, Malaysia tidak memiliki pakar yang menyebabkan tumpuan yang rendah
telah atau sedang menjana maklumat saintifik diberikan kepada aspek pendidikan
mengenai gempabumi (termasuk tsunami). masyarakat.
Apabila bencana tsunami melanda negara baru- Keperluan maklumat saintifik untuk menangani
baru ini, beberapa pakar Sains Bumi (bidang isu bencana alam merupakan suatu aspek yang
yang paling hampir untuk menghuraikan mendesak terutamanya pengurusan bencana
fenomena gempabumi dan impak bencananya) yang melibatkan amaran awal atau aktiviti
telah dijemput oleh pihak kerajaan dan media penghindaran bencana. Usaha huluan (pra-
massa untuk menjelaskan aspek saintifik bencana), terutamanya yang melibatkan
bencana ini. Mujurlah maklumat saintifik pengenalpastian cirian bencana, pemetaan
global yang tersebar melalui laman-web cukup risiko bencana, ramalan impak bencana dan
banyak dan menyeluruh bagi membolehkan pembangunan teknologi kawalan memerlukan
maklumat ini diolah semula dan digunakan pengetahuan saintifik yang mendalam.
untuk disampaikan kepada masyaratak awam. Hubungan antara amaran awal dan keperluan
Selepas bencana, beberapa pihak telah maklumat saintifik ini telah dihuraikan dalam
menjalankan pelbagai kajian impak, antaranya ISDR (2004).
kumpulan yang diketuai oleh LESTARI (2005)
yang kini sedang meninjau impak alam sekitar Jika ditinjau secara lebih dekat wujud
dan sosio-ekonomi di kawasan yang terlibat. perhubungan yang erat antara pihak media
massa, masyarakat awam dan para saintis
Media massa tempatan kurang menyebarkan tempatan mengenai kurangnya pemanfaatan
maklumat saintifik mengenai gempabumi dan maklumat saintifik untuk menghindar bencana
bencana tsunami untuk perhatian masyarakat alam. Hubungkait ini boleh dijelaskan
awam. Ini berpunca daripada beberapa berasaskan cirian tradisi dan pendekatan
kemungkinan berikut, antaranya: pendidikan dan kesedaran awam.
• maklumat saintifik tempatan terbatas 5. Pendidikan Awam
dan jika adapun masih belum berjaya Pendidikan awam, khususnya pendidikan
diolah untuk maklumat awam; formal di Malaysia telah diwarisi melalui
• kefahaman yang rendah di kalangan pendidikan yang diperkenalkan oleh kerajaan
pelbagai pihak berkepentingan mengenai Inggeris. Tumpuan telah diberikan kepada
tsunami, terutama media massa tidak pendidikan untuk meningkatkan kemahiran
membolehkan mereka mengolah bagi mewujudkan tenaga manusia yang mampu
maklumat saintifik sedia ada (global atau menjalankan tugas harian untuk pelbagai sektor
pembangunan negara. Oleh itu, tumpuan telah
diberikan kepada pembangunan sektoral yang
berkaitan dengan aspek teknikal dan ikhtisas. tanda-tanda awal kejadian, dan pendekatan
Masyarakat Malaysia kurang terdedah dengan ramalan.
pengetahuan sains alami, sains dalam hidupan
Untuk membolehkan maklumat ini diterapkan
harian dan sains untuk kesejahteraan
di semua peringkat masyarakat dan pentadbiran
masyarakat.
awam, semua bentuk pendidikan, sama ada
Walaupun banyak institusi penyelidikan dan bersifat formal atau tidak formal perlu
pusat pendidikan tinggi menjalankan memberikan perhatian mengenai isu bencana
penyelidikan dan pembangunan, tumpuan telah alam dan langkah penghindarannya. Pada
diberikan kepada penyelidikan yang bersifat peringkat sekolah dan institusi pendidikan
gunaan dan berorientasi penghasilan produk. tinggi, aspek bencana boleh dijadikan
Penyelidikan fundamental dan penerokaan dan sebahagian daripada kurikulum dan ko-
pengembangan ilmu sangat terbatas, jika ada, kurikulum bagi memastikan isu amaran awal
hanyalah atas minat dan inisiatif individu atau dan tindakan penghindaran menjadi agenda
kelompok kecil yang mempunyai kecintaan utama dalam pemikiran masyarakat dan strategi
yang mendalam untuk meneroka bidang limu asas dalam dasar pembangunan negara.
kepakaran masing-masing.
Oleh kerana pembangunan pengetahuan
Dalam keadaan begini, di Malaysia penerokaan saintifik dan penterjemahan maklumat ini
pengetahuan mengenai bencana alam, i.e. kepada dasar, sistem pengurusan dan
gempabumi (termasuk tsunami), letusan pembangunan teknologi merupakan isu yang
gunung berapi, gelinciran tanah, pencemaran rumit dan memerlukan komitmen yang tinggi,
alam sekitar dan banjir, berkembang secara setiap negara perlu mewujudkan agensi atau
berlahan dan masih terkongkong dalam dunia institusi khusus mengenai R&D dan
akademik sahaja. Belum ada usaha yang pengurusan bencana. Agensi seumpama ini
menyeluruh untuk menterjemahkan boleh diberikan mandat untuk mengembangkan
pengetahuan ini untuk dijadikan sebahagian pelbagai aspek saintifik untuk membangun
daripada kurikulum pendidikan formal di dasar mengenai bencana, sistem amaran awal,
sekolah dan pusat pengajian tinggi sebagai sistem pengurusan bencana, sistem ramalan,
bahan pendidikan awam. sistem komunikasi dan aspek pendidikan serta
kesedaran awam.
Lanjutan daripada situasi yang dinyatakan di
atas, pendidikan tidak formal turut mengikuti 6. Kesedaran Awam
aliran pendidikan formal. Tidak banyak Sebelum bencana Tsunami 26.12.04, tidak
maklumat saintifik mengenai bencana alam ramai masyarakat Malaysia yang mengetahui
dikeluarkan oleh agensi kerajaan, media massa apa itu tsunami? Kini, selepas beberapa minggu
dan pertubuhan bukan kerajaan tempatan. tragedi ini melanda hampir keseluruhan negara
Masyarakat Malaysia lebih terdedah kepada di perairan Lautan India, sebahagian besar
maklumat saintifik mengenai bencana alam masyarakat Malaysia termaklum dan mulai
yang berlaku di luar negara (bersifat global) membincangkan bencana ini secara meluas di
melalui media massa asing atau pelbagai semua peringkat masyarakat. Peristiwa bencana
bentuk penerbitan (majalah dan buku) untuk ini, sekurang-kurangnya telah berjaya menarik
pengetahuan awam. minat awam mengenai peristiwa bencana,
khususnya bencana gempabumi dan tsunami.
Perkara yang perlu diberikan perhatian utama
Peristiwa bencana, kecil atau besar, perlu
ialah keseluruhan jaringan amaran awal
dijadikan pemangkin untuk meningkatkan
bencana yang meliputi pengurusan risiko
kesedaran awam mengenai hal-ehwal bencana
bencana, kesediaan menghadapi bencana,
dan pendekatan pengurusannya.
pengurangan vulnerability, bantuan pasca-
bencana, dan pembinaan semula. Semua Membina kesedaran awam mengenai peri
perkara ini melibatkan keupayaan semua pihak pentingnya mengurus dan menghindar bencana
berkepentingan, termasuk masyarakat awam, bukannya suatu perkara yang mudah. Ini perlu
mengenai aspek saintifik bencana, i.e. punca dilakukan secara berstrategi dan berterusan.
bencana dan keupayaannya, mekanisme dan Beberapa aspek kesedaran awam yang
kelakuannya, saiz dan jangkauan, kekerapan, berkaitan dengan bencana tsunami boleh
diringkaskan seperti berikut:
• suatu peristiwa saintifik (i.e. bencana kehilangan nyawa dan kerosakan harta benda
tsunami) boleh menjadi sangat popular yang besar umumnya berpunca daripada
apabila ia melibatkan masyarakat kurangnya kesedaran awam mengenai risiko
tempatan dan dipelopori oleh media yang mereka hadap akibat sesuatu bencana
massa. Dalam hal ini, media masa boleh alam. Oleh kerana bencana bukannya suatu
dan mampu memainkan peranan penting perkara harian, usaha yang gigih perlu
bagi meningkatkan kesedaran awam diwujudkan untuk meningkatkan pendidikan
mengenai isu yang berkaitan dengan dan kesedaran awam. Untuk ini, pembangunan
maklumat saintifik, walaupun dalam maklumat saintifik dan pendekatan sebaran
keadaan biasa pengetahuan saintifik yang berkesan kepada masyarakat seharusnya
membosankan masyarakat; menjadi agenda utama untuk mengurangkan
impak bencana alam terhadap masyarakat dan
• survei secara rambang mendapati, negara.
kebanyakan maklumat mengenai bencana
diperolehi oleh masyarakat awam melalui 8. Ucapan Terimakasih
siaran tv, dan bukannya dari bahan media Sebahagian daripada maklumat yang
bercitak (majalah dan akhbar). terkandung dalam kertas ini merupakan hasil
Peningkatan peratusan masyarakat yang perbincangan dalam Dialog Meja Bulat
suka membaca masih lagi rendah di mengenai Tsunami 26.12.04 yang diadakan di
kalangan masyarakat Malaysia, lebih-lebih Institusi Alam Sekitar dan Pembangunan
lagi bahan bermaklumat saintifik; (LESTARI), UKM pada 20 Januari 2005.
Penghargaan yang tinggi diberikan kepada
• masyarakat menunjukkan minat maklumat semua yang terlibat.
saintifik mengenai bencana tsumani yang
tinggi tetapi mengharapkan ia dipaparkan 9. Daftar Pustaka
ISDR (2004). Early Warning as a Matter of Policy –
dengan cara yang termudah. Oleh itu, The Conclusions of the Second International
pelbagai strategi pembangunan kesedaran Conference on Early Warning. International
awam perlu dipelopori, antaranya Strategy for Disaster Reduction, Bonn, Germany,
menerusi pameran, filem dokumentari, 28pp.
sebaran fakta dan maklumat asas oleh
LESTARI (2005). Bencana Tsunami 26.12.04 di
agensi berkepentingan dan menerusi
Malaysia: Kajian Impak Alam Sekitar dan Sosio-
kempen penghindaran risiko bencana. ekonomi. Institut Alam Sekitar dan Pembangunaan
Kesedaran awam merupakan asas dalam proses (LESTARI), UKM (laporan sedang disediakan).
pengurusan dan penghindaran bencana alam. Terradaily – News About Planet Earth (2005).
Masyarakat awam yang menyedari dan Death tool in Asian tsunami disaster at 285,993.
berpengetahuan mengenai risiko bencana akan (http://www.spacedaily.com/)
mengambil tindakan susulan yang lebih USGS (2005a). Tectonic Summary: Magnitude 9.0
berkesan untuk menghindar atau Earthquake off the West Coast of Northern Sumatra.
meminimumkan impak bencana tersebut. Preliminary Earthquake Report
Secara jangka panjang, tindakan masyarakat (http://earthquake.usgs.gov/eqinthenews/2004/ussla
awam inilah yang akan terjelma dalam dasar v/)
dan perlaksanaan agensi kerajaan untuk USGS (2005b). Warning Could Have Saved
mengurus bencana secara jangka panjang. Thousands in Asia – 26 December, 2004
7. Kenyataan Penutup (http://iri.columbia.edu/lareef/tsunami/)
Pendidikan dan kesedaran awam merupakan
asas bagi sebuah negara untuk menghadapi
bencana alam. Dalam kebanyakan kes bencana,
Abstract
Studies on the effect of several Brassica and non-Brassica plants on the development,
reproduction and feeding behavior of Spodoptera exigua (beet armyworm, BAW) and Plutella
xylostella (DBM) were conducted in the laboratory and greenhouse. Results showed that the
reproduction, developmental rate (larva and pupa), feeding behavior (time taken to reach the
food sources, total time spent on food and time leaving in choice and non-choice tests) were
varied with plants offered. Brinjal was extremely suppressed BAW larval development and
growth. Significant correlation (r = 0.96) was observed between the total weight of feacal
produced and its development time, indicating the low digestible food would prolong larval
and pupal development time of BAW. Shorter DBM larval and pupal developmental time was
observed when larvae were fed B. juncea and B. oleracea (cultivated) than on the B. alba and
B. juncea (cultivated), and B. juncea and C. rutidosperma (wild). BAW larvae were found to
only choose okra, onion and chilli, and not on tomato or brinjal in choice experiment.
However, in no-choice experiment, BAW larvae were observed to reach and staying on the
brinjal and tomato. The feeding time spent by DBM larvae was significantly longer on the
cultivated than on the wild food plants except in a choice experiment. However, in a no-choice
experiment, DBM larvae took significantly shorter time to reach C. rutidosperma and B.
juncea var. rugose than the other food plants. Variability in responses to food offered in
relation to the absent or present in various concentrations of chemicals (eg. glucosinolates,
sinalbin, terpenoid, djenkolic acid, E – B – fenesen, other glycosides and other olfactory
chemicals) in each plant tested are discussed.
such an alternative ways to control DBM and pots in the greenhouse one-month prior to
BAW and one of those is cultural methods, experiment.
which includes planting other crops or plants
Development time of larva, pupa and egg
that might have negative effects on the pests.
production. Hundred S. exigua eggs were
The presence of different types and
placed on each food plants previously placed in
concentration of glucosinolates found in
a plastic container (20.5 x 47.0 x 6 cm3) with
brassicas and some non-brassicas such as peas,
wetted filter paper on its bottom. Number of
which act as feeding attractants or stimulants,
eggs hatched was recorded daily until no more
between host plants had been identified by Cole
hatches. Larvae were reared and fed different
(1976). The possible impact of Brassica
food plant until pupation. Number of pupae
vulgaris R. BR. and Brassica kaber D.C.
formed was recorded, collected and kept in
Wheeler on resistance management of DBM in
oviposition cages for adult emergence, mating
Michigan, USA, was reported by Idris &
and oviposition; the oviposition cage consisted
Grafius (1996). In India, the Indian mustard
of a cylindrical plastic bottle, 30 cm diameter x
(Brassica juncea (L.)(Czen.), has been used
50 cm height, internally lined with white paper
successfully as a trap crop for controlling DBM
used as oviposition site, an upper part of the
(Srinivasan & Krishna Moorthy, 1991).
cage was covered with netting cloth, cotton
This study was aimed to investigate the effect wetted with 10% sucrose solution was put on
of different food plants on the development, the upper part of the cage as food source and
reproductive and feeding behavior of P. cages were lighted for 12 hours set up 40 cm
xylsotella and S. exigua. Information derived above it. Number of adults emerged and eggs
from this study could be used in an integrated laid were recorded daily until no more eggs
management of DBM and BAW, as certain were observed. Experiment was arranged
crops that are highly preferred or non-preferred following the randomized complete design and
by the DBM or BAW could be interplanted replicated three times per treatment.
with crop that have negative impact on the pest
Hundreds S. exigua and DBM eggs were placed
population. It is expected that crops in a mix
on each food plants, respectively, previously
cropping system are less preferred or have
placed in a plastic container as above with
negative effect on DBM and S. exigua.
wetted filter paper on its bottom. Ten newly
2. Experimental hatched larvae were kept individually in a 15
Source of Insect and Plants. Spodoptera cm diameter petri dishes containing a piece of
exigua eggs were taken from Malaysia respective food plant (4 cm2). A moistened
Agricultural Research and Development filter paper was lined in the bottom part of petri
Institute (MARDI), Serdang, Selangor. First dishes. Both leaves and the filter papers were
generation of UPM-resistant strain DBM changed daily. Larva feacal was collected daily
donated by Malaysian Research Development and weighted at the end of larval period. Pupae
Institute (MARDI) was used for the study. developmental time was also recorded daily
Insects were fed artificial diets provided by until adult emergence. The treatments (food
MARDI. In S. exigua study, five types of food plants, five replicates per treatment) were
plants were used namely chilli (Capsicum arranged following a complete randomized
annum : Capsumae), tomato (Lycopersicon design, and placed in a growth chamber at 25 +
esculentum : Solanaceae), okra (Abelmoschus 2oC, 12:12 h (L:D) photoperiod and 50% R.H.
esculentus: Malvaceae), onion (Allium sativum: until adult emergence. Treatments were
Allicaceae) and brinjal (Solanum melongena: checked daily to record the larval and pupal
Solanaceae). For DBM study, four cultivated developmental times. Pupae were weighed
Brassica (Brassica juncea Cosson, B. alba when its color had changed from light green to
Rebenh, B. juncea Coss.var. Rugose Bally, B. brownish or 1-2 d before adult emergence. The
oleracea var. alboglabra (Bally), one wild emerged adults were kept temporarily for 2 - 3
Brassica (B. juncea L. (Czern)(Indian days in refrigerator (5oC) before used in a
Mustard), and one Capparidaceae, Cleome subsequent experiment.
rutidosperma D.C., were used as DBM food
In DBM study, a modified 500 ml plastic
plants. These food plants were raised in clay
container, screen lid on top (4 x 5 cm) and on
the sides (3 x 3 cm), was used as an oviposition
cage. A pair of DBM adults were released in no-choice experiment, and similarly to
each cage placed under white light parameters were recorded. However, in this
(CROMPTONR, 160 Watt, and 80 cm above study, only one plant species were placed in the
the top cage with light intensity range between petri dish.
430 - 500 lux) for 2 d, after which the male
Data Analysis. Data were analyzed using the
were taken out, to ensure mating occurred. A
SAS System program version 6.12. The
15 ml test tube (3 x 6 cm) filled with 10% (v/v)
development time of larvae, and pupae per
diluted honey was placed inside the cage to
treatments were analyzed by one-way analysis
feed the DBM adults. A single aluminum (Al)
of variance (ANOVA). Simple correlation
foil, 2.5 x 4 cm, with strips on both sides made
analysis was also conducted to find the
using forceps, coated with juice of cabbage
relationship between total fecal weight
leaves was put in a cage through a cut made on
produced per larva per treatment and larval and
the lid to serve as an oviposition substrate.
pupal development time. One-way ANOVA
Treatments were replicated four times,
was also used to analyze data of feeding
arranged following a randomize complete
behavior (times taken by larva to reach food
block, and kept at room temperature and R.H.
and times spent by larvae for feeding per plant
Numbers of egg were recorded at 0700 h daily,
(food) within 3 hours observation) experiments.
the same time an Al foil was also replaced,
To depict the qualitative trend between the
until there were no eggs laid.
pupal weight and numbers of egg produced
Feeding Behavior. Choice and no-choice tests data were analyzed using regression analysis.
were used to study feeding behavior of BAW
3. Results and Discussion
and DBM larvae on different food plants. In
Development time of larvae and pupae and
both tests, a modified 15 cm diam Petri dish
egg production. There was a significant
(four-screen lid, 1 cm diam, were made on the
difference (P < 0.05) in the development time
cover for better ventilation) following Idris &
of BAW larvae instars among treatments
Graffius (1996) was used. In a no-choice test,
(Table 1). The development time of larval
five pieces of leaf (2 cm2 each) of a food plant
instars (L1, L2, L4 and L5) was significantly
species were placed inside of each Petri dish
shorter (P < 0.05) when fed on okra than when
where distance between leave cut was 7 cm
fed on chilli. Larval instars four (L4) and five
with 1cm and 4.5 cm from edge and center of
(L5) developed significantly faster (P< 0.05) on
petri dish respectively. One third instar BAW
onion than on chilli. This indicates that both
or DBM larva, starved for 6 h and 12 h
okra and onion are positively support the
respectively, was released in the center of a
development and growth of BAW. There was
dish. In a choice test, four pieces of leaf
no significant difference (P > 0.05) in
(similar size as for no-choice test and each leaf
development time of L3 among treatments.
piece represent a plant species) per replicate
Interestingly, all larvae fed on brinjal died in
were placed inside the Petri dishes and
the first instar stage. A separate trial conducted
arranged as for no-choice test except the
on the late instar larvae (L4) exposed to brinjal
distance between leaf pieces was 5 cm. In both
also showed the same effect. This indicates that
tests, treatments were placed 80 cm below the
brinjal extremely suppressed larval
white light as mentioned above, and kept at
development and growth as such it is not a host
room temperature and R.H. Times taken by
of BAW. Gibson and Pickett (1983) reported
larva to reach food (leaf piece) from the point
that the hairs on brinjal leaves produced a
of release (center of dish), and times spent for
chemical substance named as E – B – fenesen
feeding within 3 hours observation (from 0900-
which repell insects from consuming it. There
1200 and 1400 - 1700 h for BAW and DBM
was no significant difference (P > 0.05) in the
respectively) were recorded using a tape
pupal development time among treatments.
recorder. Parameters of feeding behavior
recorded were time taken by the larvae to The mean total feacal weight produced by
reach, staying on, feeding and leaving the food. larvae differed significantly (P < 0.05) among
Experiment was arranged following the treatments. Larval feacal weight was
randomized complete design with eight significantly higher (P < 0.05) when they were
replicates per treatments. The same methods feed on chilli than on tomato or okra. High
used in choice experiment were employed in fecal produced indicated that the food
Table 1. Development time of larvae and pupae of BAW fed on different food plants.
Mean with the same letters in row are not significantly difference ( P>0.05 )
Table 2. Developmental times of DBM larvae and pupae fed on different food plants
Cultivated
Brassica juncea Cosson Sawi 10.10 + 2.32b 4.62 + 0.81ab
B. juncea Cosson var. Kai Choy 9.12 + 3.11c 4.10 + 0.56b
rugose Bally
B. alba Rebenh Kai Lan 10.87 + 1.97a 2.34 + 1.22c
B. oleracea var.
alboglabra Bally Sawi Putih 9.38 + 2.43c 4.01 + 1.56b
Wild
B. juncea L. (Czern) Indian Mustard 9.89 + 3.13b 4.86 + 0.78a
Cleome rutidosperma D.C2 Purple Maman 9.93 + 2.65b 5.01 + 0.85a
1 2
From start of pupation until adult emergence; Capparidaceae, others are Brassicaceae
Means in column with same letter were not significantly different (P > 0.05, Fisher’s Protected LSD)
consumed are not fully digestible by the plants had different effects on the
digesting system (Ridley 1986). There was a developmental time of DBM larvae. The
positive and significant correlation (r = 0.96) developmental time of DBM larvae might be
between the total weight of feacal produced and affected by the glucosinolates because DBM
its development time. This indicates that the larvae cannot discriminate between different
low digestible food would prolong larval types of glucosinolates present in the food
development time. plants.
The developmental time of DBM larvae was The developmental time of DBM pupa was
significantly (P < 0.05) shorter when larvae significantly (P < 0.05) longer when larvae
were fed on B. juncea var. Rugose and B. were fed wild food plants than the cultivated
oleracea var. alboglabra (cultivated) than on food plants (Table 2). In contrast, the
the B. alba and B. juncea (cultivated), and B. development time of H. undalis pupae fed on
juncea and C. rutidosperma (wild) (Table 2). C. rutidosperma (wild) was significantly
Interestingly, the development time was shorter than when fed cultivated Brassica
significantly (P< 0.05) prolonged by the species (Sivapragasam et al., 1994). Some
cultivated food plant, B. alba, and not by the types of glucosinolates of C. rutidosperma
wild food plants, B. juncea (Czern) and C. were reported to slow down the developmental
rutidosperma. This indicates that host food rate of DBM pupae (Wallbank & Wheatly,
250
Y = 5.21x -301.39; r = 0.85
B. juncea
200
No. egg per female+ S.E
150
B. juncea var. Rugosa
100
B. juncea L.
50
B. alba
B. oleracea C. rutidosperma
0
5 6 7 8 9 10
-3
Pupal weight (x10 )(g)
Figure 1. Relationship between number of egg and pupal weight when DBM larvae fed on different
food plant
1976). There was strong relationship (r = 0.85, this test seemed not to cause larvae to leave
P < 0.05) between the numbers of eggs laid by okra quickly. In a no choice test, there was a
adult DBM females and the weight of pupae significant different (P < 0.05) in feeding time
developed from larvae fed on different food of larvae on food plants among treatments. In
plants (Fig. 1). DBM larvae fed on B. juncea contrast to a choice test, BAW larvae were
(cultivated) resulted in higher pupal weight and observed to reach and staying on the brinjal and
more productive females (laid more eggs) than tomato. The feeding time of BAW larvae was
fed on other food plants. This suggests that significantly longer (P < 0.05) on okra and
there exist qualitative differences between food onion than on tomato, chilli or brinjal. BAW
plants that affect development and reproduction larvae spent significantly shorter time to feed
of DBM. Study conducted by Fox et al. (1990) on brinjal than on okra, onion and chilli. This is
also found that the quality of cabbage plant is tends to support our no choice test study that
positively correlated with the size of DBM BAW larvae do not prefer brinjal and tomato.
larva or pupa. However, the time taken by BAW larvae to
reach, staying on and leaving the food was not
Feeding Behavior. BAW. In a choice test, the
significantly different among treatments.
time taken by BAW larvae to reach the food,
stay on food, feeding and leaving the food Overall, result of both choice and no choice
offered was significantly different (P< 0.05) tests indicated that BAW larvae preferred okra
among treatments (Fig. 2). BAW larvae were and onion. This is because of their shorter
found to only choose okra, onion and chilli, and development time and longer time spent to feed
never observed to go towards the tomato or on okra and onion as compared to other plants.
brinjal. However, the time taken to reach, BAW attracted to okra and onion by volatile
staying on, feeding and leaving the okra, onion compound and terpenoid contained in them.
and chilli was not significantly different. This Terpenoid in plants was known to act as
suggests that presence of more than one type of pheromone to the pest and this indirectly
plant in choice test could reduce larval induced infestation of the plants by BAW
olfactory ability to allocate their preferred food (Riddiford 1967). In addition, onion plant also
plants. Aroma produced by onion foliage could produced aroma that could stimulate olfactory
stimulate larval olfactory attractant (Dindonis attractant to BAW larvae. The larval feeding
& Miller 1981). Larvae staying on and time to time on chilli in both choice and no choice tests
leave food time in choice test were relatively were shorter as compared to okra and onion.
longer on okra than on onion or chilli. This This is because the larvae could not tolerate to
indicates that larvae preferred okra than onion toxicity of Djenkolic Acid contained in the
or chilli. The presence of other food plants in chilli plant (Nas 1973). BAW larvae seemed to
Table 3. Time (minutes + S.E) taken or spent by diamondback moth third instar larvae (a) to reach
food and (b) feeding in no-choice and choice tests1,2
______________________________________________________________________________
Food plants No-choice test Choice test
________________________________________________________________________
To reach fo Feeding To reach food Feeding
______________________________________________________________________________
Cultivated
Brassica juncea Cosson 28.31 + 10.32b 30.02 + 9.01b 4.43 + 2.10b 35.58 + 10.13a
B. juncea Cosson var. 10.54 + 3.12c 45.83 + 8.92a 5.21 + 2.31b 20.65 + 5.34b
rugose Bally
Wild
B. juncea L (Czern.) 50.01 + 10.67a 15.23 + 3.50c 5.32 + 2.05b 10.89 + 3.54c
Cleome rutidosperma D.C 12.43 + 4.21c 16.54 + 3.21c 8.93 + 3.23b 18.75 + 6.27b
______________________________________________________________________________
1
observation was made from 1400 to 1700 h (3 hours)
2
Means in column with same letters were not significantly different (P > 0.05, Fisher's Protected
LSD).
ignore tomato and brinjal in choice test; these usage. The C. rutidosperma and B. juncea var.
two plants are not the host of S. exigua. This rugose (in both tests) might have higher
may due to presence of alkaloids in both of concentration of glucosinolates that act as
these Solanaceae plants (Beck & Reese 1976). feeding attractants as compared with wild B.
Chemical repellant, E – B – fenesen in brinjal juncea as times taken by DBM larvae to reach
could extremely avoid larvae from consuming C. rutidosperma and B. juncea var. rugose
it (Gibson & Pickett 1983). were shorter than to wild B. juncea (Table 4).
However, C. rutidosperma or B. juncea var.
DBM. The feeding time spent by DBM larvae
rugose might not have or having similar
in 3 hours observation periods was significantly
concentration of feeding stimulant with B.
(P < 0.05, Fisher's Protected LSD) longer on
juncea. There seemed to be no difference in
the cultivated than on the wild food plants
food quality offered by the two wild food
except in a choice test (Table 3), indicating that
plants as the pupal weight and egg produced
wild food plants are not good food sources for
per female are somewhat similar. Although B.
DBM. In contrast, feeding responses of DBM
oleracea var. alboglabra and B. alba seemed to
on the wild food plants (Capparidaceae;
have similar food quality as indicated by their
Capparis flexuosa and C. spinosa) was as
effect on the pupal weight or numbers of egg
active as on the cultivated Brassicaceae plants.
produced by DBM females, we did not test the
In a no-choice test, DBM larvae took
feeding behaviour of DBM larvae on them.
significantly (P < 0.05, Fisher's Protected LSD)
shorter time to reach C. rutidosperma and B. C. rutidosperma is a ubiquitous weed in
juncea var. rugose than the other food plants Malaysia while wild B. juncea was introduced
(Table 3). In contrast, the time taken by DBM from India (Anderson, 1974). Wild B. juncea
larvae to reach the food sources in a choice test was also proved to possess an oviposition
was not significantly different among food attractants that make it possible to be used as
plants. trap crop. In Malaysia, it is not practical to
interplant wild B. juncea with Brassica crops
Results showed that both cultivated B. juncea
due to socioeconomic reason. However, we
was a better food plants of DBM (higher
can plant it around the field and do insecticide
numbers of egg produced per adult female, and
spraying only when necessary. This could
longer time spent feeding on it), as compared
reduce DBM and other cabbage pest's
with the other food plants. This suggests that it
population in the field as well as insecticide-
should not be planted alone if we want to avoid
resistance development. Unlike wild B. juncea,
heavy infestation of DBM and reduce pesticide
A
20
10
a
5
0
OKRA ONION CHILI TOMATO BRINJAL
B
4
a
Time (Sec + S.E)
3
aa
2
a
1
0
OKRA ONION CHILI TOMATO BRINJAL
C
3.5
a
3 a
Time (Sec + S.E)
2.5
2
1.5 a
1
0.5
0
OKRA ONION CHILI TOMATO BRINJAL
3.5 D
3 a a
Time (Sec + S.E)
2.5
2
1.5 a
1
0.5
0
OKRA ONION CHILI TOMATO BRINJAL
Figure 2. Mean time taken to reach (A), staying on food (B), feeding on food (C),
and leaving food (D) plant by BAW in a choice test experiment
the cabbage field interplanted with tomato Carlisie, D. B., Ellis, P. E., Betts, E. 1965. The
plants than in the field planted with cabbage influence of aromatic shrub on sexual maturation in
alone. We could also plant wild B. juncea the desert locust, Schistocerca gregaria. Jour. Insect
around the plot or field planted with cultivated Physiol. 11: 1541- 1558.
B. juncea , and this may be able to avoid a Cole, R. A. 1976. Isothiocyanates, Nitriles and
cultivated B. juncea from heavy infestation of Thiocyanates as Products of Autolysis of
DBM. Glucosinolates in Cruciferae. Phytochem., 15: 759-
762.
4. Conclusion
Although the foliage of chilli and tomato to a Fox, L. R., D. K. Letourneau, J. Eisenbach, and S.
V. Nouhuys. 1990. Parasitism rates and sex ratios of
certain extent did not show an obvious effect
parasitoid wasp: Effect of herbivore and plant
on larval growth or preference, these plants quality. Oecologia, 83: 414-419.
could sustain larvae development to reach the
adult stage. It is hoped that the results had add Gibson, R. W., Pickett, J. A. 1983. Wild potato
new information for effective integrated repels aphid by release of aphid alarm pheromone.
302: 608 – 609.
management program of BAW in Malaysia.
For example, the severe damage caused by Gupta, P.D. and A. J. Thorsteinson. 1960. Food
BAW larvae on okra or onion could be reduced plant relationships of the diamondback moth
through interplanting brinjal with okra or (Plutella maculipennis (Curt.)). Entomol. Exp.
onion. Similarly, DBM development, Appl., 3: 241-250.
reproduction and feeding behavior could be Idris, A. B., and E. Grafius. 1996. Effects of wild
manipulated by inter-planting cabbages with and cultivated host plants on oviposition, survival,
non-host or less preferred plants. and development of diamondback moth
(Lepidoptera; Plutellidae) and its parasitoid
5. Acknowledgments Diadegma insulare (Hymenoptera: Ichneumonidae).
We really indebted to Mr. Hussan Abd. Kadir Environ. Entomol., 25: 825-833.
of MARDI and Prof. Dzolkifli Omar of UPM
Nas, L. P. 1973. Toxicant occurring naturally in
for donating us the BAW and DBM. This
foods. Publ. No. 2117 Nat. Acad. Sci., Washington,
project was funded by the Faculty of Scince D. C.
and Technology (Faculty of Life Sciences),
Universiti Kebangsaan Malaysia, Selangor, Riddiford, L.M.1967. Trans-2-hexenal: Mating
Malaysia. stimulant for Polyphemus moths. Science, 158: 139
– 141.
6. References
Ridely, M. 1986. Animal behviour: A concise
Ahmad, Y. and T. H. Ho, 1980. List of economic
introduction. Blackwell Scientific publication.
pests, host plants, parasites and predators in West
University of Oxford.
Malaysia (1920-1978). Ministry of Agriculture
Malaysia. Bulletin No. 153: 538 pp. Sivapragasam, A., A. Asma, and M. A. Rafi. 1994.
Development and biotic potential of cabbage
Anderson, M. R. 1974. Malayan wild flowers.
webworm (Hellula undalis) on the weed, Cleome
Dicotyledons. The Malaysian Nature Publication,
rutidosperma. Paper presented at International
Kuala Lumpur. 450 pp.
Conference on Plant Protection in the Tropics, 23-
Bach, C.E. and B.E. Tabashnik. 1990. Effects of 31 March 1994, Kuala Lumpur, Malaysia.
nonhost plant neighbors on population densities and
Talekar, N. S., Shelton, A. M. 1993. Biology,
parasitism rates of the diamondback moth
ecology, and management of the diamondback
(Lepidoptera: Plutellidae). Environ. Entomol., 19:
moth. Annual Review of Entomology, 38: 275-301.
987-994.
Wallbank, B.E. and G.A. Wheatley. 1976. Volatile
Beck, S.D., Reese, J.C. 1976. Insect-plant
constituents from cauliflower and other crucifers.
interaction: nutrition and metabolisme. Dlm. James
Phytochem., 15: 763-766.
W. Wallace & Richard L. Mansell (pnyt.)
Biochemical interaction between plants and insects,
hlm. 63 – 71. Plenum Press. New York and London.
Iis Siti Jahro1), Djulia Onggo1), Susanto Imam Rahayu1) , Ismunandar1) dan Ibrahim Baba2)
1)
Departemen Kimia, Institut Teknologi Bandung,
Jl. Ganesha No. 10 Bandung, 40132, Indonesia
e-mail : djulia @ chem.itb.ac.id
2)
Pusat Pengajian Sains Kimia, Universiti Kebangsaan Malaysia
43600 UKM, Bangi, Selangor Darulehsan, Malaysia
e-mail : kpstm@pkrisc.cc.ukm.my
Abstrak
Senyawa [Fe(NH2trz)3]Cl2 3H2O telah berhasil disintesis dari larutan senyawa besi(II)
klorida dan ligan 4-Amino-1,2,4-triazole di bawah atmosfer gas nitrogen dalam pelarut
metanol tanpa oksigen. Rumus molekul senyawa ini ditentukan atas dasar kadar unsur-
unsur pembentuknya yakni Fe = 13,05 ; C = 16,61 ; H = 3,68 ; N = 36,12 % dan didukung
oleh daya hantarnya sebesar 280 Ω-1.cm2.mol-1 yang menunjukkan kompleks bermuatan +2.
Senyawa ini termasuk kelompok spin crossover yang dibuktikan dari sifat magnetnya. Pada
temperatur ruang (296 K) diamati harga momen magnet sebesar 2,99 BM dengan fraksi spin
rendah 0,56 dan fraksi spin tinggi 0,44. Sejalan dengan meningkatnya temperatur maka fraksi
spin rendah semakin berkurang dan fraksi spin tinggi semakin meningkat hingga pada
temperatur 308 K, fraksi spin tinggi senyawa ini menjadi 1 dengan harga momen magnet 5,4
BM. Fenomena penyeberangan spin (spin crossover) ini berlangsung reversibel dan
menunjukkan tipe histeresis dengan ∆T sekitar 4 K. Fenomena penyeberangan spin ini juga
didukung oleh perubahan warna kompleks dari ungu menjadi putih dan sebaliknya.
Kata kunci : sintesis, spin crossover, [Fe(NH2trz)3]Cl2, momen magnet, fraksi spin tinggi
[Fe(phen)2(NCS)2] dengan phen = 1,10- pelarut metanol. Di dalam labu yang lainnya
phenanthrolin (König, et al., 1968). dilarutkan 0,6 gram ligan NH2trz dalam 10 mL
Selanjutnya sejak tahun 1970 hingga saat ini pelarut metanol. Selanjutnya larutan ligan
penelitian fenomena SC pada kompleks ditambahkan ke dalam labu berisi larutan FeCl2
Fe(II) berkembang secara pesat, misalnya 4H2O menggunakan alat suntik. Campuran
pada kompleks [Fe(dip)2(NCS)2] oleh König, diaduk di bawah atmosfir N2, endapan yang
et al. (1986), [Fe(pyq)3][ClO4]2.H2O oleh terbentuk disaring menggunakan kaca masir
Onggo, et al. (1990), [Fe(dpa)2][ClO4]2 oleh dan dikeringkan dalam desikator vakum berisi
McCusker, et al. (1996) , desikan P2O5.
{[Fe(bt)(NCS)2]2[bpym]} oleh Real, et al.
Karakterisasi Senyawa Kompleks Fe(II)
(1999), [Fe(NH2trz)3][BF4]2.H2O oleh
Hasil Sintesis
Kahn, et al. (1998), [Fe(btr)3][ClO4]2 oleh
Karakterisasi yang dilakukan terhadap senyawa
Garcia, et al. (1999) dan [Fe(NH2trz)3][NO3]2
kompleks Fe(II) hasil sintesis meliputi
oleh Gütlich, et al. (2000). Penelitian-penelitian
penentuan rumus molekul senyawa kompleks
kompleks Fe(II) tersebut mengarah pada
berdasarkan analisa kadar Fe dan unsur C, H,
pemanfaatan senyawa kompleks sebagai sensor
N, serta pengukuran daya hantarnya dan
temperatur dan elemen aktif pada peralatan
identifikasi karakter penyeberangan spinnya
display serta memori. Sehubungan dengan
(spin crossover) berdasarkan pengukuran
pemanfaatannya sebagai elemen aktip pada
momen magnet dengan variasi temperatur
memori maka senyawa SC dikenal sebagai
mulai dari 273 hingga 308 K disertai
material cerdas.
penetapan fraksi spin tingginya.
Pada makalah ini dilaporkan pembentukan dan
3. Hasil dan pembahasan
karakter penyeberangan spin (SC = Spin
Senyawa kompleks Fe(II) dengan ligan 4-
Crossover) ion Fe(II) pada kompleks
amino-1,2,4-triazole (NH2trz = C2H4N4)
[Fe(NH2trz)3]Cl2 3H2O dengan indikator
berhasil disintesis dalam bentuk serbuk padatan
pengaruh temperatur terhadap sifat magnet dan
berwarna ungu , dari lima kali pengerjaan
tampilan warna kompleks tersebut.
diperoleh berat total hasil sintesis 2,54 gram
2. Percobaan dengan rendemen berkisar 60 – 63 %. Hasil
Sintesis Kompleks Fe(II) dengan Ligan 4- analisis komposisi kimia yang disajikan pada
Amino-1,2,4-triazole (NH2trz = C2H4N4) Tabel 1 menunjukkan senyawa kompleks yang
Di dalam labu 50 mL ditimbang 0,4 gram FeCl2 diperoleh memiliki rumus molekul
4H2O kemudian secepat mungkin labu ditutup [Fe(C2H4N4)3]Cl2.3H2O atau biasa dituliskan
dan ke dalamnya dialirkan gas N2 dan 6 mL sebagai [Fe(NH2trz)3]Cl2 3H2O.
305 K 308 K
1,00
(299; 0,94)
0,75
(296; 0,64)
Fraksi spin tinggi
0,50
(
(288; 0,22)
0,25
(288; 0,11)
(273; 0,06)
0,00
270 280 290
Tem peratur (K)
momen magnet spin rendah sekitar 0,7 – 1 BM, magnet 5,4 BM. Sebaliknya penurunan
maka dapat ditentukan fraksi spin tinggi dan temperatur dari temperatur ruang (293 K)
rendah kompleks Fe(II) dalam senyawa hingga temperatur 273 K menurunkan fraksi
[Fe(NH2trz)3]Cl2 3H2O berdasarkan harga spin tinggi kompleks ini dari 0,44 manjadi
momen magnet teramatinya pada berbagai sekitar 0,06 akibat kompleks spin tinggi
temperatur pengukuran yang digunakan. mengalami perubahan menjadi kompleks spin
rendah. Fenomena penyeberangan spin
Pada temperatur ruang (293 K) harga momen
kompleks [Fe(NH2trz)3]Cl2 3H2O ini
magnet senyawa kompleks [Fe(NH2trz)3]Cl2
berlangsung reversibel tetapi pola perubahan
3H2O sebesar 2,99 BM menunjukkan serbuk
spin pada saat peningkatan temperatur dari 273
padatan kompleks [Fe(NH2trz)3]Cl2 3H2O hasil
– 308 K berbeda dengan pola perubahan spin
sintesis merupakan campuran kompleks F(II)
kebalikannya, pada saat penurunan temperatur
pada keadaan spin tinggi dan rendah dengan
dari 308 – 273 K sehingga memunculkan
fraksi spin rendah (0,56) lebih besar daripada
fraksi spin tinggi (0,44). Pemberian energi histeresis dengan lebar (∆T) sekitar 4 K.
pemanasan berupa peningkatan temperatur 4. Kesimpulan
menyebabkan kompleks pada keadaan spin Senyawa kompleks [Fe(NH2trz)3]Cl2 3H2O
rendah mengalami perubahan keadaan spin telah berhasil disintesis dari senyawa FeCl2
menjadi kompleks spin tinggi sehingga harga 4H2O dan ligan 4-Amino-1,2,4-triazole (NH2trz
momen magnet dan fraksi spin tinggi semakin = C2H4N4). Rumus molekul senyawa kompleks
meningkat sejalan dengan meningkatnya dibuktikan dari data hasil analisis kadar unsur-
temperatur dan pada temperatur 308 K unsur pembentuknya dan didukung oleh data
diperkirakan semua kompleks [Fe(NH2trz)3]Cl2 daya hantarnya.
3H2O keadaan spin rendah sempurna
Pada temperatur ruang senyawa kompleks
mengalami penyeberangan spin menjadi
[Fe(NH2trz)3]Cl2 3H2O hasil sintesis
kompleks spin tinggi yang ditandai dengan
merupakan campuran kompleks Fe(II) pada
harga fraksi spin tinggi sebesar 1 dan momen
keadaan spin tinggi dan spin rendah dengan König, E., Madeja, K., and Watson, K.J., (1968),
fraksi spin rendah lebih besar daripada fraksi Reversible Quintet-Singlet Transition in
spin tinggi. Pada temperatur 308 K semua Dithiocyanotobis(2,2’-dipyridyl)iron(II), J. Am.
kompleks spin rendah sempurna mengalami Chem. Soc. 90, 1146-1153.
penyeberangan spin (spin crossover) menjadi McCusker, J.K., Rheingold, A.L., and Hendrickson,
kompleks spin tinggi yang ditandai dengan D.N., (1996), Variable-Temperature Studies of
perubahan harga fraksi spin tinggi dari 0,44 Laser-Initiated 5T2 → 1A1 Intersystem Crossing in
manjadi 1 dan momen magnet dari 2,99 Spin Crossover Complexes: Empirical Correlations
menjadi 5,4 BM serta perubahan warna between Activation Parameters and Ligan Structure
serbuk kompleks dari ungu pada keadaan spin in a Series of Polypyridyl Ferrous Complexes,
Inorg. Chem., 35, 2100-2112
rendah menjadi putih pada keadaan spin tinggi.
Onggo, D., Hook, J.M., Rae, A.D., and Goodwin,
5. Daftar Pustaka H.A., (1990), The Influence of Steric Effects in
Garcia, Y., Kahn, O., Rabardel,L, Chansou, B., Substituted 2,2’-Bipyridine on the Spin State of
Salmon, L., and Tuchogues, J.P., (1999), Two-Step Iron(II) in [FeN6]2+ Systems, Inorganica Chimica
Spin Conversion for the Three-Dimensional Acta, 173,19-30.
Compound Tris(4,4’-bis-1,2,4-triazole)iron(II)
Diperchlorate, Inorg. Chem., 38, 4663-4670. Onggo D, dan Sugiharto, H.K., (2001), Transisi
Spin Pada Senyawa Kompleks Besi(II) dengan
Gütlich, P., Garcia, Y., and Goodwin, H.A., (2000), Ligan Bidentat Beratom Donor Nitrogen, Jurnal
Spin Crossover Phenomena in Fe(II) Complexes, Pendidikan Matematika dan Sains, 1, IV, 43 – 49.
Chem. Soc. Rev., 29, 419-427.
Real, J.A., et al., (1999), Light Induced Excited Pair
Kahn, O., and Martinez, J., (1998), Spin Transition Spin State in an Iron(II) Binuclear Spin-Crossover
Polymers: From Molecular Materials Toward Compound, X., J. Am. Chem. Soc., 121, 10630-
Memory Devices, Science,, 279, 44-48. 10633.
Abstract
In our search for agents effective against immune-mediated disorders and inflammation, we
have screened several Malaysian medicinal plants for their ability to inhibit the expression of
intercellular adhesion molecule-1 (ICAM-1) and vascular adhesion molecule-1 (VCAM-1) on
the surface of murine endothelial cells (F-2) and mouse myeloid leukemia cells (M1)
respectively. A number of plant extracts consisting of different families and genera were tested
of which some extracts showed significant activities against ICAM-1 and VCAM-1. Bioassay
directed fractionation of two plants namely Goniothalamus andersonii and Alstonia spatulata
resulted in the isolation of compounds with interesting results indicating the possibility of
their use as sources of immunosuppressive and anti-inflammatory substances. Goniothalamin
and gonodiol from G. andersonii were found to inhibit the cell surface expression of both
ICAM-1 and VCAM-1, while alstonisine from A. spatulata inhibited the cell surface
expression of VCAM-1 by more than 50% which was better when compared to seven other
congener alkaloids from the same genus.
facilities were already in place for the testing of interesting to note that most of the samples
anti-allergic natural products using endothelial tested are alkaloid containing plants due to the
cells . group’s interest in alkaloidal plants. Several
extracts prepared from Alstonia spatulata,
2. Experimantals
Dehaasia incrassata, and Rauwolfia perakensis
Plant materials. Plant samples were collected
reduced the level of VCAM-1 to less than half
from all over Malaysia and voucher specimens
of the control value. A petroleum extract of
were deposited in the herbarium of UKM
Eupatorium odoratum, however, promoted the
Bangi. Each plant material (20g) was extracted
VCAM-1 expression. It was also observed that
at room temperature with either methanol,
extracts of D. incrassata roots were capable of
chloroform and pet. Ether (PE)
downregulating both ICAM-1 and VCAM-1.
Fractionation and identification of active
Due to their availability in large quantities, two
principles. The dried ground bark of
plant samples were chosen for detailed analysis
Goniothalamus andersonii (500g) was
of the chemical constituents that were active in
extracted with petroleum ether followed by
the respective bioassays. Both G. andersonni
ethyl acetate and the resulting solutions
and G. fasciculatus were selective in inhibiting
evaporated to dryness. The ethyl acetate extract
VCAM-1 cells only while A. spatulata was
was applied on to a silica gel column and eluted
selective against VCAM-1. Isolation and
with chloroform to yield mainly goniothalamin
consequent testing of goniothalamin and
and goniodiol as active components of G.
goniodiol indicated that both compounds dose-
andersonii. Powdered roots of A. spatulata
dependently downregulate not only the level of
(860g) was extracted with methanol at room
VCAM-1 but also that of ICAM-1, suggesting
temperature for 3 days (2x) and the resulting
the crude extracts may contain some other
crude methanol extract (88.2g) was worked up
inhibitors of VCAM-1. On the other hand,
for the alkaloid content in the usual manner
bioassay-guided isolation of the active
(acid-base extraction) to yield the crude
constituents of A. spatulata identified
alkaloids (4.75g). Further fractionation via
alstonisine as the component that was
bioactivity directed column chromatography
responsible for the inhibition of the cell
yielded the bioactive alkaloids which were
surface expression of VCAM-1 by 52.5%.
identified by the usual spectroscopic
Tests on other alkaloids from Alstonia were not
techniques.
as effective as alstonisine, most of which
Spectral data. NMR and MS were measured showed VCAM-1 expression at 12.5 µg/ml by
using Jeol JNM-LA500 and Jeol JMS-HX110 more than 70% (see Table 2 and Figure 1).
respectively
It would be difficult to choose the right plant
Bioassay. Cell surface expression of ICAM-1 candidate for testing from ethnobotanical data
and VCAM-1 were measured using established since the old literature would not list anti-
methods (Tanaka et al. 2001). inflammatory or immunosuppressive use of the
medicinal plants. However it would be
3. Results and Discussion
A total of 29 extracts were tested for the worthwhile to look at medicinal plants used for
inhibition of cell surface expression of ICAM-1 “inflammatory symptoms” such as wounds,
and VCAM-1 (Table 1). Flow cytometry bruises, carbuncles, sting by insects,
analyses showed that a number of our samples rheumatism, ulcers, throat complaints and
reduced the expression of ICAM-1 and bronchitis. Burkill (1936) do describe some of
VCAM-1 indicating the potential of these these and have been shown in the results for
plants having chemical constituents that act as Kadsura scandens which has been traditionally
immunosuppressive and anti-inflammatory used for rheumatism, a kind of autoimmune
principles. Samples that significantly disorder.
downregulated the expression of ICAM-1 were 4. Conclusion
the extracts of Ancistrocladus tectorius and
Tabernaemontana macrocarpa while Dehaasia Cell surface expression of ICAM-1 and
incrassata, Mitragyna speciosa, Cinnamomum VCAM-1 is known to be associated with a
povectum and Cucurma domestica increased variety of immune and inflammatory disorders
the cell surface expression of ICAM-1. It is
although it is not the only bioassay available to plants are a potential source of therapeutic
indicate such activities of natural products. Our principles for anti-allergic drugs although a
research programme has successfully shown more thorough investigation is needed for the
that natural products from Malaysian medicinal programme to progress further.
Table 1: Effect of various extracts of Malaysian medicinal plants on the cell surface expression of
ICAM-1 and VCAM-1
Table 2: Inhibitory effect of isolated compounds on the expression of ICAM-1 and VCAM-1
Compound Relative amount of Relative amount of
ICAM-1 (%) VCAM-1 (%)
Goniothalamin 52.7 67.1
Goniodiol 45.8 42.4
Alstonerine nt 101.6
Alstophylline nt 108.7
Quaternine nt 79.6
Volkenseine nt 90.5
Vincorine nt 77.0
10-methoxy-N1-
methylburnamine-17-O- nt 72.5
benzoate
17-deacetyl-5α,10-
dimethoxyakuammiline nt 86.0
17-O-3’,4’,5’-
trimethoxybenzoate
Alstonesine nt 52.5
Isoliquiritigenin 52.8 66.8
Dose of each compound 12.5 µg/ml ; 0.6% DMSO used as control; nt = not tested
H O
H
O
NCH3
R N
NH
H O CH3
O COCH3
Me alstonerine (R=H)
N alstophylline (R=OCH3)
Alstonisine
Me
H3CO
O N N
N N
CH3
CH3 CH3
COOCH3 H COOCH 3
H
H 3 CO
H3 CO
H 3 CO O N
N N
N
R
CH 3
Quaternine (R=CH3) CH 3
vincorine CH3 Volkenseine (R=H
HO
O O
O O OH
goniodiol
goniothalamin
Figure 1: Structures of compounds isolated and tested against ICAM-1 and VCAM-1
Iqbal Musthapa 1), Euis H. Hakim 1), Yana M. Syah 1), Lia D. Juliawaty 1), Sjamsul A.
Achmad 1), Lukman Makmur 1), Zalifah Latif 2), Laily B. Din2), Ikram M. Said 2)
1)
Kelompok Penelitian Kimia Organik Bahan Alam, Departemen Kimia, Institut Teknologi Bandung, Jalan
Ganeca 10, Bandung 40132, Indonesia
2)
School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti
Kebangsaan Malaysia, 43600 UKM Bangi, Selangor D.E, Malaysia
Abstrak
Dua senyawa flavonoid terisoprenilasi, yaitu kudraflavon C (1) dan artokarpin (2) telah
berhasil diisolasi dari kayu batang Artocarpus heterophyllus. Penentuan struktur terhadap
kedua senyawa tersebut dilakukan berdasarkan data spektroskopi, serta melalui
perbandingan dengan senyawa standar. Senyawa 1-2 memperlihatkan sifat sitotoksik yang
kuat terhadap sel murine leukemia P-388.
Kata kunci : Artocarpus heterophyllus, flavonoid terisoprenilasi, kudraflavon C, artokarpin,
sel murine leukemia P-388
Jawa Barat pada bulan Agustus 2004 dan telah Evaluasi Biologi. Pengujian sifat sitotoksik
diidentifikasi di Herbarium Bandungense, dilakukan terhadap sel murine leukemia P-388.
Departemen Biologi ITB. Spesimen tumbuhan
3. Hasil dan Pembahasan
disimpan di herbarium tersebut.
Senyawa 1 diperoleh sebagai padatan amorf
Ekstraksi dan Isolasi. Serbuk kayu batang A. berwarna kuning kecoklatan dengan titik leleh
heterophyllus sebanyak 3,5 kg diekstraksi 96-98 OC. Spektrum UV dalam metanol
dengan metanol pada temperatur kamar selama memberikan serapan maksimum pada λmaks
3 kali berturut-turut, menghasilkan 103 gram 263, dan 316 (bahu)nm, spektrum ini
ekstrak metanol. Selanjutnya ekstrak yang mengindikasikan suatu flavon dengan kromofor
diperoleh dipartisi berturut-turut dengan n- sinamoil yang muncul sebagai pita I (316nm)
heksan (10 g), diklorometan (38 g), etil asetat dan kromofor benzoil yang ditunjukkan oleh
(40 g), dan ekstrak metanol sisa (15 g). Ekstak pita II (263nm), pita I yang berupa bahu
diklorometan (38 g) kemudian difraksinasi menunjukkan adanya substituen isoprenil pada
lebih lanjut dengan kromatografi cair vakum posisi C-3 di cincin C. Penambahan reagen
(KCV) mempergunakan eluen n-heksan-etil geser NaOH mengindikasikan bahwa senyawa
asetat yang secara berangsur-angsur 1 memiliki gugus hidroksi bebas pada C-4’
ditingkatkan kepolarannya sehingga diperoleh yang ditunjukkan dengan adanya pergeseran
enam fraksi utama A-F. Fraksi B (5,2 g) batokromik dari pita I sebesar 44 nm. Spektrum
difraksinasi lebih lanjut dengan KCV IR dari senyawa ini memperlihatkan gugus
menggunakan eluen n-heksan-etil asetat dengan fungsi utama dari suatu flavon, dimana gugus -
meningkatkan kepolaran, diikuti dengan C=O terkonjugasi muncul pada 1650 cm-1 dan
kromatografi radial (silika gel ; eluen vibrasi ulur C=C aromatik terlihat pada 1359-
klorofom:metanol (9,5:0,5)) menghasilkan 1620 cm-1, sementara serapan untuk gugus –
kudraflavon C (1)(0,2 g). Dengan metodologi OH terlihat pada 3373 (lebar) cm-1, selain itu
yang sama senyawa artokarpin (2) (0,4 g) juga serapan C-H alifatik tampak didaerah 2917 cm-
1
diisolasi dari fraksi A ekstrak diklrorometan. yang memperkuat dugaan adanya gugus
Kudraflavon C (1), diperoleh sebagai padatan isoprenil pada senyawa ini. Berdasarkan
amorf berwarna kuning kecoklatan, t.l. 96-98 analisis di atas disarankan bahwa senyawa hasil
O isolasi adalah suatu flavon yang terisoprenilasi
C; UV (MeOH) λmaks : 263, dan 316
pada posisi C-3. Spektrum 1H-NMR
(bahu)nm; (MeOH + NaOH) λmaks : 269 dan
memperlihatkan bahwa senyawa 1 mempunyai
360 nm; IR (KBR) νmaks : 3373 (OH), 2917 (C- tiga proton aromatik pada cincin B yang
H alifatik), 1650 (C=O), 1620,1563,1463, 1359
muncul sebagai sistem ABX pada δH 6,54
(cincin aromatik) cm-1; 1H-NMR (aseton-d6,
(1H,d, J =2,2 Hz), 6,49 (1H, dd, J = 8,4 & 2,2
400 MHz) δ (ppm) : 6,39 (1H,s), 3,10 (2H,d, J Hz), 7,16 (1H,d, J = 8,4 Hz). Adanya sinyal-
= 7,0), 5,12 (1H, m), 1,42 (3H, s),1,56 (3H, s), sinyal tersebut menunjukkan bahwa cincin B
3,34 (2H,d, J =7,0), 5,27 (1H, m),1,77 (3H, s), dari senyawa 1 memiliki substituen –OH pada
1,64 (3H, s), 6,54 (1H,d, J =2,2), 6,49 (1H, dd, C-2’ dan C-4’ sebagaimana lazimnya flavonoid
J = 8,4 & 2,2), 7,16 (1H,d, J = 8,4); 13C-NMR yang berasal dari tumbuhan Artocarpus.
(aseton-d6 , 100 MHz) δ (ppm) : 162,1, 121,4, Adanya sinyal singlet pada δH 13,5 adalah
183,0, 105,0, 160,0, 111,7, 162,4, 93,4, 157,0, karakteristik untuk gugus –OH pada C-5 yang
24,6, 122,7, 132,0, 25,8, 17,8, 22,0, 123,4, membentuk khelat dengan gugus karbonil pada
131,4, 25,7, 17,6, 113,0, 157,2, 103,8, 161,4, C-4. Spektrum 1H-NMR senyawa 1 juga
108,0, 132,1. memperlihatkan sinyal pada 6,39 (1H, s) yang
Artokarpin (2), diperoleh sebagai padatan memberi petunjuk bahwa pada cincin A
amorf berwarna kuning pucat, t.l 176-178 OC; senyawa 1 tersubstitusi oleh gugus –OH pada
UV (MeOH) λmaks : 204,279, dan 321 posisi C-5 dan C-7 dan empat sinyal metil
(bahu)nm; (MeOH + NaOH) λmaks : 207,276 pada 1,42 (3H,s), 1,56 (3H,s), 1,63 (3H,s),
dan 360 nm; IR (KBR) νmaks : 3392 (OH), 2959 1,77(3H,s) menunjukkan adanya dua substituen
(C-H alifatik), 1621 (C=O),1455,1352 (cincin isoprenil pada posisi C-3 dan C-6. Dari analisis
aromatik) cm-1. spektrum 1H-NMR tersebut, maka dapat
disarankan bahwa senyawa 1 adalah 5,7,2’,4’-
OH OH
HO O H3CO O
3
OH OH
14 9
OH O 10 OH O
(1) (2)
batokromik sebesar 39 nm pada pita I, yang Pada pengujian sifat sitotoksik terhadap sel
menunjukkan adanya gugus –OH bebas pada murine leukemia P-388, senyawa 1 dan 2
posisi C-4’ di cincin B. Keberadaan gugus – memperlihatkan aktivitas yang kuat yang
OH ini didukung oleh spektrum IR senyawa 2 diperlihatkan dengan nilai IC50 berturut-turut
yang menunjukkan adanya serapan pada 3392 3,30 dan 1,9 µg/mL. Senyawa 2 juga
cm-1. Spektrum IR senyawa 2 juga dilaporkan menghambat transpor asam amino
memperlihatkan serapan untuk gugus fungsi leusin melalui membran usus ulat sutera
utama dari suatu flavon yaitu serapan karbonil bombyx mori, dengan nilai IC50 3,65 mmol/L
pada 1621 cm-1 dan vibrasi ulur C=C aromatik (Achmad, 2004).
(1352-1455 cm-1), sementara serapan untuk C-
4. Kesimpulan
H alifatik terlihat pada 2959 cm-1. Data
Dari fraksi diklorometan kayu batang A.
spektrum IR senyawa 2 tersebut ternyata
heterophyllus telah ditemukan dua senyawa
identik dengan data yang sama dari artokarpin
flavon terisoprenilasi, yaitu kudraflavon C (1)
yang sebelumnya telah diisolasi dari tumbuhan
dan artokarpin (2). Hasil uji biologis terhadap
A. champeden (Hakim, 1998). Bukti tambahan
kedua senyawa tersebut memperlihatkan sifat
terhadap struktur 2 diperoleh dari hasil
sitotoksik yang kuat, menunjukkan bahwa
perbandingan KLT antara senyawa 2 dengan
tumbuhan ini berpotensi sebagai sumber bahan
senyawa artokarpin yang memperlihatkan nilai
kimia yang bermanfaat.
Rf yang sama pada tiga sistem eluen yang
berbeda. Dengan demikian dapat disimpulkan 5. Ucapan Terimakasih
bahwa senyawa 2 adalah artokarpin. Ucapan terima kasih disampaikan kepada
Herbarium Departemen Biologi ITB yang telah
Struktur senyawa kudraflavon C (1) dan
mengidentifikasi tumbuhan tersebut.
artokarpin (2) memiliki jenis kerangka yang
sama yaitu 3-prenilflavon, tetapi diantara kedua 6. Daftar pustaka
senyawa tersebut terdapat perbedaan yaitu pada Achmad, S.A. (2004). Review : Empat Puluh Tahun
gugus samping yang terikat pada C-7 dan posisi dalam Kimia Organik Bahan Alam Tumbuh-
ikatan rangkap pada gugus isoprenil yang Tumbuhan Tropika Indonesia : Rekoleksi dan
terikat pada C-6. Gugus samping pada C-7 Prospek, Bull. Soc. Nat. Prod. Chem. (Indonesia),
35-54.
dalam senyawa kudraflavon C (1) berupa gugus
–OH bebas sedangkan pada senyawa artokarpin Achmad, S.A., Hakim, E.H., Makmur, L.,
(2) berupa metoksi, kemudian posisi ikatan Mujahidin, D., Syah, Y.M., (1999). Prosiding
rangkap pada gugus isoprenil yang terikat pada Seminar Nasional Kimia Bahan Alam ‘99, hal. 1-9.
C-6 dalam senyawa kudraflavon C (1) berada Agustini, D.M., Makmur, L., Achmad, S.A.,
diantara C-15 dan C-16 sedangkan pada Ghisalberti, E.L., Hakim, E.H., Syah, Y.M., (1999).
artokarpin (2) berada diantara C-14 dan C-15. Prosiding Seminar Nasional Kimia Bahan Alam
‘99, hal .198-204.
Keberadaan senyawa kudraflavon C (1) dan
artokarpin (2) dalam Arocarpus, diindikasikan Eliza., (1998). Artokarpin dan Turunannya dari
sebagai prekursor dari sejumlah senyawa Kayu Akar Artocarpus maingayi King, Tesis,
turunan flavon terisoprenilasi yang terdapat Departemen Kimia , Institut Teknologi Bandung.
dalam genus ini. Senyawa-senyawa tersebut Hakim, E.H., Marlina E.V., Mujahidin, D., Achmad,
sebelumnya telah diisolasi dari beberapa S.A., Ghisalberti, E.L., Makmur, L., (1998).
spesies Artocarpus, seperti A. champeden Proceeding ITB, 30, 31-36.
(Hakim, 1998), A. glauca (Agustini, 1999), dan Hano, Y., Y. Matsumoto., K. Shinohara., Jin Yun
A. maingayi (Eliza, 1998) . Hal ini Sun., T. Nomura T., (1990). Heterocycles,
menunjukkan kedekatan secara kemotaksonomi 31(7),1339-1344.
antara A. heterophyllus dengan A. champeden, Jarret F.M. (1959). Studied in Artocarpus and Allied
A. glauca, dan A. maingayi. Genera I, General Considerations, J. Arnold
Arboretum, 40,1-29.
Abstrak
Kesan perlekatan antara gentian aramid dan getah asli (NR) telah diukur secara kuantitatif
menggunakan kaedah ujian mikro-ikatan. Dua jenis gentian aramid yang digunakan dalam
kajian ini adalah gentian tanpa rawatan (HM) dan gentian yang dirawat dengan bahan
perekat aktif epoksi (HMA). Kedua-dua gentian tersebut seterusnya dirawat dengan lateks
resorsinol formaldehid (RFL) sebelum dititiskan dengan lateks NR. Didapati bahawa rawatan
permukaan gentian menggunakan RFL ke atas kedua-dua gentian HM dan HMA telah
meningkat kekuatan ricih antara muka gentian/matriks. Keputusan ini telah disokong oleh
analisis mikroskop imbasan elektron (SEM) ke atas sampel selepas ujian regangan.
Keputusan ini memberikan kesimpulan bahawa rawatan permukaan gentian dengan bahan
perekat aktif epoksi dan lateks resorsinol formaldehid (RFL) meningkatkan lekatan antara
muka antara gentian aramid dan matriks ENR.
Kata kunci : Aramid, getah asli, mikro-ikatan
Daya mericih, Fp
Plat ricih
Gentian
Diameter gentian, d
0.30
0.25
Daya 0.20
0.15
(N)
0.10
0.05
0.00
0.2 0.4 0.6 0.8 1.0 1.2
Pemanjangan (mm)
Rajah 2: Perbandingan plot daya ricih melawan pemnajangan untuk TNHM yang dirawat RFL
dan tanpa rawatan RFL
14
Tegasan ricih antara muka, τa (MPa)
0
0 200 400 600 800
Panjang terbenam, Le (µm)
Rajah 3: Perubahan nilai τa yang ditentukan menggunakan Per (1) pada panjang
terbenam berbeza untuk ujian mikro-ikatan Twaron/NR
Diameter gentian diukur dengan cara kalibrasi 3. Hasil dan Pembahasan
mikrograf SEM. Seterusnya SEM digunakan Ujian mikro-ikatan
untuk mengkaji permukaan gentian aramid Rajah 2 menunjukkan plot daya melawan
tanpa rawatan dan selepas dirawat, pemanjangan daripada ujian mikro-ikatan.
membandingkan perbezaan di antara Proses nyah-ikatan telah mula dikaji oleh
permukaan gentian yang tanpa rawatan dan Greszczuk (1966) di mana beliau membuat
yang dirawat dengan RFL dan interaksi antara andaian bahawa daya tarikan keluar maksimum
permukaan gentian dengan matriks. gentian berlaku pada permulaan nyah-ikatan
OH
HO CH2OH + CO NH
OH
OH
CH2
CO N
OH
O O
NaOH
HO CH2OH + CH2 CHCH2O(CH2)4OCH2CH CH2
OH
O
HO CH2OCH2CHCH2O(CH2)4OCH2CH CH2 Polymer
OH
(Fmax = Fd). Pengaruh panjang terbenam semasa antara gentian dan matriks dan mekanisma
gentian ditarik keluar daripada matriks juga kegagalan adalah nyah-ikatan gentian
telah dikaji oleh Pisanova et al. (2000). Beliau sepanjang matriks. Sebaliknya TNHMA
menyatakan bahawa IFSS boleh ditentukan menunjukkan nilai τsyang lebih tinggi. Ini
pada Le = 0 (Pers. (2)) Dengan menggunakan mungkin disebabkan kekasaran permukaan
teori ini maka nilai IFSS untuk setiap sistem gentian yang meningkatkan ikatan mekanikal
boleh ditentukan seperti ditunjukkan dalam gentian-matriks. Rawatan permukaan bahan
Rajah 3. aktif epoksi pada permukaan gentian juga
Jadual 1 menunjukkan nilai IFSS yang dijangka membantu memperbaiki interaksi
ditentukan daripada Rajah 3. Didapati bahawa gentian-matriks. Jadual 1 juga menunjukkan
kedua-dua TNHM dan TNHMA yang dirawat
nilai τs bagi TNHM tanpa RFL sangat rendah
yang menggambarkan bahawa tiada perlekatan dengan RFL mempunyai nilai τs yang lebih
tinggi berbanding tanpa rawatan RFL.
(a) (b)
Rajah 6: Mikrograf SEM permukaan gentian selepas gentian ditarik keluar daripada matriks NR; (a)
TNHM tanpa RFL, (b) TNHM dirawat RFL
(a) (b)
Rajah 7: Mikrograf SEM permukaan gentian selepas gentian ditarik keluar daripada matriks NR; (a)
TNHMA tanpa RFL, (b) TNHMA dirawat RFL
gentian diselaputi oleh sedikit fragmen NR. interface: Evaluation of experimental parameters.
Manakala Rajah 7(b) menunjukkan dengan Compos Sci & Technol, 34, 35-51.
jelas bahawa matriks terlekat pada bahagian Greszczuk LB. (1966). Theoretical studies of the
permukaan gentian TNHMA yang dirawat RFL mechanisms of the fibre-matrix interface in
dan keadaan permukaan yang begitu kasar. Ini composites in ‘Interface in Composites’ ASTM
membuktikan bahawa ikatan antara gentian dan STP;452, 42-59.
matriks begitu kuat dibandingkan dengan Job L. & Joseph R. (1999) Studies on Rubber-to-
gentian yang tidak dirawat (Jadual 1). Nylon Tire Cord Bonding. J Appl Polym Sci., 71,
4. Kesimpulan 1197-1202.
Penyelidikan ini menunjukkan bahawa Miller B., Muri P., Rebenfeld L. (1987). A
gabungan antara ujian mikro-ikatan dan kajian Microbond method for determination of the shear
morfologi menggunakan SEM boleh digunakan strength of a fibre/resin interface. Compos Sci
untuk mengkaji kesan rawatan permukaan Technol, 2, 17-32.
gentian Twaron ke atas kekuatan antara muka Nielsen L.E. & Landel R.F. 1994. Mechanical
komposit Twaron/NR. Kajian menunjukkan properties of polymer and composites. New York:
bahawa TNHMA memberikan nilai IFSS yang Marcel Dekker Inc.
lebih tinggi berbanding TNHM yang Pisanova E., Zhandarov S., Mader E., Ahmad I.,
bermaksud rawatan dengan bahan aktif epoksi Young R.J. (2001) Three techniques of interfacial
telah meningkatkan interaksi gentian-matriks. bond strength estimation from direct observation of
Seterusnya rawatan permukaan Twaron crack initiation and propagation in polymer-fibre
menggunakan RFL juga menunjukkan bahawa systems. Compos. Part A: Appl. Sci. & Manu. 32A,
berlaku peningkatan interaksi antara getian dan 435-443.
matriks berbanding gentian tanpa rawatan RFL. Pitkethly M.J., Favre J.P., Gaur U., Jakubowski J.,
Keputusan ini membolehkan kesimpulan dibuat Mudrich S.F., Caldwell D.L., Drzal L.T., Nardin M.,
bahawa kedua-dua rawatan permukaan iaitu Wagner H.D., Di Landro L., Hampe A., Armistead
bahan aktif epoksi dan RFL telah J.P., Desaeger M., Verpoest I. (1993). A round
meningkatkan kekuatan antara muka gentian robin programme on interfacial test methods.
Twaron dan getah asli. Compos Sci & Technol ,48, 205-214.
A Comparison of Two SPE Cartridges Use for the Extraction of Fluroxypyr from
Soil
Abstract
The purpose of this study is to compare two SPE cartridges used for extracting fluroxypyr in
the soil. The proposed methods involve two steps: solid-liquid extraction followed by
cleaning-up process. Fluroxypyr in the soil samples was extracted into an acetonitrile layer
and eluted through one of two types of polyvinyl dibenzene solid phase extraction (SPE)
cartridges (IST ISOLUTE ENV+ or OASIS® HLB) for additional clean up. Quantification of
the extracted fluroxypyr was carried out by high performance liquid chromatography (HPLC)
including a diode array detector. The HPLC detector response was tested with standard
solutions containing 0.4 to 5 µg/ml fluroxypyr. A standard calibration curve where r2 =
0.9995 (p<0.05) was obtained. The minimum detectable concentration was 1 µg/kg. Using
OASIS® HLB, the average recovery rate of fluroxypyr from soil spiked with 1, 5, 10, 25 or 50
µg/kg fluroxypyr was 107±0.5%, 100±4.7%, 101±2.5%, 100±0.7% and 82±0.9%,
respectively. Meanwhile, using IST ISOLUTE ENV+, the recovery rate of fluroxypyr from the
spiked soils containing 1, 5, 10, 25 or 50 µg/kg of the fluroxypyr was 91±8.0%, 94±6.8%,
93±6.2%, 90±6.5% and 103±9.0%, respectively. The method developed proved to be suitable
for determination of fluroxypyr in soil samples and is recommended for the monitoring of
fluroxypyr contamination of the environment. Based on the percentage recovery and relative
standard deviation, the method using OASIS® HLB appeared to be better than the one using
IST ISOLUTE ENV+ for the extraction of fluroxypyr in soil.
Key words: Fluroxypyr, IST ISOLUTE ENV+, OASIS® HLB, SPE Cartridge, Soil.
quantification of fluroxypyr in soil and water for 10 min. The top layer (acetone + water)
samples. The objective of this study is to was transferred to a Schott bottle using a glass
determine the efficiency of the SPE cartridges Pasteur pipette and 200 ml of fluroxypyr- free
namely OASIS® HLB and IST ISOLUTE water were added. The bottles were then closed
ENV+ in the cleaning process of fluroxypyr and the contents mixed by shaking for a few
extracts from soil samples. seconds. The contents were then kept on an
ultrasonic bath for 5 min and the pH of the
2. Experimental
mixture adjusted to pH 3.0. A SPE cartridge
Reagents
was attached to the manifold, which was pre-
All reagents and solvents used in this study
washed with 3 ml acetonitrile and 3 ml distilled
were of analytical grade. Acetonitrile,
water. The washings were then discarded. The
methanol, acetic acid and acetone were
SPE tubing was immersed into the mixture and
obtained from Merck and standard fluroxypyr
the aspirator was switched on for the water to
of 99.7% purity was purchased from the
be sucked through either IST ISOLUTE ENV+
Laboratories of Dr. Ehrenstorfer Co.
or OASIS® HLB. After the water was
Germany. Solid phase extraction (SPE)
completely drawn through the SPE cartridge,
OASIS® HLB (polyvinyl dibenzene) containing
the cartridge was vacuum-dried. Fluroxypyr
200 mg of sorbent were obtained from
adsorbed in the cartridge, was then eluted with
WATERS (USA). The ISOLUTE ENV+
4 ml acetonitrile. The elute was dried
containing 200 mg sorbent was obtained from
completely using vacuum. The residue was
International Sorbent Technology (IST),
then redissolved with 1 ml acetonitrile before
MidGlamorgan UK.
being injected into the HPLC – DAD.
Apparatus
3. Results and Discussion
The pH meter model used was a PHM 210,
Figure 1 shows the calibration data obtained by
Radiometer, from Copenhagen. A vacuum
triplicate analysis, with each solution being
manifold, IST VacMaster was purchased from
injected thrice. The linear regression (R²) was
International Sorbent Technology (IST). The
found to be 0.9986 and the equation derived
aspirator connected to the vacuum manifold, a
from the calibration area data was y = 202.87x
Buchi B-169 Vacuum N-Evap Model 1111,
+ (-7.0509), where y is the area of fluroxypyr
used to evaporate the solvent, was purchased
obtained from the HPLC analysis and x the
from Organomation Associates Inc. USA.
concentration of fluroxypyr in µg/mL. The
HPLC Conditions reproducibility and linearity of the injection
An Agilent HPLC 1100 Series fitted with a technique are acceptable.
diode array detector (DAD) of wavelength 254
The efficiency of the method was tested by
nm was used. The column used was a LUNA
adding known amounts of fluroxypyr to soil
RP18, 5 µm, (250mm X 4.6mm I.D.). The
which was not contaminated with any
mobile phase was acetonitrile and acetate
fluroxypyr residue. The recovery of fluroxypyr
buffer, (1% acetic acid in water) often in the
was determined by analyzing the soil samples
ratio of 60:40. The flow rate and injection
spiked with the fluroxypyr standard solution at
volume were 0.8 ml/ min and 100 µl 5 different levels viz. 1, 5, 10, 25 or 50 µg/kg
respectively. (Figure 3). The recovery of fluroxypyr was
Methodology determined after the clean-up process with the
Twenty grams of fluroxypyr-free soil samples SPE cartridge of either OASIS® HLB or IST
in 250 ml conical flasks were spiked with ISOLUTE ENV+. The recovery and relative
fluroxypyr standard at the following standard deviation of fluroxypyr spiked in soil
concentrations: 1, 5, 10, 25 or 50 µg/kg. samples at levels of 1, 5, 10, 25 or 50 µg/kg
Eighty-ml of acetone: water (95:5) was then using OASIS® HLB were 107±0.5%,
added to each conical flask and the mixture was 100±4.7%, 101±2.5%, 100±0.7% and
again mixed thoroughly for 30 sec on the 82±0.9%, respectively with relative standard
vortex mixer. Each conical flask was placed in deviation of 0.5% to 4.7%. When the soil was
the ultra sonic bath for 15 min, and then the spiked with fluroxypyr at 1, 5, 10, 25 or 50
contents were transferred into test tubes and µg/kg the recovery was 91±8.0, 94±6.8,
centrifuged on high speed (3,500 rpm) at 26°C 93±6.2, 90±6.5 and 103±9.0%, respectively
1200
Area 600
400
200
0
0 1 2 3 4 5 6
Figure 2. HPLC chromatograms for a) blank soil sample, b) fluroxypyr standard solution (0.02 µg/ml)
, c) spiked soil sample (0.05 µg/kg).
when IST ISOLUTE ENV+ was used in the This result shows that in general the recovery
clean up process. The relative standard was greater when OASIS® HLB was used as
deviation ranged from 6.2% to 9.0%. compared to IST ISOLUTE ENV+. The lower
value of the relative standard deviation of the
100
90
80
70 OASIS
Recovery (%)
60
50 ENV+
40
30
20
10
0
1 5 10 25 50
Concentration of fluroxypyr (µg/kg)
recovery clearly indicates that OASIS® HLB is assays: Development and quantitation in soil and
more accurate as compared to IST ISOLATE water. J. Agric. Food Chem., 44, 488-496.
ENV+. This finding is in line with a previous Kidd, H., James, D.R. (1991). The Agrochemicals
report, whereby OASIS® HLB had shown good Handbook A0791/Aug 91, 3rd edition. Unwin
recovery in determining the fluroxypyr residue Brothers Limited. Old Woking, Surrey.
in soil samples (Halimah et al., 2004). Lehmann, R.G., Miller J.R. (1989). Soil catalysed
4. Acknowledgement hydrolysis of fluroxypyr-methylheptyl ester. Weed
The work was supported by research grant Res., 29, 385-389.
IRPA 08-02-02-0011 EA185 from the Ministry Lehmann, R.G., Miller, J.R., Cleveland, C.B.
of Science, Technology and Innovation of (1993). Fate of fluroxypyr in water. Weed Res. 33,
Malaysia. 197-204.
5. References Lehmann, R.G., Miller, J.R., Olberding, E.L.,
Halimah Muhamad, Tan Y. A., Ismail B. S. (2004). Tillotson, P.M., Laskowski, D.A. (1996).
Method development for determination of Degradation under laboratory and greenhouse
fluroxypyr in soil. J. Environ. Sci. Health B39 (5), conditions Weed Res. 30, 375-382.
765-777. Worthing, C.R. (1987). The Pesticide Manual – A
Johnson, B.D., Hall, J.C. (1996). Fluroxypyr-and World Compendium. 8th Edition. British Crop
triclopyr-specific enzyme-linked immunosorbe Protection Council. 179-180.
Abstract
Several KSbO3-type metal oxides have important applications, such as in electrocatalysis.
Based on the composition of NaBi2Sb3O11, two oxides with composition of KBi2Sb3O11 and
Pb2BiSb3O11 were chosen as target. Both solid state reaction and hydrothermal methods were
used to prepare the compounds. Powder X-ray diffraction patterns of the solid state reaction
products indicated that only NaBi2Sb3O11 adopted KSbO3 structure. The milder method,
hydrothermal reaction, using various reactants and reactions conditions was then used to
prepare KBi2Sb3O11 and Pb2BiSb3O11. In the hydrothermal method; CaCO3, Bi, PbO2,
Pb(CH3COOH)2.3H2O, Bi2O3 and Sb2O3 were used as reactant, KOH mineralizer
concentration were varied from 0.5 to 4 M and reaction time were varied from 24 to 72 hours.
Powder diffraction patterns of the hydrothermal reaction products showed that the obtained
oxides adopted flourite type structure.
Keywords: bismuth oxide, X-ray powder diffraction, hydrothermal, solid state reaction, lead
oxide.
Figure 1. KSbO3 structure showing SbO6 edge shared octahedra, red and purple spheres
represent K and O.
Table 1. Reactants and reactions conditions employed in the preparations of prepare KBi2Sb3O11 and
Pb2BiSb3O11 via hydrothermal methods.
KBi2Sb3O11 stoichiometric mixture of K2CO3, the oven. Synthesis details are given in Table 1.
Bi2O3 and Sb2O3 with molar ratio of 1 : 2 : 3 Greater detail of the synthesis has been
and for Pb2BiSb3O11 mixture of PbO-Bi2O3- publihed (9).
Sb2O3, PbO2-Bi2O3-Sb2O3 and
X-ray powder diffraction patterns were
Pb(CH3COOH)2.3H2O-Bi2O3-Sb2O3 in molar
recorded using Cu Kα radiation in the range 2θ
artio of 4 : 1 : 3 were employed. In each case
the mixture was introduced into an autoclave. = 10-90° and 0,05° step size. Cell parameters
Mineralizer, KOH, in various concentration were determined using Le Baile method
was then added. The autoclave was heated in implemented in Reitica (10).
Figure 2. Le Baile refinement profile for NaBi2Sb3O11 indicated that KSbO3 type structure was
adopted.
Figure 3. Typical powder diffarction patttern of hydrothermal product, in this case reaction of PbO2-
Bi2O3-Sb2O3, KOH 3 M for 72 hours. The red lines showed the diffraction pattern for HoTa3O7 a
defect flourite oxides, space group Fm3m.
this factor, atomic simulation will be used. The 4. Facer, G. R., Elcombe, M. M., Kennedy, B. J.,
result will be published in due course. Aust. J. Chem., 36, 507, 1983.
Jalifah L.1*, A. Latiff. M. 2, Noor Hapeedah M.A.1, Hairul, M.1, Darmiwati, R.1, Hasrina, H.1,
Norhafipah, M.1, Yana M. Syah3, Euis H. Hakim3
1
School of Chemical Sciences & Food Technology, Faculty of Science & Technology,Universiti
Kebangsaan Malaysia, 43600 Bangi, Selangor, Malaysia.
2
School of Environmental and Natural Sciences, Faculty of Science & Technology, Universiti Kebangsaan
Malaysia, 43600 Bangi, Selangor, Malaysia.
3
Natural Product Chemistry Group, Department of Chemistry, Institut Teknologi Bandung, Jalan Ganesha
10, Bandung 40132, Indonesia
(*author of correspondence : jali@pkrisc.cc.ukm.my)
Abstract
Acronychia pedunculata (Mentua Keminiyan) is one of the species of Rutaceae that has been
taxonomically classified as Acronychia laurifolia, A. arborea, and A. resinosa. This plant is
widely distributed throughout the tropical countries of Asia. Literature search has reported an
extensive chemical investigation on several parts of this plant that led to the isolation of
alkaloids, coumarins, terpenes, acetophenones derivatives and lignans. Our on-going
phytochemical work on Malaysian A. pedunculata has spotted some differences and
similarities on the chemical contents of this local species. In this paper, we will discuss the
chemosystematics of Malaysian A. pedunculata.
Keyword : Acronychia pedunculata, furoquinolines, acetophenones, chemotaxonomy
Malaysia. Each part was air-dried, ground and 3. Results and Discussion
successively extracted with Soxhlet apparatus The main components of Malaysian A.
in petroleum ether, ethyl acetate and ethanol to pedunculata were furoquinoline alkaloids and
yield the petroleum ether, ethyl acetate and dipyranoacetophenones. In addition, phenolic
ethanol extracts. Each crude extract was compounds were also obtained consisted of the
subjected to Vacuum Liquid Chromatography lignan (+)-sesamin and phenylpropanes;
(VLC) over silica gel 60H using the mixtures elimicin and iso-elimicin. The other isolates
of hexane/ethyl acetate and ethyl were furo~ and pyranocumarins namely
acetate/ethanol. VLC fractions containing bergapten, xanthoxyletin and alloxanthoxyletin
interesting compounds (based on TLC & 1H (Table 1).
NMR) were further purified by either VLC
All furoquinoline alkaloids have been
micro-column or chromatotron. Evolitrine (1),
documented previously as constituents of plant
kokusaginine (2), skimmianine (3), elimicin
classified as A. laurifolia (Cui et al., 1999) and
(4), octandrenolone (6) and (+)-sesamin (8)
A. pedunculata (De Silva et al., 1979; Kumar et
were isolated from the leaves part whereas O-
al., 1989). Furthermore, furoquinolines were
methyloctandrenolone (7), isoelimicin (5) and
found to be the most abundant in Malaysian A.
kokusaginine (2) were found in the bark. The
pedunculata as they occurred in the leaves,
root parts found to contain bergapten (9),
roots and barks. In contrast, coumarins were
xanthoxyletin (10) and alloxanthoxyletin (11).
localised in the roots while previous reports
The structures of isolated compounds were
identified bergapten and two pyranocoumarins;
assigned based on comparison of their
seselin and norbraylin from the leaves parts of
spectroscopic data with those of literature.
A. laurifolia (Rahmani et al., 1996).
OMe
R1
MeO MeO
R2 N O
MeO MeO
R3
OMe OMe
R1 = R3 = H; R2 = OMe (1)
R1 = R2 = OMe; R3 = H (2) (4) (5)
R1 = H; R2 = R3 = OMe (3)
O O
O R O
O
OMe
O
O
O
O O O
O
(8) (9)
R = OH (6))
R = OMe (7)) OMe
O
O O O
MeO O O
(10)
(11)
Terpenoids
Mono~ X X
Sesqui~ X
Tri~ X X X
Acetophenones
Prenylated~ X X X X X
Pyrano~ X
Dipyrano~ # #
Furoquinolines
Kokusaginine X X, # #
Evolitrine X # X
Skimmianine X # X #
Maculosidine X
γ-fagarine X
Dictamnine X
OCH2O~ X
Coumarins
Furo~ X, #
Pyrano~ X #
Lignans X #
Phenylpropanes # #
The tetrahydrofuran lignan, (+)-sesamin was Chattajee 1973). Apart from the report on the
isolated from the bark of Malaysian A. presence of pyranoacetophenone in the root of
pedunculata. This finding was consistent with A. pedunculata (Kumar et al. 1989), we
the previous presence of sesamolin and observed the leaves and barks of Malaysian A.
yangambin in the roots of A laurifolia (Cui et pedunculata contained dipyranoacetophenones.
al., 1999). Thus, the presence of simple
The presence of dipyranoacetophenones was
phenylpropanes such as elimicin and iso-
previously reported from A. octandra T.
elimicin is highly expected.
Hartley (previously known as Melicope
The types of metabolites so far reported from octandra F. Muell.), and this taxon acted as a
Malaysian A. pedunculata are unequivocal with probable relic of the early stage in the evolution
regards to the association of previous work on of this genus (Quader et al., 1991).
A. pedunculata and A. laurifolia. However, Octandrenolone (6) and its derivatives were
there was a clear dichotomy among also reported from Melicope erromangensis
acetophenones; this work reported the isolation (Muyard et al. 1996). It is suggested that
of dipyranoacetophenones while prenylated dipyranoacetophenones could be formed
acetophenones were encountered in the through cyclisation of the two prenylated
previous studies either from A. pedunculata chains located in acetophenones such as
(De Silva et al 1991; Kumar et al. 1989; Sy & acrovestone.
Brown 1999) or A. laurifolia (Banerjee and
From the chemotaxonomic point of view, this Cui, B., Chai, H., Dong, Y., Horgen, F. D., Hansen,
chemical evidence supported Hartley’s B., Madulid, D. A., Soejarto, D. D., Farnsworth, N.
contention that Melicope and Acronychia were R., Cordell, G. A., Pezzutto, J. M. and Kinghorn, D
closely allied, despite their separation by A. (1999). Quinoline Alkaloids from Acronychia
laurifolia. Phytochem. 52, 95-98.
Engler in different sub-families according to
indehiscent (Acronychia) or dehiscent De Silva, L. B., De Silva, U. L. L., Mahendaran, M.
(Melicope) nature of the fruits (Hartley, 1981). & Jennings, R. (1979). Kokusaginine & Evolitrine
On the other hand, acridones that were from Acronychia pedunculata. Phytochem. 18,
common in both taxa were not detected in this 1255-1256.
study. De Silva, L. B., Herath, W. M., Liyanage, C.,
Kumar, V., Ahmad, V. U. & Sultana, A. (1991).
4. Conclusion Demethylacrovestone from Achronychia
Furoquinoline alkaloids and acetophenones pedunculata fruits. Phytochem. 30(5), 1709-1710.
found to be the major secondary metabolites in
Malaysian A. pedunculata. The presence of Hartley, T. G. (1981). A Revision of the Genus
Tetradium (Rutaceae). Garden. Bull. Singapore. 34,
coumarins, tetrahydrofuran lignans and simple
91-131.
phenylpropanes were also detected. It is
perhaps noteworthy that A. pedunculata, like Kumar, V., Karunaratne, V. & Meegalle, M. R. S.
other Acronychia and its closely allied K. (1989). 1-[2’, 4’-Dihydroxy-3’, 5’-di-(3”-
Melicope, was known to produce both methylbut-2”-enyl)-6’-methoxy]phenyletanone from
furoquinolines and simple acetophenones. Acronychia pedunculata Root Bark. Phytochem.
28(4), 1278-1279.
However, further investigation has to be done
on A. laurifolia particularly in looking at the Muyard, F., Bissoue, A. N., Bevalot, F., Tillequin,
presence of dipyranoacetophenone, to point F., Cabalion, P. & Vaquette, J. (1996).
some affinity between these two taxa. Acetophenones and Other Constituents from the
Roots of Melicope erromangensis. Phytochem.
5. Acknowledgement 42(4), 1175-1179.
The authors wish to thank En. Shamsul (UPM)
Quader, A., Armstrong, J. A., Gray, A. I., Hartley,
& En. Isa (UKM) for the plant collection & T. G. & Waterman, P. G. (1991). Chemosystematics
identification. PUSPA, UKM are highly of Acradenia and General Significance of
acknowledged for financial support (NH) Acetophenones in the Rutaceae. Biochem. Syst.
during her attachment in ITB. Ecol. 19(2), 171-176.
6. References Rahmani, M., Taufiq-Yap, Y. H. & Sukari, M. A.
Arthur, H. R., Chan, R. P. K., Loo, S. N., Tam, S. (1996). Constituents of Acronychia laurifolia.
W. & Tung, S. (1966). New Alkaloids from Hong Fitoterapia. 67(2), 180-182.
Kong Plants. Phytochem. 5, 379-383.
Ridley, H. N. (1967). The Flora of the Malay
Baneerji, J. R. N. & Chattajee, A. (1973). Peninsular. Vol. 11. Reeve & Co., London.
Acetophenones from Acronychia laurifolia. Indian
Sy, L. K. & Brown, G. D. (1999). 1-[2’, 4’-
J. Chem. 11 : 693.
Dihydroxy-3’-(3”-methylbut-2”-enyl)-5’-(1”’-
Burkill, I. H. (1966). A Dictionary of Economic ethoxy-3”’-methylbutyl)-6’-methoxy]phenyletanone
Products of the Malayan Peninsula. Vol. 2. The from Acronychia pedunculata Phytochem. 52 : 681-
Ministry of Agriculture & Co-operatives, Kuala 683.
Lumpur, 1415-1416.
Abstrak
Satu jenis terbitan kitosan, iaitu resin melamin-kitosan-formaldehid (MKF) telah berjaya
disintesis. Kemampuan MKF melakukan penjerapan atau prapemekatan bagi kuantiti surihan
ion-ion logam Au(III), Pt(II) and Pd(II) telah diuji menggunakan kaedah statik. Mod
pengadukan dan amaun MKF dibiarkan malar iaitu masing-masing 150 rpm and 0.1 g.
Penentuan kuantitatif bagi ion-ion logam tersebut dilakukan dengan kaedah Spektrometri
Pancaran Optik-Plasma Gandingan Aruhan (ICP-OES). Telah didapati bahawa kapasiti
penjerapan bagi resin MKF adalah maksimum pada pH 1 dan masa penjerapan optimum
adalah kurang daripada 15 minit bagi ketiga-tiga ion logam tersebut. Nyahjerapan bagi ion-
ion logam tersebut daripada MKF telah dijalankan menggunakan beberapa agen pengelusi.
Keputusan mendapati bahawa agen pengelusi terbaik ialah EDTA 0.1 M yang mana 100%
nyahjerapan Au(III) diperolehi, diikuti oleh 89% bagi Pt(II) dan 86% bagi Pd(II).
Kata kunci: Prapemekatan; nyahjerapan; terbitan kitosan; ion logam Au(III), Pt(II) dan
Pd(II).
dibekalkan oleh Chito-Chem (M) Sdn. Bhd. dan dianalisis secara kuantitatif menggunakan
Garam piawai bagi platinum, aurum dan instrumen ICP-OES. Prapemekatan oleh MKF
paladium diperolehi daripada Sigma. Air suling pada pH 1, 3, 5, 7, 9 dan 11 dilakukan untuk
nyahion disediakan melalui sistem penulenan mendapatkan pH yang optimum bagi
Barnstead E-Pure. penjerapan ketiga-tiga ion logam tersebut.
Nyahjerapan terhadap ion-ion logam yang
Instrumen
terjerap pada MKF dilakukan menggunakan 10
Penentuan logam dilakukan dengan
ml larutan KSCN 1M, NaSCN 1M, NH4SCN
menggunakan Spektrometer Pancaran Optik-
1M, Na2HPO4 0.1M, EDTA 0.1M dan Na2SO3
Plasma Gandingan Aruhan (ICP-OES) Optima
0.1M untuk menentukan agen pengelusi
4300V Perkin Elmer pada panjang gelombang
terbaik.
optimum iaitu Pt 265.945 nm, Au 267.595 nm
dan Pd 340.458 nm. Selain itu meter pH 3. Hasil dan Pembahasan
(Mettler Delta 320), penimbang (Electronic Spektrum FTIR bagi MKF
Balance ER-120A) dan Spektrometer Spektrum inframerah bagi kitosan tulen (Rajah
Inframerah Transformasi Fourier (FTIR) jenis 1) dibandingkan dengan spektrum MKF (Rajah
Perkin Elmer, Model Gx juga digunakan. 2) yang telah diperolehi daripada instrumen
FTIR. Jenis getaran pada nombor gelombang
Penyediaan Melamin-kitosan-formaldehid
bagi masing-masing puncak yang signifikan
(MKF)
pada spektrum tersebut disenarai dalam Jadual
Isipadu 50 ml larutan asid asetik 2% b/i
1. Regangan N-H dan O-H menunjukkan
dimasukkan ke dalam kelalang refluk 500 ml.
struktur kitosan pada sampel MKF masih
Sebanyak 5g serbuk kitosan ditambah ke dalam
wujud. Kemunculan regangan C=N, C-N dan
kelalang sambil dikacau sehingga kitosan
C-H menunjukkan terbentuknya ikatan antara
melarut. Isipadu 50 ml larutan formaldehid
melamin, formaldehid dan kitosan dalam MKF.
35% b/i ditambah, diikuti dengan 31.5 g
melamin sambil dikacau dengan pengacau Keadaan Optimum Prapemekatan
mangnet. Campuran direfluk selama 15-20 Masa Penjerapan
minit sambil dikacau. Selepas tempoh ini, Masa penjerapan yang optimum bagi MKF
larutan jernih bertukar kepada gel lutsinar. terhadap ion-ion logam Pt(II), Au(III) dan
Sebaik sahaja gel terhasil, larutan natrium Pd(II) didapati tercapai dalam masa kurang
hidroksida 10% ditambahkan perlahan-lahan. daripada 15 minit seperti ditunjukkan dalam
Gel bertukar kepada pepejal putih pada pH 10 Rajah 3. Kitosan dan terbitanya dapat dikatakan
dan tidak larut dalam air. Resin melamin- sebagai suatu bahan mikroporous (Muzzarelli
kitosan-formaldehid yang terhasil dibilas 1977). Penjerapan ion logam daripada larutan
dengan 1 M HCl, air nyahion panas dan oleh kitosan dan terbitan kitosan melibatkan 3
dikeringkan. Bagi kegunaan khusus, resin langkah berturutan iaitu pengangkutan ion
dibilas secara berlebihan dengan 1 M HCI, 1M logam kepada permukaan luaran penjerap,
HNO3, 0.1 M natrium hidroksida dan air penyebaran ion logam ke dalam liang penjerap
nyahion yang mencukupi. Kemudian dan penjerapan ion logam pada permukaan
dikeringkan, ditimbang, dikisar dan diayak ke dalaman penjerap yang merupakan langkah
saiz 75-45 µm. Resin MKF dilakukan pencirian penentu kadar penjerapan (Kurita et al. 1979).
menggunakan FTIR. Secara relatif, kapasiti penjerapan oleh MKF
terhadap ion-ion Pt(II) adalah lebih tinggi
Kaedah Prapemekatan Ion Logam
berbanding dengan Au(III) dan diikuti oleh
Sebanyak 0.1 g serbuk MKF bersaiz 75-45 µm Pd(II).
dimasukkan ke dalam bikar 100 ml setiap
satunya. Larutan 50 ml ion logam Pt(II), pH Optimum
Au(III) dan Pd(II) berkepekatan 2.0 hingga Keputusan ujikajian penjerapan dalam julat pH
100.0 mg/L masing-masing dimasukkan ke 1 ke 11 ditunjukkan dalam Rajah 4. Didapati
dalam setiap bikar sambil diaduk dengan bahawa pH optimum bagi penjerapan ketiga-
kelajuan 150 rpm. Masa penambahan larutan tiga ion logam Pt(II), Au(III) dan Pd(II) oleh
logam dicatatkan. Sebanyak 1 ml larutan MKF adalah pada pH 1. Ini bersesuaian dengan
tersebut dipipetkan ke dalam tabung uji pada apa yang telah dilaporkan iaitu terbitan kitosan
sela masa tertentu ke dalam tabung uji berlabel lebih tahan berbanding kitosan tulen pada
keadaan asid disebabkan taut silang yang boleh
LAMPIRAN
8000
7000
Kapasiti penjerapan (ug/g)
6000
5000
4000
Pt(II)
3000
Au(III)
Pd(II)
2000
1000
0
0 5 10 15 20 25 30 35 40 45 50 55 60
8000
7000
Kapasiti penjerapan (ug/g)
6000
5000
4000
3000
Pt(II)
2000 Au(III)
Pd(II)
1000
0
1 3 5 7 9 11
pH
120
100
% nyahjerapan
80
60 Au(III)
Pt(II)
Pd(II)
40
20
0
Na2SO3 NaSCN NH4SCN EDTA Na2HPO4 KSCN
Jenis pengelusi
Rajah 5: Histrogram menunjukkan % nyahjerapan melawan jenis
pengelusi
Abstrak
Ilmunasi TiO2 dengan sinar ultra violet (λ < 410 nm) menghasilkan pasangan elektron (pada
pita konduksi) dan positive hole, h+, (pada pita valensi). Telah diamati bahwa, iluminasi film
TiO2 dengan sinar ultra violet yang disertai dengan pemberian tegangan listrik positif
(anodik) meningkatkan photocurrent secara signifikan. Difahami bahwa atas pengaruh
medan listrik tersebut timbul lapisan deplesi pada pita valensi dan pita konduksi, dimana
ujung kedua lapisan pita energi tersebut dipermukaan film TiO2 lebih besar dibandingkan
dengan didalam bulk. Keadaan tersebut mengakibatkan hole (h+) yang terbentuk pada pita
valensi mempunyai kecenderungan besar bergerak ke permukaan film, sementara elektron
pada pita konduksi justru mempunyai kecenderungan tergelincir ke bagian bulk dan melalui
back contact diteruskan ke counter electrode (katodik). Meningkatnya photocurrent
merupakan representasi meningkatnya kerapatan arus elektron yang melewati sirkuit luar
dan dilepaskan ke larutan melalui katoda, yang hakikatnya sebanding dengan ketersediaan h+
pada permukaan film TiO2 (anodik). Hole positif (h+) tersebut akan menginisiasi reaksi
oksidasi dan didalam lingkungan aqueous akan menghasilkan radikal hidroksil (•OH).
Radikal hidroksil mempunyai potensial oksidasi ~ 2,8 V vs NHE yang hakikatnya dapat
mengoksidasi hampir kebanyakan senyawa organik beracun menjadi senyawa yang lebih
sederhana. Sebagai tambahan radikal hidroksil dipercaya dapat melakukan penetrasi
kedalam sel mikroba dan merusak sistem hidupnya. Dapat dikatakan bahwa pemberian
medan listrik pada film TiO2 (anodik) memberikan efek peningkatan kemampuan film TiO2
dalam menghasilkan radikal hidroksil. Namun realisasi keadaan tersebut menjadi sistem
reaktor fotoelektrokatalisis memerlukan persyaratan desain khusus, mengingat ekpose sinar
dan medan listrik pada permukaan film TiO2 harus dilakukan pada saat bersamaan dan
kontinyu. Akan didiskusikan desain umum reaktor fotoelektrokatalisis dan usulan desain novel
reaktor fotoelektrokatalisis. Desain baru yang diusulkan memanfaatkan keuntungan desain
reaktor menggunakan kolom gelas yang bagian dalamnya dilapisi film TiO2 (Inner Wall Glass
Column Tube Coated with TiO2 Film, IWGCT-TiO2) dan penyinaran dari arah luar kolom
yang baru-baru ini kami kembangkan.
Jarnuzi Gunlazuardi1), Rahmat Wibowo 1), Zaenal Awaludin1) ; Ros Kusuma Dewi1) , dan
Cuk Imawan 2)
Abstrak
Telah dikembangkan elektroda karbon pasta yang dimodifikasi (EKPM) dengan kaliks
(6)aren dan dipelajari perilaku siklik voltametrinya. EKPM disiapkan dengan mencampurkan
larutan kaliks(6)aren kedalam bubuk grafit, dimana setelah pelarut organiknya diuapkan
molekul kaliks(6)aren akan melapisi permukaan grafit. Grafit yang telah terlapisi kemudian
ditambah campuran resin, pengeras, dan/atau aditif lainnya dengan perbandingan yang
sesuai sampai terbentuk pasta dan dikemas kedalam tabung gelas (l= 60 mm; id= 2,2 mm).
Kontak ohmic EKPM dilakukan dengan kawat tembaga. Perlakuan panas dan ageing
terhadap EKPM memungkinkan terjadinya interaksi kimiawi antara grafit dengan modifier
yang memfasilitasi komunikasi elektrokimia antara EKPM dengan ion logam didalam
permukaan elektroda. Keberhasilan sensing elektrokimia ditunjukkan oleh kemunculan arus
anodik yang khas pada pola siklik voltamogram EKPM didalam larutan yang mengandung
ion merkuri (II) dan elektrolit pendukung, dimana pola yang sama tidak muncul pada
elektroda karbon pasta yang tidak dimodifikasi. Lebih jauh besarnya arus anodik tersebut
meningkat sejalan bertambahnya konsentrasi ion merkuri (II), dengan tingkat kelinieran
yang baik pada daerah antara 10-6 M ~ 10-5 M (R=0,9894), dan presisi yang cukup baik
(RSD=2,51 %). Pengukuran dilakukan dengan kondisi scan potensial dari – 0,6 volt s/d + 0,6
volt (vs Ag/AgCl), waktu akumulasi 3 menit, scan rate 100 mV/s , pH 5 dan elektrolit 0,1M KI.
Kata kunci: elektroda karbon pasta, kaliks(6)aren, ion merkuri, voltamogram siklik, arus
anodik.
grafit dapat kita lekatkan sebagai lapisan tipis fabrikasi elektroda karbon pasta yang
suatu bahan kimia fungsional yang dimodifikasi dengan kaliks(6)aren, investigasi
memodifikasi permukaan grafit dan memberi perilaku siklik voltametri dan aplikasinya untuk
dampak kepada perilaku kimia baru yang sensing terhadap ion merkuri. Sedangkan
berbeda dari permukaan grafit yang tidak diskusi dan analisis lebih mendalam akan
dimodifikasi. Elektroda karbon (grafit) yang dipublikasikan ditempat lain (Gunlazuardi et al,
telah dimodifikasi memberikan perilaku 2005)
elektrokimia yang yang khas, bergantung
1.b. Pendekatan Konseptual
kepada kekhasan interaksi antara bahan kimia
Grafit adalah salah satu bentuk alotrof karbon,
modifier permukaan grafit dan analit disekitar
dimana atom karbon membentuk susunan
permukaan elektroda. Elektroda seperti itu
heksagonal dengan lembaran segi enam.
dikenal sebagai elektroda karbon pasta yang
Masing-masing atom karbon memiliki tiga
dimodifikasi secara kimiawi (Chemically
tetangga atom karbon terdekat dan membentuk
Modified Carbon Paste Electrode, CMCPE).
segitiga sama sisi (Hurlbut.& Cornelius, 1971).
Berbagai senyawa kimia telah digunakan Tiga dari empat elektron valensi pada setiap
sebagai modifier pada CMCPE. Beberapa atom karbon membentuk tiga ikatan kovalen
contoh yang dapat disebutkan diantaranya dengan tiga atom karbon lainnya. Sementara
adalah: elektroda karbon pasta yang elektron valensi ke empat tetap bebas, yang
dimodifikasi dengan dimetilglioksim telah pada saatnya dapat bebas bergerak, menjadikan
digunakan untuk penentuan Ni2+ (Baldwind et grafit mampu menghantar arus listrik (gambar
al, 1986); 2-metil-8-hidroksiquinolin (Khoo et 1). Elektron valensi keempat pada ujung
al, 1999) dan 3,4-dihidro-4,4,6-trimetil-2- tertentu juga dapat sebagi site aktif untuk
2pirimidintion (Abbaspour & Moosavi, 2002) terjadinya ikatan kimia dengan senyawa kimia
digunakan untuk penentuan Cu2+, dan masih modifier. Apabila modifier dapat
banyak contoh lagi. Diantara banyak senyawa mengakomodasikan pengembangan
yang dapat digunakan sebagai modifier, kami delokalisasi elektron melalui ikatan rangkap
tertarik untuk mengekplorasi kelompok terkonjugasi, maka gangguan elektron pada
senyawa yang dikenal sebagai kaliksaren. salah satu ujung bagian modifier akan
Kaliksaren merupakan suatu senyawa diteruskan kebagian ujung lain dari modifier
makromolekul yang termasuk dalam kelas yang berikatan dengan grafit. Dinamika
siklooligomer. elektron pada grafit kemudian diteruskan ke
sirkuit eksternal dan counter elektroda,
Struktur kaliksaren terdiri dari tiga bagian,
sehingga pasangan elektroda kerja (grafit yang
yaitu upper rim, central anulus, dan lower rim.
telah dimodifikasi) dan counter elektroda
Bagian upper rim terdiri dari cabang alkana
(misalnya, platina) akan memberikan respon
yang akan dilekatkan kepada grafit, sedangkan
yang spesifik terhadap reaksi redok analit pada
bagian lower rim berupa gugus polar yang akan
permukaan elektroda kerja.
menghadap ke larutan aqueous dimana analit
berada. Telah banyak dilaporkan bahwa 2. Bahan dan Metoda
kelompok senyawa kaliksaren dapat berfungsi Bahan.
sebagai ligan pengektrak ion-ion logam Bahan Kimia. Bubuk grafit (Merck), merkuri
didalam air, dimana interaksi ion logam dengan (II) nitrat monohidrat (p.a), alumunium (III)
kaliksaren terjadi karena kesesuaian rongga klorida heksahidrat (p.a), kalsium (II) nitrat
lower rim dan/atau melalui ikatan kovalen dihidrat (p.a), tembaga (II) nitrat tretrahidrat
kordinasi. Manakala ion logam yang sesuai (p.a), seng (II) klorida dihidrat (p.a),
sudah terikat atau berada didalam daerah lower magnesium (II) nitrat dihidrat (p.a), kloroform,
rim, yang nota bene terikat pada elektroda metanol, buffer asetat 0,1M, epoksi resin
grafit, dan kepada elektroda grafit diberi bias (Dextone), kaliks(6)aren (Sigma),
potensial yang sesuai (voltametri silkik) maka Aquademineralisata.
akan terjadi proses redoks terhadap ion logam
Bahan pengemas elektroda. Kawat tembaga
terkait. Sebaga hasilnya akan diperoleh
(diameter = 1,5 mm), glass tube, kertas silicon
voltamogram siklik yang khas sesuai dengan
karbida No.1500 untuk polishing.
ion logam terkait. Paper ini melaporkan
Gambar 1. Gambaran struktur grafit [A] [B] dan struktur kaliks(6)aren, serta gambaran bagaimana kaliks(6)
aren mengatur diri sehingga membentuk ruang tiga dimensi unik [C] yang dapat berfungsi sebagai pasangan
”host-guest” terhadap ion logam yang mendekat pada lower rim di fasa air.
Gambar 2. Gambaran konseptual konstruksi elektroda karbon pasta yang dimodifikasi dengan
kaliks(6)aren didalam casing tabung gelas dan kawat tembaga sebagai kontak ohmik [A] dan gambaran
voltamogram siklik yang dihasilkan pada saat elektroda disusun pada sel voltametri
Metoda. Sebelum digunakan bagian permukaan
Fabrikasi elektroda. Sejumlah tertentu elektroda digosok dengan kertas silikon karbida
kaliks(6)aren (e.g. 0,01 g) dilarutkan kedalam No. 1500 hingga halus, dan diukur diukur
10 ml pelarut kloroform:metanol (2:1). hambatannya dengan Digital Multimeter.
Kemudian kedalam larutan tersebut
Pengukuran elektrokimia. Sebanyak 5 ml
dimasukkan sejumlah tertentu (0,2 g) bubuk
larutan 1x10-3M Hg2+ dimasukkan kedalam
grafit dan diaduk hingga homogen dan
labu 50 ml. Kedalamnya dimasukkan sejumlah
dipanaskan pada suhu 60oC selama 12 jam
tertentu larutan KI (0,830 g) dalam buffer
hingga pelarutnya menguap. Sejumlah bubuk
asetat 0,1M dan kemudian volumenya
grafit yang sudah dimodifikasi (0,1 ~ 0,30
dijadikan tepat 50 ml dengan bantuan buffer
gram) dan bahan perekat (resin & pengeras,
asetat, sehingga menghasilkan larutan 1x10-4M
1:1) dimasukan dalam cawan porselin dan
Hg2+; 0,1M KI dan pH nya sama dengan 5,00
diaduk hingga homogen. Adonan kemudian
(+ 0,1). Larutan ini dituangkan ke dalam sel
dimasukkan kedalam glass tube yang telah
elektrokimia yang disusun seperti pada Gambar
dipotong (l = 6 cm; id=0,22 cm) ditekan pada
3.2 lalu dihubungkan dengan potensiostat, yaitu
bagian lubang hingga campuran bubuk grafit
VersaStat II (Princeton Applied Research,
masuk kedalam glass tube setinggi 2 cm.
USA). Potensial awal dipilih mulai dari .0.9V
Kawat tembaga sepanjang 6,5 cm dimasukan
dan potensial akhir 0,4V, scanrate 100 mV/s,
ke dalam glass tube pada bagian lubang atas
waktu akumulasi 3 menit dan aliran gas
lalu ditekan sekuat-kuatnya hingga jarak
nitrogen. Tinggi puncak arus dihitung dari
permukaan bagian bawah elektroda dengan
perpanjangan base line ingá puncak arus
ujung tembaga berjarak 2 mm. Elektroda ini
maksimum dari cyclic voltammogram. Jumlah
dipanaskan dalam oven pada suhu 60oC selama
kaliks(6)aren dalam elektroda optimum dipilih
48 jam, lalu disimpan didalam desikator.
berdasarkan tinggi puncak arus pada cyclic pasta dipelajari dengan memvariasikan
voltammogram. perbandingan resin dan pengeras dengan
jumlah karbon yang sama, yaitu 0,2 gr. Diamati
3. Hasil dan Pembahasan
bahwa makin sedikit jumlah pengeras maka
Pembuatan elektroda karbon pasta
hambatannya makin besar. Pada perbandingan
Pengaruh Komposisi Karbon. Studi pengaruh
R:P = 3/2, 6/1,dan 9/1 elektroda memiliki
komposisi karbon dalam pembuatan elektroda
hambatan yang lebih besar. Namun jika
karbon pasta dilakukan dengan memvariasikan
komosisi pengerasnya ditambah sifat elektroda
jumlah karbon dan jumlah epoksi yang sama,
karbon pasta ternyata mudah mengalami
yaitu 0,5 gr dan perbandingan resin dengan
pengikisan, bahkan dengan kertas biasa.
pengeras sama (1:1). Elektroda karbon pasta
Berdasarkan hasil ini maka dipilih
yang digunakan adalah yang memiliki
perbandingan R:H=6:1, yang merupakan
hambatan listrik kecil dan tidak mudah rapuh.
komposisi dengan sifat elektroda karbon pasta
Hasil pengukuran hambatan listrik dari
yang baik.
berbagai elektroda yang disiapkan ditunjukkan
pada Gambar 3. Pengamatan menunjukkan Pengaruh jumlah kaliks(6)aren dalam
bahwa elektroda dengan kompisisi grafit antara elektroda karbon pasta. Pengaruh komposisi
10 % sampai 17 % memberikan hambatan kecil kaliks(6)aren dalam elektroda karbon pasta
yang kondusif untuk digunakan sebagai sensor dipelajari dengan mengevaluasi tinggi puncak
dan mempunyai sifat fisik yang sebagagi pasta arus yang dihasilkan pada cyclic
yang baik, tidak rapuh setelah kering dan tidak voltammogram sebagai respon terhadap adanya
terkikis selama pemakaian. Komposis grafit 1x10-4 M Hg2+ . Dari hasil cyclic
diatas nilai tersebut memberikan hantaran yang voltammogram ini ditentukan sensitivitas
baik, namur elektrodanya menjadi sangat elektroda terhadap Hg2+ dengan mengukur
rapuh. tinggi puncak arusnya. Pengamatan
menunjukkan bahwa pada jumlah kaliks(6)aren
Pengaruh komposisi/perbandingan Resin dan
0,20% hingga 1,09% puncak arus yang
Pengeras. Pengaruh komposisi resin (R) dan
dihasilkan bertambah besar, ini karena jumlah
pengeras (P) terhadap sifat elektroda karbon
Gambar 3. Pengaruh komposisi grafit dalam adonan pasta pada hambatan elektroda.
Gambar 4. Pengaruh komposisi/perbandingan Resin dan Pengeras grafit dalam adonan pasta pada
hambatan elektroda.
Gambar 5. Pengaruh komposisi kalis(6)aren dalam adonan pasta pada tinggi puncak voltamogram.
Dalam larutan 0,1M KI komponen utama yang waktu akumulasi yang lebih lama dari 3 menit
terbentuk dengan Hg2+ adalah HgI3 -,yang tidak lagi menunjukkan kenaikan arus yang
tersolvasi oleh satu molekul H2O dengan signifikan. Lamanya waktu akumulasi akan
bentuk tetrahedral(Kong et al, 2002)). Dengan memberi kesempatan yang cukup untuk
adanya gugus .OH pada kaliks(6)aren, spesi berlangsungnya reaksi kompleksasi pada
HgI3- kemungkinan akan berikatan dengan permukaan elektroda. Dengan maksimalnya ion
salah satu gugus .OH pada kaliks(6)aren merkuri yang berada didalam elektroda maka
sehingga membentuk komplkes ligan ganda arus redoksnya juga makin besar, sehingga
dengan bentuk tetrahedral. Jadi dengan satu menghasilkan puncak arus yang semakin
molekul kaliks(6)aren kemungkinan dapat tinggi. Namun pada waktu akumulasi yang
mengikat enam ion Hg2+ yang menyebabkan lebih besar dari 3 menit diamati kenaikan
jumlah kaliks(6)aren dibutuhkan dalam puncak arus menjadi tidak signifikan, hal ini
elektroda karbon pasta hanya sedikit (1,09%) dimungkinkan karena pada waktu tersebut
dari pada umumnya, yaitu 10-30%(Anonim, jumlah Hg2+ yang tereduksi sudah maksimum
2003) pada permukaan elektroda.
Pengaruh potensial awal. Pemilihan potensial Pengaruh scan rate.Pengaruh scan rate
awal pada voltametri siklik sangat penting terhadap tinggi puncak arus ditunjukkan pada
untuk menghasilkan reaksi reduksi yang Gambar 9. Dapat dilihat bahwa scan rate yang
sempurna pada Hg2+menjadi Hg0. Pengaruh makin besar menghasilkan kenaikan puncak
potensial awal terhadap tinggi puncak arus arus yang makin besar pula. Hal ini sesuai
dapat kita lihat pada Gambar 7, dimana terlihat dengan persamaan Randles-Sevcik dimana arus
bahwa pada potensial awal -0,4 V hingga pada (Ip) sebanding deingan akar pangkat dua dari
potensial awal -0.8 V terjadi kenaikan tinggi scan rate, seperti dibawah ini:
puncak arus. Pada potensial awal -0,4 V tinggi
puncak arus sebesar 110,9 µA dan -0,8 V
sebesar 131,1 µA, ini disebabkan karena pada Ip: arus puncak (anodik), n: elektron yang
potensial -0,4 V Hg 2+ tidak tereduksi sempurna terlibat, A: luas`permukaan efektif elektroda,
bila dibandingkan pada saat -0,8 V(Huang et al, C: konsentrasi analit, D: koefisien difusi, dan
2002). Sedangkan potensial awal yang lebih V: scan rate.
negatif dari -0,8 V, puncak arus menjadi
berkurang akibat adanya intervensi reduksi H+ Grafik tinggi puncak arus terhadap V1/2
menjadi H2 (Khoo, et al, 1999). Berdasarkan memiliki kelinieran yang baik, r = 0,988,
hasil ini dapat disimpulkan bahwa arus menandakan berlangsungnya komunikasi
maksimum terjadi pada potensial awal -0,8 V. antara elektroda dengan ion Hg2+ seperti yang
dihipotesakan pada bagian pendekatan
Pengaruh waktu akumulasi Pengaruh waktu konseptual. Kenaikan tinggi puncak arus
akumulasi terhadap tinggi puncak arus dapat dengan bertambahnya scan rate sangat
dilihat pada Gambar 8. Diamati bahwa. waktu berhubungan dengan laju elektrolisis pada
akumulasi yang bertambah menghasilkan permukaan elektroda. Elektrolisis yang terjadi
kanaikan tinggi puncak arus. Waktu akumulasi pada permukaan elektroda dalam merespon
1 menit hingga 3 menit memperlihatkan perubahan potensial mengakibatkan sistem
kenaikan puncak arus yang besar, sedangkan akan berusaha menjaga keseimbangan
Gambar 7. Pengaruh potential awal dimulainya siklik voltametri pada elektroda karbon paste
yang dimodifikasi kaliks(6)aren terhadap tinggi arus puncak, diukur pada larutan yang
mengandung ion Hg++ 1x 10-4 M, 0,1M KI, bufer asetat pada pH 5.
Gambar 8. Pengaruh waktu akumulasi sebelum dimulainya siklik voltametri pada elektroda
karbon paste yang dimodifikasi kaliks(6)aren terhadap tinggi arus puncak, diukur pada larutan
yang mengandung ion Hg++ 1x 10-4 M, 0,1M KI, bufer asetat pada pH 5
Gambar 9. Pengaruh scan rate terhadap tinggi puncak arus pada elektroda karbon paste yang dimodifikasi
kaliks(6)aren terhadap tinggi arus puncak, diukur pada larutan yang mengandung ion Hg++ 1x 10-4 M, 0,1M
KI, bufer asetat pada pH 5
konsentrasi spesi yang teroksidasi dan arus makin besar. Scan rate juga berpengaruh
tereduksi. Hubungan V 1/2 terhadap tinggi pada lapisan difusi. Jika scan rate makin
puncak arus mempunyai nilai yang sesuai bertambah maka lapisan difusi makin
dengan persamaan Nerst, maka semakin cepat berkurang dan ini menyebabkan bartambahnya
laju potensial laju elektrolisis makin cepat dan arus.
Gambar 10. Pengaruh pH terhadap tinggi puncak arus pada elektroda karbon paste yang
dimodifikasi kaliks(6)aren terhadap tinggi arus puncak, diukur pada larutan yang
mengandung ion Hg++ 1x 10-4 M, 0,1M KI
Pengaruh pH. Pengaruh pH terhadap tinggi Dari Gambar 12 dapat kita lihat bahwa pada
puncak arus dilakukan pada kodisi pengukuran daerah konsentrasi 2x10-6 hingga 1x10-5M
yang optimum, yaitu dengan potensial awal - mempunyai kelinieran, r = 0,9894. dari data
0,8 V, waktu akumulasi 3 menit dan scan rate tersebut dapat dibuat persamaan linier untuk
100 mV/s. Gambar 10. menunjukkan pengaruh arus, Ip[µA] = 2x106C[M] . 2,4647. Dari data
pH terhadap puncak arus dimana puncak arus tiga standari deviasi untuk lima kali
maksimum terjadi pada pH 5. Pada pH yang pengukuran 1x10-5, 5x10-6, dan 2x10-6, batas
lebih rendah dari pH 5 terjadi penurunan tinggi deteksi untuk elektroda karbon pasta yang
puncak arus, ini disebabkan karena terjadi dimodifikasi kaliks(6)aren, yaitu LOD =
protonasi pada ligan(Kong et al, 2002) 1,29x10-6 M. Presisi pengukuran ditentukan
sehingga mengurangi kemampuan dengan nilai standar deviasi relatif (RSD).
kaliks(6)aren untuk mengikat Hg2+. Pada pH Hasil pengukuran 1x10-5M Hg2+ dengan
yang lebih besar dari pH 5 juga terjadi elektroda karbon pasta yang dimodifikasi
penurunan tinggi puncak arus, ini disebabkan kaliks(6)aren sebanyak tujuh kali memiliki
karena kemungkinan dapat membentuk RSD = 2,51%.
Hg(OH)2 yang tidak dapat berikatan dengan
4. Kesimpulan:
kaliks(6)aren.
Dari penelitian yang dilakukan dapat
Kalibrasi, batas deteksi dan presisi. Kurva disimpulkan beberapa hal berikut:
kalibrasi pada rentang konsentrasi 1x10-5M
Telah berhasil dibuat elektroda karbon
hingga 8x10-5M Hg2+ dapat kita lihat pada
pasta yang dimodifikasi dengan
Gambar 11. Pengukuran dilakukan pada
kaliks(6)aren (EKPM-Kaliks-6), dimana
kondisi pengukuran optimal dengan potensial
elektroda ini memberikan respon yang
awal -0,8 V, waktu akumulasi 3 menit dan scan
spesifik terhadap ion merkuri didalam
rate 100mV/s , pH 5 dan dalam elektrolit 0,1M
air.
KI. Diamati bahwa pada daerah konsentrasi
1x10-5 M hingga 8x10-5M mempunyai Komposisi optimum elektrode karbon
kelinieran, r = 0,9946. dari data tersebut dapat pasta yang menghasilkan hambatan
dibuat persamaan linier untuk arus, Ip [µA] = listrik yang rendah dan sifat fisik yang
717333C[M] + 13,77. baik adalah 0,20; 0,43; 0,07 untuk
karbon, resin dan hardener. Sedangkan
Nurulhuda Edy Muslim, Jumaat Hj. Adam, Muhamad Barzani Gasim, Sahibin Abd. Rahim,
Jumat Salimon, Geri Gopir, Ramlan Omar dan Marlia Mohd Hanafiah
Abstrak
Istilah tanah BRIS (Beach Ridges Interspersed with Swales) menggambarkan tanah endapan
pasir laut. 31% daripada kawasan benua di bumi yang mempunyai keluasan sebanyak
48,000,000 km2 adalah terdiri daripada kawasan berpasir. Tanah Bris mempunyai taburan
yang meluas di pantai Timur Semenanjung Malaysia terutamanya di Kelantan, Terengganu,
Pahang dan Johor. Tanah bris selalunya terdapat di antara 0.2-8.0 km dari pantai. Tekstur
tanah bris yang sangat berpasir mempunyai kandungan nutrien N,P, K, Mg dan Ca yang
rendah, saliran yang rendah dan struktur tanah yang lemah. Mengikut kajian yang dilakukan,
daripada segi taburan saiz kumin, kandungan pasir di dalam tanah bris ialah melebihi 97 % ,
kelodak 0-1% dan lempung kurang daripada 3%. Keupayaan tanah memegang kation dan
keupayaannya memegang air juga rendah. Kandungan karbon organik rendah iaitu kurang
daripada 1% dan nilai pHnya <5.0. Oleh itu, didapati kawasan tanah bris hanya ditumbuhi
dan didominasi oleh Casuarina equisetifolia, Melaleuca leucodendron, zizypus sp., Beckia
frustescens, Reminea maritema dan Fimbristylis sp. serta beberapa jenis rumput sahaja.
Pokok-pokok ini tidak dapat mengeluarkan bahan organik yang mencukupi untuk keperluan
tanaman. Namun, hasil daripada teknologi yang semakin canggih dan pembajaan
sepenuhnya, tanah bris telah ditanam dengan pelbagai jenis tanaman komersial seperti
Anacardium occidentale (gajus), tembakau, Cocus mucifera (kelapa) dan sayur-sayuran.
Kegiatan utama penduduk kawasan Setiu adalah pertanian. Data gunatanah pertanian 1997
menunjukkan adanya pertambahan kawasan pertanian sebanyak 43,935 hektar berbanding
tahun 1990 iaitu 40,204 hektar. Pertambahan ini berlaku sejajar dengan kecanggihan
teknologi dan peruntukan yang disediakan oleh kerajaan. Manakala kawasan hutan telah
diteroka menyebabkan keluasannya berkurangan daripada 65,771 hektar pada tahun 1990
kepada 59,393 hektar pada tahun 1997.
rongga makro yang baik untuk pengudaraan kekonduksian elektrik tertinggi iaitu 2850
tetapi tidak baik untuk keupayaan meyimpan µS/cm manakala sampel D2 menunjukkan nilai
air bagi kegunaan tumbuhan.. Kedudukan kekonduksian elektrik terendah iaitu 1060
kawasan ini berada lebih kurang pada garis µS/cm. Pada umumnya nilai kekonduksian
lintang 5°30’39 U dan garisbujur 102°57’55 T.. elektrik yang tinggi dalam tanih akan
Didapati aras air tanah berada pada kedalaman menjejaskan pertumbuhan tanih.(
di antara 60-70 cm dari permukaan tanah Ponnamperuma & Solivan 1981). Nilai
walaupun dalam keadaan kemarau. Tanah ini kekonduksian tanih berada dalam julat indeks
berwana coklat gelap ke kekelabuan. 1-5 di mana indeks 1-3 berkemungkinan
merosakkan tumbuhan. Manakala nilai kapasiti
Tanih bris di Setiu adalah terdiri daripada Siri
pertukaran kation adalah berjulat 6.960 –
Rudua dan Rhu Tapai (JPN, Terengganu)..
30.880meq/100g tanih dengan purata 12.808 +
Bagi profil Rudua, tekstur lapisan atas (0-
7.860 meq/100g menunjukkan keupayaan tanah
15cm) mempunyai ciri-ciri coklat ke kelabu (10
memegang kation dan keupayaannya
YR 5/2 ); pasir kasar, berstruktur butir tunggal,
memegang air juga rendah. Analisis korelasi
gegai dan mempunyai garisan sempadan yang
menunjukkan tidak terdapat hubungan yang
jelas. Manakala tekstur lapisan (15 – 40 cm)
signifikan antara KPK dengan peratus bahan
berwarna coklat cerah ke kelabu (10 YR 6/2);
organik pada aras bererti 5% (r = -0.1468).
pasir kasar, berstruktur butir tunggal dan gegai.
Pada dasarnya tanih bris mempunyai tahap
Sebanyak 4 lokasi yang dipilih iaitu Stesen 1 di kesuburan yang rendah. Data analisis juga
Stesen Komoditi Rhu Tapai (A), Stesen 2; menunjukkan purata kandungan nutrien K, Mg
Penanaman Kelapa Sawit (B), Stesen 3; dan Ca di kawasan Setiu adalah rendah
Lembah Bidong( Kawasan tumbuh semulajadi) disebabkan struktur tanahnya yang lemah
(C) dan Stesen 4; Kg.Rhu Tapai (D) dan Kg. menghalang penyerapan nutrien. Di Kampung
Penarik (E). Penarik(E) mencatatkan nilai KPK,
Jadual 1 menunjukkan penentuan pH, kekonduksian elektrik dan kandungan nutrien
Kekonduksian Elektrik (µS/cm), Ca2+ , Mg2+, yang tinggi berbanding kawasan lain. Ini
K+, Na+, Al3+, H+, dan jumlah Kapasiti kerana tanih di kawasan ini didapati berwarna
Pertukaran Kation (KPK). Secara keseluruhan, agak gelap dan subur berbanding tanih di
didapati nilai pH sampel tanih adalah berjulat kawasan lain. Menurut kajian pada masa lalu,
daripada 3.60 hingga 4.56 dengan purata 4.02 + penanam tembakau cuba mengatasi masalah
0.28. Secara amnya, didapati keasidan tanah di tanih bris dengan menyodok lapisan atas tanih
kawasan Setiu adalah tinggi (pH < 4.0). Sampel bris supaya akar tanaman tembakau mendekati
A2 iaitu di Stesen Komoditi Rhu Tapai, lapisan spodik dan aras air bawah tanah
menunjukkan nilai tertinggi iaitu 4.56 (Aminuddin et.al. 1984; Yeoh 1986). Lapisan
manakala sampel E1 menunjukkan nilai pH spodik terdiri daripada campuran pasir dan
terendah. Menurut Parker (1991), pH yang jirim organik yang bersepadu dengan Al3+ dan
sesuai untuk tanaman ialah 5.8 – 6.5 kerana Fe3+. Lapisan yang berwarna kelabu kehitaman
pada peringkat ini, zat makanan untuk ini didapati lebih subur daripada lapisan lain
tumbuhan tersedia dengan banyak dan akar- (Aminuddin et.al. 1985). Oleh itu
akar tumbuhan paling aktif apabila pH lebih berkemungkinan di kawasan ini penduduknya
daripada 5.8. Analisis korelasi menunjukkan telah melakukan perkara yang sama
tiada hubungan yang signifikan antara pH memandangkan di sini terdapat beberapa
dengan peratus bahan organik (%BOT) pada ladang tembakau yang telah lama diusahakan.
aras bererti 5% (r = -0.1254). Sampel B1, B2, Kebanyakan penduduk di kawasan ini didapati
D2 dan D3 didapati tiada kehadiran Al3+. Ion menanam pokok gajus, pokok kapas, mangga
Al3+ dan H+ adalah sumber keasidan tanih. dan kelapa.
Sampel E2 dan E3 mempunyai kandungan Menurut laporan yang diambil daripada Jabatan
Al3+yang tertinggi dengan purata 1.70 + 1.61 Pertanian (1997) dan Wong (1974), aktiviti
meq/100g. Kekonduksian elektrik berjulat di pertanian telah bertambah seiring dengan sektor
antara 1060 µS/cm hingga 2850 µS/cm dengan perindustrian berbanding tahun 1966 dan 1997.
purata 2093 + 553.1 µS/cm. Sampel E2 iaitu di Pada tahun 1966, aktiviti pertanian yang
Kampung Penarik menunjukkan nilai dijalankan adalah seluas 19 130 ha dan sektor
perindustrian pula seluas 327 ha berbanding hasil kajian juga menunjukkan sifat dan ciri
pada tahun 1997 iaitu seluas 96 745 ha dan 4 tanih bris dan tumbuhan yang dominan di
455 ha. Oleh itu pelbagai langkah telah atasnya. Oleh itu diharap kajian ini dapat
dilaksanakan oleh kerajaan bagi meningkatkan menyumbang penambahan maklumat mengenai
lagi hasil pertanian di daerah ini. Sebagai tanih bris dan membantu kepada langkah yang
contoh, di Stesen Komoditi Rhu Tapai (A), berkesan bagi meningkatkan kesuburannya di
tanihnya telah disuburkan dengan kaedah Malaysia. Dengan tahap pengurusan, teknologi
POME sebagai bahan pembaik tanah dan dan pembajaan yang cekap tidak mustahil tanih
meningkatkan hasil tanaman di tanah bris bris dapat menjadi tapak pertanian yang
sekurang-kurangnya dua kali ganda. Stesen ini mempunyai hasil yang menguntungkan.
menjalankan beberapa jenis tanaman komersial Pemantauan ke atas tanih dapat memberi
iaitu kelapa pandan, nenas, sukun, gajus, pokok maklumat yang bernilai yang boleh mengesan
kapas dan beberapa jenis cili. Walaupun tanih perubahan, penilaian ke atas kesan yang timbul
di sini mempunyai tahap keasidan yang tinggi akibat daripada gangguan samada semulajadi
iaitu pH< 4, usaha telah dilakukan bagi ataupun oleh aktiviti manusia.
mengatasi masalah ini dengan pengapuran
5. Rujukan
tanah di dalam lubang penanaman yang Aminuddin.Y, Abdullah C.T, Ahmad, A.R Md
dilakukan dengan kadar 1-2kg/lubang, diberi 2- Yunus, J. Wan Zaki, W.M. dan Kamaruddin,
4 minggu sebelum ditanam bersama baja fosfat A.R.(1994). Peningkatan kesuburan tanih bris dan
sebanyak 200g/lubang. Di kawasan Penanaman hasil tembakau dengan kek enapcemar kilang
Kelapa Sawit pula, Jabatan Pertanian telah minyak sawit. MARDI.
mengorek lubang tadahan air di antara pokok- Chai ,T.B. and Samat,W. (1984). Masalah-masalah
pokok kelapa sawit ini bagi mengelakkannya penanaman gajus di tanih bris. Tek. Pert.,5(2);178-
mengalami masalah kekurangan air dan 189.
meletakkan baja dan nutrien yang mencukupi
untuk kesuburan tanih ini. Usaha ini telah Courtney, F.M. & Trudgill, S.T.1984. The
Soil.Ed.Ke-2. London:Hodder & Stoughton.
dijalankan selama 2 tahun dan telah
memberikan hasil yang semakin baik. Laporan Kesesuaian Tanah Projek Kelompok
Manakala di Kg. Rhu Tapai, walaupun Tanaman Kelapa Pandan Kg. Beris Meraga, Mukim
tanihnya agak kurang subur, namun penduduk Kijal, Kemaman. (2000). Pejabat Pertanian Daerah
tempatan tetap menanam pokok yang sama Kemaman.
seperti di Kg Penarik di kebanyakan kawasan Mabaso, M.L.H, Appleton, C.C, Hughes, J.C,
rumah mereka dengan menggunakan baja untuk Gouws, E. (2003). The effect of soils type and
menyuburkan tanih. Selain daripada climate on hookworm (Necator americanus)
penggunaan baja, tumbuhan yang ditanam ini distribution in KwaZulu-Natal, South Africa.
telah resistan dan boleh beradaptasi dengan Tropical Medicine & International Health., Vol.8
Issue 8, p722,6p.
keadaan tanih bris.
Noraini J. (1992).Pembangunan Perindustrian di
4. Kesimpulan Kawasan Kemaman, Kerterh dan Paka dan
Kajian mengenai sifat tanih bris ada dilakukan Kesannya Ke Atas Persekitaran dan Sumber Asli.
oleh Jabatan Pertanian. Namun tiada kajian Simposium Sumber Alam Kebangsaan Pertama pg.
terperinci yang dijalankan bagi menentukan 47-60.
peranan faktor kepelbagaian ekologi khususnya
Nossin, J.J (1964). Beach Ridges of the East Coast
dalam aspek hidrologi, faktor edafik dan iklim, of Malaya. J. Trop. Geog., 18: 111-117.
dan juga ke atas variasi fisiognami, komposisi,
corak dan kepelbagaian spesies serta kitaran Penyiasatan Gunatanah Tahun (1990 & 2000),
nutrien bagi spesies tumbuhan di kawasan Jabatan Pertanian Negeri Terengganu.
tanah rendah yang mengandungi tanih bris di Ponnamperuma, F.N. & Solivan, J.L.1981. Varietal
Malaysia. Hasil kajian ini menunjukkan reaction of rice to iron toxicity on acid sulfate soil.
bahawa dengan faktor pembangunan dan Proc.Bangkok Symposium on Acid Sulfate Soils.
manusia, tekstur tanih bris telah mengalami Dost,H. & Van Breeman,H (Edi.) Ilri Publi.31.
perubahan yang ketara. Kegiatan pertanian juga Shamsudin Jusop (1990). Sifat dan Pengurusan
telah makin meluas seiring dengan kepesatan Tanah di Malaysia. Dewan Bahasa dan Pustaka.
sektor perindustrian di daerah ini. Selain itu,
LAMPIRAN
Jadual 1 : Penentuan pH, Kekonduksian Elektrik (µS/cm), Ca2+ , Mg2+, K+, Na+, Al3+, H+, dan jumlah
Kapasiti Pertukaran Kation.
%Kandungan
Sampel pH Ca2+ Mg2+ K+ Na+ Al3+ H+ KPK KE Lembapan %BOT
A1 4.04 2.970 0.271 1.052 4.133 1.80 0.90 11.126 2330 4.6247 4.6089
A2 4.56 1.195 0.203 3.960 6.751 0.70 0.60 10.035 2410 4.0343 4.0261
A3 3.95 7.400 2.123 1.092 5.204 1.50 1.00 18.319 2430 4.0276 4.0222
B1 4.18 3.060 0.110 2.017 3.171 UD 0.50 8.858 1330 4.0109 3.9759
B2 4.21 1.934 0.100 0.760 5.111 UD 0.40 8.306 2280 4.0128 3.9671
B3 4.06 1.253 0.697 0.578 3.532 0.50 0.40 6.960 1340 4.3756 4.3809
C1 3.65 0.690 1.425 1.030 4.166 2.10 1.20 10.611 2090 4.0566 4.0590
C2 3.79 0.755 1.290 0.814 2.831 1.40 1.30 8.389 2240 4.7581 4.7561
C3 4.25 1.122 1.349 0.930 3.194 1.60 0.90 9.095 2340 4.6870 4.6693
D1 4.09 1.983 0.320 0.623 3.171 0.70 0.60 7.397 2350 4.3644 4.3649
D2 3.90 2.410 0.157 1.103 3.316 UD 0.40 7.386 1060 4.3541 4.3535
D3 4.03 1.609 0.183 0.586 3.925 UD 0.40 10.077 1290 4.3699 4.3572
E1 3.60 20.400 1.285 2.155 4.202 1.20 1.50 30.742 2610 4.4078 4.3913
E2 4.40 1.048 0.241 0.703 3.647 6.40 1.90 13.939 2850 4.0823 4.0804
E3 3.62 18.270 1.305 1.243 7.362 0.80 1.90 30.880 2450 4.1507 4.1353
Purata 4.02 4.407 0.737 1.243 4.2477 1.70 0.93 12.808 2093 4.2878 4.2765
Sisihan
0.28 6.291 0.658 0.886 1.334 1.61 0.53 7.860 553.1 0.2580 0.2616
Piawai
Program Oleokimia,
Pusat Pengajian Sains Kimia & Teknologi Makanan,
Fakulti Sains dan Teknologi, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor, Malaysia.
*
Corresponding author: e-mail: jumat@pkrisc.cc.ukm.my
Abstrak
Minyak kasar biji kekabu (Ceiba petandra) diesktrak dengan menggunakan pelarut heksana
selama 3 jam pada suhu 60 dan 40 oC melalui kaedah pengekstrakan soxhlet. Kandungan
lipid kasar, triasilgliserol, asid lemak dan sifat-sifat fizikokimia minyak biji kekabu dikaji.
Hasil kajian menunjukkan biji kekabu mengandungi minyak sebanyak 25-30%. Asid lemak
linoleik, palmitik dan oleik merupakan asid lemak dominan dalam minyak biji kekabu dengan
peratusan sebanyak 42.3%, 22.5% dan 20.9% masing-masing. Ciri-ciri minyak biji kekabu
didapati setanding dengan minyak politaktepu (PUFA) bijirin lain.
Key words: Kekabu seed oil, linoleic acid, PUFA
th
492 Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Khairul Asmak Abd. Kadir dan Jumat Salimon
Rajah 1: Buah kekabu dengan pod buah, gentian kekabu dan biji kekabu
o
Bahan Kimia C masing-masing. Gas nitrogen telah
Semua bahan kimia yang digunakan diperolehi digunakan sebagai gas pembawa dengan kadar
dari pembekal tempatan adalah terdiri dari kelajuan 0.3 ml/min. Pengesahan punyak
“reagent gred” samada HPLC atau gred FAME dilakukan dengan membandingkan
analitikal dan digunakan terus tanpa melakukan puncak-puncak FAME piawai.
penulenan semula.
Penentuan sifat fisiko-kimia
Pengekstrakan lipid/minyak Indek biasan telah ditentukan dengan
Pengekstrakan minyak kekabu telah dilakukan menggunakan Atago refractometer pada 28 oC.
dengan menggunakan kaedah piawai yang Nilai-nilai penyabunan, iodin, keasidan, asid
dicadangkan oleh “Standard Methods for The bebas dan titik awan minyak kekabu telah
Analysis of Oils, Fats and Derivatives” 1.122, ditentukan dengan menggunakan kaedah Porim
IUPAC [2]. Biji kekabu yang telah Test Method [4]. Kandungan air/kelembapan
dihancurkan diekstrak dengan menggunakan minyak telah ditentukan menggunakan titratan-
pelarut hexana (Merck) dan direfluk selama auto 701 Karl Fisher Tritino Metrohm.
tiga jam pada 60 oC. Pelarut kemudiannya
3. Hasil dan Pembahasan
dikeluarkan dengan menggunakan “rotary
Ciri Fizikal
evaporator”. Minyak yang terhasil diletakan
Buah kekabu secara amnya mempunyai bentuk
dalam ketuhar bervakuum pada suhu 60 oC
membujur (oblong) dengan ukuran 6-12 in. dan
selama 30 min. dan ditimbang dan seterusnya
2-4 in. jejari, mempunyai lebih kurang 60%
disimpan dalam peti sejuk untuk analisis
gentian kekabu/kekapas yang berwarna kelabu
selanjutnya.
keputihan dan lebih kurang 40% biji benih
Penentuan Komposisi Asid Lemak (FAC) yang berwarna kelabu kehitaman seperti yang
Kandungan dan komposisi asid lemak telah ditunjjukan dalam Rajah 1.
ditentukan dengan menggunakan Kromatograpi
Rajah 2 menunjukkan biji kekabu yang
Gas. Minyak kekabu telah ditukar kedalam
merangkumi kira-kira 30-50 % mengikut berat
bentuk asid lemak metil ester (FAME) dengan
buah kekabu. Ianya mempunyai bentuk-pear,
menggunakan kaedah. AOCS Cd 14c-94 [3].
berwarna dari kelabu hingga “dark-brown" dan
0.05 g sampel diletakkan dalam vial 2 mL yang
menggandunggi kira-kira 25-30 % minyak.
mempunyai penutup skrew. 0.95 mL n-hexana
Sais ukuran biji kekabu berubah mengikut sais
kemudiannya ditambahkan diikuti oleh 0.05
buah dan biasanya dalam julat 4-6 mm
mL larutan naterium metoksida. Larutan
bergantung kepada jenis, species dan kawasan
campuran kemudiannya digincang dengan
tanaman.
menggunakan penggoncang vortex selama
sepuluh saat dan dibiarkan selama 15 min.
Kira-kira 1µL larutan organic yang terhasil
disuntikkan kedalam peralatan Shimadzu GC-
17A FID yang dilengkapi dengan turus
capillary BPX 70 (30m x 0.25mm x 0.25µm).
Suhu awal turus telah diprogramkan pada 180
o
C selama 30 min. dan suhu penyuntik dan Rajah 2: Biji kekabu
pengesan dibiarkan pada suhu 160 oC and 280
100
200
Extracted Lipid
Sample (g)
Sample (g)
150 Extracted lipid (%)
(%)
50
100
50
0 0
1 2 3 4 5 6 7 8
Experiment
Jadual 2 : Komposisi asid lemak dalam minyak kekabu dan minyak lain
Komposisi asid lemak Reference
Seed C12:0 C14:0 C16:0 C18:0 C18:1 C18:2 C18:3
Oil
a
KO - 0.08 22.5 3.1 20.9 42.3 0.07 exp.
CtO - 0.9 24.7 2.3 17.6 53.3 0.3 [6]
CPO 0.2 1.1 44.0 4.5 39.2 10.1 0.4 [7]
PKO 48.3 15.6 7.8 2.0 15.1 2.7 - [7]
KO: minyak kekabu, CtO: minyak biji kapas, CPO: minyak sawir mentah, PKO:minyak isirong sawit
a
exp: data hasil kajian ini
molekul triasilgliserolnya sebanyak 807.22 lemak linoleik yang penting diambil dalam diet
g/mol. harian [8]. Kajian lebih lanjut perlu dijalankan
terutamnya dari espek ketoksikan sebelum
Kandungan asid lemak
ianya dapat digunakan secara langsung sebagai
Kandungan dan komposisi asid lemak yang
sumber minyak makan seperti minyak “edible”
terdapat dalam minyak kekabu dan beberapa
yang lainnya.
minyak makan lain untuk perbandingan
ditunjukkan dalam Jadual 2. Hasil kajian 5. Ucapan Terimakasih
menunjukkan bahwa minyak kekabu Setinggi penghargaan diucapkan kepada
mengandunggi asid lemak major sebagai asid “Ministry of Science and Technology &
linoleik, C18:2 (42.3%), asid palmitik, C16:0 Inovasi” (MOSTI) di atas pembiayaan gran
(22.5%) dan asid oleik C18:1 (20.9%). Asid penyelidikan IRPA # 09-02-02-0115 EA 277
oleik dan asid linoleik merupakan kandungan dan Universiti Kebangsaan Malaysia di atas
asid lemak taktepu merangkumi lebih dari 63% sebahagian dari pembiayaan Skim Zamalah dan
dari jumlah asid lemak. Peratusan asid lemak pengajian peringkat sarjana kepada Miss
tepu pula merangkumi kira-kira 25% dari Khairul Asmak Abdul Kadir.
jumlah asid lemak minyak kekabu. Asid lemak
6. Daftar Pustaka
tepu ini terdiri dari asid palmitik C16:0 [1] J.G.Vaughan. 1970. The Stucture and
(22.5%), asid sterik, C18:0 (3.1 %) dan asid Utilization of Oil Seeds. Great Britain: The Chaucer
miristik C14:0 yang jauh lebih rendah sebanyak Press.
(0.08 %). Secara perbandingan minyak kekabu
[2] IUPAC. 1979. Standard Methods for the
mempunyai peratus asid lemak linoleik (42 %)
analysis of Oils, Fats and Derivatives. (6th ed).
yang menghampiri sifat-sifat minyak biji kapas Great Britain: Pergamon Press.
yang kaya dengan kandungan asid linoleik (53
%) sebagaimana yang ditunjukkan dalam [3] V.C. Mehlenbacher. 1964. Official and
Jadual 2. Oleh itu adalah dijangkakan bahwa Tentative Methods of The American Chemists’
minyak kekabu adalah sesuai digunakan Society. 2nd ed. Illinois: American Chemists’
Society.
sebagai penganti setiap kegunaan minyak biji
kapas yang jauh lebih mahal, terutamanya [4] PORIM Test Method. 1995. Bandar Baru
dalam penggunaan minyak salad dressing, Bangi: Palm Oil Research of Malaysia.
minyak masak, dan juga dalam penyediaan [5] Luque de Castro, M.D. & Garcia-Ayuso, L.E.
lelemak dan margarines [5]. Dengan 1998. Soxhlet Extraction of Solid Materials: an
kandungan asid lemak linoleik yang tinggi, outdated technique with promising innovative
minyak kekabu boleh digunakan sebagai future. Analytica Chimica Acta 369: 1-10
sumber modifikasi minyak lain seperti minyak [6] Basil S. Kamel & Yukio Kakuda. 1992. Fatty
kelapa sawit dan minyak kernel sawit yang Acids in Food and Their Health Implications, in
mengandunggi 10.1 dan 2.7% asid linoleik Ching Kuang Chow (Ed). Fatty Acids in Fruits and
masing-masing. Fruits Products, pg. 263 – 296. USA: Marcel
Dekker, Inc.
4. Kesimpulan
Kajian awal ini telah menunjukkan bahwa biji
kekabu mempunyai peraus minyak terekstrak [7] Salmiah Ahmad, Zainab Idris, Rubaah Masri &
yang agak tinggi dan mempunyai kandungan Rohana Ahmad. 1996. Oleochemicals in Malaysia-
Towards Value Addition. PALM OIL Technical
asid lemak tak tepu yang tinggi. Peratusan asid
Bulletin 2(3):2-5.
lemak linoleik yang tinggi dan komposisi asid
lemak lain dalam minyak kekabu menunjukkan [8] Akoh, C.C. 1998. Food Lipids: Chemistry,
minyak kekabu mempunyai cirri-ciri yang Nutrition and Biotechnology. In Akoh, C.C & Min,
hampir sama dengan minyak biji kapas yang D.B. (Ed). Lipid-Based Synthetic Fat Substitues, pg
559 - 588. USA: Marcel Dekker, Inc.
jauh lebih mahal. Minyak kekabu mempunyai
ciri-ciri minyak yang berpotensi untuk
dikomersialkan terutamanya dalam espek
sumber asid lemak politektepu seperti asid
Abstract
Five fungal chitosan samples were produced by extracting fungal chitosan from 60-hour old
mycelia of Absidia sp. DR using different treatment combinations (CTVB, CAA1, CAA2, CFA1
and CHCl1). The antibacterial properties of these chitosan samples were tested against seven
bacteria (3 Gram positive and 4 Gram negative) by employing the disc diffusion and the
minimal inhibition concentration (MIC) determination methods. The fungal chitosan’s
molecular weight (MW) ranged from 7.4 x 104 to 2.8 x 105 Da whereas the commercial
crustacean chitosan MW was 2.2 x 106 Da to 8.1 x 106 Da in size. The degree of deacetylation
(DD) for the chitosan samples ranged from 82.08% to 87.31%. It was observed that the fungal
and crustacean chitosan generally had similar bacterial inhibition trends whereby Gram
positive bacteria were more susceptible to the action of chitosan as compared to Gram
negative bacteria. This was especially obvious in the disc diffusion test where only small
zones of inhibition were observed (diameters of 7.0 to 9.5 mm) for all samples and
concentrations of fungal and crustacean chitosan used in this study. This study also showed
that the crustacean chitosan gave the lowest MIC value of 0.078 mg/ml as compared to 0.156
mg/ml given by the fungal chitosan. On the whole, the fungal chitosan CAA1 (DD 82.56%,
MW 2.37 x 105 Da) gave the best results when tested against Gram positive bacteria
meanwhile CAA2 (DD 87.12%, MW 2.76 x 105 Da) yielded the best results for Gram negative
bacteria. From the experimentations conducted we concluded that chitosan with a
combination of high degrees of deacetylation and high molecular weight does not necessarily
yield better bacterial growth inhibitory effects. The overall bacterial growth inhibitory
reaction is also dependent on the interaction between chitosan with the bacteria, and the
nature of the target organism.
Keywords: Chitosan, Absidia sp., antibacteria, degree of deacetylation, molecular weight
Chitosan has a massive range of applications in by adding sterilized distilled water onto the
industries such as cosmetics, pharmaceutical, fungal mycelia grown on potato dextrose agar
textile, food, biotechnology and agriculture. plates (PDA) and then carefully scraping the
Physicochemical properties such as the degree spores from the mycelia using a stab wire.
of deacetylation and molecular weight dictates Spore suspension was filtered into a sterilized
the characteristics of chitosan (Arcidiacono & flask and spore count was performed using a
Kaplan, 1992) thus determining its application. haemacytometer (Improved Neubauer, 0.100
Chitosan is surface active compound which mm deep, brightline Hemacytometer, USA).
falls in the category of cationic antimicrobial The spore suspension was prepared as 1x107
agent. The antibacterial and antifungal spores/ml. 5 ml of spore suspension was
properties of chitosan has drawn the attention inoculated into every flask. The fungus was
of many researchers to work on developing grown as submerged batch cultures at 30°C and
chitosan as a natural food preservative (Roller with agitation of 150 rpm for 60 hours and was
& Covill 2000). Much study has been then harvested using a vacuum filter (Milipore)
conducted on the the antimicrobial properties and Whatman paper No. 1. The fungal biomass
of crustacean chitosan and to a lesser extent, obtained was dried in a freeze dryer (Labconco
fungal chitosan. However many contradictory Model 216004) and weighed.
results were reported in the literature
Extraction
(Sudarshan et al. 1992; Gagne 1993; Jeon et al.
Lyophilized fungal biomass was then subjected
2001). Several studies reported that chitosan
to methods of White et al. (1979) and Rane and
with higher molecular weights were able to
Hoover (1993) with several modifications for
better inhibit bacterial growth as compared to
the extraction of chitosan from the fungus.
lower molecular weight chitosan whereas
Three different acids, acetic acid (AA) formic
different studies reported otherwise (Jiang et al.
acid (FA) and hydrochloric acid (HCl) were
1996; Helander et al. 2001; Jeon et al. 2001).
used as the extracting solution. Two
Gagne (1993) and Park et al. (2004) reported
combinations of acid treatment were
that the degree of deacetylation was important
performed: [1] acid concentration 2%,
in conferring the inhibitory effects of chitosan.
incubation period 12 hours and temperature
Therefore, this study aims to compare the
antibacterial properties of fungal chitosan and 95°C, and [2] acid concentration 10%,
crustacean chitosan and also to determine the incubation period 12 hours and temperature
effect of the degree of deacetylation and 95°C. Five fungal chitosan were produced and
molecular weight of chitosan to its antibacterial designated as CAA1(TVB), CAA1, CAA2,
activity. CFA1 and CHCl1. AA, FA and HCl
correspond to acetic acid, formic acid and
2. Experimental hydrochloric acid respectively with the
Fungi and culture medium numbers 1 and 2 indicating the acid treatment
The fungus used in this study, Absidia sp. DR, combination. With the exception of
a Zygomycete was obtained from the culture CAA1(TVB), all fungal chitosans were
collection of the school of Biosciences and extracted from mycelia harvested from YPG.
Biotechnology, Faculty of Science and Crustacean chitosan (crab) with low (CLMW)
Technology, Universiti Kebangsaan Malaysia. and high (CHMW) average molecular weight
Absidia sp. DR was grown on yeast-extract were obtained from SIGMA whereas shrimp
peptone glucose, YPG medium (yeast extract (CMMW) chitosan was obtained from
3gm/l,peptone 10gm/l, glucose 10gm/l and 1 Chitochem (Perak, Malaysia).
ml/l trace elements) and TVB medium (glucose
20gm/l; (NH)4SO4 1.4gm/l; KH2PO4 2 gm/l; Quality and statistical analysis
CaCl2 0.3gm/l; MgSO4.7H2O 0.3gm/l; The degree of deacetylation was determined by
molybdic acid 85% 0.01gm/l and 1ml/l trace the first derivative UV spectrophotometry
elements) for 60 hours. Both growth media method (FDUVS) (Muzarelli & Rochetti,
were prepared as 195ml aliquots in 500ml 1985). The degree of deacetylation for the
Erlenmeyer flasks and were autoclaved at chitosan samples was determined based on
110°C, 15 psi for 10 minutes (Arcidiacono & calculations for the percentage of the
Kaplan 1992). Inocula was prepared aseptically glucosamine content in the samples (Muzarelli
& Rochetti, 1985). The average molecular
comprised of networks which have a great Gram positive and Gram negative bacteria.
number of pores that enable foreign molecules
For S. aureus, fungal chitosan showed
to enter the cells easily. On the cell surface,
inhibition zones at every concentration except
chitosan polycations creates a destabilization
for CHCl1 and CAA2 (no zones formed at
effect in the outer structure of the cell wall.
0.625mg/ml) (Table ). It is interesting to note
This shows that there is a strong interaction
that both chitosans were found to have the
between chitosan and cell wall surface
highest DD (Table 1). Results for B. cereus
(Sudarshan et al. 1992). Chitosan is also able to
(not shown) also showed a similar trend
induce extreme morphological changes on
whereby only CHCl1 and CAA2 did not exhibit
Gram positive bacteria due to increased
inhibition zones at 0.625mg/ml concentration.
autolysin activities which leads to disruption of
Only chitosan with DD ranging from 82.02% to
the bacterial cell wall (Dagry et al. 2000).
84.55% gave satisfactory inhibition. CAA1
However, discussion will only be focused on S.
gave the best inhibitory effect towards S.
aureus, B. cereus (Gram positive) and E.
aureus with a zone diameter of 9.0mm at
aerogenes, P. aeruginosa (Gram negative). In
2.5mg/ml concentration. The SIGMA
the disc diffusion test, the diameters for the
crustacean chitosans did not inhibit bacterial
zones of inhibition ranged from 7.0 to 9.5 mm
growth below 5mg/ml concentration. In past
for all fungal and crustacean chitosans with the
studies (Sudarshan et al.,1992; Gagne 1993),
best inhibitory effects obtained at 5mg/ml and
chitosans with higher degree of deacetylations
2.5mg/ml chitosan concentrations for both
were said to yield better inhibitory effects as
TABLE 2 Zones of inhibition (mm) for fungal and crustacean chitosan towards S. aureus
Chitosan/ Conc. 10.00 5.00 2.50 1.25 0.625
(mg/ml)
CTVB 8.00 7.57 ± 0.25 7.57 ± 0.25 7.50 7.00
CAA1 8.50 8.75 ± 0.25 9.00 7.25 ± 0.25 7.25 ± 0.25
CAA2 8.00 8.25±0.25 7.50 7.00 -
CFA1 7.75± 0.25 7.75 ± 0.25 8.00 7.50 6.50
CHCl1 8.00 7.75 ± 0.25 7.50 7.00 -
CS 8.00 8.25± 0.25 8.00 8.00 -
CLMW 8.00 8.50 - - -
CHMW 8.00 7.75± 0.25 - - -
0.7
0.6
0.5
absorption (OD)
0.4
0.3
0.2
0.1
0
0 0 0.01 0.02 0.04 0.08 0.16 0.31 0.63 1.25 2.5 5
concentration (mg/ml)
1.4
1.2
1
absorption OD 0.8
0.6
0.4
0.2
0
0 0 0.01 0.02 0.04 0.08 0.16 0.31 0.63 1.25 2.5 5
concentration mg/ml
Table 3 Zones of inhibition (mm) for fungal and crustacean chitosan towards E. aerogenes
Chitosan/Conc. 10.00 5.00 2.50 1.25 0.625
(mg/ml)
CTVB - - - - -
CAA1 7.50 8.25±0.25 8.00 - -
CAA2 - - - - -
CFA1 - - - - -
CHCl1 - - - - -
CS 7.50 8.00 7.00 - -
CLMW 7.50 8.00 7.00 - -
CHMW 7.50 7.00 7.00 - -
compared to chitosans with lower degree of an antibacterial agent for E. coli (Sudarshan et
deacetylation as they have more reactive al. 1992). However the inability of chitosan to
groups. DD is important because it determines inhibit E.coli in this study might be due to the
the polycationic global charges in the chitosan different bacterial strain used. On the whole it
(Gagne 1993). However this study found that was observed that E. aerogenes was more
CAA1 (82.56%) rendered a higher degree of susceptible towards the action of commercial
inhibition as compared to CAA2 (86.15%) and crustacean chitosan which had high MW (2.2 x
CHCl1 (87.31%), both with a higher degree of 106 Da hingga 8.1 x 106 Da). However, CAA1
deacetylation (Table 1, Table 2 ). This finding was the only fungal chitosan able to inhibit E.
is supported by Park et al. (2004) whereby it aerogenes whereby inhibition zones were
was discovered that chitosan and formed at the higher chitosan concentrations
chitoologosaccharide gave better antimicrobial (10mg/ml, 5 mg/ml, 2.5 mg/ml) with the
effects at DD 75% as compared to a higher DD clearest zone of inhibition with a diameter of
of 90% and a lower DD of 50%. This means 8.25±0.25 mm at 5 mg/ml. Results from this
that a specific range of effective DD for test showed that chitosan with high MW weight
antimicrobial activities exists. was necessary in order to inhibit growth of E.
In the disc diffusion test conducted against aerogenes (Table 3). It is also important to note
Gram negative bacteria, all chitosan samples that DD too played an important role in the
did not appear to inhibit the growth of E. coli inhibitory effect as CAA1 had a lower DD
(ATCC 29522) and S. marcescens as there value as compared to CAA2 although CAA2
were no clear formation of inhibition zones. had a higher MW (Table 1, Table 3 ). This
Past studies reported the efficacy of chitosan as result again suggests that there is a specific
range of DD for effective inhibition. In the case
Table 4 MIC values for fungal and crustacean chitosan after 24 hours bacterial growth
Chitosan/Bacteria B.c S. a S. f E. a E. c P. a S. m
CTVB 0.625 0.625 0.625 5 1.25 5 2.5
(mg/ml)
CAA1 0.156 0.156 0.3125 2.5 1.25 2.5 2.5
(mg/ml)
CAA2 0.3125 0.3125 0.3125 2.5 0.625 2.5 2.5
(mg/ml)
CFA1 1.25 0.625 0.625 5 1.25 5 2.5
(mg/ml)
CHCl1 0.3125 0.625 0.625 2.5 1.25 2.5 2.5
(mg/ml)
CLMW 0.156 0.156 0.3125 2.5 0.078 1.25 2.5
(mg/ml)
CHMW 0.156 0.078 0.156 2.5 0.078 1.25 2.5
(mg/ml)
CS 0.156 0.078 0.156 2.5 0.078 1.25 2.5
(mg/ml)
B.c - B. cereus; S. a - S. aureus; S.f - Streptococcus faecalis; E. a - E. aerogenes;
E. c - E. coli; P. a - P. aeruginosa; S. m - Serratia marcescens
for P. aeruginosa, only commercial crustacean (82.56%, 2.370 x 105 Da). Due to its relatively
chitosans were able to inhibit bacterial growth higher molecular weight, CAA2 may cause a
at all concentrations except for 0.625mg/ml greater destabilization effect on the Gram
which was the lowest concentration (Results negative bacterial cell that eventually led to
not shown). P. aeruginosa is one of the more bacterial growth inhibition (Helander 2001;
resistant bacteria towards most membrane Park et al. 2004). In addition, its high DD may
active antibacterial agent. This is attributed to also contribute to the change in the
the difference in its polysaccharide makeup as permeability of the plasmalema thus leading to
well as the presence of hydroxy acids in lipid bacterial growth inhibition (Gagne 1993).
when compared to other enterobacteriaceae Therefore, it can be postulated that higher
(Brown 1971). degree of deacetylation and higher molecular
weight of chitosan can better inhibit Gram
The lowest MIC value obtained for Gram
negative bacteria (Helander et al 2001) as
positive bacteria were 0.156mg/ml and
compared to the lower values for Gram positive
0.3125mg/ml whereas the lowest MIC value for
bacteria (Table 1, Table 4, Figure 2). The MIC
Gram negative bacteria were 1.25mg/ml and
values given by CAA1 were comparable to that
2.5mg/ml. In the MIC test, CAA1 gave an MIC
of the crustacean chitosan except for E. coli and
value of 0.156 mg/ml for the Gram positive
P. aeruginosa. The crustacean chitosan CLMW
bacteria, S. aureus and B. cereus (Figure 1)
and CS gave an MIC value of 0.078mg/ml for
whereas CAA2 yielded the best inhibitory
S. aureus. The MIC results also indicated that
effect towards Gram negative bacteria with an
the effectiveness of the antimicrobial activity of
MIC value of 2.5mg/ml for E. aerogenes and P.
chitosan is dependent on its physicochemical
aeruginosa (Figure 2). CAA2 has a higher MW
attributes as well as the morphology of the test
(2.757 x 105 Da) and DD (86.15%) compared
bacteria (Table 4).
to other fungal chitosans such as CAA1
The difference in the concentration which bacteria, and the nature of the target organism.
causes inhibition of bacterial growth for the This study also discovered that a specific range
disc diffusion test and the determination of the of degree of deacetylation for effective
MIC value may lie in chitosan’s ability to antimicrobial activities exists. However the
chelate ions, essential nutrients and trace specific range of DD is yet to be determined as
elements from the growth media. Chelation of it might differ according to the test organism
these nutrients deprive bacteria of essential employed.
matters to sustain growth (Park et al. 2004).
5. Acknowledgement
Chelation also more readily occurs in liquid
The authors would like to thank the Ministry of
matrix (MHB) as compared to solid matrix
Science, Technology and Innovation for the
(MHA).
National Science Fellowship awarded to Dawn
In addition, this study also found that fungal Carmel Paul and for IRPA Grant awarded to
chitosan produced from various treatments Dr. Kalaivani Nadarajah andProf. Dr. Abdul
have antibactericidal effects towards B. cereus Jalil Abdul Kader.
at different concentrations (Table 5). This
6. References
might occur due to the significantly lower Arcidiacono, S. & Kaplan, D.L. (1992). Molecular
average molecular weight of the fungal Weight Distribution of Chitosan Isolated from
chitosan as compared to the crustacean chitosan Mucor rouxii under Different Culture and
which enabled it to penetrate B. cereus to cause Processing Conditions, Biotechnology and
further disruption in the bacterial cell which Bioengineering, 39, 281-286.
eventually led to bacterial cell death (Rose Brown, M.R.W. (1971). Inhibition and destruction
1980). In addition, it was observed that the of P. aeruginosa. In: Inhibition and destruction of
MBC values differ according to chitosan the microbial cell, Hugo, W.B. (Ed), Academic
sample used with CHCl giving the lowest MBC Press, London.
value of 0.625mg/ml (Table 5). The possible
Dagry, M.K., Reddy, B., Benhamou, N. & Arul, J.
explanation to this phenomenon is that CHCl is (2000). Antimicrobial action of chitosan on
more readily protonated as compared to other postharvest storage bacteria, Abstrat, IFT Annual
chitosan samples. This creates a more acidic Meeting, 65C-24
environment in the growth medium, thus
increasing its ability to bind to the outer Gagne, N. (1993). Production of chitin and chitosan
from crustacean waste and their use as a food
membrane of Gram negative bacteria (Helander
processing aid. MSc Thesis, McGill University,
et al. 2001; Xie et al. 2002) causing a change in Montreal.
the morphology of the plasmalema thereby
eventually leading to cell death. The crustacean Helander, I.M., Nurmiaho-Lassila, E.L.,
chitosan used in this study did not exhibit Ahvenainen, R., Rhoades, J. & Roller, S. (2001).
Chitosan disrupts the barrier properties of the outer
antibactericidal effect towards B. cereus. It is
membrane of Gram-negative bacteria, International
possible that the crustacean chitosan were Journal of Food Microbiology, 71, 235-244
unable to cause further bacterial damage due to
their high average molecular weight (2.216x106 Jeon, Y.J., Park, P.J., & Kim, S.K. (2001).
Da to 8.099 x 106). Antimicrobial effects of chitoologosaccharides
produced by bioreactor, Carbohydrate Polymers,
4. Conclusion 44, 71-76.
Among all fungal chitosan samples, CAA1 Jiang, Y., Bi., Y., Wang, Z. & Jiang, J. (1996). In-
(82.56%, 2.370 x 105 Da) was found to give the vitro antibacterial properties of chitosan, Chinese
best overall results for both disc diffusion test Journal of Antibiotics, 21, 54-56.
and the determination of the MIC value when
tested against Gram positive bacteria Muzzarelli, R.A.A. & Rochetti, R. (1985).
Determination of the degree of acetylation of
meanwhile CAA2 rendered the best results in
chitosans by first derivative ultraviolet
the MIC determination when tested against spectrophotometry, Carbohydrate Polymers 5:461-
Gram negative bacteria. The combination of 472.
high degrees of deacetylation and high
molecular weight might not necessarily yield Park, P.J., J.Y. Je, H.G. Byun, S.H. Moon & Kim,
S.K. (2004). Antimicrobial activity of hetero-
better bacterial growth inhibition as its action
chitosans and their oligosaccharides with different
also depends on its interaction with the
molecular weights, Journal of Microbiology and Rose, A.H. (1980). Chemical Microbiology: An
Biotechnology, 14, 317-323. introduction to microbial physiology, Butterworths,
London.
Rane, K.D. & Hoover, D.G. (1993). An evaluation
of alkali and acid treatments for chitosan extracted Sudarshan, N.R., D.G. Hoover & D. Knorr. (1992).
from fungi, Process Biochemistry 28:115-118. Antibacterial action of chitosan, Food
Biotechnology, 6, 257-272.
Rege, P.R. and Block, L. H. (1999). Chitosan
processing: Influence of process parameters during White, S.A., Farina, P.R. and Fulton, I. (1979).
acidic and alkaline hydrolysis and effect of the Production and Isolation of Chitosan from Mucor
processing sequence on the resultant chitosan’s rouxii, Applied and Environmental Microbiology,
properties, Carbohydrate Research, 321, 235-245. 38, 323-328.
Roberts, G. A. F. (1992). Chitin Chemistry. The Xie, W.M., Xu, P.X., Wang, W. & Liu, Q. (2002).
Macmillan Press Ltd, London. Preparation and antibacterial activity of water-
soluble chitosan derivative, Carbohydrate Polymers,
Roller, S. & Covill, N. (1999). The antifungal
50, 35-40.
properties of chitosan in laboratory media and apple
juice, International Journal of Food Microbiology
47, 67-77.
Abdul Salam Babji, Norrakiah Abdullah Sani dan Khairul Faizal Pa’ee
Program Sains Makanan, Pusat Pengajian Sains Kimia dan Teknologi Makanan,
Fakulti Sains dan Teknologi, Universiti Kebangsaan Malaysia, Bangi, 43600, Selangor, Malaysia.
E.mail: daging@pkrisc.cc.ukm.my
Abstrak
Dalam kajian ini, produk bakeri sejukbeku dibandingkan dengan produk bakeri dibakar terus
pada hari yang sama ia dikeluarkan. Dua produk ini dibezakan dari segi prosesnya iaitu
proses konvensional di mana produk bakeri ini dibakar terus selepas doh dinaikkan dan
proses penyejukbekuan sebelum dibakar. Objektif kajian ini adalah untuk membuktikan
bahawa produk bakeri sejukbeku serta dibakar adalah lebih baik kualitinya berbanding
produk bakeri dibakar terus. Produk seperti Butter Gipfel Crescent (preproven) dan Farmers
Bread (prabakar) telah digunakan sebagai sampel kajian. Berikutan itu, penentuan
parameter seperti kehilangan berat produk, peratusan kelembapan, analisis tekstur dan
peratusan kerak dan isi roti ditentukan. Kehilangan berat Butter Gipfel Crescent, selepas
dibakar terus adalah lebih tinggi berbanding perlakuan sejukbeku serta dibakar (P<0.05).
Bagi Farmers Bread, kehilangan berat bagi perlakuan sejubeku serta dibakar adalah lebih
tinggi berbanding dibakar terus (P<0.05). Kandungan kelembapan sepanjang tempoh 24jam
pengeringan bagi kedua-dua sampel untuk perlakuan sejukbeku serta dibakar adalah lebih
tinggi berbanding dibakar terus (P<0.05). Bagi analisis tekstur, kedua-dua produk yang
disejukbeku serta dibakar mempunyai tahap penembusan yang lebih tinggi oleh penetrometer
berbanding dibakar terus. Bagi peratusan kerak dan isi, kedua-dua sampel yang disejukbeku
dan dibakar mempunyai peratusan kerak yang lebih tinggi berbanding dibakar terus
(P<0.05). Berdasarkan penilaian sensori secara keseluruhan, pengguna lebih menggemari
produk Butter Gipfel Crescent yang disejukbeku serta dibakar dan bagi Farmers Bread pula,
pengguna lebih menggemari sampel yang dibakar terus daripada disejukbeku serta dibakar.
Kesimpulannya, produk bakeri sejukbeku serta dibakar adalah lebih baik kualitinya
berbanding dibakar terus kerana kebolehannya mengekalkan peratusan kelembapan dan
justeru memberi kesan yang baik kepada tekstur dan penerimaan pengguna.
Kata Kunci: Makanan sejukbeku, produk bakeri sejukbeku, produk bakeri dibakar terus.
Jadual 3: Nilai Peratusan Kandungan Kelembapan Menggunakan Kaedah Oven (AOAC 1984)
Produk bakeri Peratusan kandungan air (%)
Sejukbeku serta dibakar Dibakar terus
Butter Gipfel Crescent 19.92 ± 0.81 a 17.68 ± 0.60 b
Farmers Bread 43.11 ± 3.00 a 32.16 ± 3.05 b
Nilai min pada baris yang sama dengan superskrip yang berbeza menunjukkan perbezaan yang bererti
(P<0.05)
6 7
a
b
5
a a a 6
a a
a
a a a a a a a a a
a a a a a
a b a 5
a
4 a a a b a a a
b
a
a
4
Minskor
Minskor
3 a
b
3
2
2
1
1
0 0
Keseragaman Isipadu Tekstur Kepadatan Kesan Rasa Bau Kesan Keseragaman Isipadu Tekstur Kepadatan Ketulan Kesan Pahit Bau masam Kesan
Ketulan Kerangupan
warna Permukaan lubang mentega mentega gigitan warna permukaan lubang gigitan
Dibakar terus Sejukbeku dan dibakar Dibakar terus Sejukbeku dan dibakar
(A) (B)
Rajah 1: Min Skor Bagi Penilaian Sensori (Ujian Deskriptif) Bagi Produk Butter Gipfel
Crescent (A) dan Farmers Bread (B)
a-b :
Abjad yang berbeza menunjukkan perbezaan bererti (P<0.05)
5.4
6
a
5.2 a a
a a 5
a
a a a a
a a a
5 a a a a
a a
a b b a a
Minskor Atribut
4
Minskor Atribut
4.8 a
a 3
a
4.6
b
2
4.4
1
4.2
4 0
Warna Aroma Rupabentuk Rasa mentega Kelembapan Kekerasan Keseluruhan Pahit
Warna Aroma Rupabentuk Kelembapan Kekerasan keseluruhan
Dibakar terus Sejukbeku dan dibakar Dibakar terus Sejukbeku dan dibakar
(A) (B)
Rajah 2: Min Skor Bagi Penilaian Sensori (Ujian Hedonik) Bagi Produk Butter Gipfel
Crescent (A) dan Farmers Bread (B)
a-b :
Abjad yang berbeza menunjukkan perbezaan bererti (P<0.05)
itu, kelembapan di dalam isi roti dapat tinggi memberikan kelebihan kepada produk
dikekalkan untuk meningkatkan kualiti produk bakeri tersebut untuk mengurangkan
bakeri sejukbeku. kehilangan kelembapan. Peratusan kerak yang
tinggi bagi Farmers Bread menunjukkan kesan
Analisis tekstur menunjukkan perbezaan bererti
pembakaran dua kali bagi jenis prabakar.
(P<0.05) bagi produk Butter Gipfel Crescent
Kehilangan kelembapan dapat diminimakan
(Jadual 4). Ini menunjukkan bahawa
kerana kurang air dapat meresap ke permukaan
kelembapan yang tinggi dalam produk bakeri
produk bakeri.
sejukbeku akan memberi kesan tekstur yang
lembut. Atribut yang dinilai dalam ujian deskriptif ialah
keseragaman warna, isipadu roti, tektur
Terdapat perbezaan bererti (P<0.05) dalam
pemukaan, kepadatan, ketulan, kesan lubang,
penentuan peratusan kerak dan isi bagi kedua-
rasa mentega, bau mentega, keranggupan dan
dua produk (Jadual 5). Peratusan kerak yang
kesan gigitan (Rajah 1). Bagi produk Butter
Gipfel Crescent, terdapat perbezaan bererti bagi Justeru itu, ia memberikan tekstur yang lembut
atribut isipadu dan keranggupan (P<0.05). Bagi kepada produk bakeri sejukbeku. Ujian sensori
produk Farmers Bread pula, terdapat mendapati produk Butter Gipfel Crescent
perbezaan bererti bagi atribut isipadu, sejukbeku serta dibakar serta Farmers Bread
kepahitan dan kemasaman bagi kedua-dua dibakar terus paling digemari oleh ahli panel
perlakuan (P<0.05). pengguna.
Dalam ujian hedonik, atribut yang dinilai ialah 5. Penghargaan
keseragaman warna, aroma, rupabentuk, rasa Penghargaan diberikan kepada Hiestand
mentega, pahit, kelembapan, kekerasan dan Malaysian Sdn.Bhd. kerana telah memberikan
penerimaan keseluruhan (Rajah 2). Bagi peluang menjalankan kajian ini serta membantu
produk Butter Gipfel Crescent dan Farmers menyediakan sampel kajian.
Bread, panel dapat membezakan atribut
6. Rujukan
kelembapan secara bererti (P<0.05) bagi kedua- AOAC (1984). Official Methods of Analysis (11th
dua perlakuan. Secara keseluruhan ujian Ed.). Associate of Official Agricultural Chemist,
deskriptif menunjukkan bahawa produk Butter Washington D.C.
Gipfel Crescent sejukbeku serta dibakar paling
Giannou, V., Kessoglou, V., Tzia, C. (2003).
digemari berbanding dibakar terus tetapi bagi
Quality and safety characteristics of bread made
produk Farmers Bread, perlakuan dibakar terus from frozen dough. J. Food Sc. 14: 99-108.
adalah lebih digemari.
Matz, S.A (1995). Bakery technology and
4. Kesimpulan engineering. Ed. Ke-2. Jil. 1. The AVI Publishing
Produk bakeri sejukbeku serta dibakar Company Inc., Westport, Connecticut.
mempunyai kandungan kelembapan yang lebih
Marston, P.E (1978). Bakers Digest. Ed. 2. Jil.52.:
tinggi berbanding produk bakeri segar 18.
disebabkan penghasilan kerak roti yang tebal
bagi produk bakeri sejuk beku serta dibakar
yang dapat meminimakan kehilangan air.
Dua Senyawa Oligomer Reaveratrol Dari Kulit Batang Shorea Parvifolia Dyer.
(DIPTEROCARPACEAE)
1
Kelompok Penelitian Kimia Organik Bahan Alam, Departemen Kimia, Institut Teknologi Bandung, Jalan
Ganeca 10, Bandung,40132, Indonesia
2
School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti
Kabangsaan Malaysia, 43600 UKM Bangi, Selangor D.E. Malaysia
Abstrak
Dua trimer resveratrol, davidiol A (1) dan (+)-(α)-viniferin (2) telah diisolasi untuk pertama
kalinya dari ekstrak aseton kulit batang Shorea parvifolia Dyer. Struktur kedua senyawa
tersebut ditetapkan berdasarkan data spektroskopi meliputi data spektroskopi UV, IR, 1H-
NMR dan 13C-NMR serta perbandingan dengan data sejenis dari senyawa yang sama yang
telah dilaporkan.
HO OH
A1 H 4
O OH
7 A1 OH
H B2
HO H
8 H 1 12
C1 OH
A2 8 8
7
O 7 H A2
H 8
7
H 12 10
10 O
OH H C2 8 7 H
C2 OH
HO H 1
B1 H 8 10 B1
HO 1 7
4 C1 B2
HO 4
HO 12
OH
OH OH
(1) (2)
Kata kunci: davidiol A, (+)-(α)-viniferin, oligomer resveratrol, Shorea parvifolia Dyer.,
Dipterocarpaceae.
1a - 134.3
2a,6a 7, 19 ( d, 8,6 ) 128.1
3a,5a 6, 78 ( d, 8,6 ) 116, 0
4a - 155, 8
7a 6, 08 ( d, 2,2 ) 85, 8
8a 4, 40 (s) 50.4
9a - 147
10a - 117.9
11a - 158,0
12a 6, 40 ( d, 2,2 ) 101, 3
13a - 156,9
14a 6, 55 ( d, 2,2) 103.9
16 - 137.4
2b,6b 7,01 ( d, 8,4 ) 129.6
3b,5b 6, 58 ( d, 8,4 ) 115, 3
4b - 158,2
7b 5, 24 (s) 36,5
8b 4,19 (d, 11,7) 51.7
9b - 143.2
10b - 119
11b - 159.4
12b 6, 02 (s) 95.9
13b - 154, 8
14b - 122, 2
1c - 134, 2
2c,6c 6, 73 (d, 8,6) 129.8
3c,5c 6,61 (d, 8,6) 115, 5
4c - 156.6
7c 4, 38 (d, 9,9) 56.1
8c 2, 95 (dd, 11,7; 9,9) 67.5
9c - 144
10c 6, 42 (d, 2,2) 108.3
11c - 158, 9
12c 6,17 (t, 2,2) 102
13c - 158,9
14c 6,42 (d, 2,2) 108.3
6,73(2H, d, J 8,6 Hz, H-2c,6c) dan 6,61 (2H, d, spin A2X pada δ 6,42 (2H, d, J 2,2 Hz, H-
J 8,6 Hz, H-3c,5c) ppm yang menunjukkan 10c,14c) dan 6,17 (1H, t, J 2,2 Hz, H-12c)
adanya tiga gugus 4-hidroksifenil. Data untuk gugus 1,3,5-trisubstitusifenil.
spektrum 1H-NMR juga menunjukkan sinyal- Berdasarkan data 1H dan 13C-NMR tersebut,
sinyal untuk satu pasang proton aromatik senyawa 1 adalah trimer resveratrol davidiol
kopel-meta pada δ 6,40 (1H, d, J 2,2 Hz, H- A.
12a) dan 6,55 (1H, d, J 2,2 Hz, H-14a) yang
Perbandingan data 1H dan 13C-NMR senyawa
sesuai untuk gugus 1,2,3,5-tetrasubstitusifenil,
1 dengan davidiol A memperlihatkan
satu sinyal singlet aromatik pada δ 6,02 ppm
kesesuaian pada nilai geseran kimianya.
untuk 1,2,3,5,6- pentasubstitusifenil, dan
Selanjutnya konfirmasi struktur senyawa 1
sinyal-sinyal proton aromatik dengan sistem
didasarkan pada perbandingan data fisik dan Spektrum UV dan IR senyawa 2 tidak berbeda
spektroskopi UV dan IR dari senyawa davidiol secara signifikan dengan spectrum yang sama
A dan senyawa 1 seperti terlihat pada Tabel 2. dari senyawa 1. Hasil perbandingan dengan
Dengan membandingkan data-data di atas data base IR memberikan korelasi 97% dengan
maka dapat disimpulkan bahwa senyawa 1 senyawa (+)-(α)-viniferin. Hasil Kromatografi
adalah senyawa davidiol A yang diisolasi Lapis Tipis (KLT) senyawa 2 dan senyawa
pertama kalinya dari spesies S. parvifolia. standar menunjukkan harga Rf yang sama
Senyawa davidiol A pertama kali ditemukan terhadap tiga sistem eluen yang berbeda.
pada tumbuhan Shopora davidii9 dan sudah Berdasarkan hal ini maka penentuan struktur
pernah diisolasi dari Shorea hemsleyana10 dan senyawa 2 selanjutnya dengan
Shorea guiso11. Senyawa davidiol A membandingkan data fisik dan spektroskopi
dilaporkan menunjukkan aktivitas antitumor.12 UV dan IR kedua senyawa tersebut seperti
terlihat pada tabel 3.
HO Dari hasil perbandingan data senyawa 2 dan
A1 H standar, maka dapat disimpulkan bahwa
O OH senyawa 2 adalah senyawa (+)-(α)-viniferin
7
H B2 yang diisolasi pertama kalinya dari spesies S.
HO H
8
7 C1 OH parvifolia. Senyawa (+)-(α)-viniferin
A2 8 8
H sebelumnya telah diisolasi dari beberapa
7
H tumbuhan seperti Caragana chamlagu5,
OH H
C2 OH Shorea hemsleyana10, S. parvistipulata13 dan
B1
Hopea bancana13.
HO
Hasil penelitian sebelumnya menyatakan
OH bahwa senyawa (+)-(α)-viniferin
(1) memperlihatkan aktivitas anti inflamasi5 dan
Syimposium on the Chemistry of Natural 14. Aminah, N.S., 2003, “Fitokimia beberapa
Products, Sapporo, 1997, 571 spesies Shorea (Dipterocarpaceae) Hutan
Tropika Kalimantan”, Disertasi Doktor,
13. Tukiran, 2003, “Senyawa mikromolekul
Institut Teknologi Bandung, Indonesia, 126-
dari beberapa tumbuhan meranti (Shorea)
127.
Indonesia”, Disertasi Doktor, Institut
Teknologi Bandung, Indonesia, 92-95
Abstrak
DNA polimerase merupakan enzim multifungsi yang terdiri dari 3 domain yaitu: eksonuklease
5`-3`, eksonuklease 3`-5`, dan polimerase 5`-3`. Dalam penelitian ini telah dilakukan studi
struktur fungsi domain polimerase DNA Pol I ITB melalui mutasi terarah (site directed-
mutagenesis). Hasil penjajaran urutan asam amino yang dibandingkan dengan asam amino
dari beberapa bakteri diperoleh 6 daerah lestari (conserved). Hasil analisis homologi
menunjukkan bahwa DNA Pol I ITB mempunyai kemiripan yang tinggi dengan B.caldotenax
yaitu 99%. Sisi aktif enzim terletak pada daerah lestari 3 dan 5 ( motif A dan C) yang terletak
pada subdomain palm. Sisi aktif enzim dicirikan dengan 3 residu asam amino yang rantai
sampingnya mengandung gugus karboksilat, yaitu: Asp653, Asp830 dan Glu831. Studi
mutagenesis dilakukan terhadap residu asam amino lestari yaitu Asp802 (yang terletak pada
daerah lestari 6) dan Glu831 (yang terletak pada daerah lestari 5/motif C). Mutasi dilakukan
dengan metode PCR megaprimer. Mutan D802N dan E831Q telah berhasil dikonstruksi dan
diekspresi secara heterolog di E.coli.
Kata Kunci: daerah lestari (conserved), ekspresi heterolog , mutasi terarah (site directed-
mutagenesis), PCR megaprimer, studi struktur fungsi
katalisisnya diperlukan 2 ion logam divalen sisi pemotongan KpnI dan BamHI. Untuk
(Mn2+, Zn2+, Mg2+). Subdomain fingers, memastikan bahwa gen DNA polimerase telah
berperan di dalam interaksi dengan dNTP dan termutasi, maka dilakukan karakterisasi dengan
templat, sedangkan subdomain thumb melakukan analisis restriksi terhadap gen
mempunyai peranan di dalam prosesivitas (Li mutan dan dilanjutkan dengan penentuan
et al, 1998; Patel et al. 2001). Sisi aktif enzim urutan nukleotida. Gen mutan yang telah diklon
DNA polimerase terletak pada subdomain palm ke dalam vektor ekspresi digunakan untuk
yang tersusun dari 3 residu asam amino yang mentransformasi sel E.coli GI724, dan
mempunyai gugus karboksilat (Asp pada motif overekspresinya dianalisis dengan
A serta Asp dan Glu pada motif C) (Patel et elektroforesis SDS-PAGE.
al., 2001; Kiefer et al., 1997; Joyce dan Steitz,
2. Percobaan
1994).
Peremajaan E.coli
DNA polimerase digunakan di dalam teknik E.coli GI724 yang membawa gen DNA Pol I
bilogi molekular seperti dalam penentuan mutan digoreskan dalam medium RMG-A (1 X
urutan nukleotida DNA (DNA sequencing) dan M9 salts; 2% casamino acid; 0,5% glukosa; 1
PCR (polymerase chain reaction) (Blondal et mM MgCl2; 100 µg/ml ampisilin; dan
al., 2001). Lebih dari 50 gen DNA polimerase 1,5%bacto-agar) langsung dari stok gliserol,
telah diklon dan ditentukan urutan kemudian diinkubasi pada temperatur 30oC
nukleotidanya ( Uemori et al., 1995). Beberapa selama 12-16 jam.
dari DNA polimerase tersebut saat ini
digunakan di bidang bioteknologi, terutama Studi Homologi dan identifikasi residu
untuk proses PCR. Karena dalam setiap siklus asam amino lestari
Untuk mengetahui homologi (tingkat
PCR diperlukan termostabilitas enzim yang
keidentikan) urutan basa dan residu asam
tinggi, maka DNA polimerase termostabil
amino lestari (motif) dapat dilakukan dengan
menjadi komponen yang sangat penting (Choi
membandingkan tingkat kesesuaian urutan
et al., 1999; Adam dan Kelly, 1998).
nukleotida maupun tingkat kesesuaian urutan
Beberapa bakteri termofilik telah diisolasi dari asam-asam amino yang terdapat di GenBank.
sumber air panas Cimanggu dengan kondisi Dalam penelitian ini digunakan program
suhu 80oC dan pH 7. Hasil identifikasi salah Predictprotein pada situs internet http://
satu isolat dengan analisis 16S rRNA www.embl-
menunjukkan bahwa bakteri tersebut heidelberg.de/predictprotein/submit_def.html.
dikarakterisasi sebagai Bacillus
thermoleovorans (Akhmaloka et al., 2000b). Site directed-mutagenesis dengan PCR
Gen penyandi DNA polimerase dari isolat megaprimer
Mutasi dilakukan pada gen DNA Pol I yang
Cimanggu tersebut telah diklon ke dalam
telah di klon ke dalam vektor ekspresi pTrxFus
vektor ekspresi pTrxFus dan plasmid
(plasmid rekombinan pITB-9A) dengan
rekombinannya disebut pITB-9A. Plasmid
menggunakan metode PCR megaprimer
tersebut diekspresikan dengan metode ekspresi
(Sambrook dan Russell, 2001; Barik, 1997).
gen secara heterolog di E.coli (Pramono H,
Primer untuk site directed-mutagenesis
2004). Di dalam tulisan ini akan dilakukan
terdiri atas:
kajian struktur-fungsi domain polimerase DNA
Pol I ITB. Untuk kajian tersebut tahap awal FPK: 5’-GGTACCAATGAAAAAAAAGCTTGTTTTAATC-3’
penelitian dilakukan studi homologi untuk RPB: 5’-GGATCCTTTATGTCGCGTCATACC–3’
memperoleh residu asam amino lestari yang FM-802n: 5’-CAAGGGAGCGCCGCTAACATTATT–3’
potensial untuk dimutasi. Tahap selanjutnya FM-831q: 5`-ACAGGTGCATGACCAGCTCATTTTGG-3`
adalah mutasi terarah (site directed-
mutagenesis) dengan mutasi tunggal untuk Primer FPK dan RPB dirancang dengan sisi
mengetahui fungsi dari residu asam amino pemotongan KpnI dan BamHI agar dapat
tersebut. Mutasi dilakukan dengan metode PCR disisipkan ke dalam vektor ekspresi pTrxFus.
megaprimer. Adapun strategi untuk Sedangkan primer mutan Fm-802n dan FM-
mendapatkan gen mutan adalah dengan 831q dirancang sesuai dengan urutan gen
merancang satu primer mutan serta satu pasang penyandi DNA Pol I wild-type kecuali untuk
primer yang mengadung enzim restriksi dengan asam amino yang akan dimutasi. Perancangan
481 . 5 . . . . 540
predict_h3250 LSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFE
dpo1_bacca LSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFE
dpo1_bacst LAGILANMEFTGVKVDTKRLEQMGAELTEQLQAVERRIYELAGQEFNINSPKQLGTVLFD
dpo1_theaq LSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHPFNLNSRDQLERVLFD
dpo1_ecoli LVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAHEIAGEEFNLSSTKQLQTILFE
______1______
541 : . . . . 6 600
predict_h3250 KLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTK
dpo1_bacca KLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENIlhYRQLGKLQSTYIEGLLKVVRPDTK
dpo1_bacst KLQLPVLKKTKTGYSTSADVLEKLAPHHEIVEHILHYRQLGKLQSTYIEGLLKVVHPVTG
dpo1_theaq ELGLPAIGKTEkkRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLPDLIHPRTG
dpo1_ecoli KQGIKPLKKTPGgpSTSEEVLEELALDYPLPKVILEYRGLAKLKSTYTDKLPLMINPKTG
601 . . . . : . 660
predict_h3250 KVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELR
dpo1_bacca KVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELR
dpo1_bacst KVHTMFNQALTQTGRLSSVEPNLQNIPIRLEEGRKIRQAFVPSEPDWLIFAADYSQIELR
dpo1_theaq RLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEE-GWLLVALDYSQIELR
dpo1_ecoli RVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPE-DYVIVSADYSQIELR
_________2________ ________A_______
661 . . . 7 . . 720
predict_h3250 VLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYG
dpo1_bacca VLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYG
dpo1_bacst VLAHIAEDDNLIEAFRRGLDIHTKTAMDIFHVSEEDVTANMRRQAKAVNFGIVYGISDYG
dpo1_theaq VLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR
dpo1_ecoli IMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFG
_______B_______
721 . . : . . . 780
predict_h3250 LAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRN
dpo1_bacca LAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRN
dpo1_bacst LAQNLNITRKEAAEFIERYFASFPGVKQYMDNIVQEAKQKGYVTTLLHRRRYLPDITSRN
dpo1_theaq LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARV
dpo1_ecoli LARQLNIPRKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSN
781 . 8 . . . . 840
predict_h3250 FNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEE
dpo1_bacca FNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEE
dpo1_bacst FNVRSFAERTAMNTPIQGSAADIIKKAMIDLSVRLREERLQARLLLQVHDELILEAPKEE
dpo1_theaq KSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEE--MGARMLLQVHDELVLEAPKER
dpo1_ecoli GARRAAAERAAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHDELVFEVHKDD
________6_______ ______C_______
841 : . . ] 876
predict_h3250 MERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
dpo1_bacca MERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
dpo1_bacst IERLCRLVPEVMEQAVTLRVPLKVDYHYGPTWYDAK
dpo1_theaq AEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAK
dpo1_ecoli VDAVAKQIHQLMENCTRLDVPLLVEVGSGENWDQAH
Gambar 1. Daerah lestari pada ujung C domain polimerase. Urutan nukleotida DNA polimerase termostabil
isolat lokal (Predict h 3250) dibandingkan terhadap DNA polimerase B.caldotenax, B.stearothermophillus,
T. aquaticus, dan E.coli. Daerah lestari /motif yang terdiri dari (1, 2, 3 atau motif A, 4 atau motif B, 5 atau
motif C, dan 6) ditandia dengan (--). Residu asam-asam amino lestari dicetak dengan tinta biru dan sisi aktif
enzim dicetak dengan tinta merah; Sedangkan residu asam amino yang dimutasi dicetak dengan tinta ungu
(Ambarsari et al., 2004).
rpm hingga dicapai OD550 0,5. Setelah itu pada terdapat pada DNA pol I ITB yaitu domain
kultur ditambahkan triptofan dengan eksonuklease 3`-5`(pada bagian tengah urutan
konsentrasi akhir 100 µg/ml dan kultur kembali asam amino), domain eksonuklease 5`-3` (pada
diinkubasi tetapi pada temperatur 37oC dengan bagian ujung-N), dan domain polimerase 5`-3`
pengocokan 200 rpm selama 3 jam. Selanjutnya (pada bagian ujung-C). Ujung-N urutan asam
sel dipanen dengan cara sentrifugasi dan pelet amino hasil deduksi mengandung enam motif
sel disuspensikan dalam bufer lisis. Ekstrak eksonuklease 5`-3`, yaitu motif A,B,C,D,E, dan
kasar protein diperoleh dengan cara sonikasi F (Pramono, 2004). Sedangkan pada ujung-C
dan dianalisis dengan elektroforesis SDS- terdapat motif 1, 2, 3 (A), 4 (B), 5 (C), dan 6
PAGE. yang dapat dilihat pada Gambar 1.
3. Hasil dan Pembahasan Dari hasil penjajaran ini juga diperoleh
Analisis homologi pada domain polimerase beberapa residu asam amino lestari antara
DNA Pol I ITB lain
Berdasarkan hasil analisis homologi dengan Asp 653 (homolog dengan Asp 610 pada Taq ,
bantuan program predictprotein didapatkan Asp 653 pada Bst, dan Asp 705 pada E.coli)
bahwa urutan asam amino gen penyandi DNA yang terletak pada motif A dan residu Asp
Pol I ITB mempunyai kemiripan yang tinggi 830
, Glu 831 (homolog dengan Asp 785, Glu 786
dengan B.caldotenax, B.stearothermophilus, pada Taq; Asp 830, Glu 831 pada Bst; Asp 882,
T.aquaticus, dan E.coli masing-masing adalah Glu 883 pada E.coli ) yang terletak pada motif
99%, 88%, 44%, dan 41%. Dengan analisis C. Residu asam amino tersebut merupakan sisi
yang sama diperoleh letak domain yang aktif enzim yang terletak pada subdomain
1 2 3 4 1 3
23.130
23.130 9.416
9.416 6.557
6.557 4.361
4.361 2.322
2.322 2.027
2.027
Gambar 2. Elektroforegram hasil PCR. (a). DNA λ/Hind III, (1); hasil PCR 1 (±200 bp), (2); hasil PCR
2 (± 2630 bp), (3); Templat/pITB9 (± 6230 bp), (4) (Ambarsari et al., 2004). (b). DNA λ/Hind III, (1);
hasil PCR 2 (± 2630 bp), (3)
Urutan Nukleotida
Vektor GGGAGCGCCGCTGACATTATTAAAAAGGCGATGAT
kloning ************ **********************
GGGAGCGCNGCTAACATTATTAAAAAGGCGATGAT
Vektor GGGAGCGCCGCTGACATTATTAAAAAGGCGATGAT
ekspresi ************ **********************
GGGAGCGCNGCTAACATTATTAAAAAGGCGATGAT
palm. Residu asam-asam amino lain yang juga dengan ukuran sekitar 2600 bp yang
lestari terlihat pada beberapa daerah lainnya merupakan gen mutan D802N, dan hal yang
(Gambar 1). sama dilakukan terhadap mutan E831Q.
Amplikon PCR pertama dan kedua dapat
Konstruksi Mutan D802N dan E831Q
dilihat pada Gambar 2a dan 2b.
Residu asam amino yang dimutasi merupakan
residu yang lestari, yaitu Asp802 pada motif 6 Fragmen DNA mutan D802N yang telah
dan Glu831 pada motif 5 (C), dan informasi dikonstruksi, diklon ke dalam vektor kloning
residu tersebut masih belum diungkapkan. Pada pGEM-T kemudian dilakukan subklon ke
penelitian ini Aspartat dimutasi menjadi dalam vektor ekspresi pTrxFus. Sedangkan
Asparagin (D802N) dan Glutamat menjadi mutan E831Q diklon langsung ke dalam vektor
Glutamin (E831Q) dengan mengganti gugus - ekspresi pTrxFus. Untuk mendapatkan klon
CO2 menjadi –CONH2, penggantian ini tidak transforman yang membawa DNA plasmid
mengubah struktur (isosterik). Mutan D802N rekombinan (yang telah termutasi), maka
dikonstruksi dengan metode PCR megaprimer dilakukan karakterisasi, yaitu memotong DNA
dan gen mutan diperoleh setelah melalui dua plasmid tersebut dengan beberapa enzim
tahap proses PCR. Tahap pertama PCR restriksi. Gambar 3 menunjukkan hasil
menghasilkan amplikon dengan ukuran sekitar pemotongan DNA plasmid rekombinan untuk
1 2 3 4 5 6
23.130
9.416
6.557
4.361
2.322
2.027
Gambar 3 Elektroforegram hasil analisis restriksi plasmid pGEM-T rekombinan mutan D802N. 1,
DNA λ/HindIII, 2.DNA plasmid uncut, 3. DNA plasmid/EcoRI (± 4973 bp dan ± 627 bp), 4. DNA
plasmid/KpnI (± 5600 bp), 5. DNA plasmid/BamHI (± 5600 bp), 6. DNA plasmid/KpnI dan BamHI
(± 3000 bp dan ± 2600 bp) (Ambarsari et al., 2004).
1 2 3 4 5 6
23.130
9.416
6.557
4.361
2.322
2.027
Gambar 4. Elektroforegram hasil analisis restriksi plasmid pTrxFus rekombinan mutan E831Q. 1.
DNAλ/HindIII 2. DNA plasmid/KpnI (± 6200 bp) 3. DNA plasmid/BamHI (± 6200 bp) 4. DNA
plasmid PstI (± 5000 dan 1000 bp) 5. DNA palsmid/HindIII (± 3000, 2000 dan 500 bp) 6. DNA
plasmid uncut
200 bp (yang disebut sebagai megaprimer) mutan D802N. Hasil pemotongan baik dengan
dan tahap kedua PCR diperoleh amplikon BamHI maupun KpnI diperoleh 1 pita DNA
1 2 3 4 5 6 7
220 kDa
97 kDa
66 kDa
45 kDa
30 kDa
20 kDa
Mutan D802N
Gambar 5. Elektroforegram SDS-PAGE hasil ekspresi tinggi DNA polimerase mutan. 1. marker
protein; 2, 5, 6. DNA polimerase wild-type, 3 dan 4. DNA polimerase mutan; 7. pTrx (Tioredoksin).
dengan ukuran 5600 bp, pemotongan dengan pol I atau famili A. Selain aktivitas polimerase
EcoRI dihasilkan 2 pita DNA dengan ukuran juga ditemukan adanya aktivitas eksonuklease
masing-masing sekitar 4973 bp dan 627 bp, dan 5`-3 dan eksonuklease 3`-5. Sisi aktif enzim
pemotongan dengan (BamHI, KpnI) dihasilkan ditunjukkan dengan adanya residu asam amino
2 pita DNA dengan ukuran sekitar 3000 bp dan yang mengandung gugus karboksilat yang
2600 bp. Tabel 1 menunjukkan hasil analisis terletak pada motif A (Asp 653 ) dan motif C
melalui penentuan urutan nukleotida. (Asp 830, Glu 831).
Gambar 4 menunjukkan hasil pemotongan Mutan D802N dan E831Q telah berhasil
DNA plasmid rekombinan untuk mutan dikonstruksi dan diekspresi secara heterolog di
E831Q. Hasil pemotongan dengan BamHI E.coli GI724 dan berat molekul protein fusi
maupun KpnI diperoleh 1 pita DNA dengan hasil ekspresi diperoleh sekitar 112 kDa.
ukuran 6200 bp, pemotongan dengan PstI
5. Daftar Pustaka
dihasilkan 2 pita DNA dengan ukuran masing- Adams M.W.W., Kelly R.M., (1998), Finding and
masing sekitar 5000 bp dan 1000 bp, Using Hyperthermophilic Enzymes. Tibtech., 16,
pemotongan dengan HindIII KpnI) dihasilkan 2 hal. 329 –332.
pita DNA dengan ukuran sekitar 3000 bp dan
Akhmaloka, Pramono H., Tika I.N., Suharto A.,
2600 bp.
Retnoningrum D.S., Sindumarta M., Padmawinata
Overekspresi Mutan D802N dan E831Q K., dan Oei B.L., (2000b). Eksplorasi potensi
Untuk mengetahui ekspresi mutan D802N dan bakteri termofilik isolat lokal: Studi kasus DNA
E831Q, maka plasmid rekombinan ke dua polimerase termostabil, Prosiding Seminar Hasil
mutan tersebut digunakan untuk Penelitian dan Pengembangan Bioteknologi III,
Cibinong 7-9 Maret 2000: 31-39
mentransformasi sel E.coli GI724. Protein
mutan akan terekspresi setelah diinduksi Ambarsari L., Pramono H., Madayanti F., Moeis
dengan triptofan yang dapat diamati dengan M.R., Akhmaloka, (2004). Konstruksi dan
terlihatnya pita tebal pada elektroforegram Overekspresi Gen Penyandi DNA Polimerase I
SDS-PAGE. Berat molekul protein yang Mutan dari Bakteri Termofil Isolat Lokal, Hayati,
11 (3), hal. 115-120.
diperoleh sekitar 112 kDa yang merupakan
fusi antara protein mutan dengan tioredoksin Barik S., (1997). Mutagenesis and Gene Fusion by
yang berukuran sekitar 12 kDa (Gambar 5). Megaprimer PCR. Di dalam: White B.A., (ed).,
PCR Cloning Protocols, Humana Press Inc, New
4. Kesimpulan jersey, hal. 173-182.
Hasil analisis homologi menunjukkan bahwa
urutan asam amino pada gen penyandi DNA Blondal T., Thorbjarnardottir S. H., Kielleczawa J.,
Hjorleifsdottir S., Kristjansson J.K., Enarsson J.M.,
polimerase termasuk di dalam kelompok DNA and Eggertsson G., (2001), Cloning, sequence
analysis and functional characterization of DNA Patel P.H., Loeb L.A., (2000). DNA Polymerase
polymerase I from the thermophilic eubacterium Active Sites is Highly Mutable: Evolutionary
Rhodothermus marinus, Biotechnol. Appl. Biochem., Consequences, Proc. Natl. Acad. Sci., USA., 97,
34, hal. 37-45 hal. 5095 – 5100.
Choi J.J., Jung S.E., Kim H., Kwon S., (1999). Patel P.H., Suzuki M., Adman E., Shinkai A., Loeb
Purification and Properties of Thermus filiformis L.A., (2001), Prokaryotic DNA Polymerase I:
DNA Polymerase Expressed in Escherichia coli, Evolution, Structure, and “Base Flipping”
Biotechnol. Appl. Biochem., 30, hal. 19 – 25. Mechanism for Nucleotide Selection, J. Mol.Biol.,
308, hal. 23-837.
Joyce C.M., Steitz T.A., (1994). Function And
Structure Relationships In DNA Polymerases, Annu. Pramono H. (2004). Kloning dan Ekspresi di
Rev. Biochem., 63, hal. 773 – 822. Escherichia coli Gen DNA Polimerase I Bakteri
Termofilik Isolat Cimanggu. Disertasi Doktor,
Kiefer J.R., Mao C., Hansen C.J., Basehore S.L.,
Departemen Kimia, Institut Teknologi Bandung.
Hogrefe H.H., Braman J.C., Beese L.S., (1997).
Crystal Structure of a Thermostable Bacillus DNA Sambrook J., Russell D.W., (2001), Molecular
Polymerase I Large Fragment at 2.1 Ao Resolution, Cloning: A Laboratory Manual, Ed., ke-3, Cold
Structure, 5, hal. 95-108. Spring Harbor Laboratory Press, New York.
Li Y., Korolev S., Waksman G., (1998). Crystal Uemori T., Ishino Y., Doi H., and Kato I., (1995),
structures of open and closed forms of binary and The hyperthermophilic archaeon Pyrodictium
ternary complexes of the large fragment of Thermus occultum has two alpha-like DNA polymerases, J.
aquaticus DNA polymerase I: structural basis for Bacteriol., 177(8), hal. 2164-2177
nucleotide incorporation, The EMBO Journal, 17
(24), hal. 7514-7525.
Abstract
In the program for the research of bioactive compounds from Indonesian rain forest plants
water-and organic-soluble extracts of the twigs of Taxus sumatrana (Miquel) de Laubenfels
have been evaluated for their α-glucosidase inhibitor activity. The ethanol- and ethyl acetate-
soluable extracts showed significant activity (IC50 ±15 µg/ml). From phytochemical
preliminary evaluation, it was suggested that the active compounds were probably either
flavonoids or taxane diterpenoids. Further isolation work using high performance liquid
chromatography, a known anticancer paclitaxel has been isolated, as one of the active
compounds.
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154,Proceeding of Joint Seminar on ChemistryE-mail
Homepage : http://www.chem.itb.ac.id/jschem, ITB-UKM VI 2005
: jschem@chem.itb.ac.id
Laily B. Din, Mohd Wahid Samsudin, Zuriati Zakaria, Ikram M. Said & A. Latiff
Laily B. Din, Mohd Wahid Samsudin, Zuriati Zakaria, Ikram M. Said & A. Latiff
Abstrak
Penyelidikan taburan dan fitokimia liken dan tumbuhan berbunga telah dijalankan di
Universiti Kebangsaan Malaysia sejak daripada tahun 1980an. Banyak data telah berjaya di
jana hasil daripada aktiviti penyelidikan ini. Dalam makalah ini sejarah, perkembangan
serta kemajuan penyelidikan mengenai liken dan tumbuhan berbunga akan di bentangkan.
Me
Me O Me Me OHOH
Me
O
OH Me Me
Me
HO OH COOMe
CHO Me Me Me
Atranorin Zeorin
OMe
MeO
NMe
MeO
O
N-Metil-2,3,4-trimetoksimorfinandien-7-on
O O
O
Goniotalamin
oksida
HOOC
OH
O O
Goniotalamin
Asid sinamik O O
Dihidroksigoniotalamin
OH
O
OCOCH3
OH O
O
O O OH
O O Goniofufuron
Asetilgoniotalamin
Hidroksigoniotalamin
O O
Dehidrogoniotalamin
O OH
OH
OH
O O
OH O O
O O O
OMe OMe O
O O
HO MeO O
MeO
NH NH NH
MeO MeO
MeO
batang Goniothalamus tomentosus (Saunders Kajian kimia ke atas daun Gelsemium elegans
2003) yang dikutip di Hutan Simpan Sungai (Loganiaceae) yang dikutip di kawasan hutan
Jelok, Kajang, iaitu satu spesies baru dari Dataran Kelabit Bario, Sarawak telah
Malaysia yang telah diperihalkan telah menghasilkan empat alkaloid indola, 19-(Z)-
menghasilkan dua alakaloid iaitu aristololaktam akuammidina, 14-hidroksigelsenisina ,
BII, Goniopedalina dan ouregidion. Sebatian gelsenisina dan gelsemina (Yusof et al. 2005).
aristololaktam BII telah dipencilkan terdahulu Tumbuhan ini adalah dari jenis yang memanjat
daripada G. velutinus yang dikutip di Sabah dan menurut penduduk tempatan tumbuahn ini
(Omar et al. 1992). amat beracun dan boleh menyebabkan
kematian jika termakan.
O OH
MeO C
O
CH2OH
N N
N
N O
H
Me OCH3
19-(Z)-Akuammidina 14-Hidroksigelsenisina
Zeorin
O O
Zeorin
NCH3
N
N O N O
OCH3 H
Gelsinisina Gelsimina
Khozirah Shaari et al. (eds.), Medicinal products one, the major alkaloid from Alseodaphne
from tropical rain forests: Proceedings of the perakensis. Pertanika 12(3):421-424.
conference. FRIM, Kuala Lumpur. 44-51.
Mat-Salleh, K. 2001. New and noteworthy species
Elix, J.A., Din, L.B. & Samsudin, M.W. 1991. New of Bornean Goniothalamus (Annonaceae). Folia
species of Ramalina (lichenized ascomycotina) from Malaysiana 2(2): 75-116.
Australia and Malaysia. Mycotaxon. XL:41-44.
Omar, S., Chee, C.L., Ahmad, F., Niu, J.X., Jaber,
Elix, J.A., Din, L.B. & Ismail, G. 1997. New species H., Huang, J. & Nakatsu, T. 1992. Phenanthrene
and combinations in the lichen genus Parmotrema ( lactams from Goniothalamus velutinus.
Asscomycotina, Parmeliaceace) from Malaysia and Phytochemistry 31: 4395-4397.
Papua New Guinea. Mycotaxon. LXII: 341-347.
Saunders, R.M.K. 2003. A synopsis of
Galloway, J.G., Din, L.B. & Latiff, A. 1997. An Goniothalamus species (Annonaceae) in Peninsular
additional bibliography of Malaysian lichenology. Malaysia, with a description of a new species.
Malaysian Applied Biology 26: 93-99 Botanical Journal of the Linnean Society 142: 321-
339.
Galloway, J.G., Samsudin, M.W. & Latiff, A. 1994.
A bibliography of Malaysian lichenology. Sam, T.W. 1979. Malaysian lichen flora:
Malaysian Applied Biology 22: 215-221. Chemotaxonomy identification of Lepraria
candelaris. Malayan Nature Journal 33: 113-114.
Yusof, H., Din, L.B., Zakaria, Z. & Mat-Salleh, K.
2004. The chemical constituents of the stem bark Sammy, N. 1975. An annonated list of lichens from
and roots of Goniothalamus tomentosus. Sains Penang. Malay. Nat. J. 28: 214-216.
Malaysiana 23: 67-73.
Zakaria, Z., Din, L.B., Ahmad, F.B., San, C.H. &
Lajis, N.H. & Din, L.B. 1985. Report on the Mat-Salleh, K. 2002. Styrylpyrone derivatives from
phytochemical survey conducted at the Krau Game Goniothalamus kinabaluensis (Annonaceae).
Reserve, Lancang, Temerloh, Pahang. In Lajis, N.H. ACGC Chemical Research Communications, 15:
et al. (eds.), Aspects of Natural Product Chemistry: 72-77.
Thephytochemical survey, proceedings of a
Zakaria, Z., Din, L.B., Latiff, A. & Elix, J.A. 2000.
workshop. UPM, Serdang. 20-31
Notes on the morphology and chemical constituents
Lajis, N.L., Mahmud, Z., Din, L.B.& Toia, R.F of lichens, Cladia aggregata (Sw.) Nyl. In
1989. N-methyl-2,3,6-trimtehoxymorphinandien-7- Peninsular Malaysia. Malayan Nature Journal
54(1): 27-30.
Lee Yook Heng 1), Elizabeth A. H. Hall2), Alan Tunnacliffe2), Musa Ahmad*
1)
School of Chemical Sciences & Food Technology
Faculty Science & Technology, Universiti Kebangsaan Malaysia,
43600 Bangi, Selangor, Malaysia
*Corresponding author: yhl1000@pkrisc.cc.ukm.my
2)
Institute of Biotechnology, University of Cambridge, CB2 1QT, England, UK.
Abstract
An understanding of the chemical content of cells can give information regarding cell
physiology and biochemistry, which have important implication to medical and biomedical
research. However, most conventional analytical techniques cause perturbation of the cells
and alter biochemical processes at cellular level. Therefore they are not suitable for chemical
analysis at cellular environment. In this paper, we described the design, synthesis and
characterization of micro- and nanospheres impregnated with sensing agent for the detection
of ions at cellular level. These nanosensors are capable of detection pH changes in the body
of microorganism such as rotifer.
and chromoionophores) are also discussed. and fluorescent behaviour of the nanospheres in
Preliminary application of the optical response to changes in pH and potassium ion
nanosensors to the microorganism rotifer was were recorded using both optical and
demonstrated. fluorescence microscopes.
2. Experimental Application of micro- and nanospheres to
Synthesis of acrylic nanospheres study rotifer organisms
Acrylic micro- and nanospheres were Two different species of rotifer organisms were
synthesized by a photopolymerisation transferred to a multi-well microplate and
procedure using a mixture of n-butyl acrylate acclimatized for 4 hours in the plate. 100 µL of
(nBA), cross-linker hexanedioldiacrylate nanosphere suspension was added to each well.
(HDDA) and AIBN initiator in polyethylene The experiment was performed in triplicates.
glycol (PEG) solution. The mixture is first For comparison purpose, green fluorescent
degassed with nitrogen followed by sonication microspheres was also used in the rotifer
before exposure to UV radiation in a RS UV exeperiment. Blank experiments (rotifer
exposure unit. The amount of nBA, HDDA, without addition of micro- or nanospheres)
AIBN and PEG was varied and its effect on the were also included. The ingestion of micro- and
properties of the micro- and nanosphere was nanospheres by the rotifers was viewed under
studied. The product from photopolymerisation both optical and fluorescent microscopes.
was purified by filtration and rinsed with THF
Fluorescent spectrophotometric studies of
several times. The volume of the milky filtrate,
which contained the micro- and nanosphers acrylic nanosensors
Acrylic microspheres were immobilized with
was reduced by a rota-evaporator.
chromoionophore I and a lipophilic anion to
A solution of of chromoionophore, potassium construct pH sensitive nanosensors. For
tetrakis(fluorophenyl) borate (KTFPB) in THF potassium ion-selective nanosensors, the
was prepared and used for introducing the microspheres were also immobilized with
sensor materials by absorption into the valinomycin apart from chromoionophore I and
nanospheres. For sensor used for potassium ion the lipophilic anion. A fixed amount of
detection, valinomycin antibiotic was also microsphere suspension was dispensed into a
added to the THF solution. The THF was 96 well-plate and place in a fluorescent
removed completely by evaporation with a spectrophotometer (Cary). The samples were
rota-evaporator. The dry residue was then re- then illuminated under an excitation
suspended again in water and finally filtered wavelength of 560 nm and the emission of each
through a nylon membrane to remove flakes of sample in individual well was scanned from
chromoionophore I. The final suspension is a 570 – 800 nm. The slits used were 10-20 nm
blue coloured colloidal solution. while the detector voltage (PM tube) was from
Characterisation of nano-spheres with 800-1000 V.
optical/fluorescent microscopies For the pH sensitive nanosensor, the spectra
The size of the acrylic micro- and nano-spheres were recorded for pH =1 to 13 and for
was estimated by optical and fluorescent potassium ion-selective nanosensor, spectra
microscopies. The optical microscope (Leia were taken at 0 M KCl (TrisHCl, pH 7) and at
DMIRB) was equipped with a Nikon camera 1 M KCl (TrisHCl, pH 7). To examine the
and a video TV to record images of the spheres. selectivity of the potassium ion-selective
The magnification used was from 200 – 400X. nanosensor, 1 M NaCl was used as an
The fluorescence microscope (Nikon) was used interference ions and the spectra of the
with an excitation wavelength of 510-560 nm response to Na ion were also recorded. For the
(G2A) and magnification from 250-600 X. For potassium nanosensor, the experiments were
estimating the size of spheres greater than 5 performed in triplicates.
µm, a comparison with Sephadex beads of size
3. Results and Discussions
40-120 µm was carried out whilst for those Optimisation of microsphere synthesis
with size < 5 µm, green fluorescent process
microspheres of size 3 µm were used for There are several factors that affect the yield,
comparison purpose. The changes in colour size distribution and aggregate formation of the
(a) (b)
Figure 1 (a). A comparison of the size of the acrylic microspheres (red) with that of Sphadex beads
(colourless spheres) of average size 80 µm in diameter (200X magnificcation). (b). Size comparison of
acrylic microspheres after filtration through a 5 µm membrane with that of commercial available green
fluorescent microspheres (standard size of 3 µm in diameter). The white/black spheres are acrylic
microspheres. (~ 400X magnification, fluorescence excitation: 410-460 nm for green microspheres)
(a) (b)
Figure 2. The changes of the red colour of microspheres (base form, not filter) to blue (acid form) after
exposure to 1 M of HCl. (a) 0 min, and (b) 30 min. (magnification 100-200X).
In contrast to the large microspheres, the smaller size microspheres, i.e. < 3 µm can response quickly to
changes in acid-base condition
Figure 3. The fluorescent behaviour of microspheres (<5 m size and containing chromoionophore) in the
base form after exposure of the acid form to 1 M NaOH for 10 mins. (Ex. 510-560 nm, magnification
600X)
Figure 5. The emission spectra of potassium ion-selective nanosensors before (B) and after (K) exposure
to 1 M KCl at pH =7
(a) (b)
Figure 6. Feeding of rotifer with acrylic nanospheres: (a) Rotifer under acclimatized condition, no nano
size spheres was fed. (b) Rotifer after fed with nano-spheres for several hours. More bluish-green spheres
are found inside the guts of the organisms (Magnification: 200-300X)
(a) (b)
Figure 7. The fluorescent images of a rotifer that contain acrylic nanospheres: (a) In optical microscope,
(b) under fluorescent irradiation of 510-560 nm (Magnification: 200X)
potassium ion penetrates into the shperes. and this indicated the acrylic fluorescent
Exposure to KCl leads to a rapid shift (< 1 min) nanospheres are non-toxic and suitable to be
of the emission maxima from 700 nm to 650 used in a living system.
nm (Figure 5). This is in agreement with the
4. Conclusion
deprotonation of the chromoionophore when
The synthesis of acrylic
valinomycin selectively complexed the
microspheres/nanospheres based on cross-
potassium ions and extracted the ions into the
linked nBA matrix using photopolymerisation
acrylic spheres. However, when the
was successful. The conditions for synthesis of
nanosensors were exposed to NaCl under the
microspheres to yield size of < 5 µm in
same condition, there was no obvious shift in
diameter and non-tacky spheres have been
the emission spectra even after 10 min. But
produced. Fluorescent spectrophotometry
when KCl was added, a shift to 650 nm was
studies have demonstrated that the acrylic
again observed. This confirmed that the acrylic
nanosensors can be used as pH and potassium
nanosensor is selective to potassium ion only
ion-selective sensing in micro-environment.
but not sodium ion.
The nanosensors gave rapid response and
The emission maxima obtained here appears to showed good selectivity. By increasing the
be different. It has been reported that with amount of micro- or nanospheres, a more
excitation at 565 nm, emission peaks for sensitive nanosensor can be obtained. Optical
protonated form were observed at 615 and 683 and fluorescence microscopies demonstrated
nm and for deprotonated form at 643 and 725 that these micro- or nanospheres can be used as
nm. The emission peaks obtained for the nanosensors for the studying micro-organisms
acrylic nanospheres are 650 nm (deprotonated), directly.
700 nm (protonated) and a small shoulder at
about 740 nm. 5. Acknowledgement
We thank the Royal Society, UK for a
Response of nanospheres in rotifer feeding awarding a fellowship to enable this work to be
experiments carried out at Cambridge University. We also
Acrylic nanospheres containing immobilized like to show our appreciation to the Universiti
chromoionophore were fed to two species of Kebangsaan Malaysia for granting a sabbatical
rotifers. Both species of rotifers ingested the leave to Lee Yook Heng to visit Cambridge,
nanospheres within minutes after being fed. UK.
The nanospheres were clearly seen in the gut of
6. References
the organisms. Under the optical microscope, a
Dubertret B, Skourides P, Norris DJ, Noireaux V,
small amount of nanospheres was retained in Brivanlou AH, Libchaber A. In vivo imaging of
the gut of the organisms, mostly near the jaw of quantum dots encapsulated in phospholipid
the animal immediately after exposure to the micelles. Science, 298, 1759-1762.
nanospheres. But the gut was soon filled up
Lee Y. H, Toth K, Hall E. A. H.. 2004. Ion-transport
after several hours of exposure (Figure 6b).
and diffusion coefficients of non-plasticised
While in the gut of the rotifer, the colour of the methacrylic-acrylic ion-selective membranes.
nanospheres turned to an intense blue colour. Talanta, 63, 73-87.
This may indicate that the gut of the animal is
acidic and is the first time that the gut of the Lee Y. H., Teh H. F., Loh H. C, Musa. A. 2003.
Influence of methacrylic-acrylic copolymer
micro-organism is observed to be acidic.
composition on plasticiser-free optode films for pH
The acidic nature of the gut can be confirmed sensros, Sensors, 3, 83-89.
by viewing the organisms under a fluorescence Lee Y. H, Hall E. A. H. 2000: Producing " Self-
microscope. Using excitation of 510-550 nm, a Plasticizing" Ion-Selective Membranes. American
weak fluorescence was observed (Figures 7). Chemical Society Publ., Anal. Chem. 72, 42-51.
For a complete acid form, fluorescence should
Lee Lee Y. H, Hall E. A. H., 2000: Methacrylic-
not be observed. The very weak fluorescence acrylic polymers in ion-selective membranes :
could only be observed under long exposure achieving the right polymer recipe, Elsevier Science
time of 4 seconds and it indicated that the base Publ., Analytica Chimica Acta 403, 77-89.
form still present in small quantities. Therefore,
the gut of the animal is not extremely acidic. Lee Y. H, Hall E. A. H., 1996: Methacrylate-
acrylate based polymers of low plasticiser content
The organisms remain active even after a day
for potassium ion-selective membranes. Elsevier Low S. B., Lee Y. H.,. Bohari M. Y., Musa A..
Science Publ. Analytica Chimica Acta, 324, 47-56. 2004Photocurable ferrocene-containing pHEMA
films for mediated amperometric biosensor. Thin
Lee Y. H, Hall E. A. H.. 2000. Taking the plasticiser
Solid Films (In press).
out of methacrylic-acrylic membranes for K+-
selective electrodes. Electroanalysis , 12, 3, 187- Parak, W.J., Boudreau, R, Le Grod M, Gerion D,
193. Zanchet D, Micheel CM, William SC, Alivisatos
AP, Larabell, C. 2002. Cell motility and metastatic
Lee Y. H, Hall E. A. H.. 2000. One-step synthesis of
potential studies based on quantum dot imaging of
K+-selective methacrylic-acrylic copolymers
phagokinetic tracks. Adv. Mater, 14, 882-885.
containing grafted ionophore and requiring no
plasticiser. Electroanalysis, 12, 3, 178-186. Sharron G. P., Lin H., Michael J. N. 2003.
Nanoparticles for bioanalysis. Current Opinion in
Lee Y. H., Loh H. C., Musa. A. 2003. Biosensor
Chemical Biology, 7, 609-615.
potentiometrik untuk penentuan urea dan ketoksikan
logam berat. J. Sains Malaysiana, 32, 43-51.
Abstrak
Artocarpus merupakan salah satu genus tumbuhan dari famili Moraceae. Keanekaragaman
yang tinggi dari tumbuhan ini ada di Indonesia, Malaysia dan Filipina. Genus ini diketahui
mengandung senyawa jenis flavonoid, arilbenzofuran dan Diels – Alder adduk. Studi kimia
terhadap beberapa spesies Artocarpus yang tumbuh di Indonesia memperlihatkan bahwa
genus ini memiliki kandungan senyawa jenis flavonoid yang unik. Beberapa senyawa
flavonoid tersebut memiliki pula sifat sitotoksik yang tinggi terhadap sel murine leukemia
P388 sehingga tumbuhan Artocarpus dapat berpotensi sebagai sumber senyawa-senyawa
yang bersifat anti tumor.
Kata kunci: Artocarpus, Moraceae, sel murine leukemia P388
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem,
th E-mail : jschem@chem.itb.ac.id
534 Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Lia Dewi Juliawaty, Euis Holisotan Hakim, Yana Maolana Syah,
Sjamsul Arifin Achmad dan Lukman Makmur
langka yang endemik untuk Indonesia, dan spesies ini dan mempunyai aktivitas sitotoksik
mempunyai nama daerah ‘keledang’. yang tinggi dengan nilai IC50 5,1 µg/mL.
2. Percobaan HO OH
Tumbuhan A. altilis diperoleh dari Kabupaten 2'
B 4'
HO O
HO OH A 2'
2'
B
4'
3
O
O O
OH OH O
A
3 10
OH O
(6)
(4) OH
B 4'
HO O
2’,4’-Dioksigenasi piranoflavon A 2'
3
O
Selain itu, senyawa jenis piranoflavon yang
mempunyai sistem 2’,4’-dioksigenasi pada OH O
cincin B yaitu albanin A (5) telah diisolasi dari
A. champeden dan siklokomunin (6) yang
diperoleh dari A.champeden serta A. altilis (7)
(Achmad, 2005 ; Hakim, 2005). Senyawa 5 Selanjutnya, dari kayu batang A. altilis
memperlihatkan sitotoksisitas yang tinggi ditemukan senyawa kudraflavon A (8) dan
dengan nilai IC50 2.3 µg/mL, sedangkan senyawa artelaskromen (9) dari kayu batang A.
senyawa 6 memberikan nilai IC50 4,2 µg/mL lanceifolius (Ersam, 2000 ; Hakim, 2005) yang
Satu senyawa aktif lain yaitu artelastin (7) yang merupakan 2’,4’-dioksigenasi piranoflavon
dipisahkan dari A. lanceifolius memberikan yang keduanya memiliki gugus 2,2-dimetil
nilai IC50 5,8 µg/mL. kromen yang terbentuk antara gugus hidroksi
HO OH pada C-8 dan gugus isoprenil pada C-7.
2' 4' Senyawa 8 memperlihatkan aktivitas yang
B
HO O cukup tinggi dengan nilai IC50 4.98 µg/mL,
A sedangkan 7 hanya mempunyai aktivitas
3 sedang (moderate) terhadap sel P388 dengan
OH O
nilai IC50 13,5 µg/mL. Adanya penurunan nilai
IC50 dapat disarankan karena pada 9 terdapat
gugus isoprenil bebas yang tersubstitusi pada
(5) C-8.
OH OH
4'
B
O O
2' H3CO O
A
O A O
3
OH O O OH
OH
(8) (11)
OH
OH
4' H3CO O
B
O O A O
2'
A OOH
O OH O
3
OH O
(12)
(9) Dihidrofuran
2’,4’,5’-Trioksigenasi piranoflavon Senyawa baru jenis dihidrofuran diisolasi dari
A. lanceifolius, yaitu artoindonesianin G (13),
Kulit batang A. champeden ternyata juga H (14) dan I (15) (Syah, 2001). Ketiganya pula
mengandung sikloheterofilin (10) yaitu memberikan sitotoksisitas yang tinggi dengan
senyawa jenis piranoflavon lain yang memiliki nilai IC50 berturut-turut adalah 0,7 ; 1,8 dan 1,8
gugus hidroksi pada C-2’, C-4’ dan C- µg/mL. Dapat disarankan bahwa keaktivan
5’(Achmad, 2005 ; Hakim, 2005). Senyawa 10 tersebut karena adanya cincin dihidrofuran
memberikan nilai IC50 23,6 µg/mL. yang terbentuk gugus hidroksi pada C-7 dengan
isoprenil pada C-6 atau C-8.
OH
OH
B
4' HO OH
O O B
O O
A
O A
3
OH O
OH O
(10) (13)
HO OH
Oksepinoflavon B
O O
Senyawa jenis oksepinoflavon yang diisolasi A
dari A. champeden yaitu caplasin (11) dan
senyawa baru artoindonesianin B (12) yang
OH O
diperoleh dari A. champeden dan A. altilis.
Keduanya memberikan aktivitas yang tinggi
dengan nilai IC50 2,0 dan 1,9 µg/mg (Ersam, (14)
2000 ; Achmad, 2005 ; Hakim, 2005), hal
tersebut dapat disebabkan karena pada kedua
senyawa mempunyai cincin oksepin, yang
terbentuk antara gugus hidroksi pada C-2’ dan
isoprenil pada C-3’.
from the heartwood of Artocarpus chempeden Fruits and Nuts, Prosea Foundation, Bogor,
Spreng (Moraceae), Fitoterapia, 75,134-140 Indonesia, 50-71.
Verheij, E.W., and Coronel, R. E. (Eds.), (1992),
Plant Resources of South-East Asia, Vol. 2.., Edible
Abstract
New perovskite LixLa(1-x)/3NbO3 were synthesized by solid-state reaction. The crystal symmetry
changed from orthorhombic to tetragonal and then to cubic with increasing of Li composition
in LixLa(1-x)/3NbO3 as was observed in the XRD pattern. Powder XRD pattern of the samples x
= 0 were indexed in an orthorhombic system, x = 0.1 the crystal structure changes to the
tetragonal system, and then all the lattice parameters a, b, c become equal at the composition
x = 0.25. The lattice parameter contracts during lithium insertion due to the reducing of Nb-O
interatomic distance.
Keywords: perovskite, LixLa(1-x)/3NbO3, XRD, crystal-structure
1. Introduction interaction.iv
Lithium niobate has been an attractive material
Iymer and Smith first described the crystal
for integrated optics because of its excellent
structure of pristine La1/3NbO3.v La ions and
electro-optical, acousto-optical and nonlinear
vacancies at A-sites are ordered within alternate
optical properties. Rare earth doped materials
(001) planes doubling the c-parameter of the
have received a renewed attention because of
cubic perovskite-type cell and leading to a
the availability of a broad range of its use (such
slightly distorted orthorhombic lattice with
as fuel cells, gas sensors, batteries, and random
parameters a~ap, b~bp, c~2ap (p refers to the
access memory materials).i ii
cubic-perovskite unit cell) as we had reported.6
Investigation of the relationship between
In this article, the structural transformation in
structure and property is an important research
LixLa(1-x)/3NbO3 perovskites were reported.
field. From a structural point of view, if there is
a two-dimensional channel or three- 2. Experimental
dimensional tunnel in the structure of a Different compositions of the LixLa(1-x)/3NbO3
compound, then a rich diversity of uses can be (x = 0, 0.1, 0.25) solid solution were prepared
obtain. by conventional solid-state reaction. The
mixture of stoichiometric amounts of Li2CO3
Lithium intercalation in A-site-deficient
(99.9%, Sigma-Aldrich), La2O3 (99.9%, Sigma-
perovskite type oxide, La1/3NbO3 were
Aldrich), and Nb2O3 (99.9%, Sigma-Aldrich)
considered for use as electrode material for the
was heated at 800oC for 24 hours. After that,
lithium ion battery.iii Nakayama et al have
the calcined powder was ground and heated at
recently investigated the electrochemical
900oC for 24 hours. These processes were
behavior associated with Li insertion into the
repeated at higher temperatures (1000oC,
solid solution LiyLa(1-y)/3NbO3 and concluded
1100oC and 1200oC) for 24 hours each time.
that the cell potential was strongly dependent
on the arrangement of La3+ ions and Coulombic X-ray diffraction was employed to characterize
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
a
3,950 b
c/2
3,945
3,940
Orthorhombic
3,935
3,925
Tetragonal
3,920
3,915
Cubic
3,910
3,905
3,900
3,895
3,890
25
-2
Spontaneous Polarization µC/cm
20
15
10
center of unit cell. There are two or three A-site lanthanum insertion, the niobium-oxygen
vacancies exist in the structure. The ordering distance is decreasing which leading cell
arrangement of vacancies provides a two- parameter contraction.
dimensional channel for lithium insertion ad
4. Conclusion
extraction.2 That’s why, this material was
Cell parameters of LixLa(1-x)/3NbO3 (x = 0, 0.1,
considered for use as electrode material for the
0.25) perovskites change from orthorhombic
lithium ion battery. Spontaneous polarization of
(Pmmm) to tetragonal (P4/mmm) and then to
this compound was calculated as 25 µC/cm2.
cubic (Pm-3m) with increasing the composition
In second case, Li0.1La0.3NbO3 has tetragonal x, which drive down its ferroelectric properties.
perovskite structure with rearrangement of host The spontaneous polarization (Ps) for x = 0;
lattice framework from Pmmm to P4/mmm. The 0.1; 0.25 are 25 µC/cm2, 16.2 µC/cm2 and 0
parameter cell was calculated as a = b = µC/cm2 which mean the material lose its
3.915(1) Å, c = 7.89(1) Å. The NbO6 ferroelectric properties at the composition x =
octahedral lies in the center of unit cell, La3+ 0.25.
ions locate at the corner of it, and while Li+
ions occupy the vacancies between La3+ ions.
Lithium ions are small enough to insert in that 5. References
site, which make the structure more compact. 1. Nakayama, M., Imaki, K., Ikuta, H.,
The more symmetric of this structure give Uchimoto, Y., Wakihara, M.; J. Mater.
smaller spontaneous polarization, 16.2 µC/cm2. Chem 12, 2002, 1500.
It is because Li+ ion surrounding stabilizes 2. Nakayama, M., Imaki, K., Ikuta, H.,
NbO6 octahedral. Uchimoto, Y., Wakihara, M., Ra,
Wonkyung; Chem. Mater, 15, 2003, 1728-
The last perovskite, Li0.25La0.25NbO3 has
1733
calculated cell parameter a = b = c = 3.904(6) Å
with cubic symmetry (Pm-3m). Cubic structure 3. Wang, G.X., Yao, P., Bradhurst, D. H Dou
has higher symmetry; therefore dipole moments S.X., Liu, H.K.; Solid State Ionics 124 ,
will be fading away. Hereinafter, 1999, 37-43.
Li0.25La0.25NbO3 has no ferroelectric properties 4. Nakayama, M., Imaki, K., Ikuta, H.,
but paraelectric. Its spontaneous polarization is Uchimoto, Y., Wakihara, M.; J. Phys.Chem.
0 µC/cm2. The spontaneous polarization curve B, 106, 2002, 6437-6441
versus composition x in LixLa(1-x)/3NbO3 shown 5. Iyer P.N.; Smith, A. J. J. Acta Crystallogr.,
in Fig. 2. 23, 1967, 740
The conclusion from Fig.1 is consistent with 6. Purwaningsih, L., Ismunandar; Proceeding
the previous study by Nakayama. Its structural of National Seminar of Indonesian Chemical
changes were triggered by complicated Society, 2003
interatomic distance of its atoms. Through the
Total flows contribution of the Tasik Chini feeder rivers and its significant water
level, Pahang, Malaysia
Muhammad Barzani Gasim, Mohd. Shuhaimi Othman and Tan Choon Chek
Abstract
Tasik Chini is located in the southeast region of Pahang, Malaysia. Humid tropical climate
with two monsoon periods, characterized by bimodal pattern; southwest and northeast
monsoons bring annual rainfall from 1488 to 3071 mm. The lake system lies at 3o15’40"N and
102o45’40" and comprises of 12 open water bodies. The lake area covers 202 ha of open
water (permanently flooded area) and 700 ha of freshwater swamp and swamp forest, which
is temporarily or seasonally inundated by water. However the open water area has expanded
greatly since 1995, due to the increased retention of water after the construction of a barrage
at Chini River. Disturbance of hydrological function was started in late 1995, when the water
has damaging hectare of plants community, and then they cut it down the barrage to about
1.80 m lower in 1998. Chini River, which was the tributary of the Pahang River now become
abandoned, only survived by seven river tributaries, such as Datang River in the Northeast,
Gumum and Kura-Kura Rivers in the East, Perupok River in the west and Melai and two
unnamed Rivers in the South, .The lake is drained by a Chini River, which meanders for 4.8
km before it reaches Pahang River. Total flows of each feeder river was ranged from 0.004 to
0.08 m3/sec or 345 to 7,171 m3/day, while discharge of Chini River to Pahang River was 1.2
m3/sec or 103,680 m3/day and this contribution from five feeder rivers was far below the
target to contribute water to the lake if the barrage being demolished. Some activities such as
illegal logging, oil palm plantation, ecotourism, recreation forest and agriculture were taken
part and consequently increase the sedimentation and that may shorten the living span of the
Tasik Chini in the next future.
Keywords: feeder river, total flows, barrage, inundated, sedimentation
Basin analysis such as morphometric studies Kura-kura and 7) Sg. Perupuk. Basin area of
may ultimately extend to show the influence of the seven feeder rivers are ranged from 0.26 to
basin characteristics on channel cross sections 6.313 km2, Sg. Gumum has the largest sub
and channel attributes. According to Horton basin and Sg. Kura-kura is the smallest. Total
cited by Strahler (1957), stream networks have stream length and length of overland flow for
a distinct fabric, called the drainage the watershed is ranged from 0.08 to 22.93 km,
composition, in which the relationship between Sg. Kura-kura is the shortest and Sg.B &
streams of different magnitude can be Sg.Gumum are the longest. Drainage density
expressed in mathematical terms. and bifurcation ratio ranged from 3.08 to 5.77;
Sg. Datang is the largest Dd while Sg. Perupuk
Strahler (1956) and Verstappen (1983)
is the largest Ro. Total area for the seven sub
described, if drainage density value less than
catchments of the Tasik Chini feeder rivers are
5.00 its consider as coarse texture, common in
27.533 km2 (Table 1).
resistant rock like sandstone or quartzite,
between 5.00 and 13.7 as medium texture, and Characteristics of the Tasik Chini Basin based
between 13.7 to155.3 as fine texture, is on the morphometric variables show that: a)
common in soft rock like clay or hornfels. drainage density shows that surface
Bifurcation ratio (Ro) is defined as the ratio of characteristics of the Tasik Chini basin consist
the number of streams of a given order to the of coarse texture; infiltration rate is more
next higher order (using Strahler order). When dominant than surface runoff; b) scarcity of
the geology is reasonably homogeneous length of overland flow most of the river
throughout a basin, Ro value usually ranges branches in the basin. All these criterions were
from 3.0 to 5.0 (Dale et al., 1978). The length indicated that insufficiency of water supply to
ratio (RL), similar in context to the bifurcation the main river.
ratio, is the ratio of the average length of
Stream flow discharge from each sub basin to
streams of a given order to those of the next
the tasik is relatively low it is ranged from
higher order. The length ratio can be used to
0.018 to 0.083 m3/sec or average at 0.05
determine the average length of streams in an
m3/sec. Daily discharge from each sub basin
unmeasured given order (Lo) and their total
was ranged from 346 to 7,171 m3 or average at
length. A stream segment from Horton’s
4,258 m3/daily Sg. Gumum is the largest sub
method that was refined by Strahler (1952a)
basin as well as largest stream flow in the
becomes the ordered units. Finally, Carlston
basin, and Sg. Kura-kura was the lowest. Total
(1963) introduced the application of the Jacob
stream flow for the basin area (27.533 km2) is
Model in order to relate the connection between
0.345 m3/sec or 29.808 m3/day (Table 2).
morphometric (landform) and stream flow
(hydrology) in form of regression relationship. Total area of the Tasik Chini Basin under this
study is 57.00 km2, consist of 27.533 km2 sub
2. Experimental
basins that occupied by seven feeder rivers,
Two series of topographical maps with scale of
20.447 km2 of small and scattered sub basins
1: 25000 were used to draw the characteristics
and 9.02 km2 catchments for the lake area
of river basin morphometry of the Tasik Chini.
(Figure 1).
The two series are consisting of: (a) Series
L8010, Kg Belimbing, Sheet 90 d, and (b) Total flow from seven feeders rivers is 0.345
Series L8010, Sungai Mentiga, Sheet 90s. The m3/sec, while total flow from another small sub
whole sub catchments of the Tasik Chini basins based on the stream flow calculation
Watershed were redrawn on the tracing paper, only 0.271 m3/sec. If we consider that all the
to determine their morphometric sub catchments could contribute water
characteristics. Velocity and flow pattern of accordingly to the tasik and make the total flow
every river were identified and measured with to Tasik Chini become 0.616 m3/sec or 53,222
flow meter during field observation. m3/day. If the average depth of the Tasik Chini
is 1.6 m, volume of the lake can be calculated
3. Results and Discussion
as 2.02 (10000) x 1.6 x 1m 3= 32,320 m3. There
Morphometric characteristics of the basin that
are few small islands in the lake, P. Balai for
included of the seven feeder rivers, namely: 1)
example (±0.5 km2). Calculation of the total
Sg. Gumum, 2) Sg. Melai, 3) Sg. Datang, two
unnamed rivers 4) Sg.A and 5) Sg.B, 6) Sg.
volume of the lake will be different and the Hyland, E.M. 2003. The potential for private sector
volume of tasik should be less than 32,320 m3. partnerships to protect marine/coastal areas through
national action programmes. Industry and
In this calculation show that total volume of the environment 27 (1). P. 25-28
Tasik Chini (32,320 m3) is less than total flow
Jabatan Alam Sekitar (JAS). 1999. Pencemaran Air.
that was contributed by feeder rivers and small
Mengenai bumi kita. Kementerian Sains, Teknologi
sub catchments (53,222 m3/day), there are may dan Alam Sekitar, Kuala Lumpur.
be another retention of water contribution from
certain sub catchments such as dried source that Malaysian Nature Society. 1999. A Survey of
does not contribute water to the lake; for vegetation and avifauna of Chini. Malaysia Nature
Society.
example Sg. Datang catchment, was identified
as a stagnant water, high Evapotranspiration of Strahler, A. N. 1952a: Hypsometric (area altitude)
the tasik may be another factor. analysis of erosional topography. Geological Society
American Bulletin. 63 : P.1117 - 1142
There is another source that may come from
ground water contribution. Water contribution Strahler, A. N.1957: Quantitative analysis of
watersheds geomorphology. Trans. Americans
as base flow recharge to Tasik Chini was came
Geophysics Union. 38 : P.913 – 920
from infiltration process after precipitation
being intercept by tress in the forest areas. The Verstappen, H.Th. 1983. Applied geomorphology.
calculation can be formulated as follows: Geomorphological Surveys for Environmental
Development. Elsevier, Amsterdam.
P = Qs + R + ET,
United Nation Environment Programme (UNEP)
where: 2003. Freshwater: meeting our goals, sustaining our
future. The Geo Section Division of Early Warning
P = Precipitation; Qs = Surface runoff; ET= and Assessment (DEWA), UNEP. P. 36-53
Evapotranspiration; R = Recharge (Infiltration).
Wetlands International Asia – Pacific. 1998. The
4. Conclusion ecological assessment of Tasik Chini, Pahang,
Stream flow from Chini River to Pahang River Peninsular Malaysia: an evaluation of its
during the normal period (May) was 1.2 m3/sec conservation value and environmental
or 103,680 m3/day. Water input to fulfill water improvement requirements. Kuala Lumpur.
requirement in order to maintain sustainable of
the Tasik Chini is far below the target, its only
0.616 m3/sec or 53,222 m3/day. There are
unbalance discharge between water input from
the seven feeder river and small sub basins and
water output to the Pahang River, the
difference most probably was supported by
ground water discharge either as base flow or
through flow origin. Once Tasik Chini is
depend on ground water supply through base
flow process; logging activity in surrounding
area of the basin should be observed and
monitors in order to maintain level of the tasik.
5. Acknowledgment
This study was conducted and supported by
Government grand (IRPA: 02-02-09-0117-
EA294).
6. References
Carlston, C.W. 1963. Drainage density and stream
flow. In Stanley A. Schumm. (Ed.) Drainage basin
morphology. P. 181-188
Dale F. R., Kochel R. C. & Miller. J. R. 1978.
Process of geomorphology. Wm.C.Brown
Communications,Inc.All. United States. P.136-190.
Table 2: Total flow contribution from 7 feeder rivers into Tasik Chini
No. Feeder Basin Stream Stream
River Area flow flow
(km2) (m3/sec) (m3/day)
1 Sg.Datang 3.613 0.047 4,060
2 Sg.Perupuk 3.798 0.052 4,493
3 Sg.Melai 2.778 0.018 1,555
4 Sg.Kura- 0.26 0.004 346
kura
5 Sg.Gumum 6.313 0.083 7,171
6 Sg.A 4.963 0.065 5,616
7 Sg.B 5.808 0.076 6,566
Total 27.533 0.345 29.808
1) SIRIM Berhad, Lot 34, Jalan Hi-Tech 2/3, 09000 Kulim, Kedah, Malaysia, e-mail: mansor@sirim.my
2) Pusat Pengajian Sains Kimia, Universiti Sains Malaysia, Pulau Pinang, 11800, Malaysia
Abstrak
Tipisan nipis TiO2 boleh terhasil daripada celupan substrat kaca yang disalut dengan Indium-
Timah Oksida (ITO) ke dalam larutan sol gel yang mengandungi campuran logam alkoksida
titanium isopropoksida sebagai bahan pemula, etanol sebagai pelarut dan asid asetik sebagai
bahan penstabil. Analisis menggunakan Mikroskop Daya Atom (AFM) menunjukkan bahawa
tipisan nipis TiO2 adalah seragam dan saiz butiran adalah nano-kristal. Kekesatan tipisan
nipis ini adalah dibawah 5 nm dan ini mengesahkan tipisan nipis ini adalah seragam.
Difraktogram pembelauan sinar-X (XRD) yang dijalankan juga menunjukkan kehadiran fasa
anatase tipisan nipis TiO2 yang dipanaskan pada suhu 400oC hingga 650oC selama 1 jam.
Ujian voltametri berkitar (CV) menunjukkan kehadiran sifat-sifat elektrokromik tipisan nipis
di dalam larutan LiCl4 + PC, dengan keadaan tanpa warna kepada kelabu.
Profil Konsentrasi Oxygen Axial Dalam Air Pada Kolom Gelembung Bersekat
Vertikal Secara Eksperimen dan Simulasi
Abstrak
Kolom gelembung adalah tempat terjadinya proses perpindahan massa, dimana gas akan
berkontak dengan liquida . Gas akan terdispersi ke dalam phase liquida yang kontinu dalam
bentuk gelembung. Tingkat perpindahan massa dalam kondisi tertentu akan menentukan
lajunya dimana seluruh proses terjadi. Dalam proses ini dapat terjadi laju perpindahan
massa yang tinggi yaitu dengan memperbesar luas interfacial dan tingkat intensitas
turbulensi yang tinggi. Diantara peneliti-peneliti sebelumnya antara lain telah menggunakan
model dengan anggapan bahwa dispersi axial lebih dominan daripada konveksi axial, karena
liquidnya dalam keadaan stagnan. Pengembangan model telah dilakukan dalam penelitian ini
untuk memprediksi profil konsentrasi oxygen terlarut secara axial dan steady-state dalam
sebuah kolom gelembung bersekat dan vertikal, denganlaju alir dan udara secara counter-
current. Jika profil konsentrasi oxygen hanya dipengauhi oleh tekanan hydrostatik saja, maka
akan terbentuk profil linier; jika terdapat pengaruh pengadukan maka profilnya menjadi non-
linier. Beberapa faktor yang mempengaruhi profil konsentrasi oxygen antara lain, koefisien
perpindahan massa gas-liquid volumetric overall, laju liquida dan laju gas dalam kolom.
Pengaruh dari kenaikan variabel di atas terhadap profil konsentrasi adalah tidak begitu
besar karena kenaikan variabel tersebut dipengaruhi oleh laju alir gas dan laju alir liquida
yang harganya relatif kecil kalau dibandingkan dengan adanya pengaruh pengadukan.
Sedangkan dalam penelitian ini dilengkapi dengan sekat yang berfungsi sebagai pengaduk.
Dengan adanya sekat ini maka profil konsentrasi akan berbentuk non-linier. Dengan
menimbulkan bentuk-bentuk tak berdimensi maka konsentrasi okigen terlarut dapat dihitung
secara analitis. Model yang dikembangkan meninjau aliran bulk, dimana terjadinya
perpindahan massa ke arah axial karena pengaruh aliran konveksi, dan perpindahan massa
melalui lapisan film yang mengelilingi gelembung dengan kondisi steady-state. sedangkan
model yang lain, selin variabel-variabel di atas juga akan ditinjau pengaruh dari dispersi
radial. Dari sini akan dapat diturunkan suatu persamaan differensial, yang dapat mewakili
peristiwa di atas. Dengan memakai beberapa kondisi batas yang diperlukan maka persamaan
ini dapat diselesaikan. Dalam penelitian ini juga dilakukan secara eksperimen. Hasil simulasi
akan dibandingkan dengan hasil eksperimen, dan juga dibandingkan dengan hasil peneliti-
peneliti sebelumnya.
1) Departemen Kimia, Universitas Surabaya, Raya Kali Rungkut, Surabaya 60292, Indonesia,
e-mail: maria_gmp@ubaya.ac.id
2) Institut für Chemie und Biochemie, Ernst-Moritz-Arndt-Universität Soldmannstrasse 16, Greifswald, D-
17489, Germany, e-mail: weisz@uni-greifswald.de
Abstract
The dye methylene blue (MB) was covalently attached to a third strand oligonucleotide and its
binding to double-stranded DNA was investigated by NMR methods. MB is able to produce
singlet oxygen upon irradiation which in turn may cleave DNA strands at specific sites. This
offers a significant potential of MB to act as an artificial nuclease and may find its application
in many human therapy methods. Up to now, structural details of the dye binding could only
be indirectly deduced from linear and circular dichroism studies as well as from theoretical
calculations. In order to specify the preferred binding mode, we have synthesized MB with a
suitable linker for subsequent attachment to an amino-modified DNA oligonucleotide. The
resulting oligonucleotide-dye conjugate was subjected to several complementary DNA double
helices and formed triple helices were characterized by NMR spectroscopic methods. The
predominant binding mode was explored by performing a series of one- and two-dimensional
homo- and heteronuclear NMR experiments in aqueous solution, in some cases also
employing specifically 15N-labeled cytosine nucleosides at the potential binding site.
Departement of Chemistry ITB, Jl. Ganesha 10,thBandung 40132, Phone : +62 (22) 2502103 ext 101,
Proceeding
Fax : +62 (22) 2504154, Homepage :of The 6 ITB-UKM Joint Seminar
http://www.chem.itb.ac.id/jschem, on: jschem@chem.itb.ac.id
E-mail Chemistry
M.A. Nawi, S.S.Chow and M.Z. Ibrahim
Peat Adsorbents Prepared with Natural Rubber Latex As Filter Media For The
Treatment Of Domestic Wastewater
Abstract
Temperate peat soil has been proven to be useful as a filter medium for treating domestic
wastewater. However, no works has been done to convert tropical peat soil inot a filter media
for wastewater treatment. This is due to the intrinsic nature of tropical peat soil which
leaches heavily, have poor hydraulic conductivities and acidic nature. This paper relates to
our work in converting tropical peat soil into a functional filter media for domestic
wastewater treatment. Thus, tropical peat soils with severe leaching problems and poor
hydraulic conductivities was converted into a functional filter media via heat treatment at
500 °C for 3 hours and further pelletized with natural rubber latex. Adsorption isotherms
analysis showed that the uptake of COD by peat-rubber pellets followed both Langmuir and
Freundlich models. Thermally treated peat-rubber pellets had improved hydraulic
conductivities , neutral pH and minimal organic leaching. Sustainable removal of COD from
molasses solution was achieved upon its repeated usage. This self-regenerating
characteristics was proven to be due to the better growth of bacteria on the surface of the
adsorbent. This filter system was used to treat domestic wastewater and its performance was
folowed for up to three months. Up to 3000 L of wastewater was treated using the filter
system without any significant breakthrough level.This filter system was able to remove COD,
BOD, turbidity, suspended solid, colour , NH3-N, org-N, PO4-P, Cu and Zn with level of
removal at 75.2 %, 96.7%, 76.9%, 78.9%, 75.0%, 74.5%, 51.2%, 96.8%, 48.7% and 33.3%
respectively.
Key words - Tropical peat, thermal treatment, molasses, natural rubber , peat pellets, self-
regeneration.
adsorption of dissolved organic matter ( low For RR12, there was a steady decrease in uptake
surface areas ) and low pH. of dye with increasing weight of added rubber.
Table 1: Physical characteristics of Malaysian raw and thermally treated peat soils from Gunung Jerai
and Batu Pahat.
Thun et al (1983 ) had demonstrated that This phenomenon is expected since each
thermally treated peat increased peat’s additional rubber additive would increase the
mechanical strength making peat filtration beds shielding effect of the peat surface thus reducing
less susceptible to clogging. In line with their the effectiveness of surface adsorption of the dye
work, we had subjected Malaysia raw peat soils molecules. Since the difference was due to the
with simple thermal treatments in anticipation of biodegradability of molasses samples, peat
improved physical characteristics that may allow pellets was functioning via both adsorbents and
it to be used as filter media for wastewater biodegradation.
treatment ( M.A.Nawi et al, 2004). As shown in
A time-equilibrium study of the removal of COD
Table 1, thermal treatment of peat at optimized
and RR12 dye by the peat-rubber pellets revealed
heating temperature of 500 ºC for 3 hours in a
that the time equilibrium for domestic wastewater
muffled furnace reduced peat leaching problems,
was achieved within 40 minutes , molasses waste
remove their acidic nature and improved their
was at 60 minutes and for RR12 was at 40
adsorption capacities. However, thermal
minutes. The differences in time equilibrium
treatment did not improve hydraulic
was due to the different nature of chemicals
conductivities of peat.
adsorbed by pelletized treated peat. For
In order to increase the rate of filtration and to comparison,thermally treated peat without latex
render its eventual usefulness as a filter bed produce a time equilibrium of 10 minutes with
medium, the treated peat needs to be pelletized. RR12 (M.A.Nawi et al, 2004). Thus the coating
Among the various binders tested for this of rubber onto peat have slowed down the
purpose; natural Malaysian rubber latex produced diffusion of molecules into the adsorbents
the best results. The choice of natural rubber surfaces. It was also observed that extended
latex is further augmented by it easy availability contact time produced two more equilibriums
locally and its relatively cheap costs. with successive increments of uptake for
molasses waste while one more time equilibrium
Optimization study of the ratio of latex to
for domestic wastewater. This phenomenon was
thermally treated peat was done by monitoring
not observed for RR12. This observation was
the removal of COD by pelletized peat samples
due to the effect of biological activities after
from a diluted molasses wastewater sample using
extended contact time itdid not occur with non-
contact time of 8 hours. The optimum ratio of
biodegradable dye.
rubber to thermally treated peat was 0.20 g latex
per 2 g. thermally treated peat . Amounts lower Adsorption isotherms studies were done to
or higher than this range produces lower COD determine the adsorption characteristics of
removal values. This behaviour was not rubber- peat pellets. For this purpose, only
observed with non-biodegradable impurities such thermally treated Gunung Jerai peat samples
as textile dye (Cibacron brilliant red B or RR12). were selected for pelletization. This selection
Table 2: Langmuir and Freundlich parameters of adsorption by rubber-latex peat pellets prepared from
thermally treated Gunung Jerai peat. ( a) Langmuir isotherms and (b) Freundlich isotherms
a. Langmuir Isotherm
Types of samples Monolayer Langmuir Correlation
capacity,Qo (mg/g) constant, b (L/g) factor
Domestic wastewater 3.428 0.015 0.9786
Molasses 14.99 0.002 0.9955
Textile dyes(RR12) 10.471 0.385 0.9979
b.Freundlich Isotherm
Types of samples Constant, 1/n Constant, K (L/g) Correlation
coefficient
Domestic wastewater 0.0254 1.336 0.9864
Molasses 0.0309 0.157 0.9939
Textile dyes(RR12) 0.0072 2.89 0.9662
was based on its higher adsorption capacity as biological degradation thus cleaning up surface
compared to Batu Pahat peat (see Table 1). For of the adsorbent for further uptake of the next
molasses waste, all peat peat samples were batch of pollutants. As shown in Figure 1, the
shaken for 5 hours in order to correlate with the percent removal of COD by the rubber coated
first plateau obtained in previous time peat pellets did not decreased upon repeated
equilibrium studies. The data were then fitted usage with fresh new batches of molasses
into linearized equations of both Langmuir and solutions. Instead, the uptake increased at
Freundlich and the results are given in Table 2. second usage and was more or less maintained
Modes of adsorption fit both Langmuir and for the entire duration of repeated usage. On the
Freundlich as shown by the respective other hand, thermally treated peat without rubber
correlations values. The thermally modified showed a decrease in uptake at the second usage
peat-latex pellets had a Langmuir monolayer (Qo) and was maintained through out at a much lower
of 14.993 mg/g for molasses and 3.428 mg/g for percent removal of COD. When peat pellets
domestic wastewater. This value was not were used for a similar repeated treatments of
significantly different from Qo of 15.20 mg/g non-biodegradable textile dye,(RR12, curve c), it
molasses adsorption for unpelletized thermally experienced uptake reduction that eventually
treated peat . Therefore, pelletizing peat with reached values close to zero after the fifth
natural rubber did not give the undesirable effect exposure. The result for RR12 dye was expected
of adsorption reduction as usually expected. A since it is non-biodegradable. Therefore for non-
low 1/n value obtained for each case would biodegradable substances, each repeated
mean that it is more suitable as a filter medium exposure would have a continuous reduction in
rather than as a batch-mode medium. the adsorption capacity of the peat pellets as such
that after the fifth exposure it became completely
In order to investigate the possibility of
exhausted. However molasses were
biological activities that may influence the
biodegradable in nature. The maintenance of
removal capacity of dissolved organics by peat
uptake with no apparent saturation point
pellets, a study was done on the repeated usage of
suggests the existence of bioactivity that help to
the same rubber coated peat pellets with different
clean-up the adsorption sites for incoming new
fresh batches of molasses and domestic
pollutants.
wastewater samples. In this study, each solution
was shaken with respective peat samples for up The role of biodegradation mechanism occurring
to 8 hours. The choice of using extended contact on the surface of peat pellets is supported further
time was to correlate with the second plateau of by the evidence that significant reduction of COD
the time equilibrium curve . As speculated removal occurred when either of the molasses
above, biological activity was another important solution or peat pellets were sterilized. It can be
mechanism of COD removal besides surface seen from Figure 3 that when both molasses
adsorption. The combination of these two solution and peat rubber pellets were sterilized,
mechanisms means that the adsorbed very poor COD removal occurred especially
biodegradable organic molecules may undergo upon repeated usage. Better results were
obtained when either one of them was not This is a very clear evidence that the increasing
sterilized. The best result was obtained when number of bacteria counts on the adsorbent
both molasses solution and peat pellets were not surface was responsible for the improved uptake
sterilized. of COD by peat pellets upon its continued
100
90 a
80
70
Percent removal,%
60
50 b
40
30
20 c
10
0
1 2 3 4 5 6 7 8 9
No of repeated usage
Figure 2 : Plots of percent removal uptake of COD upon repeated usage of (a) peat-rubber
pellets on molasses solution (b) thermally treated peat on molasses solution and (c) peat-rubber
pellets on non-biodegradable textile dye reactive red 12 (RR12)
90
80
Percent COD removal,%
70
60
50
40
30
20
10
0
0 1 2 3 4 5 6 7
No of repeated usage
Figure 3: The effect of sterilization on either peat-rubber pellets or molasses solution or both
on the efficiency of COD removal upon repeated usage of peat-rubber pellets
An experiment was further done to count bacteria repeated usage. However, thermally treated peat
growth within thermally treated peat and without rubber generally was one fold smaller in
pelletized thermally treated peat by using terms of total number of bacteria. The results of
molasses wastewater system. It was found that this experiment provided a clear explanation for
the presence of rubber improved the bacteria the observed sustainable uptake of COD from
counts. In addition, bacteria growth was found to molasses upon repeated usage of the adsorbents.
increase with repeated usage of the peat pellets. The presence of rubber had induced higher
bacteria activities that helped the adsorbent to be pellets filter system is summarized in Table 4
self-regenerative. The possible role of rubber below.
here was to provide attachment sites for bacteria
4. Conclusion
growth. The raw natural rubber is a
Tropical peat soils with severe leaching problems
macromolecular isoprenoid. Non rubber
and poor hydraulic conductivities can be
constituents may includes proteins, lipids,
converted into a decent filter media via simple
carbohydrates, resins and inorganic salts. The
thermal treatment. This thermally treated peat
presence of these constituents may help in the
has been shown to have minimal leaching
promotion of rapid bacteria growth on the surface
Table 4: Water quality characteristics of domestic wastewater (influent) and treated wastewater
( effluent) by peat pellets filter system. Flow rate was maintained at 100 mL/min.
pH 7.55 7.22 -
of the peat pellets. In fact the introduction of problems and improved adsorption capacity
rubber into the peat system has increased bacteria (M.A.Nawi et al, 2004). Pelletization of this
growth by up to 100 times. thermally treated peat with natural rubber latex
had significantly increased its hydraulic
Evaluation of hydraulic conductivities of peat-
conductivities by at least 200 times. Addition of
rubber pellets gave a value of 0.227 cm/sec. This
rubber did not significantly drop the adsorptive
is about 174 times better than raw peat soil. In
capacity of thermally treated peat. These
addition, the system also provides a very low peat
pelletized thermally treated peat exhibited self-
soil leaching (M.A.Nawi et al, 2004) and
regeneration behaviour possibly due to bacteria
improved hydraulic conductivities. We therefore
activities that free-up the adsorption sites for
had converted raw tropical peat soil into a
further uptake of the pollutants. This bacteria
suitable filter media for wastewater treatment.
activities however did not occur with non-
The filter system that was set up was a laboratory
biodegradable pollutants. Adsorption isotherms
scale filter unit fabricated using a 300g peat
analysis proved that the uptake of COD followed
pellets layered above sand and fine gravels in a
both Langmuir and Freundlich models. The low
perspex container. Essentially no breakthrough
1/n value means that the adsorbents is more
point was observed over the entire application of
suitable for use as a filter medium rather than the
peat pellets filter in the treatment of domestic
batch mode medium.
wastewater . The overall performance of peat
Abstract
Poly(methyl methacrylate) (PMMA)-SiO2, hybrid membranes were prepared by sol-gel
process and immersion into a water bath of ternary solutions obtained by adding additional
amounts of TEOS, as inorganic precursor to PMMA solutions. Methods to obtain an intimate
dispersion of the inorganic particles in the PMMA solutions were developed. A variety of the
membranes were prepared by varying evaporation time after casting of ternary solution.
Membranes were also cast from a binary solution of PMMA and solvent for comparison
purposes. All the obtained membranes were characterized by scanning electron microscope
observations, FTIR, EDX and ultrafiltration tests. The effect of the above-mentioned
preparative parameters on the structure, flux and dextran retention properties of the
membranes is discussed.
keywords: hybrid membranes, immersion precipitation, PMMA, sol-gel, TEOS;
solvent bath. The solvent diffuses into the non- the ranges. The chemical analysis of the hybrid
solvent (coagulant) bath, whereas the non- membranes was analyzed by Energy Dispersive
solvent will diffuse into the cast polymeric X-Ray, EDX (Oxford Instrument, 7353,
film. After period of time, the exchange of England). The hybrid membranes were
solvent and non-solvent has proceeded so far fractured in liquid nitrogen and coated with Au
that the solution becomes thermodynamically by sputtering. Analysis was carried out on
unstable and the phase separation occurred selected areas. Membrane samples (surface
(Mulder, 1991). The porous membranes have 28.7 cm2) were tested with an ultrafiltration
been prepared by either of the methods (UF) laboratory unit with an aqueous solution
described above. In this work, the membranes of dextran with nominal average molecular
cast from PMMA-solvent-TEOS ternary mass, 70 kDa (Sigma, Dextran T70). Operating
solutions was prepared by combination of sol- conditions were: temperature 25°C, membrane
gel process and the immersion precipitation pressure 3 bar and stirring speed 600 rpm.
technique and the effect of evaporation time on Dextran concentration in the feed (200 ppm)
the properties and ultrafiltration performance of and permeate was determined by the
the membrane is discussed. calorimetric method (Dubois et al., 1956).
2. Experimental 3. Results and discussion
Membranes were prepared as described in Fig. 1 shows SEM micrographs of the cross
previous work (Mohammad and Zulfikar, section and skin layer surface of the hybrid
2004) from ternary solutions of poly(methyl membranes prepared by sol-gel (Figs. 1 a and
methacrylate) (PMMA, 350,000; Aldrich), b) which was obtained by adding to PMMA
tetrahydrofuran (THF, Merck) as well as TEOS solution (15 wt.%) at ratio (80/20) of
(Aldrich). PMMA was thoroughly dissolved in PMMA/TEOS. It is apparent that membranes
the respective solvent at 15% concentration obtained by sol-gel have co-continuous
polymer (w/w) in solution first. TEOS was structure and are not affected by the addition of
added directly to the solution under continuous TEOS to the PMMA solution. The polymer
agitation. Then acidic solution (pH = 2) were matrix generally hides SiO2 particles. The skin
added in stoichiometric amount (TEOS:H2O = layer surface of the membrane prepared by sol-
1:4) and mixed for 24 h more at ambient gel appears to be smooth.
temperature. The final composition solution of
Whole cross-sections of the membranes
PMMA/TEOS was 80/20 (w/w). The
prepared in the combined use of sol-gel process
homogeneous solution above was left for 24
and the immersion precipitation are shown in
hours to release air bubbles. Solutions were
Fig. 2 (a,b). Water was used as the non-solvent.
poured onto a glass plate and cast as thin films
When the evaporation period was 24 h, pores
(thickness ca. 350 µm) and was allowed to were formed in almost the whole cross-
exposure at room temperature for 1, 24 and 48 sections. However, most of the pores appeared
hours and then immersed in a water bath at become bigger after 48 h.
25°C. Finally, the membranes were obtained
then dried at 60 oC in vacuum for 5 hours. Figure 3 shows structures near top surface
Membrane surfaces and cross-sections were contacted with non-solvent. When evaporation
observed under a scanning electron microscope period 24 h, the pores formed near the top
(SEM, Oxford Instrument, 7353, England). All surface (Fig.3a). As the evaporation period
specimens were coated with a thin layer of gold increased to 48 h, the size of the pore became
before SEM observation. Cross-sections were bigger near the top surface (Fig. 3b).
prepared by fracturing the membranes at liquid Formation of membrane structures as shown in
nitrogen temperature. Fourier transform Fig. 2 a,b and 3 a,b is explained as follows. The
infrared spectroscopy (FT-IR) spectra of the morphology is closely related to the nature of
hybrid membranes were recorded between the interactions between phases because
4000 and 450 cm-1 on a Bio-Rad, FTS 165 morphology results from a competition
spectrometer. Samples for FTIR were prepared between the cross linking kinetics (formation of
in the form of KBr pellets method. A minimum SiO2 clusters and bonding to PMMA), the
of 18 scans signal was averaged with a phase separation kinetics due to the
resolution of 2 cm-1 at the 4000 - 450 cm-1 in immiscibility of SiO2 clusters in the polymer
(a) (b)
Fig. 1. SEM micrographs of hybrid membrane prepared by normal sol-gel: (a) top surface, (b) cross section
(a) (b)
Fig. 2. SEM micrographs of cross section of hybrid membranes prepared in combined use of sol-gel and
immersion precipitation: (a) immersion period – 24 h, (b) immersion period – 48 h
(a) (b)
Fig. 3. SEM micrographs of top surface of hybrid membranes prepared in combined use of sol-gel and
immersion precipitation: (a) immersion period – 24 h, (b) immersion period – 48 h
and thermodynamic (Lanteme et al., 1996; physical links such as hydrogen bonding
Silveira et al., 1995; Landry et al., 1992a, between uncondensed alcohol functions of the
1992b). In hybrid system based on high molar inorganic clusters and carbonyl groups of the
mass organic preformed polymer (for example polymer chains (Landry et al., 1992a, 1992b).
PMMA), without designed functionalization, During PMMA/TEOS formation, TEOS is
gelation is generally attributed to strong initially homogeneously dispersed in PMMA
(a) (b)
Fig. 4. EDX spectra of top surface of hybrid membranes prepared in combined use of sol-gel and immersion
precipitation: (a) immersion period – 24 h, (b) immersion period – 48 h
solution. As the hydrolysis/condensation out of the casting film (Mulder, 1991). Because
reaction goes on, the inorganic SiO2 network is solvent (THF) diffuses out of the casting film,
formed. The growth of SiO2 network is miscibility and the enthalpy interaction
entropically unfavorable towards miscibility between the PMMA segments and the
and the enthalpy interaction between the inorganic component also deteriorates, and this
PMMA segments and the inorganic component condition can be due to the large difference on
also deteriorates, and this condition can be due the thermal expansion coefficient between the
to macroscopic phase separation. A strong PMMA and silica and cause macroscopic phase
interaction between the PMMA and SiO2 is separation occurred. Therefore, particles of
necessary in order to prevent these phase SiO2 can be loss during the immersion of
separation (Lanteme et al., 1996; Silveira et al., casting film in the water bath and macro voids
1995; Landry et al., 1992a, 1992b). The structure with size in the range of tenths of
solvents of this study can be broadly grouped micrometers was obtained.
into non-polar category. In this category, weak
The chemical analysis of the top and bottom
polar interactions between the THF molecules
layer of membrane film by EDX analysis
and the polymer repeat unit was present and
shows that the top face contains the carbon,
favors interactions between the PMMA and the
oxygen and silicon elements (Fig.4a,b).
SiO2 domains, thus phase separation inhibited.
However, the hybrid membrane that was
THF solvent also functions as solvent swelling
evaporated for 48 h lower contains silicon
the growing network (Silveira et al., 1995) and
compare to 24 h (Fig.4b). From EDX analysis
diluting the unfavorable interaction between
also shows that the bottom face has higher
PMMA and SiO2 as describe above.
contain silicon than the top face (not shown
When casting film is immersed into water bath, here). As described above, when casting film is
the exchange of solvent and non-solvent immersed into water bath, the solvent diffuses
(water) occurred. According to Mulder, the out rapidly. This creates a deficiency in solvent
difference in the solubility parameters between in that region which then drives the solvent
THF (diluents) and water (non-solvent) is large, from bottom surface towards the top. The net
which indicates the low mutual affinity results for this system is that the inorganic
between the diluents and the non-solvent. It is precursors which are near the bottom remain
correspondent to solvent non-solvent mobile for a longer period of time before
interaction parameters, g12. If miscibility vitrification, and therefore have time to grow to
solvent non-solvent was higher (low g12 much and larger particles.
values), non-solvent can be easily penetration
In Fig. 5 the ultrafiltration performance of
to casting film. In this case, a high ratio of
hybrid membranes cast from ternary solutions
solvent outflow versus non-solvent inflow is
in the two different processes is compared. It is
achieved and in fact only the solvent diffuses
worth observing that the reported permeate flux
30 30
water permeability, Lp
25 25
rejection (%)
(L/m .h.bar) 20 20
15 15
2
10 10
5 5
0 0
0 1 24 48
immersion period (h)
Fig. 5. Water permeability and retention of membranes as a function of immersion period: S
rejection, ● water permeability
and retention values are the ones taken after 15 Technology, Malaysia through IRPA Grant 09-
min from the start. This is because during the 02-02-0070-EA 197.
UF tests, the membranes tend to compact with
6. References
consequent lowering of the permeate flux. This Bottino A., Caparmelli G., and Comite A., (2002).
trend, also found for other types of organic- Preparation and Characterization of Novel Porous
inorganic systems (Bottino et al., 2002; Schaep PVDF-ZrO2 Composite Membranes, Desalination,
et al., 1998). Fig. 5 indicates that an increase of 146, 35-40.
evaporation period leads to an increase of the
Chowdhury S.R., Elshof J.E., Benes N.E., Keizer
flux and a lowering of the retention. Obviously, K., (2002). Development and Comparative Study of
the absolute values of permeate flux and Different Nanofiltration Membranes for Recovery
retention for the three four of membranes are of Highly Charged Large Ions, Desalination, 144,
quite different since the structure of these 41–46.
membranes is different, as seen in SEM
Dubois M., Gilles K.A., Hamilton J.K., Rebers P.A.,
analysis (Fig.1-3). and Smith F., (1956). Calorimetric Method for
4. Conclusions Determination of Sugars and Related Substances,
The hybrid membranes were prepared in Anal. Chem., 28, 350-361.
combined use of sol-gel and the immersion Hu Q., Marand E., Dhingra S., Fritsch D., Wen J.,
precipitation. When the membranes immersed Wilkes G., (1997). Poly(amide-imide)/TiO2 Nano-
into water, pores were formed. As the composite Gas Separation Membranes: Fabrication
evaporation period increased, the loss of and Characterization, Journal of Membrane Science,
particles of SiO2 become higher, therefore the 135, 65-79.
size of the pore became bigger near the top Landry C.J.T., Coltrain B.K and Brady B.K.,
layer. The UF performance of the membrane (1992). In situ Polymerization of Tetraethoxysilane
can be properly varied by the evaporation in Poly(methyl methacrylate): Morphology and
period increased of the ternary casting film. Dynamic Mechanical Properties, Polymer, 33, 7,
This fact along with the modifications induced 1486-1495.
by combined use of sol-gel and the immersion Landry C.J.T., Coltrain B.K., Wesson J.A.,
precipitation may open new avenues towards Zumbulyadis N., and Lippert J.L., (1992). In situ
the preparation of new PMMA/SiO2 hybrid Polymerization of Tetraethoxysilane in Polymers:
membranes. Chemical Nature of The Interactions, Polymer, 33,
7, 1496-1506.
5. Acknowledgements
The authors wish to thank the financial support Lanteme B., Dumon M., Mai C., Pascault J.P.,
(1996). In situ Polymerization of Titanium
from the Institute of Technology Bandung,
Indonesia and the Ministry of Science and
Alkoxides in Polyvinylacetate, Journal of Non- Okumus E., Gurkan T., Yilmaz L., (2003). Effect of
crystalline Solids, 194, 63-71. Fabrication and Process Parameters on the
Morphology and Performance of a PAN-based
Mohammad A.W and Zulfikar M.A., (2004).
Zeolite-filled Pervaporation Membrane, Journal of
Synthesis and Characterization of Poly(methyl
Membrane Sci. , 223, 23.
methacrylate)/SiO2 Hybrid Membranes: Effect of
Solvents on Structural and Thermal Properties, Schaep J., Vandecasteele C., Leysen R., Doyen W.,
submitted to Microporous and Mesoporous (1998). Salt Retention of Zirfon Membranes,
Materials. Separation and Purification Technology, 14, 127.
Mulder M., (1991). Basic Principles of Membrane Sforca M.L., Yoshida I.V.P., Nunes S.P., (1999).
Technology, Kluwer Academic Publisher, Organic-Inorganic Membranes Prepared from
Netherland. Polyether Diamine dan Epoxy Silane, Journal of
Membrane Science, 159, 197-207.
Nunes S.P., Peinemann K.V., Ohlrogge K., Alpers
A., Keller M., Pires A.T.N., (1999). Membranes of Silveira, K.F., Yoshida I.V.P., and Nunes S.P.,
Poly(ether imide) and Nanodispersed Silica, Journal (1995). Phase Separation in PMMA/Silica Sol-gel
of Membrane Sci. , 157, 219. Systems, Polymer, 36, 7, 1425-1434.
Abstrak
Satu kajian kualiti air di Tasik Chini telah dijalankan pada bulan Disember 2004 iaitu dalam
musim hujan. Sebanyak 15 stesen persampelan telah dipilih dan sebanyak 14 parameter
kualiti air telah ditentukan dalam kajian ini. Keputusan yang diperolehi menunjukkan nilai
purata keseluruhan tasik bagi parameter suhu adalah 27.28 ± 0.82 °C, oksigen terlarut (DO)
5.83 ± 0.62 mg/L, konduktiviti 23.55 ± 3.44 µS/cm, jumlah pepejal terlarut (TDS) 15.1 ± 2.2
mg/L, kekeruhan 32.31 ± 42.17 NTU, pH 6.56 ± 0.22, klorofil-a 0.88 ± 0.239 µg/L, ammonia-
N 0.407 ± 0.254 mg/L, nitrat 0.027 ± 0.027 mg/L, fosfat 0.077 ± 0.025 mg/L, sulfat tidak
dikesan, permintaan oksigen kimia (COD) 12.85 ± 3.26 mg/L, permintaan oksigen biokimia
(BOD) 0.78 ± 0.42 mg/L dan jumlah pepejal terampai (TSS) 29.78 ± 25.00 mg/L.
Perbandingan dengan nilai Piawaian Interim Kualiti Air Kebangsaan (INWQS) menunjukkan
secara amnya parameter yang dikaji berada dalam kelas I-II kecuali TSS dan kekeruhan yang
agak tinggi (kelas II) berbanding pada musim kering akibat kemasukan air daripada sungai
Pahang ke dalam Tasik Chini. Pengiraan nilai IKA menunjukkan tasik ini dikategorikan
sebagai kelas II (84.91 ± 5.39) di mana ianya selamat untuk kegiatan rekreasi.
Kata kunci: Tasik Chini, kualiti air, tanah bencah
th
564 Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
M. Shuhaimi-Othman, Mohd Barzani, Lim Eng Chong dan Mushrifah Idris
BOD 300 ml. Sampel air yang diambil berbanding pada musim kering (Shuhaimi-
disimpan dalam kotak berisi ais untuk tujuan Othman et al., 2005) akibat kemasukan air dari
pengawetan (suhu < 4 °C). sungai Pahang ke Tasik Chini, terutama di
stesen 4a dan 4b yang berhampiran dengan Sg.
Parameter in-situ
Chini. Terdapat pengurangan oksigen terlarut
Parameter in-situ ditentukan dengan
di stesen 2 dan 4a yang di klasifikasi sebagai
menggunakan HYDROLAB DataSonde® 4 dan
kelas III (4.9 mg/L) mengikut INWQS (3-5
Surveyer® 4a. Parameter yang diukur adalah
mg/L). Pengiraan nilai IKA menunjukkan tasik
suhu, oksigen terlarut (DO), pH, konduktiviti,
ini dikategorikan sebagai kelas II (84.91 ±
jumlah pepejal terlarut (TDS), kekeruhan dan
5.39) di mana ianya selamat untuk kegiatan
klorofil-a. Kalibrasi ke atas prob berlainan
rekreasi yang melibatkan sentuhan badan
dilakukan dimakmal sebelum pengukuran
manakala stesen 10, 11 dan 12 di kelaskan
parameter di lapangan.
dalam kelas I (>91.76).
Analisis Makmal
Perbandingan diantara stesen menunjukkan
Sampel yang diambil dari stesen persampelan
terdapatnya tren dimana stesen 1-4 yang
diuji untuk 7 parameter kualti air iaitu
terletak di kawasan berhampiran resort dan
permintaan oksigen biokimia (BOD),
penempatan penduduk mempunyai beberapa
permintaan oksigen kimia (COD), jumlah
bacaan parameter yang lebih tinggi/merosot
pepejal terampai (TSS), ammonia-N, nitrat,
seperti DO, COD dan ammonia-N berbanding
sulfat dan fosfat. Semua kaedah adalah
stesen 11 dan 12 yang terletak lebih jauh
mengikut kaedah yang disarankan oleh kaedah
daripada kawasan tersebut. Kepekatan nutrien
piawai (APHA 1992) dan HACH (2003). Enam
seperti nitrat dan fosfat yang merupakan
parameter iaitu pH, DO, COD, BOD,
penyumbang utama proses eutrofikasi didapati
ammonia-N dan TSS digunakan dalam
hadir dalam kuantiti yang rendah (0.0-0.1
pengiraan IKA seperti yang dicadangkan oleh
mg/L).
Jabatan Alam Sekitar, Malaysia.
4. Kesimpulan
3. Hasil dan Pembahasan Kajian ini menunjukkan secara amnya
Keputusan parameter kualiti air di 15 stesen
parameter kualiti air yang dikaji di 15 stesen di
persampelan bagi bulan Disember 2004 di
Tasik Chini berada dalam kelas I-II (INWQS
Tasik Chini ditunjukkan dalam Jadual 1. Hasil
dan IKA) kecuali parameter oksigen terlarut
yang diperolehi menunjukkan nilai purata
dan TSS di beberapa stesen persampelan (kelas
keseluruhan tasik (julat minima-maksima) bagi
III) akibat musim tengkujuh pada bulan
parameter suhu adalah 27.28 ± 0.82 °C (26.8- tersebut.
28.1 oC), oksigen terlarut (DO) 5.83 ± 0.62
mg/L (4.9-7.3 mg/L), konduktiviti 23.55 ± 3.44 5. Penghargaan
µS/cm (20.3-30.7 µS/cm), jumlah pepejal Kajian ini telah dibiayai oleh geran
terlarut (TDS) 15.1 ± 2.2 mg/L (13.0-19.7 penyelidikan IRPA 09-02-02-0114-EA276.
mg/L), turbiditi/kekeruhan 32.31 ± 42.17 NTU 6. Rujukan
(0-130.9 NTU), pH 6.56 ± 0.22 (6.2-6.8), APHA, 1992. Standard Methods for the
klorofil-a 0.88 ± 0.239 µg/L (0.3-1.2 µg/L), Examination of Water and Wastewater. Ed Ke-
ammonia-N 0.407 ± 0.254 mg/L (<0.02-0.9 18.Washington: American Public Health
mg/L), nitrat 0.027 ± 0.027 mg/L (0-0.1 mg/L), Association (APHA).
fosfat 0.077 ± 0.025 mg/L (0.04-0.1 mg/L), Chong, I. K., 2001. Laporan Persidangan Tahunan
sulfat tidak dikesan, permintaan oksigen kimia Pengurus Kanan Jabatan Pengaliran dan Saliran
(COD) 12.85 ± 3.26 mg/L (7.4-17.7 mg/L), Malaysia 2001. Jabatan Pengaliran dan Saliran
permintaan oksigen biokimia (BOD) 0.78 ± Negeri Pahang.
0.42 mg/L (0.3-1.8 mg/L) dan jumlah pepejal HACH, 2003. The Handbook of DR/2500
terampai (TSS) 29.78 ± 25.00 mg/L (1.6-74.2 Laboratory Spectrophotometer. USA: HACH
mg/L). Perbandingan dengan nilai Piawaian Company.
Interim Kualiti Air Kebangsaan (INWQS; JAS
JAS, 1992. Laporan Kualiti Alam Sekitar Malaysia
1992) menunjukkan secara amnya parameter
1990. Kuala Lumpur, Kementerian Sains, Teknologi
yang dikaji berada dalam kelas I-II kecuali TSS dan Alam Sekitar.
dan kekeruhan yang agak tinggi (kelas II)
Mushrifah Idris, Ahmad Abas Kutty, 2004. Trends Shuhaimi-Othman, M., Lim, E.C., Mushrifah, I.,
of physico-chemical water quality in Tasik Chini. Shaharudin, I., 2005. Kualiti air dan logam berat di
Dalam Mushrifah Idris, Khatijah Hussin & Abdul Tasik Chini, Pahang. Prosiding Seminar IRPA
Latiff Mohammad (pnyt). Khazanah Tasik Chini. RMK-8, Kategori EAR, Jilid II, 216-220.
Bangi: Penerbit Universiti Kebangsaan Malaysia.
(dlm. Penerbitan).
LAMPIRAN
Rajah 1. Peta menunjukkan 12 ‘laut’ dan 15 stesen persampelan di Tasik Chini, Pahang.
Jadual 1: Purata (± sisihan piawai) parameter kualiti air dan nilai IKA di 15 stesen persampelan di Tasik Chini bagi bulan
Disember 2004.
SO42-
Stesen BOD (mg/L) COD (mg/L) TSS (mg/L) NH3-N (mg/L) NO3- (mg/L) PO43- (mg/L) IKA
(mg/L)
1a 1.89 ± 0.29 17.70 ± 0.00 17.33 ± 1.25 0.333 ± 0.021 0.017 ± 0.012 0.103 ± 0.021 ND 81.29
1b 0.81 ± 0.08 17.25 ± 1.76 14.33 ± 3.78 0.290 ± 0.017 0.033 ± 0.029 0.013 ± 0.015 ND 84.62
2 0.30 ± 0.17 16.65 ± 1.06 18.67 ± 1.25 0.300 ± 0.017 0.027 ± 0.006 0.097 ± 0.023 ND 81.39
3 0.69 ± 0.31 12.60 ± 0.14 46.67 ± 2.25 0.637 ± 0.084 0.017 ± 0.012 0.093 ± 0.023 ND 80.63
4a 0.26 ± 0.17 7.40 ± 0.28 72.72 ± 3.51 0.803 ± 0.162 0.067 ± 0.006 0.097 ± 0.029 ND 77.25
4b 0.66 ± 0.02 7.60 ± 0.14 74.17 ± 0.76 0.897 ± 0.095 0.033 ± 0.040 0.043 ± 0.015 ND 78.64
5 0.50 ± 0.00 9.60 ± 0.56 61.50 ± 2.17 0.543 ± 0.136 0.007 ± 0.006 0.080 ± 0.010 ND 81.93
6 0.59 ± 0.29 12.00 ± 0.70 42.22 ± 1.07 0.513 ± 0.047 0.007 ± 0.012 0.073 ± 0.015 ND 82.51
7 0.62 ± 0.46 12.90 ± 2.12 43.67 ± 1.75 0.507 ± 0.061 0.033 ± 0.031 0.070 ± 0.017 ND 82.50
8 0.78 ± 0.05 13.50 ± 1.41 20.89 ± 2.16 0.320 ± 0.030 ND 0.087 ± 0.023 ND 85.72
9a 1.41 ± 0.67 15.80 ± 2.12 10.17 ± 1.89 0.180 ± 0.017 ND 0.080 ± 0.020 ND 88.75
9b 0.56 ± 0.06 15.20 ± 0.42 12.17 ± 2.02 0.233 ± 0.025 0.037 ± 0.035 0.063 ± 0.015 ND 88.81
10 0.78 ± 0.10 10.60 ± 5.37 7.50 ± 1.323 0.107 ± 0.012 0.100 ± 0.070 0.067 ± 0.015 ND 91.97
11 1.04 ± 0.76 12.70 ± 0.99 3.00 ± 0.500 0.033 ± 0.006 0.020 ± 0.026 0.083 ± 0.050 ND 92.26
12 0.91 ± 0.17 11.20 ± 0.84 1.67 ± 0.289 < 0.02 0.003 ± 0.006 0.110 ± 0.060 ND 95.40
ND – tidak dikesan
Korelasi Umum Konstanta Henry untuk Sistem Solute Polar dalam Polimer
Abstark
Dalam penelitian ini, Konstanta Henry dari solute polar dalam polimer diperoleh dari finite
contrentation data VLE (vapor liquid equilibrium) dengan metode ekstrapolasi persamaan
UNIQUAC pada limit konsentrasi solute mendekati nol. Hasil ektrapolasi tersebut di
crosschek dengan data infinite dilution yang diperoleh dari metode inversi gas liquid
chromathography (IGC) melalui hubungan linier antara ln 1/Kp dengan 1/T. Hasil yang
diperoleh untuk sistem 11 solute polar dalam 4 polimer menunjukan suatu konsistensi yang
baik kecuali untuk sistem acetone- polyvinyl acetate. Dari kedua metode tersebut dibuat
korelasi umum, yang didasarkan pada prinsip corresponding state untuk masing-masing
polimer.
Key Word : Finite Concentration, Infinite Dilution, Korelasi Umum, Konstanta Henry
H 1 = Ω 1∞ f 10 L (7) 1 b
ln = a+ (10)
Pada tekanan rendah, fugasitas liquid murni Kp T
dari compenen 1, f10L adalah sama pada tekanan dimana a dan b adalah konstanta yang
uapnya. Definisi lain dari konstanta Henry tergantung dari masing-masing sistem. Hasil
adalah : dari korelasi persamaan tersebut dibuat average
p1 absolute deviation (AAD) dan ditampilkan
K P = (8) dalam tabel 2.
V 10
4. Korelasi Umum Konstanta Henry
dimana P1 adalah tekanan parsial solute dalam Korelasi umum konstanta Henry sistem solute-
Pa, dan V10 adalah solubilitas solven dalam polimer dikembangkan dan didasarkan pada
molten polimer dalam m3 (STP)/kg polimer dan prinsip corresponding state, prinsip ini
membutuhkan konstanta kritis solute. Metode suatu analisis hubungan antara ln (1/Kp)
ini telah dikembangkan diantaranya oleh Stiel, dengan Tc/T, baik slope maupun intercept
dkk (1985), Chiu dan Chen (1996) untuk bergantung pada faktor acentrik dari masing-
solute non polar. Pada penelitian ini kedua masing solven sebagai berikut :
metode tersebut diaplikasikan untuk solubilitas
-6 -6
2.0 2.5 3.0 3.5 4.0 1.5 2.0 2.5 3.0 3.5 4.0
-8 -8
-10 -10
ln 1/Kp
ln 1/Kp
-12 -12
-14 -14
prediksi
prediksi
-16 IGC -16
IGC
-18 -18 1000/T
1000/T
Gambar 1. Konstanta Henry propanol dalam PVA Gambar 2. Konstanta Henry 2 propanol dalam PVAc
-6 -6
1,5 2,0 2,5 3,0 3,5 4,0 2,0 2,5 3,0 3,5 4,0
-8 -8
-10 -10
ln 1/Kp
ln 1/Kp
-12 -12
-14 -14
prediksi prediksi
-16 -16
IGC
IGC
-18 -18
1000/T
1000/T
Gambar 3.Konstanta Henry 2 butanol dalam PVAc Gambar 4. Konstanta Henry acetone dalam PVAc
Tabel 3 : AAD antara persamaaan Stiel dan Chiu dan Chen untuk 11 solute dalam PI
Tabel 4 : AAD antara persamaaan Stiel dan Chiu dan Chen untuk 11 solute dalam PIB
Tabel 5 : AAD antara persamaaan Stiel dan Chiu dan Chen untuk 11 solute dalam PBMA
Tabel 6 : AAD antara persamaaan Stiel dan Chiu dan Chen untuk 11 solven dalam PVAc
Polymer-solvent Jumlah AAD (%)
Data Stiel Chiu & Chen van't Hoff
PVAc Methanol 6 3.33 4.67 2.54
Ethanol 5 1.54 1.21 4.58
Propanol 13 2.37 4.02 0.93
2-Propanol 19 1.74 3.72 0.75
Butanol 17 9.30 8.77 2.26
2-Butanol 12 2.48 2.63 1.07
2-methyl-1-propanol 5 5.57 3.95 1.08
Acetone 4 5.89 2.85 4.19
MEK 4 4.85 1.60 0.07
Methyl acetate 5 4.67 2.45 2.48
Propyl acetate 5 4.96 2.45 3.12
Tabel 7 : AAD antara persamaan Stiel (1996) dan Chiu dan Chen (1985) untuk 4 polimer.
Polimer AAD %
Stiel (1996) Chiu dan Chen (1985)
PI 13.5 10.9
PIB 18.2 12.5
PBMA 14.5 14.8
PVAc 13.5 13.8
masing solute. Korelasi umum PVAc, analisa didasarkan pada corresponding state
menunjukkan bahwa kedua korelasi baik menggunakan persamaan (11) dan (12) dapat di
dengan persamaan (19) maupun persamaan terapkan untuk sistem 11 solute polar dalam
(20) menunjukkan AAD yang sama masing- polimer PI, PIB, PBMA dan PVAc.
masing 3,8%, pada korelasi ini sistem acetone-
Daftar Notasi
PVAc tidak diikutkan, karena tidak adanya
a konstanta persamaan (10)
konsistensi sewaktu di crosschek
2
a1 aktifitas solven
⎛ 1 ⎞ ⎛ Tc ⎞
ln ⎜⎜ ⎟⎟ = − 18 ,819 + (1, 557 + 2 , 239 ω ) ⎜ ⎟
⎝ Kp ⎠ ⎝ T ⎠ aij parameter interaksi persamaan UNIQUAC
(19) b konstanta persamaan (10)
⎛ 1 ⎞ ⎛ Tc ⎞ fi fugasitas state untuk solven murni (Pa)
ln⎜⎜ ⎟⎟ = −30,210 + 7,045ω + (10,236 −1,972ω)⎜ ⎟
⎝ Kp ⎠ ⎝T ⎠ H konstanta Henry fraksi massa (Pa)
(20)
Kp konstanta Henry (Pa kg/m3 (STP))
Untuk PIB dan PBMA, AAD menunjukkan
bahwa dengan korelasi persamaan (11) dan Mi massa molar komponen i (kg/mol)
persamaan (12) tidak menunjukkan perbedaan nirep number of repeat dalam componen i
yang signifikan seperti yang ditunjukkan pada
pi tekanan parsial (Pa)
tabel 2, sehingga PBMA dan PVc disarankan
untuk menggunakan persamaan (11) karena qi parameter luas untuk componen i
lebih sederhana.
ri parameter volume untuk komponen i
5. Kesimpulan
T temperatur (K)
Verifikasi finite concentration data VLE
dengan data infinite dilution menggunakan Tc temperatu kristis (K)
hubungan linier antara konstanta logaritma
Tg temperatur transisi glass (K)
Henry dengan invers temperatur telah berhasil
diaplikasikan untuk sistem polar–polimer, Vi0 solubiltas solven (m3(STP)/kg)
kecuali untuk sistem acetone-PVAc. Sedangkan w fraksi massa
korelasi umum konstanta Henry yang
1) Staf Pengajar Jurdik Kimia FKIP Univ. Syiah Kuala Darussalam Banda Aceh 23111
2) Staf Pengajar Dept. Kimia FMIPA ITB Jl. Ganesa 10 Bandung 40132
Abstrak
Telah disintesis kopoliester dari senyawa ε- kaprolakton dan 2,2-dimetil-1,3-propandiol
dengan menggunakan katalis kompleks distannoksan. Pada penelitian ini telah dipelajari
pengaruh komposisi monomer yang digunakan terhadap struktur kopolimer,viskositas, dan
sifat termal kopoliester yang dihasilkan. Hasil penelitian menunjukkan bahwa semakin tinggi
kandungan monomer ε- kaprolakton dalam campuran awal komonomer maka terjadi
peningkatan kandungan monomer tersebut dalam kopolimer yang terbentuk, sehingga terjadi
peningkatan titik leleh dan viskositas poliester. Hasil ini juga didukung oleh data bilangan
hidroksi poliester yang menurun seiring dengan meningkatnya kandungan monomer ε-
kaprolakton.
Kata Kunci: Sintesis, oligomer, ε- kaprolakton.
poliester-uretan dengan karakteristik yang diukur dalam bentuk pelet KBr dengan berat
diinginkan. sampel dibuat konstan. Viskositas oligomer hasil
sintesis ditentukan secara viskometri dengan alat
2. Percobaan
viskometer Ostwald, dimana hasilnya dikonversi
2.1 Bahan
dari data waktu alir menjadi viskositas instrinsik.
Bahan kimia utama yang diperlukan ialah:
Penetuan sifat termal berupa titik leleh dilakukan
dibutiltin oksida (Aldrich), dibutiltin diklorida
dengan alat DTA. Bilangan hidroksi kopoliester
(Aldrich), neopentil glikol (Aldrich), ε-
yang dihasilkan ditentukan dengan metode
kaprolakton (Aldrich), nitrogen cair (PPTN
titirimetri sesuai dengan prosedur ASTM D2849
Bandung) , kloroform p.a, (E-Merck) , n-heksana
– 69 sebagai berikut: Sebanyak 0,5 g sampel
p.a. (E-Merck).
ditambahkan 4 mL reagen asetilasi yang dibuat
2.2 Metoda dengan mencampurkan 127 mL asam asetat
2.2.1 Sintesis kopolimer anhidrida dengan 1000 mL piridin. Kemudian
Sebanyak 0,20 g katalis distannoksan diisi ke dipanaskan pada suhu 98 oC selama 2 jam, lalu
dalam reaktor polimerisasi, selanjutnya didinginkan pada temperatur kamar. Kemudian
dipanaskan pada suhu 80oC selama 4 jam dalam dibilas dengan 6 mL aquadest, lalu didiamkan
kondisi vakum (tekanan 2-5 mmHg). Sebanyak selama 24 jam. Tambahkan indikator pp 1 %
5,0 g ε-kaprolakton dan 0,625 g 2,2-dimetil-1,3- sebanyak 3-4 tetes dan lakukan titirasi dengan
propandiol (perbandingan mol ε-kaprolakton dan larutan KOH 0,1 N. Bilangan hidroksi ditentukan
2,2-dimetil-1,3-propandiol = 10 : 1) selanjutnya dengan persamaan berikut:
dimasukkan ke dalam reaktor yang telah berisi Bilangan Hidroksi (mg KOH/g) = [( B − A) Nx 40] (1)
katalis, lalu divakum selama 15 menit. Kemudian W
dilakukan degassing sebanyak dua kali dengan
menggunakan campuran 1 L metanol teknis Dimana: B = jumlah mL KOH yang diperlukan
dengan 500 mL nitrogen cair. Setelah itu reaktor untuk titrasi blanko
di seal dalam keadaan vakum dan selanjutnya A = jumlah mL KOH yang diperlukan
dilakukan polimerisasi dalam batch yang berisi untuk titrasi sampel
minyak parafin pada suhu 100 oC selama 4 jam.
N = Normalitas KOH
Kondisi yang sama diulang untuk komposisi: mol
ε-kaprolakton: 2,2-dimetil-1,3-propandiol adalah W = berat sampel (g)
20:1; 30:1; 40:1 dan 50:1. 3. Hasil dan Pembahasan
2.2.2 Karakterisasi 3.1 Sintesis Kopolimer
Karakterisasi terhadap kopolimer meliputi Jalur sintesis kopolimer poliester dapat dilihat
penentuan struktur, penentuan viskositas, pada gambar 3.
pengukuran sifat termal dan pengukuran bilangan 3.2. Struktur kopolimer
hidroksi. Struktur oligomer yang dihasilkan Secara kualitatif, hasil pengukuran spektra IR
ditentukan dengan alat FTIR Shimadzu series (Gambar 4) untuk kopolimer diperoleh data
8400 dan NMR- 1H dan NMR-13C. Sampel serapan sebagai berikut: 3440 cm-1 (s, -OH);
100oC, 5 mmHg
+
OH OH
O
O
ε-kaprolakton 2,2-dimetil-1,3-propandiol
O O
O O
H O O H
n n
Poli(ε-kaprolakton-co-2,2-dimetil-1,3-propandiol)
Gambar 3. Reaksi pembentukan kopolimer dari monomer ε- kaprolakton dan 2,2- dimetil-1,3-
propandiol
2954,7 , 2877,6 cm-1 (s, C-H dari –CH2-); 1728,1 Terbentuknya kopolimer dapat dibuktikan
cm-1 (s, -C=O dari R-CO-O-R), 1473,5 cm-1(s, melalui spektra NMR-1H (Gambar 5) dan 13C
CH3-C), 1396 cm-1(m, CH3-C) dan 1180,4 cm-1 (gambar 6). Berdasarkan spektra NMR-1H di
(s, -CH2-CO-O-R). Berdasarkan data serapan atas, terlihat adanya puncak serapan oleh bagian
jelaslah bahwa telah terbentuk oligomer seperti 2,2-dimetil-1,3-propandiol dan bagian ε-
reaksi pada gambar1. Hal ini tampak pada kaprolakton. Serapan yang dihasilkan oleh bagian
serapan disekitar 3440 cm-1 oleh gugus –OH, 2,2-dimetil-1,3-propandiol terjadi pada δ : 0,86-
dimana terjadi intensitas serapan yang tajam 0,93 ppm (m, C(CH3)2) dan 3,82-3,89 ppm (m,
untuk monomer 2,2-dimetil-1,3-propandiol. Akan OCH2), sedangkan bagian ε-kaprolakton
tetatpi setelah terbentuk kopolimer terjadi memberikan serapan empat puncak yang sangat
penurunan yang signifikan pada daerah tersebut. tajam pada δ: 1,25-1,40 (CH2CH2CH2COO),
Terjadinya penurunan tersebut disebabkan gugus 1,55-1,65 (OCH2CH2 dan CH2CH2COO), 2,20-
hidroksil yang terdapat pada senyawa 2,2- 2,35 (CH2COO) dan 3,95-4,05 (OCH2).
dimetil-1,3-propandiol telah bereaksi dengan
senyawa ε-kaprolakton membentuk kopolimer. Pembentukan kopolimer juga diperkuat oleh data
Adapun serapan gugus –OH pada kopolimer serapan NMR 13C (Gambar 6). Hal ini jelas
dihasilkan oleh gugus –OH pada ujung rantai, terlihat adanya serapan oleh bagian 2,2-dimetil-
dimana pada setiap rantai kopolimer terdapat dua 1,3-propandiol dan ε-kaprolakton. Bagian 2,2-
gugus –OH (Gambar 4). dimetil-1,3-propandiol memberikan tiga puncak
Tabel 1. Komposisi monomer dan berat molekul kopolimer pada berbagai variasi komposisi monomer
serapan yang dihasilkan masing-masing pada δ( Hasil perhitungan komposisi dan berat molekul
ppm): 22,0 (C(CH3)2), 32,2 (C(CH3), 62,5 kopolimer selengkapnya dapat dilihat pada tabel
(OCH2), adapun bagian ε-kaprolakton dihasilkan 1.
pada δ( ppm): 24,5 (CH2CH2COO), 25,2 Berdasarkan tabel 1, tampak bahwa semakin
(OCH2CH2), 28,3 (OCH2CH2CH2), 64,1 banyak monomer ε-kaprolakton dalam campuran
(OCH2CH2) dan 173,5 (COO). monomer sebelum sintesis, maka kandungan
3.3 Pengaruh komposisi monomer sebelum senyawa tersebut dalam kopolimer semakin
sintesis terhadap komposisi monomer dalam meningkat hingga perbandingan mol 40:1. Akan
kopolimer tetapi pada perbandingan mol awal 50:1,
Komposisi monomer dalam kopolimer ditentukan peningkatan kandungan senyawa lakton hanya
dengan mengukur spektra NMR 1H untuk sampel sekitar 50% dari campuran monomer awal. Hal
kopolimer pada berbagai variasi komposisi ini dapat dijelaskan sebagai berikut: mekanisme
Gambar (7). Dengan menghitung rasio integrasi pembentukan kopolimer berlangsung dalam dua
absorbansi salah satu puncak serapan proton tahap. Tahap pertama terjadi reaksi antara
bagian ε-kaprolakton dengan salah satu puncak monomer ε-kaprolakton dan 2,2-dimetil-1,3-
serapan bagian 2,2-dimetil-1,3-propandiol pada propandiol hingga semua monomer diol habis
berbagai variasi komposisi akan diperoleh data bereaksi. Tahap ke dua ialah terjadi perpanjangan
komposisi monomer dalam oligomer. rantai oleh monomer ε-kaprolakton pada setiap
Berdasarkan data komposisi dapat ditentukan ujung rantai. Perpanjangan rantai terus
berat molekul. Dalam hal ini puncak serapan berlangsung efektif hingga batas komposisi
yang dipilih ialah pada δ= 0,8-0,9 (C(CH3)2) tertertu. Pada komposisi yang lebih besar, yakni
untuk bagian 2,2-dimetil-1,3-propandiol dan δ = 50:1, pertambahan panjang rantai menjadi
2,20-2,35 (CH2COO) dari bagian ε-kaprolakton. berkurang. Hal ini terkait dengan kereaktifan
100
Viskositas x E +3
90
80
70
60
50
40
C-1 C-2 C-3 C-4 C-5
Kom posisi m onom er
polimer, dimana semakin panjang rantai polimer molekul polimer menyebabkan jumlah rantai
yang terbentuk kereaktifannya juga berkurang polimer semakin menurun, sehingga jumlah
gugus hidroksi juga menurun karena pada
3.2.2 Pengaruh komposisi monomer terhadap
bilangan hidroksi dan viskositas oligomer pembentukan kopolimer blok antara monomer ε-
Data hubungan antara komposisi monomer kaprolakton dan neopentilglikol diasumsikan
dengan viskositas dan bilangan hidroksi polimer hanya terdapat dua gugus hidroksi untuk setiap
berturut-turut dapat dilihat pada gambar 8 dan rantai. Hal ini didukung oleh data bilangan
gambar 9. Berdasarkan data pada gambar 8 hidroksi yang cenderung menurun seiring dengan
tampak bahwa semakin tinggi fraksi mol meningkatnya kandungan monomer ε-
monomer ε- kaprolakton dalam polimer maka kaprolakton dalam kopolimer. Panjang rantai
viskositas polimer terjadi peningkatan. Hasil ini suatu molekul polimer juga terkait dengan berat
didukung oleh data bilangan hidroksi (gambar 9) molekul dan viskositas, dimana semakin panjang
dan berat molekul, dimana bilangan hidroksi rantai molekul polimer maka viskositas dan berat
kopolimer menurun seiring dengan meningkatnya molekulnya juga semakin meningkat. Hasil ini
juga sesuai dengan data viskositas (Gambar 8).
fraksi mol monomer ε- kaprolakton. Hal ini
berarti bahwa terjadi reaksi pembentukan blok 3.2.3 Pengaruh komposisi monomer terhadap
kopolimer. Semakin besar fraksi mol monomer ε- sifat termal oligomer
kaprolakton maka rantai polimer yang terbentuk Titik leleh polimer meningkat seiring dengan
semakin panjang. Bertambahnya panjang rantai meningkatnya jumlah mol monomer ε-
Bilangan hidroksi
215 terbentuk semakin tinggi seiring dengan
195 bertambah besar jumlah mol ε-kaprolakton,
175 sedangkan bilangan hidroksi menurun dengan
155 meningkatnya jumlah mol monomer tersebut.
135
5. Daftar Pustaka
115
Considine, W.J., and Gerald, A.B, (1965), The
C-1 C-2 C-3 C-4 C-5
NMR Spektra of a Distannoxane,J.
Kom posisi Organometal Chem., 3 308-313.
Gambar 9. Kurva hubungan komposisi Doi, Y., Tanahasyi, N., (1991), The Chemical
monomer terhadap bilangan hidroksi Synthesis of P (3HB) by ring-opening
Polymerization of ®- or (S) β -D-L-
Butyrolactone, Macromolecules, 27, 3139-3146
80
Findley, R.H., and White, D.C.,(1983). Appl.
Environ. Microbiol., 45 : 71
titik leleh (oC )
75
70
Hori, J., Suzuki, M., Okeda, Y., Imai, T.,
65 Sakaguchi, M., Takahasyi, Y., Yamaguchi, A.,
60 and Akutagawa, S., (1992), A Novel
55 Biodegradable Poly(Urethane Esther) Sinthesized
C- 1 C -2 C -3 C -4 C- 5 from Poly(3-hydroxybutyrate) Segments,
kom posisi m onomer Macromolecules, 25, 5117 – 5118.
Hiltunen, K., Harkonen, M., Seppala, J.V., and
Gambar 10. Kurva hubungan antara komposisi Vaananen, T., (1996), Synthesis and
monomer terhadap titik leleh Kopolimer Characterization of Lactic acid based telechelic
prepolymers, Macromolecules, 29, 8677 – 8682.
kaprolakton dalam polimer (gambar 10). Hal ini
berarti bahwa rantai polimer bertambah panjang John, D.B., Lenz, R.W., Luick, A., (1984), Ring
dengan bertambahnya kandungan monomer ε- opening polimerization; Ivin, K.J., Saegusa, T.,
kaprolakton yang mempengaruhi kenaikan berat Eds; Elsevier Appl. Sci. Pbl.; London, 1, 7, 461
molekul, sehingga sifat termal polimer semakin Kylma, J., (2001), Lactic acid based Poly(Esther-
tinggi. Urethane) – Modification via copolymerization,
4. Kesimpulan chain linking and blending, Dissertation, Univ. of
Reaksi pembentukan oligomer antara monomer Tech. Espoo, Finland
ε-kaprolakton dan neopentil glikol telah Lori, A.H., Yuri, Y.S., and Richarde,
berlangsung. Hasilnya yaitu terbentuknya A.G.,(1996), Enzyme-Catalyzed Polimerizations
kopolimer blok, dimana semakin besar jumlah of ∈- aprolactone: effect of initiator on product
mol monomer ε-kaprolakton maka rantai strukture, propagation kinetics, and mechanism
oligomer yang terbentuk semakin panjang. Macromolecules , 29, 7759-7766.
Kandungan monomer lakton dalam kopolimer
yang terbentuk semakin meningkat seiring Lundber, R.D., and Cox, E.F., (1969), Ring
dengan meningkatnya kandungan monomer Opening Polymerization , Marcel Dekker, New
York.
Abstract
Due to drug resistant problems, there is an urgent need to discover and develop new anti-
tuberculosis lead compounds. In this study, quantitative structure-activity relationship
(QSAR) models have been used to discover and predict the anti-tuberculosis activity of
chemical compounds from a large database. The approach begins with the development of
rigorously validated QSAR models obtained using genetic algorithm-partial least square
(GAPLS) and multiple linear regression analysis (MLRA) methods. The data set used in model
development consists of 122 plant terpenoids with moderate to high activity against
Mycobacterium tuberculosis. The QSAR models were applied to mining chemicals in a
database consisting of 3319 compounds. The degree of similarity (based on Euclidean
distance) between active compounds in data set and those in the database was calculated
using the same set of descriptors used in the QSAR models. A total of 18 compounds were
short-listed. By applying the applicability domain criterion the number of possible candidates
could be further narrowed down. Finally, the biological activity of these compounds were
calculated and predicted to be active anti-tuberculosis, i.e. with minimum inhibition
concentration of less than 62.5µg/mL.
Keywords: QSAR, anti tuberculosis, plant terpenoids, database mining, applicability domain
Ethylbutanol OH 48.8
OH
2-isobuthyl-4,5- 24.2
dimethyl-phenol
O
1-phenanthren-9-yl- 12.7
propan-1-one
S
Cis-4-(2- SH 40.9
mercaptothiazolinyl) 3- NH O
buten-2-one
Abstrak
Salah satu surfaktan yang banyak digunakan adalah sorbitan monooleat, yang dapat
diperoleh melalui proses esterifikasi antara sorbitol dan asam oleat. Adanya air sebagai hasil
samping dari proses esterifikasi ini dapat menyebabkan kesulitan – kesulitan dalam
memperoleh sorbitan monooleat. Hal ini dapat diatasi dengan distilasi reaktif. Oleh karena
itu tujuan dari penelitian ini adalah mempelajari kinetika reaksi esterifikasi asam oleat
dengan sorbitol menggunakan H2SO4 sebagai katalisator melalui distilasi reaktif, dan
mempelajari pengaruh suhu, komposisi reaktan, dan konsentrasi katalis terhadap konversi
reaksi esterifikasi. Percobaan dilakukan dalam reactor batch (labu leher tiga) dengan kondisi
operasi : tekanan atmosferik, pengadukan konstan. Percobaan dilakukan dengan memvariasi
temperatur, rasio molar sorbitol dengan asam oleat, dan konsentrasi katalis. Proses
esterifikasi dilakukan selama 60 menit. Ester yang terbentuk ditentukan melalui analisa
bilangan asam, dan skala warna, yang dilakukan sampling setiap periode waktu tertentu.
Dari penelitian diperoleh hasil bahwa konversi reaksi akan meningkat dengan naiknya
temperatur operasi, rasio molar sorbitol dengan asam oleat, serta konsentrasi katalis. Reaksi
esterifikasi mengikuti reaksi reversibel order satu terhadap masing – masing reaktan.
Kata kunci : sorbitan monooleat, esterifikasi, destilasi reaktif
C
Keterangan :
B A. Termometer
B. Motor Listrik
C. Kondenser
A D. Bath oil
E E. Statif
F. Labu Leher Tiga
F
Tabel 1 Data Bilangan asam dan volume air pada temperatur 130 oC,
sorbitol : asan oleat 1:1, dan konsentrasi katalis 1%
Waktu Bilangan Asam Volume Air
(menit) (gKOH/g) (ml)
0 197,552 0
10 163,98 2,8
20 139,00 3,2
30 129,48 4,0
40 118,25 4,8
50 117,47 5,0
60 86,35 7,2
250.00
8
7
200.00
B il.as am (g K O H /g )
6
volume air(ml)
150.00 5
4
100.00
3
50.00 2
1
0.00
0
0 20 40 60 80 0 10 20 30 40 50 60 70
Gambar 2. Hubungan antara bilangan asam Gambar 3 Hubungan volume air terhadap
dan waktu (130oC,sorbitol : asam oleat 1:1, waktu reaksi (130oC, sorbitol :asam oleat 1:1,
H2SO4 1%) H2SO4 1%)
0.6 0.45
0.5 0.4
0.35
Konversi, XA
0.4
Konversi,XA
0.3
0.3 0.25
Sorbitol :As.oleat 1:1,5 0.2
0.2
0.15 kons.katalis 1%
Sorbitol :As.oleat 1:1
0.1 0.1 Kons.katalis 3%
Sorbitol:As.oleat 1,5:1
0.05 Kons.katalis 5%
0
0
130oC 140oC 150oC 160oC
130oC 140oC 150oC 160oC
Gambar 4 Pengaruh temperatur terhadap konversi Gambar 5 Pengaruh temperatur terhadap konversi
reaksi (konsentrasi H2SO4 5%) reaksi (komposisi reaktan 1:1)
langsung dari reaksi esterifikasi antara asam sorbitan monooleat yang terbentuk (bilangan
karboksilat (asam oleat) dan sorbitol dengan asamnya).
katalis yang homogen. Reaksi ini berlangsung
2.3 Kondisi operasi dan Variabel penelitian :
lambat dan reversibel dengan persamaan reaksi Tekanan : atmosferik (1 atm)
seperti berikut :
Suhu : 180 oC.
C18H35COOH + C6H8(OH)6 Ù C25H48 O7 + H2O
Ratio sorbitol/asam asetat : 0,1 ; 1 ; 10
(1)
Konsentrasi katalis PTSA : 2,5% ; 5 %; 7,5 %; 10 %
Untuk kebutuhan memproduksi surfaktan
sorbitan monooleat maka diperlukan data-data 3. Hasil dan Pembahasan
kinetika reaksi esterifikasi asam oleat dengan Langkah awal yang dilakukan dalam penelitian
sorbitol. Oleh karena itu, tujuan dari penelitian ini adalah dengan melakukan karakterisasi asam
ini adalah mempelajari kinetika proses oleat dan sorbitol yang digunakan dalam
esterifikasi surfaktan sorbitan monooleat dari penelitian ini. Asam oleat yang digunakan dalam
sorbitol dan asam monooleat dengan penelitian ini mempunyai densitas 0,8957
menggunakan katalis PTSA gram/ml, bilangan asam sebesar 197,552 gram
KOH per gram, bilangan penyabunan sebesar
2. Metodologi Penelitian 99,418 gram KOH / gram, warna (D-1500)
2.1 Peralatan Percobaan sebesar 2 dan viskositas sebesar 3,35 cP.
Peralatan experimen terdiri dari labu leheher tiga Sorbitol yang digunakan mempunyai densitas
pyrex dengan volume 1 liter, yang dipasang sebesar 1,3157 gram / ml, dan viskositas sebesar
dengan refluk kondensor untuk mencegah 23,2823 cP. Pada proses esterifikasi, dilakukan
kehilangan produk dan dilengkapi dengan pengambilan sampel setiap selang waktu 10
termometer untuk mengetahui suhu reaksi. menit selama satu jam reaksi dan dianalisa
Sebuah pengaduk kaca type anchor yang perubahan konsentrasi asam oleat (bilangan
digerakkkan oleh motor pengaduk digunakan asam)
untuk mencapai homogenitas campuran (Gambar
1). Suhu reaktan dijaga konstan dengan 3.1. Pengaruh Temperatur
menggunakan pengatur oil bath. Penelitian ini dilakukan pada variasi temperatur
130, 140, 150, dan 160 oC. Dari hasil penelitian
2.2 Prosedur Percobaan ini, dapat diketahui bahwa semakin tinggi
Sorbitol dan PTSA disikan kedalam reaktor pada temperatur yang digunakan, maka semakin besar
perbandingan tertentu dan asam monooleat sorbitan monoleat yang diperoleh. Hal ini terlihat
dimasukkan kedalam corong tetes (dropping dengan adanya peningkatan konversi pada setiap
funnel). Setelah suhu yang diinginkan tercapai, kenaikan konsentrasi produk yang dihasilkan.
asam monooleat dialirkan kedalam reaktor. Saat Pada komposisi reaktan 1:1, dan konsentrasi
tersebut dipandang sebagai awal dari waktu katalis 1% dapat diketahui bahwa konversi reaksi
reaksi. Sample reaktan (kurang lebih 5 ml) 60 menit pada temperatur 130 oC sebesar 0,2964,
diambil melalui pipet setiap periode waktu temperatur 140 oC sebesar 0,3222, temperatur
tertentu (5 – 10 menit) untuk dianalisa kandungan 150 oC sebesar 0,3297, dan pada temperatur 160
o
C sebesar 0,3542.Kenaikan ini walaupun sangat
kecil tetapi tampak bahwa dengan adanya sangat kecil tetapi tampak bahwa dengan adanya
kenaikan temperatur akan menaikkan konversi kenaikan rasio molar sorbitol : asam oleat akan
pada berbagai rasio molar sorbitol : asam oleat menaikkan konversi pada berbagai temperatur
seperti pada gambar 4, pada berbagai konsentrasi reaksi seperti pada gambar 6., dan pada berbagai
katalis seperti tampak pada gambar 5. konsentrasi katalis seperti tampak pada gambar
7.
Sebagai mana telah diketahui bahwa temperatur
berpengaruh terhadap kecepatan reaksi 3.3. Pengaruh Konsentrasi Katalis
esterifikasi, mengikuti persamaan Arrhenius : k = Konsentrasi katalisator yang diteliti adalah 1%,
ko Exp (-E/RT). Dari persamaan ini tampak 3%, 5% terhadap mol sorbitol. Dari hasil
bahwa semakin besar temperatur maka semakin penelitian ini ternyata konsentrasi katalisator
besar harga tetapan kecepatan reaksi sehingga yang semakin besar, menyebabkan jumlah
semakin besar sorbitan monooleat yang sorbitan monooleat yang terbentuk semakin
dihasilkan. Selain itu jika ditinjau dari segi besar, hal ini terlihat dengan adanya peningkatan
kinetika molekuler, peningkatan temperatur akan konversi pada setiap kenaikan konsentrasi produk
mempengaruhi pningkatan tumbukan – tumbukan yang dihasilkan. Pada temperatur operasi 130 oC,
antar molekul reaktan. Peningkatan tumbukan – komposisi reaktan 1:1,5 terlihat bahwa pada
tumbukan antar molekul reaktan akan konsentrasi 1% tercapai konversi di akhir reaksi
memungkinkan semakin besarnya konversi asam sebesar 0,4332, pada konsentrasi 3 % tercapai
oleat dan sorbitol menjadi sorbitan monooleat. konversi 0,4389 di akhir reaksi dan pada
Hal ini menyebabkan asam yang terkonversi konsentrasi 5% tercapai 0,4411. Kenaikan ini
menjadi sorbitan monooleat semakin tinggi. walaupun sangat kecil tetapi tampak bahwa
dengan adanya kenaikan konsentrasi akan
3.2. Pengaruh Komposisi Reaktan
menaikkan konversi pada berbagai temperatur
Komposisi reaktan (molar sorbitol : molar asam
reaksi seperti pada gambar 8, dan pada berbagai
oleat) yang diteliti adalah 1:1 ; 1:1,5 ; 1,5:1. Dari
komposisi reaktan seperti tampak pada gambar
hasil penelitian diperoleh bahwa semakin besar
9.
rasio molar sorbitol dengan asam oleat,
menyebabkan jumlah sorbitan monooleat yang Jumlah katalis yang digunakan dalam reaksi
terbentuk semakin semakin besar. Hal ini terlihat esterifikasi asam oleat dan sorbitol menjadi
dengan adanya peningkatan konversi yang sorbitan monooleat sangat mempengaruhi hasil
diperoleh pada setiap kenaikan rasio molar perolehan. Hal ini disebabkan karena konstanta
sorbitol dengan asam oleat. Pada temperatur kecepatan reaksi dipengaruhi oleh konsentrasi
operasi 130oC, konsentrasi katalis (H2SO4) 1%, katalisator, yaitu konsentrasi ion hidrogen,
menunjukkan bahwa pada rasio molar sorbitol : semakin tinggi konsentrasi ion hidrogen maka
asam oleat 1:1 tercapai konversi di akhir reaksi semakin tinggi kecepatan reaksinya sehingga
reaksi sebesar 0,3147, pada rasio molar sorbitol konversi reaksi semakin besar.
:asam oleat 1:1,5 tercapai konversi di akhir reaksi
3.4 Kinetika Reaksi
sebesar 0,4041, dan pada rasio molar sorbitol :
Untuk memudahkan penulisan rumus dalam
asam oleat 1,5:1 tercapai konversi pada akhir
kecepatan reaksi kimia maka persamaan reaksi
reaksi sebesar 0,4025. Kenaikan ini walaupun
0.6 0.5
0.5
0.4
Konversi,XA
0.4
Konversi,XA
0.3
0.3
Gambar 6. Pengaruh Komposisi reaktan terhadap Gambar 7. Pengaruh Komposisi reaktan terhadap
konversi reaksi (H2SO4 3%) konversi reaksi (T= 130 oC )
kimia diatas ditulis sebagai berikut : Untuk mengestimasi laju reaksi, beberapa
dimana : [A] = konsentrasi asam oleat konsiderasi berikut dilakukan :
[B] = konsentrasi sorbitol Keadaan kesetimbangan yang terjadi ketika
[C] = konsentrasi sorbitan monooleat
[D] = konsentrasi H2O kecepatan mendekati nol dan dinyatakan dengan
Laju reaksi pembentukan sorbitan monooleat hukum aksi massa sebagai berikut :
dinyatakan dengan persamaan berikut : k1 [C][ D]
rc = k1 [A]a[B]b – k2 [C]c[D]d K= =
k 2 [ A][ B]
Untuk menentukan konstanta – konstanta
kinetika reaksi, digunakan metode integral Dimana K adalah konstanta yang mencirikan
dengan pencocokan parameter (fitting parameter) kesetimbangan reaksi.
seperti berikut. Setelah waktu reaksi dan Persamaan neraca massa dalam reaktor batch
konsentrasi asam monooleat dibuat grafiknya, dengan persamaan kecepatan reaksi yang
kemudian dibandingkan dengan kurva yang telah diusulkan untuk sistem diatas dinyatakan dengan
diketahui orde dan kecepatan reaksinya (model :
kinetikanya). Kemudian selisih antara data
experimental dan data hasil perhitungan yang dC/dt = k1[A][B] – k2[C][D]
menggunakan model kinetika diminimumkan
dengan metode optimasi, sehingga diperoleh [A] = [A]o - [C]
harga konstanta – konstanta kinetika.
[B] = [B]o – [C]
Untuk itu diusulkan :
[C] = [D]
Order reaksi ke arah kanan :a=b=1
Order reaksi ke arah kiri :c=d=1 akan menjadi :
0.452
0.45 0.45
0.448 0.4
0.446 0.35
Konversi,XA
Konversi,XA
0.444 0.3
0.442 0.25
0.44 0.2
0.438 Temp.130o C 0.15
Temp.140o C CSBo:CAOo 1:1
0.436 0.1
Temp.150o C
CSBo:CAOo 1:1,5
0.434 0.05 CSBo:CAOo 1,5:1
Temp.160o C
0.432 0
0% 1% 2% 3% 4% 5% 6% 0% 1% 2% 3% 4% 5% 6%
Kons.Katalis Kons.Katalis
Gambar 8 Pengaruh konsentrasi katalis terhadap Gambar 9 Pengaruh konsentrasi katalis terhadap
konversi reaksi (komposisi reaktan 1:1,5) konversi reaksi (temperatur 150 oC)
1.2
Konsentrasi SMO (M)
1
0.8
0.6
0.4 SMO,exp
0.2 SMO,calc
0
0 10 20 30 40 50 60 70
t(m in)
Gambar 10 Perbandingan data percobaan dan data hasil perhitungan dengan model kinetika
(50oC, komposisi reaktan 1:1,5, katalis 3%)
dC/dt = k1( [A] o – [C] ) ( [B] o – [C] ) yang digunakan dan konsentrasi katalis
– k2[C] 2 (asam sulfat).
dengan mengintegralkan dC/dt akan Konstanta kecepatan reaksi esterifikasi
menghasilkan persamaan berikut (Bart, 1994) : asam oleat dengan sorbitol dengan H2SO4
1/ 2 2
sebagai katalis akan meningkat dengan
[C]= {(et(−∆) −1)(k1 ([A]o −[B]o )2 − ∆}
1/ 2
meningkatnya temperatur operasi, rasio
{2(k1 −k2 )[(k1([A] +[B] ) + (−∆) )et(−∆) −(k1([A]o +[B]o ) −(−∆)1/ 2 )]}
o o 1/ 2
molar sorbitol dengan asam oleat, dan
konsentrasi katalis (H2SO4) yang digunakan.
dimana : ∆ = 4(k1-k2)k1[A]o[B]o-k12([A]o-[B]o)2
Proses esterifikasi asam oleat dan
Persamaan diatas digunakan untuk menghitung sorbitol mengikuti reaksi reversibel order
konsentrasi sorbitan monooleat setiap saat untuk satu terhadap masing – masing reaktan.
mendapatkan harga – harga konstanta keepatan
reaksi. Destilasi reaktif dalam esterifikasi ini
kurang berjalan dengan baik.
Gambar 4.9 menunjukkan perbandingan antara
data – data hasil percobaan dan data hasil 5. Ucapan terima kasih
perhitungan menggunakan persamaan diatas. Ucapan terima kasih sampaikan kepada
Dari gambar 4.9 menunjukkan kesesuaian antara Kementrian Ristek RI, yang telah memberikan
model kinetika yang diusulkan dengan data – dana RUT X, untuk terlaksananya penelitian ini.
data experimen yang diperoleh. Dengan demikian 6. Daftar Pustaka
proses esterifikasi asam oleat dan sorbitol Aafaqi, R, mohammed, A.R, Bhatia, s., ( 1991 ),
mengikuti reaksi reversibel order satu terhadap Kinetics of Esterification of Palmitat Acid with
masing – masing reaktan. Isobutyl Alcohol, International Journal of Chemical
Kinetics, Nagoya Unniversity, Nagoya.
Sedangkan warna dari sorbitan monooleat yang
diperoleh dipengaruhi temperatur reaksi. Bart, H.J., Reidetschlager, J. Schatka, K., and
Semakin tinggi temperatur reaksi yang Lehmann, A., ( 1994 ), Kinetics of Esterification of
digunakan, semakin pekat warna yang dihasilkan. Levulinat Acid with n – Butanol by homogeneous
Catalysis, University of Technology Graz, Graz.
Dalam literatur diperoleh bahwa warna dari asam
oleat jika diukur dengan metode ASTM D-1500 Lik Anah dan Mahfud, ( 2003 ), “ Kinetika Reaksi
adalah sebesar 8. Jika dibandingkan dengan data Esterifikasi Asam Monooleat dan Sorbitol dengan
yang diperoleh dari hasil eksperimen katalis Asam P – Toluen Sulfonat, Prosiding Seminar
menunjukkan hasil yang berbeda. Hal ini Teknik Kimia Indonesia, , Yogyakarta.
dikarenakan untuk memeperoleh warna sebesar 8 Marron,S.H,and Lando,J.B,” Fundamentals of
diperlukan waktu reaksi selama 12-15 jam. Phycical Chemistry”, Macmillan Publishing Co.inc,
Sedangkan waktu reaksi yang digunakan dalam New York,1974.
penelitian ini adalah selama 1 jam. (Porter, Porter, M. R. , ( 1994 ), ”Handbook of Surfactant “,
1994). Second edition, Blackie Academic and Professional,
London.
4. Kesimpulan
Berdasarkan analisa data dari penelitian yang Vieville, C., Mouloungui, Z., and Gaset, A., (1993 ),
dilakukan dapat disimpulkan bahwa : Esterification of Oleic Acid by Methanol Catalyzed by
p – Toluenesulfonic Acid and Cation Exchange Resins
Semakin tinggi temperatur reaksi yang K2411 and K1481 in Supercritical Carbon dioxide,
digunakan, maka konversi reaksi yang Industrial Engineering and Chemistry Research, 32,
diperoleh semakin besar. 2065 – 2068.
Konversi reaksi yang meningkat dengan
naiknya rasio reaktan (sorbitol : asam oleat)
Abstrak
Penumpukan logam-logam berat dalam ikan telah dikaji di ekosistem yang tidak tercemar,
iaitu sebuah tasik tadahan air, Tasik Pangson, Selangor berbanding di ekosistem yang
tercemar, iaitu tasik bekas lombong bijih timah di Bidor, Perak. Spesies ikan yang paling
dominan di kedua kawasan kajian ialah Tilapia (Oreochromis mossambicus) dan
penumpukan logam berat dalam ikan kajian telah ditentukan melalui kaedah penghadaman
basah dengan HNO3 dan HClO4 (10:2), diikuti kaedah Spektrofotometri Serapan Atom (AAS)
oleh Perkin Elmer. Hasil kajian menunjukkan bahawa tisu otot, insang dan usus ikan dari
tasik bekas lombong di Bidor, Perak telah dicemari oleh logam berat. Nilai kadmium (Cd)
dalam tisu otot (3.13±0.03 mg/kg), insang (4.10±0.21 mg/kg), dan usus (5.32±0.145 mg/kg)
dan juga plumbum (Pb) dalam otot (27.79±0.53 mg/kg), insang (41.20±0.82 mg/kg) dan usus
(50.91±0.51 mg/kg) masing-masing adalah melebihi piawaian keselamatan yang ditetapkan
menurut Akta Makanan Malaysia 1983 dan Peraturan-peraturan Makanan 1985. Walau
bagaimanapun, arsenik (As), nikel (Ni) dan zink (Zn) berada di bawah piawaian yang
ditetapkan. Sebaliknya aras logam-logam berat dalam air dan juga ikan Tilapia dari Tasik
Pangson yang habitatnya tidak tercemar di dapati berada pada tahap lebih rendah daripada
had piawai keselamatan yang ditetapkan. Antara ketiga-tiga tisu yang dikaji, otot
menunjukkan pengumpulan logam berat pada kadar yang paling rendah diikuti insang dan
usus. Dalam persekitaran akuatik, rantai makanan merupakan laluan pengumpulan logam
berat yang penting terutamanya kepada hidupan akuatik pada aras trofik yang lebih tinggi
kerana kesan pencemaran bersifat kumulatif. Ikan merupakan sumber protein utama di
kalangan pengguna setempat, maka pengurusan dan pembangunan kawasan tasik untuk
aktiviti akuakultur memerlukan pengawalan yang rapi untuk menjamin keselamatan sumber
makanan bagi masyarakat setempat.
(bekas lombong bijih timah di Bidor, Perak) beberapa sumber tekanan terhadap biota
dan kawasan yang tidak tercemar (tasik akuatik (Barbour et al, 1997). Data tersebut
empangan Pangson, Selangor). Pemantauan juga amat bererti dalam biokriteria untuk
PTEs di kawasan tercemar memerlukan kaedah menilai kesan pencemaran dan keberkesanan
pengesanan yang cepat, reliabel, dan jimat kos langkah kawalan dan penebatan bagi
bagi menilai kesan akut dan kronis beban menangani isu-isu kualiti air (Barbour et al,
pencemar dan bahan toksik dalam jasad air 1997). Lazimnya biokriteria dan biopenunjuk
sebagai langkah berwaspada dalam pengurusan setempat lebih sesuai dan relevan dengan
sumber yang melibatkan kesihatan dan persekitaran sedia ada, di mana struktur dan
kepentingan awam. Hasil kajian membawa fungsi komuniti biotik amat dipengaruhi oleh
impak kesihatan kerana ikan Tilapia ciri-ciri spesifik seperti kejernihan dan kualiti
(Oreochromis spp.) banyak dipelihara dalam air, arus aliran, jenis substrat, vegetasi dan
tasik-tasik lombong oleh para petani, dan hasil sebagainya yang membentuk habitat tersebut
ikan dijual di pasaran tempatan (Abdullah et al, (Inger & Chin, 1962, Lowe-McConnell, 1975).
2000; Ang et al, 2000). Di Malaysia, biopenunjuk yang sesuai dapat
dikenalpasti di kalangan komponen utama
Objektif kedua kajian ini adalah untuk
ekosistem air tawar, iaitu makrofit, ikan,
menyaring calon biopenunjuk yang sesuai
amfibia, plankton dan makroinvertebrat bentos
digunakan bagi memantau penumpukan logam
(Abas et al, 2000). Meskipun terdapat pelbagai
berat, terutamanya elemen berpotensi toksik
kajian berkaitan yang telah dilaporkan (Badri,
seperti As, Hg, Cd dan Pb. Kajian oleh
1990; JAS, 1999), akan tetapi usaha bersepadu
penyelidik lain telah mengenalpasti ikan
dalam langkah penilaian PTEs dan penabiran di
sebagai salah satu agen biopengumpul PTEs
peringkat nasional dan wilayah masih belum
yang signifikan selain tumbuhan makrofit dan
dilaksanakan.
haiwan bentos seperti gastropoda (Price, 1979;
Salmijah et al, 2000). Air dari tasik bekas 3. Bahan dan Kaedah
lombong Bidor dilaporkan mengandungi Persampelan ikan dilakukan di tapak kajian tiga
surihan atau sejumlah kecil PTEs (Ang et al, buah tasik bekas lombong (yang meliputi
2000), walau bagaimanapun, sedimen keluasan sekitar 30 ekar) di Bidor, Perak dan
mengandungi kepekatan PTEs yang lebih tinggi Empangan Pangson, Selangor. Sampel ikan
berbanding air. Organisma (biota) ekosistem untuk penentuan logam berat diperolehi dengan
akuatik pula mampu mengumpul dan menggunakan jala dan perangkap ikan. Sampel
memekatkan bahan-bahan pencemar tertentu air dan sedimen juga diambil dari tapak kajian.
seperti logam berat dan racun perosak persisten Semua sampel (ikan, air dan sedimen) segera
seperti organoklorin, yang seterusnya dibawa balik ke makmal dalam bekas sejuk
tertumpuk menerusi siratan makanan, sehingga untuk persediaan analisis selanjutnya. Ikan
mencapai toksisiti signifikan dalam organisma dibilas tiga kali dalam air suling, kemudian
yang berada di aras trofik yang tertinggi seperti diasingkan kepada bahagian insang, usus dan
pada manusia. otot. Setiap bahagian tisu segar ditimbang, lalu
dikeringkan dalam oven pada suhu 80oC
Bahan pencemar yang memasuki persekitaran
sehingga mencapai berat tetap, dan seterusnya
akuatik boleh menyebabkan toksisiti akut yang
dikisar halus untuk memudahkan penghadaman
berakhir dengan kematian dalam organisma
tisu. Sampel sedimen dan tisu ikan dihadam
terimpak, atau sebaliknya kesan morbiditi
dengan asid nitrik dan asid perklorik mengikut
kronis yang secara gradual menjejaskan
kaedah piawai AOAC (1984), manakala sampel
pertumbuhan, pembiakan dan fisiologi umum
air dituras sebelum dibuat penentuan logam
spesies sensitif. Oleh itu, maka penilaian
mengikut kaedah piawai AOAC (1984).
biologi aras pencemaran dapat digunakan untuk
mengenalpasti perubahan komponen habitat Logam berat yang dikaji adalah Pb, Zn, Cu, Cd,
seperti kualiti air dan ciri-ciri sedimen dasar As, Fe, Mn, Al dan Ni, tetapi empat logam
yang mempengaruhi respons biota dan terakhir itu dianalisis hanya bagi sampel ikan
komuniti hidupan dalam sesuatu ekosistem itu. dari Bidor kerana ia mewakili tapak tercemar.
Jumlah logam ditentukan dengan
Data biologi, toksikologi dan kualiti air dapat
spektrofotometer serapan atom (Perkin Elmer
mengukur secara terus impak salah satu atau
model 4100). Semua sampel dianalisis (5.32±0.14 mg/kg), diikuti dengan insang
sekurang-kurangnya dalam tiga replikasi. (4.10±0.21 mg/kg) dan otot (3.13±0.03 mg/kg),
dan aras tersebut melebihi piawaian 1.0 mg/kg
4. Hasil dan Perbincangan
bagi Cd yang ditetapkan dalam Akta Makanan
Hasil kajian yang ditunjukkan pada Jadual 1
1983 dan Peraturan Makanan Malaysia, 1985.
hingga 7 dan Rajah 1 dan 2, mendapati bahawa
Begitu juga aras Pb adalah tertinggi dalam
otot, insang dan usus ikan Tilapia dari tasik
usus, diikuti dengan insang dan otot
bekas lombong Bidor dicemari logam berat
(50.91±0.51, 41.20±0.82 dan 27.79±0.53
tertentu pada aras yang tinggi (Jadual 1).
mg/kg berat kering masing-masing). Julat
Kepekatan Cd adalah paling tinggi dalam usus
pengumpulan Pb dalam ikan dari Bidor (Rajah
JADUAL 1. Julat aras PTEs dalam ikan Tilapia dari tasik bekas lombong Bidor
Sampel
Plumbum Arsenik Kadmium
Tisu sampel ikan komposit
(Pb) (As) (Cd)
(n)
Julat PTEs dlm
4 27.26 - 28.32* 0.14 - 0.23 3.10 - 3.16*
Tilapia (mg/kg)
Had dibenarkan # 2.0 1.0 1.0
**Nilai PTEs dalam ikan yang melebihi had yang dibenarkan oleh Akta Makanan 1983 dan Peraturan
Makanan Malaysia 1985
# Had dibenarkan di bawah Akta bagi apa-apa jenis makanan
JADUAL 2. Kepekatan logam berat dalam Tilapia (µg/g) dari Tasik Pangson
Stesen Persampelan Pb Zn Cu Cd As
Insang O. niloticus 0.006±0.004 0.009±0.0001 0.030±0.000 0.001±0.0002 tdk
Insang O. 0.013±0.002 0.009±0.0001 0.091±0.001 0.001±0.0001 tdk
mossambicus
Perut O. niloticus 0.005±0.002 0.007±0.0001 0.005±0.0001 0.001±0.0001 tdk
Otot O. niloticus 0.133±0.001 0.004±0.0001 0.009±0.0001 0.001±0.0001 tdk
Otot O. 0.008±0.002 0.005±0.0001 0.003±0.0001 0.001±0.0003 tdk
mossambicus
Air tasik 0.007±0.002 0.021±0.019 0.003±0.002 0.007±0.002 tdk
mg/L
Had dlm mkn 2.0 100 30 1.0
mg/kg*
Had dlm air 2.0 100 30 1.0
mg/L**
(*) Had maksimum dibenarkan dalam bahan makanan dan (**) dalam air oleh Akta Makanan 1983 dan
Peraturan Makanan Malaysia 1985
120
100
80
Logam dlm tisu (mg/kg)
60
40
20
Pb
0
Zn
Otot Insang Usus Had Piawai
Cd
Tisu ikan Tilapia dari Kolam Lombong Bidor
Rajah 1. Aras PTEs dalam Tilapia dari tasik bekas lombong di Bidor, Perak
0.14
0.12
0.02
0
Otot Insang Usus
Tisu ikan Tilapia dari Tasik Pangson
Rajah 2. Aras PTEs dalam Tilapia dari Tasik Empangan Pangson, Selangor
JADUAL 3. Kepekatan Pb, Cd dan As dalam tanah lombong bijih dan air tasik bekas
lombong di Bidor, Perak
PTEs Had dlm Pasir Pasir pertanian Selut Selut Air
tanah (mg kg-1) -1 (mg kg-1) pertanian (mg l-1)
(mg kg )
mineral
(mg kg-1)
-1
(mg kg )*
1 dan Jadual 1) adalah jauh melebihi had Jadual 2). Tertib menurun bagi aras PTEs
maksimum piawai, iaitu 2.0 mg/kg, dan amat dalam insang ikan adalah:
tinggi berbanding logam-logam berat lain (iaitu
Pb >Cu >Zn >Cd (0.13±0.002, 0.009±0.0001,
As, Cd, Ni dan Zn). Walau bagaimanapun, aras
0.001±0.0001 dan 0.091±0.001 mg/kg masing-
As, Ni dan Zn adalah di bawah had yang
masing, Rajah 2).
dibenarkan (Jadual 2)(Abdullah et al, 2000;
Ang et al, 2000). Aras PTEs yang tinggi dalam Bagi perut Tilapia pula, tertib menurun PTEs
sumber makanan membawa risiko menjejaskan adalah:
kesihatan pengguna setempat dalam Zn >Cu = Pb >Cd (0.007±0.0001,
jangkamasa yang panjang sekiranya sumber 0.005±0.0001, 0.005±0.002, 0.001±0.0001
protein harian diperolehi daripada ikan Tilapia mg/kg masing-masing, Rajah 2).
pada kadar yang berlebihan.
Tertib menurun PTEs bagi otot Tilapia pula
Sebaliknya analisis sampel ikan Tilapia dari adalah;
Tasik Empangan Pangson di Selangor
menunjukkan bahawa aras logam dalam insang, Pb > Zn> Cu >Cd (0.008±0.002, 0.005±0.0001,
usus dan otot adalah di bawah had maksimum 0.003±0.0001, 0.001±0.0003 mg/kg masing-
piawai bagi bahan makanan (Rajah 2 dan masing, Rajah 2).
JADUAL 4. Nilai pH dan aras logam berat dalam air dan sedimen di tasik bekas lombong Bidor, Perak.
2. Sedimen. (mg/kg).
Logam berat mungkin terkumpul dalam ikan Pangson (Jadual 3, 4 & 5). Ini menunjukkan air
melalui pengambilan air dan makanan di Tasik Pangson adalah bebas daripada
bercampur sedimen, terutamanya bagi spesies pencemaran Pb dan Cd. Secara amnya aras
yang hidup di dasar tasik seperti Tilapia logam Pb, Cd, Zn dan Cu dalam air Tasik
(Mohsin & Ambak, 1991). Air larian Pangson masih berada dalam julat minimum.
mengandungi beban kelodak yang memasuki Menurut Sarmani (1989) julat kepekatan Pb,
tasik dan menjadi sebahagian daripada sedimen Cd, Zn dan Cu yang diperolehi daripada kajian
dasar yang bertindak sebagai sinki beban merupakan nilai semulajadi.
pencemar dan medium bagi logam berat
Kebanyakan elemen berpotensi toksik dalam
memasuki ikan menerusi insang dan ususnya.
air permukaan dan tanah lombong bijih adalah
Ketersediaan sampel untuk kajian
berasal daripada batuan formasi geologi dan
biopengumpulan amat penting memandangkan
endapannya, kecuali bagi Cd (Ramli & Ang
kajian terdahulu (Price, 1979; Badri, 1990;
1999). Contohnya Pb berasal daripada galena
Salmijah et al, 2000) mendapati bahawa ikan
(PbS) dan cerussite (PbCO3) manakala As
merupakan biopenunjuk yang baik bagi PTEs.
mungkin berpunca daripada arsenopirit
Kajian lanjut yang lebih terperinci berhubung
(FeAsS) dan Cobaltite (CoAsS). Menurut Ang
sifat pengumpulan logam oleh ikan dan
et al (2000) PTEs juga mungkin merupakan
hidupan lain wajar dilakukan, malahan U.S.
hasil sampingan aktiviti perlombongan dan
Environmental Protection Agency juga telah
peleburan bijih. Selain itu, amalan pertanian
menyarankan supaya data biologi digunakan
juga boleh menjadi sumber input PTEs,
bagi menyokong penguatkuasaan undang-
contohnya tandan buah kosong dan baja tahi
undang dan dalam strategi pengurusan air
ayam yang digunakan petani ada mengandungi
(Barbour et al, 1997) Data sedemikian
PTEs (Ang et al, 2000).
dianggap berguna dalam menyelia sumber
pencemaran yang pelbagai dan terserak seperti Dalam persekitaran akuatik, komuniti ikan
efluen pertanian dan air larian permukaan. dipengaruhi oleh jenis habitat yang dibezakan
mengikut ciri-ciri tertentu seperti kualiti air,
Air tasik bekas lombong Bidor mempunyai
substrat dasar, kedalaman dan aliran air
kepekatan Pb dan Cd yang kurang daripada
(Mohsin, & Ambak, 1991). Pertalian spesies-
julat 0.01-1.55 mg/L bagi Pb dan 0.01-0.02
habitat adalah aspek fundamental bagi ekologi
mg/L bagi Cd. Kedua-dua nilai ini adalah lebih
komuniti termasuk bagi populasi ikan (Inger &
tinggi daripada aras Pb dan Cd dalam air Tasik
Chin 1962). Bagi jenis habitat tertentu,
pengkhususan sumber makanan akan berlaku bawah had yang dibenarkan oleh Interim
demi mengelakkan daripada perebutan nic di Piawaian Kualiti Air Kebangsaan, Malaysia.
kalangan ahli komuniti, dan PTEs dapat Makrofit yang tumbuh di dasar kolam dan tasik
dipekatkan di sepanjang rantai makanan dalam seperti Cyperus digitatus juga didapati mampu
suatu ekosistem yang tidak terlalu kompleks mengumpul Fe dan Mn dalam jumlah yang
seperti sebuah sungai, kolam atau tasik yang banyak, manakala makrobentos seperti siput
kecil. akuatik juga adalah merupakan pengumpul
logam yang cekap bagi Cu dan Zn.
Kajian biopengumpulan logam berat yang
dijalankan oleh Salmijah et al (2000) di tasik Dalam kajian penumpukan PTEs dalam tisu
Putrajaya dan beberapa kawasan lain di beberapa spesies ikan liar dari tasik semulajadi
Malaysia mendapati bahawa logam berat dalam iaitu Tasik Chini, Pahang yang relatif tidak
air di kebanyakan stesen persampelan adalah di tercemar, Abas, et. al (2001) mendapati bahawa
JADUAL 5. Kepekatan logam berat dalam air (mg/L) di Tasik Pangson Selangor
Stesen ** Pb Zn Cu Cd As
persampelan
1 0.006±0.004 0.053±0.040 0.002±0.001 0.004±0.003 # tdk
2 0.003±0.003 0.011±0.009 0.003±0.003 0.001±0.000 tdk
3 0.008±0.003 0.011±0.004 0.002±0.001 0.014±0.005 tdk
4 0.008±0.001 0.035±0.022 0.007±0.001 0.002±0.001 tdk
5 0.010±0.010 0.006±0.001 0.001±0.000 0.013±0.002 tdk
6 0.005±0.003 0.008±0.021 0.001±0.001 0.002±0.001 tdk
Purata 0.007±0.002 0.021±0.019 0.007±0.005 0.003±0.001 tdk
*Had dibenarkan 0.05 5.0 0.005 1.0
* Had maksimum dibenarkan oleh Akta Makanan 1983 dan Peraturan Makanan Malaysia 1985
# tdk = tidak dapat dikesan
** Sampel sedimen tidak diperolehi kerana dasar Tasik Pangson terlalu dalam
Jadual 7. Perbandingan aras Cd dan Zn dalam tisu ikan Tilapia (mg/kg) dari pelbagai kawasan
Spesies Otot Insang Kepala Usus
Tilapia rendalli
(Berg et al, 1995)* Cd:1.4 – 2.6 - - -
Zn: 20.9 – 26.9 - -
O. mortimeri
(Berg et al, 1995) Cd:1.2 – 1.3 - - -
Zn: 18.4 – 22.4 - -
O. mossambicus
(Badri 1988) Cd: 1.08 - Cd: 1.14 Cd: 1.96
Zn: 27.5 - Zn: 43.77 Zn: 56.26
O. mossambicus
(Tasik Bidor) Cd: 3.13 Cd: 4.10 - Cd: 5.32
Zn: 43.26 Zn: 43.26 - Zn: 82.49
Catatan: *ikan disampel dari Tasik Lombong Kariba, Zimbabwe.
kepekatan logam-logam paling tinggi dalam faedah dan risiko utilisasi kawasan terpinggir
sedimen, dan diikuti dalam tisu ikan. Walau dan terbiar seperti tanah amang dan tasik bekas
bagaimanapun, aras Pb, Zn, Cu, Cd, Ni dan Cr lombong untuk aktiviti akuakultur, penternakan
paling sedikit dalam air berbanding dalam tisu dan pertanian.
ikan dan sedimen, manakala kandungan PTEs
Logam toksik yang tertumpuk dalam ikan
dalam sampel air juga berada di bawah had
adalah terutamanya diambil melalui ingesi dan
yang ditetapkan oleh Piawaian Air Minuman
penurasan. Air tasik lombong mungkin
Malaysia. Aras PTEs dalam tisu ikan dari
mengandungi hanya sejumlah kecil atau
kawasan tidak tercemar juga adalah jauh lebih
surihan PTEs akan tetapi, dalam sedimen
rendah daripada had maksimum yang
terdapat aras PTEs yang lebih tinggi. Logam
dibenarkan dalam bahan makanan di Malaysia
As, Pb dan Cd terdapat dalam selut dan air
(Legal Research Board, 1997).
tasik bekas lombong di Bidor (Jadual 3), walau
Abas et al (2000) melaporkan bahawa bagaimanapun, tiada satu pun elemen tersebut
kebanyakan PTEs yang dikaji berkorelasi yang melebihi had piawai bagi kualiti air yang
positif dengan pH dan kandungan bahan dibenarkan bagi kegunaan pertanian (Smith
organik dan saiz partikel sedimen. Pengukuran 1996). Tumbuhan akuatik dan ikan kecil yang
beberapa parameter abiotik dari Tasik Pangson, menjadi makanan ikan besar juga mungkin
iaitu suhu air, oksigen terlarut, pH, tercemar oleh PTEs. Kajian ini mendapati
konduktiviti, turbiditi, nitrat dan fosfat (Jadual kandungan usus ikan Tilapia mengandungi
6) mendapati bahawa nilai kualiti air yang amaun PTEs yang tinggi yang menunjukkan
dikaji berada dalam kelas I-III bagi logam Pb bahawa proses penurasan dan ingesi adalah
dan kelas I-IV bagi logam Cu mengikut merupakan laluan utama pengambilan PTE ke
Pengkelasan Interim Sungai-Sungai di dalam tubuh ikan.
Malaysia (Jabatan Alam Sekitar, 2000). Denny, Jika terdapat risiko pencemaran PTEs dalam
at al (1995) menyatakan secara umumnya aras ikan dari kawasan pertanian, maka pihak
Cu dalam air tawar ialah 1.0 ug/L. Kepekatan pengurusan wajar mengambil pendekatan
logam Pb, Zn, Cd dan Cu dalam air dan ikan di selamat dan berwaspada, seperti menggunakan
Tasik Empangan Pangson adalah lebih rendah sistem penternakan sangkar terapung, yang
daripada had piawai yang ditetapkan (Rajah 2 menggunakan air bahagian atas yang relatif
& Jadual 2), oleh itu ikan tersebut adalah tidak tercemar, manakala pemberian makanan
selamat dimakan dan tahap pencemaran logam komersial boleh mengurangkan risiko ikan
adalah di bawah julat normal bagi kebanyakan memperoleh makanan di sedimen dasar yang
kawasan (Jadual 7). Ikan Tilapia juga diketahui mengandungi aras PTEs yang tinggi.
menunjukkan potensi baik sebagai organisma Spesies ikan yang diternak juga penting,
biopengumpul logam di persekitaran akuatik manakala kadar pengambilan dan penumpukan
(Badri, 1990; Berg et al, 1995; Salmijah et al, logam berat dalam ikan dan sumber akuatik
2000). lain perlu juga dipantau bagi menjamin
kesihatan awam.
Jasad air yang digunakan bagi keperluan
bekalan air dan kegunaan pertanian perlu 5. Penghargaan
diawasi untuk mengesan kehadiran beban Kajian ini sebahagiannya disokong oleh geran
pencemar dan bahan toksik dalam jumlah yang penyelidikan IRPA no. 01-04-01-0058 dan
dikhuatiri boleh menjejas kesihatan manusia geran Fundamental UKM no. PPS7/2000. Kami
dan kehidupan lain (Price, 1979). Kajian ini ingin merakamkan penghargaan kepada Alycia
merupakan sebahagian usaha untuk Lee dari Chemlab, Khairi, Maslina and Mazlin
mengumpul data yang diperlukan dalam dari FST, UKM atas bantuan teknikal dan
rancangan pengurusan bersepadu terhadap persampelan mengikut arahan kami
kualiti air tempatan dan di peringkat wilayah
6. Rujukan
(Barbour et al, 1997). Pengurusan sumber air Abas, A., M. Abdullah, I. Mushrifah, I & C.C. Lau
boleh menggunakan hasil kajian pelbagai pihak (2001). Heavy metals concentration in water, fish
dalam merangka dasar pentadbiran dan menilai and sediment in Lake Chini, Pahang. .Proceeding of
risiko kepada sumber biologi dan kesihatan SKAM 14.
manusia, misalnya dalam menimbangkan
Abdullah, M., Chung, P. Y., Zuriati, Z. & Ang, L.H. Jabatan Alam Sekitar (JAS) 2000. Laporan Akhir
2000. Heavy metals accumulation in Oreochromis Program Pengawasan Biologi dan Indikator Biologi
mossambicus from ex-mining ponds in Bidor, Perak. bagi Sungai-Sungai Di Malaysia. September 2000.
Konvensyen Sains dan Teknologi, Ipoh 2000.
Legal Research Board. 1997. Food Act 1983 and
MOSTE/CSTM/Kerajaan Negeri Perak, 16-18
Food Regulations 1985: All amendments up to
Oktober 2000
October, 1996-Act 281. MDC Publishers Printer
Ang, L.H., W.M. Ho, Ramli, Mohd. Othman, Sdn. Bhd., 342 hlm.
Maimon Abdullah, P.Y. Chung & L.T. Ng. 2000
Lowe-McConnell, R.H. 1975. Fish communities in
The concentration of Pb, As, Cd and Hg in some
tropical freshwaters. Longman Incorporated, New
food crops and fish produced from ex-mining sites
York. USA.
in Bidor, Perak. Conference on Science &
Technology. COSTAM 2000. Kota Kinabalu. Mohsin, A.K.M. & Ambak. M.A.. 1991. Ikan air
COSTAM/MOSTE/CSTM.18-20 September 2000. tawar di Semenanjung Malaysia. Penerbit Dewan
Bahasa dan Pustaka, Kuala Lumpur.
AOAC methods. 1984. Official methods of analysis
of the association of official analytical chemists. Price, D.R.H. 1979. Fish as indicator of water
Washington, D.C. 385-413. quality: Dlm: James, A.A. & Evision, L (penyt).
Biological indicators of water quality: Methods and
Badri, M.A. 1990. Heavy metals pollution in the
applications. Washington, Hemosphere Publishing
aquatic environment: The analyses of aquatic
Corp. hlm: 8.1-8.17.
organisms. In:. Sham Sani, Mazlan Othman dan
Badri, M.A. (eds..). Monitoring Strategies in Ramli Mohd Osman & LH Ang. 1999. The
Environmental Management and Assessment. occurrence of some important potentially toxic trace
National Workshop 28 Nov – 1 Dec 1988. Bangi: elements in ex-mining ponds located in Bidor,
Penerbit Universiti Kebangsaan Malaysia. Perak. Dlm: P120-127, COSTAM, Proceedings of
Malaysian Science dan Technology Congress
Barbour, M.T., Gerritsen, J., Snyder, B.D. &
1999.8-10 November, 1999. Hilton Kuching,
Stribling, J.B.1997. Elements of Biomonitoring. In:
Kuching, Sarawak.
Revision to Rapid Bioassessment Protocols for Use
in Streams and Rivers: Periphyton, Benthic, Salmijah Surif, Maimon Abdullah & Musyrifah
Macroinvertebrates and Fish. Contract No.841-D- Idris. 2000. Studies on pollution and management of
97-002. U.S. Environmental Protection Agency, heavy metals in Malaysian environment. Seminar
Washington, DC. Pemantauan Penyelidikan Di UKM. 30 Disember
2000, Melaka.
Berg, H., Khbus, M. & Nils Kautsky . 1995. Heavy
metals in tropical Lake Kariba, Zimbabwe. Water, Sarmani, S. 1989. Kajian Permonitoran Kualiti Air
Air and Soil Pollution. 83: 237-252. Lembangan Sungai Langat, Selangor. Sains
Malaysiana 14(2): 245-255. Universiti Kebangsaan
Denny, P., Bailey, R., Tukirhawa, E. & Mafabi, P.
Malaysia, Bangi
1995. Heavy metal contamination of Lake George
(Uganda) and its wetlands. Hydrobiologia.297:229- Smith, SRS. 1996. Agricultural recycling of sewage
239. sludge and the environment. CAB International,
Biddles Ltd., Guildford. 382p
Dominski P. 1985. Automated Cold Vapour
Determination of Mercury; EPA Stannous Chloride Zuriati Zakaria & Maimon Abdullah. 2000. Ex-
Methodology. Varian AA at work No. AA-51. Sept. mining Pools - Hazards or Resource? Konvensyen
1985. Sains dan Teknologi Ipoh. COSTAM 2000.
MOSTE/CSTM/Kerajaan Negeri Perak, 16-18
Inger, R.F. & P.K. Chin. 1962. The freshwater fish
Oktober 2000.
of North Borneo with Supplementary Chapter by
P.K. Chin. Field. Zool. 45: 268 pp.
Abstract
In this study, rambutan (Nephelium lappaceum) kernel fat (RKF) was extracted from the
seeds using hexane as solvent in a Soxhlet apparatus. The composition of the fatty acids was
determined by gas chromatography (GC). The extracted fat was then fractionated in acetone
(acetone: fat 10 : 1, 8 hr, 5ºC ) into RKF stearin and RKF olein fractions. The long chain
saturated fatty acid from unfractionated RKF and RKF stearin were further concentrated
through saponification (30% methanolic KOH), followed by acidification (0.5 N HCI) prior to
urea complexation (2.5 M ethanolic urea) at 5°C and holding times (10minute–24hr). The
arachidic rich fraction (top phase) was collected and further purified on silica gel column
using hexane: ethyl acetate: acetic acid (70:30:1) as eluting solvent prior to structural
analysis by NMR. Results from GC analysis showed that the RKF contained 38.41% arachidic
acid (20:0). The highest yield of arachidic acid with urea complex were obtained from
unfractionated (63.37%) and fractionated (77.31%) RKF after holding at 5 ºC for 30 minutes
and 60 minutes respectively. NMR, IR and GC spectrum of purified fraction confirmed the
identity of the acid as arachidic acid.
5oC and allowed to crystallise for 10 minutes. temperature were set at 240°C, split ratio 1:60.
The crystals formed (urea complex fraction, Separation was carried out with nitrogen as
UCF) was recovered by gravity filtration and carrier gas at 1.5ml/min. The peaks were
the filtrate (non urea complex fraction, NUCF) identified by comparing the retention time with
was collected. The recovered UCF was rinsed standard FAME, and plotting the log of
with 10 cm3 isooctane. The rinsed UCF was retention time against equivalent carbon length
transferred into 500 cm3 separating funnel. The (ECL). The percentage of each peak was
fatty acids were further extracted by adding 5 calculated as the percentage of the total area of
cm3 n-hexane and 200 cm3 acidified (pH=6.0) all the peaks. The results of the present study
distilled water, followed by washing with are means of duplicate analyses.
another 200 cm3 acidified water (Wanasundra
Spectroscopic analysis: NMR analysis were
1999). The organic layer (top) containing fatty
performed on JEOL ECP 400 NMR
acids was collected for gas chromatography
spectrometer at frequency of 400 MHz (1H).
(GC) analysis. The NUCF and isooctane rinsate
About 10 mg of the samples was dissolve in
were pooled and the fatty acids were extracted
CDCl3. Trace amount of CHCl3 in the solvent
in the similar manner prior to GC analysis. The
used as reference exhibits signal at 7.27 ppm in
fatty acids composition of the fractions was 1
H. IR (Infra Red) spectra were obtained from
determined using gas chromatography
KBr plates made using Perkin Elmer-1300 FT-
according to the method Timms (1978). The
IR spectrometer. The spectra in absorption
experiment was repeated for 20, 30, 60 minutes
range of 600cm-1 to 4000cm-1 were recorded.
and 24 hours cooling at 5 oC.
3. Results And Discussions
Isolation of Arachidic Acid: UCF containing
Fractionation of RKF :
the highest amount of arachidic acid further
Fractional crystallisation from organic solvent
fractionated by silica gel column (i.d. 1.5cm x
was one the earliest technique used to separate
30cm) preconditioned in n-hexane. Before
natural fats into their components. The solvent
loading, the UCF (1.15g) was dissolved in 5
most extensively used is acetone because
cm3 n-hexane. The arachidic acid was
triglycerides having different numbers of
fractionated by stepwise elution using 200 cm3
saturated acyl-group and double bonds exhibit
n-hexane : diethyl ether mixture of increasing
different solubility in this solvent (Vrettakou et
polarity. The polarity of eluting solvent was
al. 1984). Figure 1 shows the fatty acid
increased starting from n-hexane : diethyl ether
composition of olein and stearin fractions of
(9:1) to 100 % (v/v) diethyl ether. The fractions
RKF. It was clearly shown the main fatty acid
were collected in 5 cm3 vials and analysed by
in RKF and fractions was arachidic acid
TLC using petroleum eter : diethyl ether :
(C20:0) with the highest (70.92%) was found in
acetic acid, 8:2:1 (v/v/v) as developing solvent
the stearin fraction. Olein fraction was high in
(Kirchner, 1967). The presence of carboxylic
oleic (C18:1), arachidic (C20:0) and
acids was determined by using ethanolic
arachidonic (C20:1) acids. While the main fatty
bromocresol green (1%) solution as a spraying
acids in RKF was oleic (C18:1) and arachidic
agent. Fractions that showed only a single spot
(C20:0) acid. As expected, the RKF stearin was
on TLC plates were pooled and analyzed by
the highest in C20:0, therefore it was later used
Nuclear Magnetic Resonance (NMR),
for further separation and isolation of arachidic
Spectroscopy FT-Infra Red (FTIR) and GC.
acid by urea complexation and column
Fatty acid analysis: Methylation of fatty acids chromatography.
was done according to the method of Timms
Urea complexation: Urea complexation is a
(1978). Then 5µl of fatty acid methyl esters
well-established technique for elimination of
(FAME) was injected into Agilent 6890 series
monosaturated fatty acid (Ratnayake, 1988).
Gas Chromatograph equipped with flame
The effect of holding time at 5 oC on the
ionization detector (FID), column (BPX
content of C20:0 in urea complex fraction
710,60m long, 0.32mm i.d, film thickness
(UCF) and non-urea complex fraction (NUCF)
0.25µm) with the following conditions: the
obtained from RKF and RKF stearin are shown
column oven temperatures was programmed
in Table 1 and 2 respectively. As shown, both
from 120-180°C at 4°C /min and hold to 210°C
UCF and NUCF contained C20:0. As expected
for 4 minutes and the injector and the detector
the percentage of C20:0 was higher in the UCF.
80
Unfractionated RKF
RKF Stearin
70 RKF Olein
60
50
Content (%)
40
30
20
10
0
C16:0 C16:1 C18:0 C18:1 C18:2 C20:0 C20:1 C22:0
Fatty Acids
Figure 1: Fatty acids composition of Rambutan Kernel Fat (RKF), RKF stearin and RKF olein.
Table 1. Composition of long chain fatty acids (C18 – C20) in UCF and NUCF of RKF in different holding times at 5 oC
(n=2)
Holding Time Urea Complex Fraction (UCF) Non-Urea Complex Fraction (NUFC)
(minute)
C18 :0 C18 :1 C20 :0 C18 :0 C18 :1 C20 :0
10 9.93± 1.09 31.59 ±0.86 38.05 ±1.27 8.46 ±0.79 31.54 ±0.88 35.08 ±0.23
20 12.57 ±0.83 31.29 ±1.21 57.1 ±1.40 8.14 ±1.09 25.23 ±1.57 33.19 ±0.88
30 10.89±0.99 21.62 ±1.40 63.37 ±1.46 10.28±0.63 41.64 ±1.41 34.34 ±1.21
60 11.59 ±0.99 34.29 ±1.56 41.6 ±2.11 4.91 ±0.40 46.02 ±1.21 36.63 ±0.66
120 7.97 ±0.19 40.38 ±0.47 36.4±0.72 8.22 ±0.98 37.34±1.06 35.01±0.79
24 Hour 6.26 ±0.78 31.14±1.42 24.81 ±0.27 3.83±0.51 58.48±0.41 12.17 ±0.37
Table 2. Composition of long chain fatty acids (C18 – C20) in UCF and NUCF of RKF stearin in different holding times
at 5 oC (n=2)
Holding Time Urea Complex Fraction (UCF) Non-Urea Complex Fraction (NUFC)
(minute)
C18 :0 C18 :1 C20 :0 C18 :0 C18 :1 C20 :0
10 11.79 ±0.62 21.81 ±1.15 60.65 ±3.20 9.89 ±2.24 38.57 ±3.64 41.96 ±7.17
20 8.75±0.06 33.88 ±0.24 45.45 ±0.32 5.65 ±0.29 38.26 ±1.76 42.31 ±2.17
30 10.09±0.76 26.06 ±0.53 54.60 ±3.07 8.98 ±0.60 37.81 ±2.54 48.67 ±3.27
60 4.16 ±2.06 5.81 ±3.67 77.31 ±0.71 10.31±0.37 27.76 ±5.54 13.64±1.66
120 9.31 ±0.85 19.77 ±1.48 61.09 ±3.71 9.60 ±1.25 33.35 ±5.14 20.79 ±2.58
24 Hour 20.31±0.14 34.31 ±1.27 20.15 ±2.42 3.01 ±0.45 71.44 ±10.6 13.86 ±2.06
As shown in Table 1, the highest concentration C20:0 was obtained at 60 minutes holding time
(63.37 ±1.46 %) and 77.31±0.71) of C20:0 was (Table 2).
obtained from RKF in urea complex fraction Spectroscopy Analysis: UCF from RKF stearin
(UCF) at 30 minutes holding time. While from rich in C20:0 was passed through a silica gel
UCF of RKF stearin, the highest content of column chromatography and fractions showing
a single spot on TLC plates were pooled and C20:0 confirmed that they contained arachidic
analyzed for the authenticity of C20:0 by GC, acid with a retention time of 29.40 minutes
FTIR and NMR. The GC chromatogram of the
IR spectrum (Figure 2) showed characteristic
collected fractions compared to a standard
absorption band of carboxylic acid as shown by
the carboxyl C=O absorption band at 1714 cm- Fuentes, J.A. & Bazua, D. (2004). Mango seed uses:
1
and a broad O-H stretching at 2918 cm-1. thermal behaviour of mango seed almond fat and its
According to Parikh (1974), the C=O group in mixtures with cocoa butter. Bioresource
dimerized saturated aliphatic acids absorbs in Technology. 92, 71-78.
the region of 1720-1706 cm-1 and a broad O-H Guerrero, J.L.G. & Belarbi, E.H. (2001).
stretching absorption in the region of 3300- Purification Process for Cod Liver Oil
2500 cm-1. The weaker C-H stretching bands Polyunsaturated Fatty Acids. J. Am. Oil. Chem. Soc.
were generally seen superimposed by the broad 78(5). 477-484
O-H band. The absorption region at around Gunstone, F.D. & Norris, F.A. (1983). Lipids in
2849 cm-1 was assigned to C-H stretching. Food Chemistry, Biochemistry and Technology.
Two bands arising from C-O stretching and O- Pergamon Press Inc. New York, page 16.
H bending appeared near 1269 cm-1 and 1437 Haumann, B.F. (1997). Structured Lipids. INFORM.
cm-1 respectively. Both of these bands involve 8(10), 1004-1011
some interactions between C-O stretching and
in plane C-O-H bending. Hayes, D.G., Bengtsser, Y.C., Alstine, J.M.V. &
Setterwall, F. (1998). Urea Complexation for the
The 1H NMR spectrum showed signals typical Rapid, Ecologically Responsible Fractionation of
of fatty acids (Figure 3). One triplet was Fatty acid from Seed Oil. J.Am.Oil.Chem.Soc.
observed at δ 2.33 (J= 7.56 Hz) revealed the 75(10).
methylene protons (H2-2) attached next to Helmi, W. (2002). Pengubahsuaian ciri-ciri fiziko-
carboxyl group and a multiplet at δ1.60 belongs kimia lemak koko menggunakan interesterifikasi
to the adjacent methylene protons (H2-3). Other lipase dan penggunaanya dalam penghasilan
prominent signals is the upfield triplet (J= 7.0 cokolat berinti dan cokolat salutan ais krim. Tesis
Hz) at δ 0.86 which was consistent to the Ijazah Sarjana Sains. Universiti Kebangsaan
terminal methyl of the fatty acid chain. The Malaysia.
remaining signal is the intense multiplet at δ Kennedy, J.P. (1991). Structured Lipids: Fats of the
1.21 consisting of 32 methylene protons in Future. Food Technology. 45(11), 76-83
accordance to remaining 16 methylenes in the Kirchner, J.G. (1967). Technique of Organic
arachidic chain. Each signal was comparable to Chemistry Thin Layer Chromatography. Vol. XII.
the signals of the authentic sample. John Wiley & Sons Inc. US. pg 417.
4. Conclusion Parikh, V.M. (1974). Absorption Spectroscopy of
In conclusion, the seeds of rambutan Organic Molecules. Addison Wesley Publishing
(Nephelium lappaceum) fruit is one of the Company. Reading. 73-75
potential sources of long chain fatty acids, Ratnayake, W.M.N., Olsson, B., Matthew, D. &
especially C20:0. The acid content could be Ackmann., R.G. (1988) Preparation of Omega-3
enriched, through fractionation and later PUFA Concentrates from Fish Oil via Urea
isolated and purified through saponification Complexation. Fat Sci. Technol. 10. 381-386
followed by urea complexation.
Silverstein, R.M., Bassler, G.C. & Morril, T.C.
5. Acknowledgement (1963). Spectrometric Identification of Organic
This research was sponsored by the Ministry of Compound. 3 rd Ed. John Wiley & Son, Inc. New
Science, Technology & Environtent Malaysia York.
under to-down IRPA Grant No. : 09-02-04- Timms, R.S. (1978). Artefact peaks in the
004-BTK/ER/008. preparation and Gas Liquid Chromatographic
determination of methyl esters. Aust.J. Dairy. Tech.
6. References 33(1).4-6
Ackman, R.G., Retnayake, W.M.N. & Olsson, B.
(1988). The ‘basic’ fatty acid compostion of Unsal, M. & Aktas, N. (2003). Fractionation and
Athlantic fish oils: potential similarities useful for characterization of edible sheep tail fat. Meat
enrichment of polyunsaturated fatty acids by urea Science. 63. 235-239
complexation. J. Am. Oil Chem. Soc. 65. 136-138 Vrettakou, S.S., Komaitis, M.E. & Voudouris, E.C.
AOAC. (1990). Official Methods of Analysis of the (1984). Triglyceride Composition of Olive Oil,
Association of Official Analytical Chemists. 13th Ed. Cottonseed oil and their Mintures by Low
Washington. D.C. Temperature Crystallization and Gas Liquid
Chromatography. J.Am.Oil.Chem.Soc.61(6).1051-
1055
Abstrak
Proses proteksi asetilasi terhadap gugus hidroksi mempengaruhi sifat asam lemak bebas
sebagai monomer pada pembuatan membran poliuretan (PU). Komposisi optimum OH : TDI
pada sintesa membran PU adalah 1.2 : 0,41 (mol/mol) untuk membran dari asam lemak
terhidrasi tanpa proteksi dan 1.2 : 0,52 (mol/mol) untuk yang terproteksi asetilasi. Kinerja
optimum pada proses osmosa balik diperoleh dari membran tanpa proteksi pada tekanan 20
atm, dengan nilai fluks sebesar 29,61 L/m2 jam dan faktor rejeksi 44,3 %. Membran ini
bersifat transparan, elastis dan kuat, dengan karateristik sebagai berikut: proses polimerisasi
berlangsung sempurna, indeks ikatan hidrogen (HBI) 0,43, temperature transisi gelas 127,02
o
C, temperatur dekomposisi 401,55 oC, kristalinitas 60,34 %, tegangan 328,45 Mpa, regangan
2,29 %, serta ketahanan jebol 767 Kpa, mempunyai morfologi yang homogen dan rata
sebelum dan sesudah aplikasi pada proses osmosa balik (reverse osmosis).
Kata kunci: minyak jarak, proteksi, asetilasi, hidrasi, osmosa balik, fluks, factor rejeksi,
temperatur transisi gelas, dekomposisi, kristalinitas, tegangan, regangan, kekuatan jebol,
morfologi.
98 % dan air[11].
Poliuretan (PU) merupakan polimer yang telah
OH
dikenal luas oleh masyarakat, yaitu sebagai busa
tempat tidur, sofa, asesoris mobil, serat, CH 3 CH = CH 2 + H2 O CH 3 CH CH 3
propena 2-propanol
elastomer, dan pelapis (coating). Produk PU (60 % )
mempunyai bentuk yang beragam yaitu dari
plastik elastomer linier lembut sampai busa Analog dengan reaksi di atas, maka dalam
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax :
604 +62 (22) 2504154, Homepage :of
Proceeding The 6th ITB-UKM Joint Seminar
http://www.chem.itb.ac.id/jschem, E-mail
on: jschem@chem.itb.ac.id
Chemistry
Marlina, N.M. Surdia, C.L. Radiman, S. Achmad
penelitian ini proses hidrasi dilakukan terhadap kemudian dilakukan koagulasi dalam air pada
ikatan rangkap dari asam lemak. temperatur kamar selama 1 jam[12].
Untuk menghindari reaksi samping antara gugus Karakterisasi
–OH dan asam sulfat selama reaksi di atas, dapat Penentuan karakteristik membran PU dilakukan
dilakukan proteksi dengan cara asetilasi [11,12], di berdasarkan standard ASTM dan SII [14].
mana gugus –OH diubah menjdi suatu ester.
3. Hasil Dan Pembahasan
Pengaruh Perlakuan
R OH R O COR Tabel 1 menunjukkan perbandingan komposisi -
e s te r OH dari asam lemak bebas terhadap isosianat
s ta b il d a la m s u a s a n a a s a m
akibat perbedaan perlakuan awal yaitu proteksi
R OH
A c2O
R O COCH3
atau tanpa proteksi gugus –OH dari asam lemak
p irid in
bebas. Dari hasil trial and error diperoleh
Membran PU dibuat dengan cara mereaksikan komposisi optimum kedua jenis asam lemak
asam lemak bebas baik dengan mapun tanpa tersebut adalah sebagai berikut..
proteksi terlebih dahulu dan variasi dari Dari tabel 1 tampak bahwa proses proteksi
konsentrasi tolulen diisosianat. Penelitian ini
bertujuan untuk menghasilkan membran dengan Tabel 1 Komposisi Monomer Pada Sintesa
Membran PU Asam Lemak
pori yang rapat (dense membran) yang dapat
Komposisi OH:TDI
diaplikasikan pada proses osmosa balik (reverse Proses
(mol/mol)
osmosis)[13].
Hidrasi 1,2 :0,41
2. Percobaan
Bahan utama : 2,4 tolulen diisosianat (TDI), Asetilasi-Hidrasi 1,2 :0,52
asam lemak bebas, minyak jarak, CHCl3, NaOH,
(CH3)2SO4, K2CO3, benzene, Ac2O, piridin,
terhadap gugus –OH mempengaruhi proses
H2SO4.
polimerisasi pada sintesa membran PU. Hal ini
Alat utama : kemungkinan disebabkan karena proses proteksi
Peralatan yang digunakan untuk karakterisasi menyebabkan gugus –OH dari asam lemak
adalah alat spektrofotometer infra merah (IR), terlidungi selama proses hidroksilasi, sehingga
osmosa balik Membran Master RUW-4 Nitro pada akhir proses gugus –OH yang terbentuk
Denko, uji jebol jenis Mullen, Scanning Electron lebih banyak, yang mengakibatkan TDI yang
Microscop (SEM) jenis Jeol JSM-T220A, alat dibutuhkan untuk membentuk membran PU juga
uji kekuatan tarik jenis Shimadzu Autograph AG- lebih besar.
500 B, alat DTA jenis General V4.1C Du Pont
2000 yang dilengkapi komputer untuk penentuan Pengaruh Komposisi Diisosianat
Hasil penelitian juga menunjukkan bila
titik transisi gelas dan titik leleh, difraksi sinar-x
konsentrasi TDI lebih besar dari konsentrasi-
merek Diano yang dilengkapi dengan komputer
konsentrasi di atas, maka larutan dope yang
untuk penentuan derajat kritalinitas, dan
dihasilkan lebih kental dan membran yang
seperangkat peralatan gelas yang biasa
dihasilkan menjadi keras dan kaku, bahkan bila
digunakan di laboratorium.
konsentrasi TDI lebih besar dari pada konsentrasi
Metoda: –OH maka akan terbentuk busa kaku. Hasil ini
Persiapan Asam Lemak Terhidrasi menunjukkan bahwa bagian keras (hard segment)
Pemisahan asam lemak dari ester gliserol, dari poliuretan yang terbentuk lebih banyak dari
proteksi gugus –OH dan proses hidrasi ikatan pada bagian lunak (soft segment). Fenomena ini
rangkap menggunakan air dan H2SO4 dilakukan sesuai dengan yang dihasilkan oleh Marlina dkk
dengan cara standard yang umum[11,12]. (2004) terhadap PU yang berasal dari asam lemak
teroksidasi melalui proteksi asetilasi.
Sintesis Membran PU
Pembuatan larutan dope PU dilakukan dengan Karakterisasi
mereaksikan asam lemak bebas dan TDI dengan Membran PU yang dihasilkan dikarakterisasi
komposisi asam lemak bebas: TDI bervariasi dari baik sifat kimia, fisik, mekanik serta kinerjanya
1,2 : 0,2 sampai 1,2 : 1,0 (mol/mol), aduk pada pada proses osmosa balik.
temperatur 100oC dengan waktu reaksi selama 5 Sifat kimia ditentukan dengan analisis struktur
menit. Larutan dope ini dicetak di atas plat kaca, dan penentuan indeks ikatan hydrogen
menggunakan alat infra merah (IR). Spektrum oleh Wool et al. (2000). Sebaliknya temperatur
IR yang dihasilkan menunjukkan bahwa dekomposisi dari membran terproteksi lebih
hilangnya serapan untuk gugus –CO dari NCO besar dibandingkan dengan membran tanpa
pada bilangan gelombang 2272.9 cm-1 dan gugus proteksi, karena pembentukan ikatan silang dan
–OH pada bilangan gelombang 3100 – 3300 cm-1, hard segment yang lebih banyak di dalam
baik untuk membran dengan atau tanpa proteksi. membran terproteksi, sehingga memerlukan
Sebagai hasilnya timbul serapan khas pada energi yang lebih besar. Hasil ini didukung oleh
bilangan gelombang 3365 cm-1, yang merupakan data analisis XRD, di mana persen kristalinitas
serapan untuk gugus uretan. Hasil ini membran terproteksi mempunyai nilai 70,48,
menunjukkan bahwa proses polimerisasi pada lebih besar dibandingkan membran tanpa proteksi
sintesa membran PU telah berlangsung dengan yaitu 60,34. Nilai ini menunjukkan bahwa
baik dan sempurna. Dari spektrum juga tampak membran mempuntyai sifat yang kuat dan elastis,
bahwa serapan terhadap gugus uretan untuk yang dapat digunakan sebagai membran osmosa
mebran dari asam lemak yang melalui proteksi balik.
lebih tajam dan lebar dibandingkan dengan
Data kekuatan mekanik dan kekuatan jebol dapat
membran dari asam lemak hasil hidrasi tanpa
dilihat pada tebel 3. Hasil pengukuran sifat
proteksi. Hal ini membuktikan bahwa proses
mekanik menunjukkan bahwa membran PU dari
proteksi menghasilkan gugus –OH yang lebih
asam lemak terproteksi mempunyai tegangan
banyak sehingga gugus uretan yang terbentuk
yang lebih kecil dibandingkan dengan membran
juga lebih banyak. Indeks ikatan hidrogen (HBI)
PU tanpa proteksi. Hal ini disebabkan karena
dari membran dapat ditentukan, yaitu hubungan
membran tersebut berasal dari bahan baku yang
antara absorban dari puncak karbonil ikatan
memiliki –OH lebih besar, sehingga memiliki
hidrogen terhadap puncak karbonil bebas. Dari
ikatan silang yang lebih banyak yang
gambar tersebut tampak bahwa HBI membran
menyebabkan sifatnya lebih getas, sehingga lebih
dari asam lemak terproteksi lebih besar
mudah dipatahkan. Sifat ini didukung oleh nilai
dibandingkan dengan yang hidrasi, yaitu 0,49 dan
regangannya yang lebih kecil untuk membran
0,43. Fenomena ini disebabkan karena interaksi
MPU terproteksi. Sebaliknya untuk menjebolkan
antar molekul dalam molekul membran tersebut
membran ini jauh lebih sulit karena banyaknya
lebih besar pada bagian keras dari pada bagian
ikatan silang, sehingga membutuhkan energi
lunaknya, atau dengan kata lain partisipasi gugus
yang besar.
karbonil pada ikatan hidrogen bagian keras lebih
besar pada membran PU hasil proteksi.
Tabel 2 Data analisis DTA dan XRD
Sifat fisik ditunjukkan oleh analisis terhadap
temperatur transisi gelas dan temperatur Membran DTA Kristalinitas
dekomposisi menggunakan alat DTA. Dari tabel Hasil Tg TD (oC) (%)
(oC)
2 tampak data analisis yang menunjukkan bahwa
Hidrasi 127,02 401,55 60,34
membran PU dari asam lemak yang terproteksi Asetilasi- 113,75 410,59 70,48
terlebih dahulu memiliki Tg lebih kecil dari pada Hidrasi
asam lemak yang terhidrasi, hal ini disebabkan
oleh kandungan gugus –OH yang lebih banyak Tabel 3 Data analisis kekuatan mekanik
sehingga membran yang dihasilkan lebih
fleksibel, yang menyebabkan perubahan dari Uji Tarik Uji
Membran
glassy menjadi fasa rubbery lebih mudah, namun Tegangan Regangan Jebol
Hasil
lebih sulit terdekomposisi. Kemungkinan lain (Mpa) (%) (Kpa)
disebabkan oleh tahapan polimerisasi yang Hidrasi 328,45 2,29 767
terjadi. Hal ini sesuai dengan hasil penelitian Asetilasi-
Jhurry dan Alain (1997), di mana temperatur Hidrasi 231,75 1,99 860
transisi gelas dari suatu polimer turun akibat
proteksi gugus hidroksi, hal ini dapat dimaklumi
karena berkurangnya ikatan hidrogen. Namun Osmosa Balik
dalam penelitian ini, gugus hidroksi setelah Membran yang dihasilkan di atas diplikasikan
diproteksi dibebaskan kembali. Membran dari pada proses osmosa balik, menggunakan larutan
asam lemak hasil hidrasi memiliki ikatan yang dam natrium klorida 2500 ppm sebagai larutan
kuat sehingga Tg nya lebih besar, hal ini sama umpan, dengan tekanan bervariasi dari 10 to 20
dengan polimer dari minyak kedele yang didapat atm.
35 Hidrasi 50
Hidrasi
30 Asetilasi-hidrasi Asetilasi-hidrasi
45
Fluks (L/m2jam)
25
10
35
5
0 30
10 15 20 10 15 20
Tekanan (atm) Tekanan (atm)
Gambar 1 Fluks terhadap tekanan osmosa Gambar 2 Faktor rejeksi terhadap tekanan
balik pada osmosa balik
(a) (b)
Gambar 3 Morfologi membran PU dari asam lemak bebas hasil foto SEM sebelum (a) dan
sesudah (b) proses osmosa balik
Dari Gambar 1 dan 2 tampak bahwa hasil 1. Perlakuan awal terhadap asam lemak
optimum dari proses osmosa balik diperoleh oleh bebas mempengaruhi sifat-sifat membran
membran tanpa proteksi dengan nilai fluks 29,61 PU yang dihasilkan.
L/m2 jam dan faktor rejeksi 44,3 %. Hal ini
2. Kondisi optimum pada sintesa membran
menunjukkan bahwa membran yang mengalami
PU adalah 1.2 : 0,41 (mol/mol) untuk
proses proteksi mempunyai pori yang lebih rapat
membran dari asam lemak terhidrasi tanpa
sehingga menghasilkan fluks yang lebih kecil dan
proteksi dan 1.2 : 0,52 (mol/mol) untuk yang
faktor rejeksi yang lebih besar. Dari hasil
terproteksi asetilasi.
penelitian ini tampak bahwa hasil yang diperoleh
belum maksimum, oleh karena itu perlu dicari 3. Kinerja optimum membran diperoleh
cara alternatif untuk menghasilkan monomer dari membran tanpa proteksi, dengan nilai
pada pembuatan membran PU. fluks sebesar 29,61 L/m2 jam dan faktor
rejeksi 44,3 %. Membran yang dihasilkan
Analisis permukaan membran menggunakan
bersifat homogen, elastis dan kuat.
SEM yang terlihat pada Gambar 3 , di mana
tampak bahwa morfologi permukaan membran 5. Daftar Pustaka
homogen dan rata sebelum dan sesudah [1]. Ramanathan L.S., Sivaran S., Munmaya K. M.,
diaplikasikan pada proses osmosa balik. Hal ini Polyurethanes, Polymer Data Handbook, Oxford
menunjukkan bahwa membran ini dapat University Press Inc., USA, 870 – 877 (1999).
digunakan pada tekanan yang besar dan waktu [2]. Woods G., The ICI Polyurethanes Book, ICI
yang panjang. Polyurethanes & John Wiley & Son, Netherlands, 7-
41, 249-284 (1987).
4. Kesimpulan
Dari hasil penelitian ini dapat disimpulkan [3]. Odian G. (1991), Principles of Polymerization,
bahwa: John Wiley & Son, Inc., USA, 1 – 37.
[4] Cheng L.P., Huang Y.S., and Young T.H., Effect
of the Temperatur of Polyurethane Dissolution on the
Mechanism of Wet-casting Membran Formation, [10]. James A.D., CRC Handbook of Medicinal
European Polymer Journal, 39, 601-607 (2003). Herbs, Florida, CRC Press Inc., (1985).
[5] Sinha A.K. and B.K. Mandal, Thin Polyurethane [11]. Trost B.T., Ian F., and Steven V.L.,
Films of Polyhydroxysilicon Phtalocyanine and Bis- Comprehensive Organic Synthesis, Selective,
pthalocyanine Derivates, Polymer Journal, Vol. 27. Strategy, and Efficiency in Modern Organic
No. 11, 1079 – 1084 (1995). Chemistry, Volume 7 Oxidation, Pergamon Press,
USA, (1994).
[6]. Xie H. Q and J.S. Guo, Room Temperatur
Synthesis and Mechanical Properties of Two Kinds of [12] Marlina, N.M. Surdia, C.L. Radiman, S. Achmad,
Elastomeric Interpenetrating Polymer Networks based Sintesis Membran Poliuretan Dari Asam Lemak
on Castor Oil, European Polymer Journal 38, 2271- Bebas Teroksidasi Dan Tolulen Diisosianat, Prosiding
2277 (2002). Seminar MIPA 2, ITB, Bandung, (2004).
[7] Lu Y., L. Zhang, Morphology and Mechanical [13]. Stropnik C. and V. Kaiser, Polymeric Membran
Properties of Semi Interpenetrating Polymer Networks Preparation by Wet Phase Separation : Mechanism
from Polyurethane and Benzyl Konjac Glucomanan, and Elementary Process, Desalination 145, 1-10
Polymer 43, 3979-3986 (2003). (2002).
[8] Huang J. and L. Zhang, Effect of NCO/OH ratio [14] Annual Book of ASTM Standards (1976), D961,
on Structure and Properties of Graft – Inter Washington, D.C., USA.
Penetrating Polymer Networks from Polyurethane
[15] Wool R.P. (2002), Composites from Soybean,
and Nitrolignin, Polymer 43, 2287-2294 (2002).
Tenth European Conference on Composite Materials
[9] Rizk A.M. and A.S. Al- Nowaihi, The (ECCM-10), Brugge, Belgiu
Phytochemistry of The Horticultural Plants of Qatar,
Qatar , The Scientific and Applied Research Center,
University of Qatar, The Alden Press, Ltd., (1989).
Abstract
Fatty acids in surface sediments were analysed from 25 sampling sites in the Mawddach
Estuary, UK. A total of 32 different fatty acids were quantified as their methyl esters using
GC-MS techniques. Individual compounds, ratios and multivariate statistical methods were
used to identify the sources and their spatial variation. The sediments towards the sea were
rich with marine and phytoplankton markers (e.g. 16:1ω7 and short chain saturated fatty
acids) whereas those near the sewage discharge points were comprised of odd chain length
fatty acids, their branched derivatives and 18:1ω7 acid, linking these areas with bacterial
biomass. The terrestrial influence could be seen in the freshwater sediments through the use
of long chain saturates (24 and 25 carbon). Multivariate statistical technique (PCA) was used
to interpret the data. PCA was found to be useful in this case. PCA showed the compounds
separation from marine and bacterial derived compounds to the terrestrially derived fatty
acids.
Keywords: fatty acids, Mawddach Estuary, biomarkers, PCA
N
25
ST
ST 24
18 21
Mawddach 17
Estuary 14
15 19
12 20
10 22 23
13 16
8
11
1 5
3
7 9
4 6 ST
ST
Sewage outlet
ST
2 ST Septic tank
Figure 1: Location of sampling sites and sewage outfalls throughout the Mawddach Estuary
extensive sandflats throughout its length and Approximately 30-40 g wet weight of sediment
220 ha of salt marsh (Burd, 1989). Mawddach was hydrolysed with 50 ml of 6% w/v
Estuary opens into Cardigan Bay at Barmouth, potassium hydroxide in methanol (Rathburns).
which is a popular seaside town with a The samples were refluxed for 3.5 hours which
sheltered harbour for small fishing boats. A spit gave >95% recovery for Pereira (1999). The
of sand and shingle (Fairbourne sands) protects reflux samples were centrifuged (Hermle Z 230
the mouth of the estuary. A) at 2500 r.p.m. for 5 minutes. The
supernatant was then funnelled into the
The major goal of this study was to identify and
separating flask. The sterols, fatty alcohols,
distinguish the distribution of fatty acids
aliphatic and aromatic hydrocarbons were
throughout the Mawddach Estuary using
extracted into hexane. The remaining aqueous-
individual compounds, ratios and multivariate
methanol phase contained fatty acids and was
statistical method.
acidified using the 10% hydrochloric acid
2. Materials and methods (HCl) and transferred into the separating
Surface sediment samples (the top 4 cm) were funnel. Twenty ml of dichloromethane:hexane
collected from 25 sites around the Mawddach (1:4) solution and 10 ml of UHQ water were
Estuary (Figure 1). The samples were stored at added to separate the fatty acids fraction. The
4oC until further analysis. mixture was shaken and the lower phase was
removed. The procedure was repeated once
Extraction
The samples were stored at 4oC before the again. The solvent fractions were combined,
extraction. Samples were extracted concentrated by a combination of rotary
immediately after they were collected. The evaporation and nitrogen blow down to
storage condition i.e. in the fridge is similar to dryness.
the environmental condition. No change of Boron triflouride (BF3) was used to derivatise
colour was observed in related to the oxygen the fatty acid samples. The chemical reaction
usage. Extraction of sediment was carried out involves is the hydrogen atom from the
in three stages: sediment reflux, liquid-liquid carboxyl end of the fatty acid is replaced by a
separation and derivatisation. The methods methyl group forming a methyl ester and
used for extraction and purification are adapted analyse by gas chromatography-mass
from procedures found in the literatures spectrometry (Fisons MD-800).
(Mudge and Norris, 1997; Mudge et al., 1998).
Gas Chromatography - Mass Spectrometry
Experiments with spiked reference materials
A computerised gas chromatography - mass
have shown that these methods release >95% of
spectrometry (GC-MS) (Fisions MD800) was
the fatty acids, fatty alcohols and sterols from
used to analyse fatty acids of the sediments
sediments and full recovery is assumed here
with an on-column injection and secondary
(Mudge and Norris, 1997; Pereira, 1999).
cooling. The compounds are carried through
the column by helium carrier gas (99.996%
pure with a flow rate 1ml min-1 and column and quantify individual compound sources
pressure of 50 kPascal) after the sample is from complex mixtures of compounds collected
vaporised. Characteristic ions were produced from the estuary. A SIMCA-P program from
by the bombardment of compounds by Umetri (Sweden) was used to perform the PCA
electrons and they are separated according to in order to determine the biomarker
their mass:charge (m/z) ratio. Masslab, which is distributions throughout the sampling sites.
a GC-MS program, was used to record and Proportion data, added 0.001 with log
display the mass spectra. A BPX-70 (SGE) transformation were used for the analysis
column was used for fatty acid methyl esters. It
3. Results
is a very polar, bonded phase column with a 50
The results were expressed in ng g-1 WW due
m length, 0.33 mm internal diameter and
to lack of sample for dry weight analysis.
0.25µm film thickness. The temperature Arrows were applied to the figures to show the
program started at 80°C, increasing at 40°C sewage outfalls and ST for the septic tanks. A
min-1 to 160°C, then at 0.5°C min-1 to 170°C total of 32 fatty acids were identified from the
and finally at 10°C min-1 to a maximum of 25 sampling sites with 16:0 and 18:0 the two
250°C for 8 minutes. Calibration with most abundant. Figure 2 illustrates the
standards of known concentration was carried distribution of the monounsaturated and
out in order to quantify the peaks obtained polyunsaturated fatty acids (expressed as a
during the analysis. Tricosanoic acid methyl percentage of the total fatty acids
ester (23:0) was used as an internal standard. concentration), which are similar to each other
Quality Assurance Procedures (correlation coefficient r=0.58, p<0.01). High
Standard method and techniques were adopted values of monounsaturated fatty acids (>30%
whenever possible during this work. In the of total fatty acids) can be seen at S1. The
laboratory, analyses were carried out in Decon- unsaturated fatty acids together with the short
90 washed glassware. The efficiency of the chain saturated fatty acids have high
whole extraction process was confirmed by concentrations at stations towards the sea (S1
repeat reflux of some sediment samples; no and S2) and are low at stations where sewage is
further fatty acids could be detected in these likely to have a major influence on sedimentary
later extractions. Blanks and calibration organic matter (S3, S4, S6, S7, S9, S14 and
standards were used throughout the GC S22) and at freshwater end of the estuary (S24
injections. A blank was injected first and and S25). Three monounsaturated 16-carbon
followed by the calibration standard. Five fatty acids (16:1ω7, 16:1ω9 and 16:1ω11) were
samples were injected afterwards, and followed identified in this study. 16:1ω7 contributes
by the blank and calibration standard again more than 10% of the total fatty acids in S1 and
S2, which are marine in nature.
Random samples were extracted three times to
test the reproducibility of the extraction. The The distribution of percentage branched fatty
mean and standard deviation of fatty acid acids (Figure 3) is the inverse of the
18:1ω7, saturated alcohol 18:0 and cholesterol distribution of monounsaturated and
from sample 1 in the Mawddach Estuary are polyunsaturated fatty acids (r=-0.32, p<0.01).
1426 ± 45 ng g-1, 24.84 ± 0.83 ng g-1 and 1342 High percentages (>15% of total fatty acids)
± 52 ng g-1 respectively. Therefore, the were generally seen at S3, S4, S5, S6, S7, S9,
reproducibility of the extraction has been found S12, S14, S21 and S22 that are near the sewage
to be better than 90% for all three classes of discharge points, indicating those areas had
compound. Procedural blanks were also increased bacterial biomass. This observation is
analysed and no compounds of interest were supported by the low concentration of
measured in any sample. All glassware and polyunsaturated fatty acids in those stations.
Teflon-lined caps used in these analyses were The odd/even ratio (Figure 4) shows a similar
rinsed with organic solvents prior to work. distribution as the percentage branched fatty
Multivariate statistical technique acids reinforcing their link with bacterial
In this study, the results were investigated by biomass. Fatty acid 18:1ω7 has also been used
multivariate statistical analysis such as as bacterial biomarker (Saliot et al., 1991). The
Principal Component Analysis (PCA) to extract concentration of this fatty acid was strongly
14 35
12 30
8 20
6 15
4 10
2 5
0 0
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25
stations stations
40
% Branched fatty acids
ST
30
ST
20
10
0
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25
sampling station
0.5
ST ST
0.4
odd/even ratio
0.3
0.2
0.1
0
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25
sampling station
Figure 4: Distribution of odd/even ratio of fatty acids throughout the Mawddach sampling
stations
50
40
short/long ratio
30
20
10
0
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25
sampling station
polyunsaturated fatty acids representing the tidal exchange (Mannino and Harvey, 1999).
algal input are positively loaded on PC2. PCA Fatty acids have been used to evaluate sources
carried out using proportion data with log of organic matter in various depositional
transformation (+0.001) shows the clear environments (Volkman, 1986; Volkman et al.,
separation compared to the other sets of data. It 1987; Wakeham and Lee, 1989; Mudge et al.,
can be seen that 17:0 acid behaves like 1999). In this study, 25 surface samples were
"marine" derived compound in most cases, collected from the Mawddach Estuary to assess
while the 15:0 acid behaves like branched fatty the spatial variability.
acids representing the "bacterial" marker.
Long chain fatty acids and fatty alcohols are
Monounsaturated fatty acids like 18:1ω9, generally associated with the higher plants and
18:1ω11, 16:1ω7, 16:1ω9 and 16:1ω11 also are considered as indicator of terrigenous
behave like "algae" derived compounds but not inputs (Fukushima and Ishiwatari, 1984; Carrie
as well defined as others. et al., 1998). However longer chain fatty acids
Figure 6b shows the scores of the first two may also be present in some diatoms
components based on the proportion data (Volkman, 1986; Volkman et al., 1998). Long
(+0.001) with log transformation as the PCA chain fatty acids were found in all samples
carried out with this set of data showed clear collected. Higher concentrations of these
compound separation. Terrestrial organic compounds can be seen in the freshwater
matter dominates samples projected on the left samples compared to the marine samples in the
side of the diagram (terrestrial axis). Samples Mawddach Estuary. This was probably the
projected towards the right side of the diagram result of the physical processes of dispersion
are influenced with algae and marine markers and deposition of the riverine sediments
showing that sample 1 and 2 have the most combined with the selective diagenesis (Mudge
marine derived compounds. Meanwhile and Norris, 1997). The same results were found
samples that projected negatively on PC2 from the Peru sediments (Volkman et al.,
contain the greatest amount of bacterial derived 1987). Fukushima and Ishiwatari (1984) also
fatty acids (bacterial axis). found high concentration of long chain
allochthonous materials in the surficial
4. Discussion sediments of Tokyo Bay. These relatively high
Estuaries occupy a unique position between concentrations of long chain fatty acids in
land and ocean for material exchange and marine sediments were controlled by the input
biogeochemical processing of organic matter. as well as by the degradation of organic matter
The origin of organic matter in estuaries is (Westerhausen et al., 1993).
complex, and sources include: a) in situ
primary production, b) terrestrial material Fukushima and Ishiwatari (1984) used the L/H
transported by river and groundwater flow, land ratio by assuming that chain length
runoff, and atmospheric deposition, c) distributions may reflect input of fatty acids
anthropogenic sources such as wastewater and fatty alcohols. The short/long ratios
treatment plants, industrial plants, etc., and d) (similar to L/H ratio) for fatty acids in the
material from the coastal ocean transported via Mawddach samples were high in the marine
samples and low in the freshwater samples
0.30 18:1w9
18:2w 6
20:4w 6
20:1
18:3w 3 18:2
17:1 20:5w 3 16:1w9
0.20 16:3 16:1w7
16:2 16:1w11
0.10 13:0
18:0 25:0
20:0 18:1w11 14:0
12:0
p[2]
0.00
17:0
24:0 21:0
-0.10 22:0
16:0 br-16:0 ante-17:0
br-14:0
15:0
-0.20 18:1w 7
ante-15:0
iso-15:0
iso-17:0
Figure 6a: The loadings for each fatty acid on PC1 and PC2 in the PCA model
1
6
algae
2
4
15
2 24
25
19
16 21 13 4
marine
12
11
18 17 22
0
t[2]
8
10
-2
terrestrial 23
3
20 14 6
5 7
9
-4
-6 bacteria
-8 -7 -6 -5 -4 -3 -2 -1 0 1 2 3 4 5 6 7 8
t[1]
Figure 6b: The PCA scores for the first two components
(Figure 5). These ratios strongly imply that marine samples while low concentrations were
freshwater samples (above the tidal limit) are present in the freshwater samples (Figure 3.3).
rich with compounds derived from terrestrial Similar results were observed by Goñi et al.
plant sources. (2000) at Beaufort Shelf, which was dominated
by monounsaturated 16:1, followed by the short
The fatty acids detected in all marine samples
chain fatty acids (16:0, 14:0 and 12:0 acids).
were predominantly marine in origin. Similar
These compounds are not different from micro
distributions have been observed in other
algae such as diatoms and green algae (Goñi
marine systems (Carrie et al., 1998; Mudge et
and Hedges, 1995). Hence, the predominance
al., 1999). Short chain saturated fatty acids are
considered to originate from algae (Carrie et of 16:1ω7, which contributes more than 10% of
al., 1998; Rohjans et al., 1998; Mudge et al., the total fatty acids in S1 and S2 likely, is
1999). The saturates were dominated by 14:0, indicative of a marine diatom source. The 16:0
16:0 and 18:0 acids. Fatty acids such as and 14:0 fatty acids also have been observed to
be important constituents in Laptev Sea
16:1ω7, 18:4ω3 and 20:5ω3 are derived
sediments, where they have been attributed to
primarily from phytoplankton as these fatty
microalgal inputs, mainly diatoms (Zegouagh
acids are major lipids in many species of
et al., 1996).
diatoms (Volkman et al., 1989; Dunstan et al.,
1994; Reitan et al., 1994). The Branched fatty acids and fatty alcohols
monounsaturated fatty acid, 16:1ω7 is diatom (principally iso and anteiso odd chain length
derived (Carrie et al., 1998; Mudge et al., compounds) are commonly encountered in
1999) and can be found in all samples in high bacterial lipids (Parkes, 1987; Saliot et al.,
concentration, especially in marine samples. In 1991; Thoumelin et al., 1997). Therefore these
the Mawddach samples, high value of compounds are useful indicators of bacterial
unsaturated fatty acids together with the short lipid contribution or bacterial biomass. The
chain saturated fatty acids can be seen in odd/even ratios of fatty acids have a similar
Delta (western Mediterranean) by the study of Saliot, A., Laureillard, J., Scribe, P. and Sicre, M.A.
sedimentary lipid markers. Mar. Geol. 95, 207-224. (1991) Evolutionary trends in the lipid biomarker
approach for investigating the biogeochemistry of
Hama, T. (1991) Production and turnover rates of
organic matter in the marine environment. Mar.
fatty acids in marine particulate matter through
Chem. 36, 233-248.
phytoplankton photosynthesis. Mar. Chem. 33, 213-
227. Smith, D.J., Eglinton, G. And Morris, R.J. (1983)
The lipid chemistry of an interfacial sediment from
Killops, S.D. and Killops, V.J. (1993) An
the Peru Continental Shelf: Fatty acids, alcohols,
Introduction to Organic Geochemistry. Longman
aliphatic ketones and hydrocarbons. Geochim.
Scientific and Technical. New York. 265 p.
Cosmochim. Acta 47, 2225-2232.
Laureillard, J. and Saliot, A. (1993) Biomarkers in
Thoumelin, G., Bodineau, L. and Wartel, M. (1997)
organic matter produced in estuaries: a case study of
Origin and transport of organic matter across the
the Krka estuary (Adriatic Sea) using the sterol
Seine estuary: Fatty acid and sterol variation. Mar.
marker series. Mar. Chem. 43, 247-261.
Chem. 58, 59-71.
Mannino, A. and Harvey, H. R. (1999) Lipid
Tolosa, I., Vescovali, I., LeBlond, N., Marty, J-C,
composition in particulate and dissolved organic
de Mora, S. and Prieur, L. (2004) Distribution of
matter in the Delaware Estuary: Sources and
pigments and fatty acid biomarkers in particulate
diagenetic patterns. Geochim. Cosmochim. Acta
matter from the frontal structure of the Alboran Sea
63,2219-2235.
(SW Mediterranean Sea). Mar. Chem. 88, 103-125.
Mudge, S. M., Bebianno, M. J., East, J. A. and
Volkman, J.K. (1986) A review of sterol markers
Barreira, L, A. (1999) Sterols in the Ria Formosa
for marine and terrigenous organic matter. Org.
Lagoon, Portugal. Wat. Res. 33, 1038-1048.
Geochem. 9, 83-99.
Mudge, S. M., East, J. A., Bebianno, M. J. and
Volkman, J. K., Barrett, S. M., Blackburn, S. I.,
Barreira, L, A. (1998) Fatty acids in the Ria
Mansour, M. P., Sikes, E. L. and Gelin, F. (1998)
Formosa Lagoon, Portugal. Org. Geochem. 29, 963-
Microalgal biomarkers: A review of recent research
977.
developments. Org. Geochem. 29, 1163-1179.
Mudge, S. M. and Norris, C. E. (1997) Lipid
Volkman, J.K., Farrington, J.W. and Gagosian, R.B.
biomarkers in the Conwy Estuary (North Wales,
(1987) Marine and terrigenous lipids in coastal
U.K.): a comparison between fatty alcohols and
sediments from the Peru upwelling region at 15oS:
sterols. Mar Chem. 57, 61-84.
Sterols and triterpene alcohols. Org. Geochem. 11,
Parkes, R. J. (1987) Analysis of microbial 463-477.
communities within sediments using biomarkers. In:
Volkman, J.K., Jeffrey, S.W., Nichols, P.D., Rogers,
Fletcher, M., Gray, T. R. G. and Jones, J. G. (Eds.).
G.I. and Garland, C.D. (1989) Fatty acids and lipid
Ecology of Microbial Communities. Cambridge
composition of 10 species of microalgae used in
University Press, London, 440 pp.
mariculture. J. Exp. Mar. Biol.Ecol. 128, 219-240.
Pereira, M. G. S. (1999) Bacterial degradation of
Westerhausen, L., Poynter, J., Eglinton, G.,
linseed and sunflower oils in salt marsh sediments.
Erlenkeuser, H. and Sarnthein, M. (1993) Marine
PhD Thesis. University of Wales, Bangor. 199p.
and terrigenous origin of organic matter in modern
Reitan, K. I., Rainuzzo, J. R. and Olsen, Y. (1994) sediments of the equatorial east Atlantic: the δ13C
Effect of nutrient limitation on fatty acid and lipid and molecular record. Deep Sea Res. I 40, 1087-
content of marine microalgae. J. Phycol. 30, 972- 1121.
979.
Zegouagh, Y., Derenne, S., Largeau, C. and Saliot,
Rohjans, D., Brocks, P., Scholz-Böttcher, B. M. and A. (1996) OM sources and early diagenetic
Rullkötter, J. (1998) Lipid biogeochemistry of alterations in Arctic surface sediments (Lena River
surface sediments in the Lower Saxonian Wadden delta and Laptev Sea, Eastern Siberia): I. Analysis
Sea, northwest Germany, and the effect of the strong of the carboxylic acids released via sequential
winter 1995-1996. Org. Geochem. 29, 1507-1516. treatments. Org. Geochem. 24, 841-857.
Khiew Poh Sima, Huang Nay Minga, Shahidan Radimana, Md Soot Ahmadb
a
School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600
Bangi, Selangor, Malaysia.
b
School of Chemistry & Food Technology, Faculty of Science and Technology, Universiti Kebangsaan
Malaysia, 43600 Bangi, Selangor, Malaysia.
Abstract
Polyaniline-coated Cadmium Sulphide nanocompistes have been synthesized employing the
microemulsion processing technique. Microemulsion contains a dynamic structure of water
nanodroplets have been utilized as the medium for the chemical reaction to occur when
desirable reactants collide with each other. The synthesized polyaniline-coated CdS
nanocomposites were characterized by UV-Vis absorption , FTIR, X-ray diffraction and
Energy Filtered Transmission Electron Microscopy (EFTM). The appearance of
characteristic absorption band around 330, 450 and 800 nm in UV-Vis spectra confirm the
formation of conductivity emeraldine salt. The lower intensity polaron absorption for
polyaniline/CdS nanocomposites in the spectra indicates the doping state of the polymer has
been improved The very weak vibration peak of CdS bonding at 405 cm-1 is observed in FTIR
spectra. These result reveal the concentration of CdS in nanocomposites is very low due the
formation of core-shell structure.. The size of the nanocomposites is estimated to be the range
of 10-20 nm as observed in the TEM micrograpgh. The powder XRD pattern of the products
confirms the formation of cubic CdS nanocrystal in the nanocomposites.
Abstrak
Walaupun Pliny, sekitar 2000 tahun yang lepas, merupakan sarjana pertama di dunia yang
diketahui menulis dengan panjang lebar tentang sifat-sifat pada objek kristal, namun hukum-
hukum dasar berkenaan kristal hanyalah diungkapkan seawalnya selepas 1600. Johannes
Kepler pada 1611 sewaktu membuat penelitian terhadap salji yang berbentuk heksagonal
menyatakan bahawa “struktur kristal yang sebegitu mungkin disebabkan daripada
tersusunnya secara geometri unit-unit kecil secara teratur”. Steno pula pada 1669
mengatakan bahawa “sudut diantara bahagian-bahagian tertentu pada suatu kristal
selalunya tetap”. Hukum Steno ini diuji kebenarannya pada 1783 melalui ujian Contact
Ganiometer dan dengan lebih tepat lagi melalui Sinar-X pada 1912. Hukum Steno dikenali
sebagai Sudut Antara Permukaan Tetap. Seterusnya Hauy(1743-1822) yang menyelidiki
kristal melalui kaedah pembelahan mengusulkan Hukum Struktur Kristal sebagai “semua
kristal selalunya terbentuk dan tersusun daripada unit-unit kecil yang berbentuk polihedra,
dengan setiap unit pada mineral tertentu selalu mempunyai bentuk yang khas”. Huay juga
mengusulkan Hukum Pemotongan Asas sebagai “pemotongan kristal pada paksi-paksinya
selalu menunjukkan perbandingan pembolehubah yang asas dan tetap”. Manakala Bravais
Latice pada 1850 menyatakan bahawa “pola di dalam kristal mengikuti aturan susunan
atom/ion dalam ruang kekisi”. Di sini kami akan berusaha untuk membincangkan
pembangunan ilmu matematik yang terlahir daripada aksiom-aksiom ini.
1) Institute for Environment and Development (LESTARI), Universiti Kebangsaan Malaysia, 43600 Bangi,
Selangor, Malaysia
mazlin@pkrisc.cc.ukm.my, hafizan71@hotmail.com, ijan@hotmail.com
2) Chemistry Department, Faculty of Science, Universiti Malaya, 50603 Kuala Lumpur, Malaysia
smzain@pkrisc.cc.ukm.my
3) School of Social, Development and Environment, FSKK, Universiti Kebangsaan Malaysia, 43600 Bangi,
Selangor, Malaysia
iwan550@hotmail.com
4) National Hydraulic Research Institute of Malaysia (NAHRIM), Ministry of Natural Resource and
Environment, Jalan Putra Permai, Sri Kembangan 43300 Selangor, Malaysia
baharuddin@nahrim.gov.my
5) Forest Research Institute Malaysia, 52109 Kepong, Kuala Lumpur, Malaysia
zaihan@frim.gov.my
Abstract
Malaysia have adopted the concept of sustainable development as mentioned in the National
Documents of the 8th Malaysian Plan and OPP3. This calls for environmental studies within
the context of sustainable science and governance. This study details the application of
chemometrics in environmental chemistry for sustainable utilization of resources in the
Langat Basin, Selangor, Malaysia. We hope to demonstrate in this work the importance of
historical data, if they are available, in planning sampling strategies to achieve desired
research objectives. This study was conducted in order to highlight the possibility of
determining the optimum number of sampling stations which in turn would reduce cost and
time of sampling. The seasonally dependent water quality data of Langat River was
investigated during the period December 2001 – May 2002. Monthly samples were collected
from four different plots. Concentrations of nitrate, sulfate, phosphate, lead, cadmium, iron,
zinc, copper, suspended sediment (SS), ammoniacal nitrogen (AN), chemical oxygen demand
(COD) and biological oxygen demand (BOD) were determined. Dissolved oxygen,
temperature, pH and conductivity were measured in situ. Chemometric treatments using
cluster and principal component analysis were employed in which data were characterized as
a function of season and sampling sites, thus, enabling significant discriminating factors to be
discovered. Results showed that at chord distance 75.25 the cluster gave two groups of
sampling plot. Group I consists of 6 sampling stations while Group II consists of 14 sampling
stations (Figure 1,2 and 3). The two clusters are discussed in terms of the difference in data
variability.
Keywords: chemometrics, principles component analysis, cluster analysis
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem,
th E-mail : jschem@chem.itb.ac.id
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry 619
Mazlin B. Mokhtar, Hafizan Juahir, Sharifuddin M. Zain, Ijan Khushaida M. Jan, M. Ekhwan
Toriman, Baharuddin Abdullah, Zaihan Jalaludin
non-linear nature of environmental data, different samples (Massart et al., 1997). Some
analyzing these data may be tricky. The examples of the use of chemometrics are as a
multivariate nature of these data together with multicriteria decision-making (Khalil et al.,
their complex interrelation requires that 2004), chemometric investigation of variable
multivariate data analysis techniques be and site correlations (Abollino et al., 2001),
employed in order to decipher any structure determination of correlation of chemical and
within the data. In this study the application of sensory data in drinking waters by factors
chemometrics methods is used to determine the analysis (Meng et al., 1997). The chemometric
number of sampling sites which are applications in evaluating environmental data
significantly different to each other. This work has been demonstrated in several publications
is motivated by the fact that an understanding (Mendiguchia et al., 2004; Brodnjak-Voncina
of the nature of sampling sites would help in et al., 2002; Marengo et al., 1995).
reducing the number of redundant sites, thus
This study was carried out to fulfill these
reducing cost and time.
objectives, (i) to apply chemometrics in
The data collected in this study came from 4 recognizing patters in the sampling data (ii) to
different sampling plots which gave 17 evaluate and interpret river pollution data (iii)
sampling sites altogether. The study was to encourage the use of secondary data to help
conducted by a postgraduate student to measure scientists and researchers in designing better
the impact of palm oil plantation activities to approaches to future studies and (iv) to
the water quality in the Langat River Basin. understand how computer and software
The selected plots are Kg. Bukit Dugang, Kg. technologies can assist scientists and engineers
Jenderam, Bukit Changgang and Labohan in their studies. In this preliminary study, we
Dagang which are located along the river basin look at (i) in specific.
with palm oil activities. In this study, the
2. Experimental
sampling plots were selected based on the
Study site
economic needs of two districts involved in this
Langat River Basin is formed by three main
study area (Kuala Langat and Sepang District).
river which are Langat River, Semenyih River
The main economic activities for both districts
and Labu River. At the length of about 125.6
are agriculture and industry with palm oil
km, the rivers flow across Negeri Sembilan and
plantation as the main agricultural activity
Selangor State. Langat River is one of the most
(Pihak Berkuasa Perancang Tempatan Kuala
important raw water resources for drinking
Langat, Sepang and Putrajaya, 2000).
water and other activities such as recreation,
Unfortunately, the study was conducted
industrial uses, fishery and agriculture. In this
without proper sampling design and the
area, agriculture is the main activity which
selected plots were not statistically identified. It
covers 53.1% of the area, while 3.6% are for
is well known that much have been studied on
commercial purposes. Palm oil plantation takes
water quality by many researchers for the
20,993 ha from the area and another 13,574 ha
Langat River Basin. Therefore, secondary data
is covered by rubber plantation.
from previous research can be used to obtain
much information to help us in designing new Up to 17 sampling sites were selected to cover
research at the Langat River Basin. The the study (see Fig. 1). To select the location of
abundance of secondary data motivated us to the sampling stations the conventional method
use chemometric methods in order that proper based on economic activities are taken into
sampling design can be obtained. consideration. The sampling stations are
divided into four plots which are plots one and
Massart et al., (1997) defined “chemometrics
two namely Kampung Bukit Dugang and
as a chemical discipline that uses mathematics,
Kampung Jenderam consisting of five sampling
statistics, and formal logic (a) to design or
station located in the Sepang District. Plots 3
select optimal experimental procedures; (b) to
and 4, namely Bukit Changgang and Labohan
provide maximum relevant chemical data; and
Dagang are located in Kuala Langat District
(c) to obtain knowledge about chemical
which consists of four and three sampling
systems”. Chemometric methods have been
stations respectively (see Table 1.).
used for the classification and comparison of
53.26
68.84
Similarity
84.42
100.00
Rainy
Rainy
Rainy
Rainy
Rainy
Dry
Rainy
Dry
Rainy
Dry
Dry
Dry
Rainy
Dry
Rainy
Rainy
Dry
Rainy
Dry
Dry
Rainy
Dry
Dry
Dry
Fig.1: Seasonal dendogram calculated by the Ward method for the variables of Table 2. The four sampling plots
with six sampling periods
AN, conductivity, nitrate, sulfate, phosphate, linkage between groups and Ward’s method
lead, cadmium, iron, zinc, and copper (Table were applied to raw data and the results
3). obtained were represented in a dendogram.
Analytical procedures Statistical analysis were carried out by using
Dissolved oxygen, temperature, pH and both Datalab for Teach/Me software
conductivity were measured in situ. AN, (Lohninger, 1999) and Minitab for Windows
phosphate, nitrate, sulfate were determined 13.0 software packages.
using HACH KIT (192) 8038 Spectrophotmeter
3. Result and discussion
HACH DR 2000. Heavy metals (Pb, Fe, Zn, Cu
Table 3 reports all the data obtained for the
and Mn), BOD and SS, were analyzed
samples collected. The data set consists of 24
according to APHA (1998). While COD was
samples which comes from 4 different plots
determined using HACH KIT (1992) 8000,
which consists of 17 sampling sites. Plot one
Thermoreactor Model-Eco 16 Thermoreactor
and two consists of 5 sampling sites each. Plot
Velp Scientifica.
three consist of 4 sampling sites and plot four
Statistical procedures consists of 3 sampling sites. The samples were
In principal components analysis (PCA), collected in 6 different sampling periods. For
eigenanalysis of the experimental data was each of the 24 samples 16 features have been
performed to extract principal components evaluated.
(PCs) of the measured data, using two selection
Cluster Analysis
criteria: the scree plot test and corrected
Cluster analysis is one of the method are
average eigenvalue. For hierarchical cluster
applied in unsupervised pattern recognition
analysis (CA), the squared Euclidean distance
(Brereton, 2002; Forina et al., 2002; Einax et
between normalized data was used to measure
al., 1998). In this study cluster analysis was
similarity between samples. Both average
applied to search for clusters due to different
25.75
Group 1 Group 2
50.50
Similarity
75.25
100.00
Labohan Dagang
Labohan Dagang
Labohan Dagang
Labohan Dagang
Labohan Dagang
Labohan Dagang
Bukit Changgang
Bukit Changgang
Bukit Changgang
Bukit Changgang
Kg. Jenderam
Bukit Changgang
Kg. Jenderam
Bukit Changgang
Kg. Jenderam
Kg. Jenderam
Kg. Jenderam
Kg. Jenderam
Figure 2: Sampling plot dendogram clearly separating Labohan Dagang and the other plot
sampling period or different sampling sites by The two groups of samples from plots 4 (Group
using water quality variables or features. The 1) and plots 1, 2 and 3 (Group 2) join at a lower
agglomerative hierarchical cluster analysis level of similarity in the sampling plot
according to Ward was applied to detect dendogram (Figure 2) compared to the seasonal
multivariate similarities between sampling sites dendogram (Figure 1). This demonstrates that,
in different sampling plots for different from a hierarchical point of view, the
sampling periods. From Figure 1 it is observed difference between the two separated groups (1
that separation between group 1 and group 2 is and 2) is larger in the sampling plot dendogram
clearly not due to seasonal changes. (Figure 2) compared to the seasonal dendogram
Differences in the feature values (water quality (Figure 1). This is an indication that separation
parameters) due to seasonal changes are of sampling plot should be used as a more
distributed over the whole area of sampling significant factor in forming the basis of
plots. It does not form the basis of the choosing sampling sites in order to study the
separation observed in the objects (sampling effects of palm oil plantation on water quality.
sites). Searching for seasonal dependencies based on
the conventionally chosen sampling sites is
On the other hand, Figure 2 shows that if the
consequently an ineffective exercise which
separation is grouped according to sampling
involves high cost and much time being
plots, the separation shows clear discrimination
wasted.
of Labohan Dagang and the other sites. It can
be seen that Labohan Dagang (Group 1) Principal Component Analysis
sampling plot at similarity level 75.25 is very Table 4 shows the variance explained by the
different from the others. In this study the other principal components obtained in a principal
three sampling plots which merge at similarity component analysis (PCA). It clearly shows
level 75.25 (Bukit Changgang, Kampung that most of the data variance is explained in
Jenderam and Kampung Bukit Dugang) forms the first 2 PCs (99.46%). This result is in
a single group (Group 2). agreement with the observed highly redundant
300
150
Kg. Bukit Dugang
Kg. Jenderam Bukit Changgang Bukit Changgang
Kg. Jenderam
100 Kg. Jenderam Bukit Changgang Labohan Dagang
Kg. Jenderam Bukit Changgang
Kg. Bukit Dugang Labohan Dagang
Kg. Bukit Dugang
PC2
50
Kg. Bukit Dugang Kg. Bukit Dugang
Bukit Changgang
0
Kg. Bukit Dugang
0 100 200 300 400 500 600 700 800 900 1000
Labohan Dagang
-50
-150
Labohan Dagang
-200
PC1
Fig. 3: Principal component analysis for four sampling plots (with six sampling periods)
information caused by the presence of several analysis results. It can be remarked from the
variables with high covariance. values of the loadings of the features for PC1
(92.70%) (Figure 4) that the difference between
Figure 3 shows the scores of the objects
the two groups of sampling plots (Group 1 and
(sampling sites) in a space spanned by PC1 and
2) is mainly due to the suspended solid (SS)
PC2. The loadings of each feature (water
(variable 4). Suspended solid is related to the
quality variables) are shown for PC1 in Figure
natural erosion from the forest and agriculture
4. In Figure 3, the scores plot clearly shows two
area (Wan Mohd Muhiyuddin Wan Ibrahim et
linearly separable clusters. The cluster on the
al., 2000). The second important variable is the
right is formed by sampling sites in the
conductivity (variable 3) which is due to high
Labohan Dagang plot while the rest of the
concentration of inorganic compounds in the
sampling stations in the 3 sampling plots
water sample (APHA, 1998). This observation
(Kampung Bukit Dugang, Kampung Jenderam
would form the second part of our study –
and Bukit Changgang) form the other cluster.
relating the SS and conductivity difference in
This further confirms, via visual inspection, the
Labohan Dagang to palm oil plantation, if there
dendograms obtained from the hierarchical
any, or relating them to other, as yet, unknown application of cluster analysis, followed by
activities near the sampling sites in the said principal component analysis as a classification
plot. method, as demonstrated in this study, helps to
separate differently polluted rivers sections and
would help tremendously in future river
pollution monitoring projects.
5. Acknowledgement
The Institute of Environment and Development
(LESTARI), Universiti Kebangsaan Malaysia
and Chemistry Department, Faculty of
Science, University Malaya.
6. References
Abollina, O., Aceto, M., Gioia, C. L., Sarzanini, C.
and Mentasti, E., 2001. Spatial and seasonal
variations of major, minor and trace elements in
Antartic seawater. Chemometric investigation of
Fig. 4: Plot of PC1 loadings
variable and site correlations. Advances in
Environmental Research 6, 29-43
4. Conclusions
In conclusion, this study have demonstrated APHA, 1998. Standard methods for the examination
that simple chemometric treatments are able to of water and wastewater. 20th. Ed. Washington:
draw out from raw data, information that would American Public Health Association, AWWA,
MPCF
enable us to more effectively determine the
right sampling site for a particular objective, in Brereton R.G., 2002. Chemometrics: Data Analysis
order to reduce cost and time. In the case of the for the Laboratory and Chemical Plant, John Wiley
data obtained in the study, in order to determine & Son Ltd., West Sussex, England.
the effects of palm oil plantation to water Brodnjak-Voncina, D., Dobcnik, D., Novic, M. and
quality, the researcher should have determined Zupan, J., 2002. Chemometrics characterization of
the sampling sites in a more effective manner; the quality of river water. Analytica Chimica Acta
relating the objective of the study to the types 462, 87-100
of sites to be chosen for sampling purposes. Einax, J. W., Truckenbrodt, D., and Kampe, O.,
In this study, seasonal variation was found not 1998. River Pollution Data Interpreted by Means of
to be the main separation factor. Thus, the Chemometric Methods. Microchemical Journal 58,
315-324
initial sampling strategy used in order to study
the effects of palm oil plantation as well as Forina M., Armanino C. and Raggio V., 2002.
looking for seasonal changes at different Clustering with dendograms on interpretation
sampling sites proves to be ineffective. The variables. Analytica Chimica Acta 454, 13-19
sampling sites chosen in plots 1, 2 and 3 prove Khalil, W.A., Goonetillke, A., Kokot, S. and Carrol,
to be redundant in this study and should be S., 2003. Use of chemometrics methods and
reassessed to give a more optimum number of multicriteria decision-making for site selection for
sampling stations. The separation of sampling sustainable on-site sewage effluent disposal.
plots due to suspended solids and conductivity, Analytica Chimica Acta 506, 41-56
if these were historically available for the Lohninger H., 1999. Teach/Me, SDL-Software
studied area, should have been the significant Development Lohninger Teach/Me DataLab 2.002,
factors to be taken into consideration in Springer, Berlin
designing the initial sampling strategy. The Marengo, E., Gennaro, M.C., Giacosa, D., Abrigo,
abundance of historical data should be taken C., Saini, G. and Avignone, M.T., 1995. How
advantage of in designing these new sampling chemometrics can helpfully assist in evaluating
strategies. Use of chemometric methods, for environmental data Lagoon water. Analytica
example, should be encouraged in the analysis Chimica Acta 317, 53-63
of the data that would bring about new Massart,D.I., Vandeginste, B.G.M., Buydens,
information which will prove to be useful in L.M.C., De Long, S., Lewi, P.J., Smeyers-Verbeke,
reducing cost and time of sampling. The
Kg. Bukit Dugang (26/12/2001) 5.8 30.0 69 65.4 3.0 5.44 21 1.57 0.16 3.1 0.8 0.54 0.01 2.8 0.04 32.56
Kg. Jenderam (26/12/2001) 3.5 27.0 126 2.8 1.5 3.74 18 1.57 0.14 0.9 6.6 0.26 0.01 2.2 0.08 2.01
Bukit Changgang (26/12/2001) 5.9 28.0 67 186.3 4.7 6.20 9 1.32 0.08 1.3 0.6 0.37 0.01 0.09 0.02 2.46
Labohan Dagang (26/12/2001) 5.8 29.0 96 815.3 3.6 5.44 45 0.57 0.04 6.3 138.9 0.55 0.02 2.2 0.08 2
Kg. Bukit Dugang (10/01/2002) 5.8 32.0 74 10.6 4.3 2.00 9 1.60 1.50 2.6 3.0 1.65 0.15 2.44 2.28 2.92
Kg. Jenderam (10/01/2002) 5.2 24.5 211 1.6 1.2 0.45 6 2.41 0.85 0.8 15.9 3.42 0.44 1.46 2.04 2.41
Bukit Changgang (10/01/2002) 5.3 29.6 189 283.7 4.2 1.32 24 1.34 0.11 2.8 20.6 2.73 0.14 3.8 2.24 3.31
Labohan Dagang (10/01/2002) 5.6 30.0 175 746.9 1.7 0.68 10 0.87 0.03 5.7 102.6 1.11 0.16 0.38 1.67 2.05
Kg. Bukit Dugang (19/02/2002) 5.5 31.0 76 95.4 4.2 2.51 8 1.24 1.94 1.4 2.0 3.85 0.25 2.59 2.19 71.95
Kg. Jenderam (19/02/2002) 6.3 28.1 255 0.1 0.3 0.10 1 2.22 0.96 0.7 13.0 4.28 0.45 1.61 1.88 2.38
Bukit Changgang (19/02/2002) 5.4 32.9 215 119.9 5.0 1.17 2 1.71 0.12 3.9 25.0 2.57 0.13 5.87 1.96 1.44
Labohan Dagang (19/02/2002) 5.5 30.5 290 724.3 0.6 0.01 27 1.44 0.01 3.9 44.0 1.79 0.13 0.62 2.23 1.62
Kg. Bukit Dugang (3/03/2002) 5.7 30.5 29 158.9 4.2 1.28 7 0.60 0.01 0.9 7.0 8.27 0.67 1.92 3.96 0.49
Kg. Jenderam (3/03/2002) 4.7 28.2 105 0.1 1.2 1.63 25 1.95 0.04 0.8 7.0 6.85 0.36 0.81 3.6 0.19
Bukit Changgang (3/03/2002) 4.2 29.2 153 147.6 1.1 1.14 0 1.84 0.01 1.4 27.0 3.57 0.69 3.47 3.42 0.26
Labohan Dagang (3/03/2002) 5.1 29.1 74 951.4 3.4 0.29 10 2.04 0.01 1.1 31.0 2.84 0.18 0.16 5.89 0.12
Kg. Bukit Dugang (13/04/2002) 5.8 29.4 76 188.1 2.3 0.50 8 0.50 0.14 1.1 5.0 4.45 0.39 1.27 3.41 0.12
Kg. Jenderam (13/04/2002) 5.2 29.6 106 0.2 2.1 0.43 1 1.89 0.26 1 1.0 2.58 0.18 1.18 6.87 0.13
Bukit Changgang (13/04/2002) 5.9 29.8 132 123.5 3.6 0.99 2 1.89 0.01 1.5 32.0 2.39 0.43 3.21 3.14 0.03
Labohan Dagang (13/04/2002) 5.1 29.9 92 795.7 4.0 0.67 26 1.99 0.01 1.2 29.0 3.81 0.1 0.14 7.21 0.18
Kg. Bukit Dugang (15/05/2002) 6.6 27.8 163 133.5 6.1 1.74 2 1.84 0.38 1.2 9.0 1.09 0.09 2.27 4.54 0.16
Kg. Jenderam (15/05/2002) 6.7 31.2 85 0.3 4.6 0.35 4 0.23 0.25 0.8 5.0 6.74 0.16 1.09 3.4 0.28
Bukit Changgang (15/05/2002) 6.3 32.4 104 85.3 5.1 1.21 1 1.23 0.00 1.2 18.0 5.54 0.6 3.49 4.39 0.22
Labohan Dagang (15/05/2002) 4.6 30.3 263 734.7 4.7 0.43 7 2.41 0.02 1.5 63.0 3.79 0.01 0.15 1.79 0.43
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry 627
Mohammad B. Kassim, Jon A. McCleverty and Michael D. Ward
Abstract
The synthesis of molybdenum complexes containing Tp* {tris(3,5-dimethylpyrazolyl)borate}
and nitrosyl co-ligands is described. The trinuclear complex with 1,3,5-trihydroxybenzene
ligand, a new analogue of the polynuclear molybdenum nitrosyl with arenediolate complexes,
has not been reported previously. The new trinuclear analogue exhibited interesting
coordination behaviour in comparison to the dinuclear complexes containing
{Mo(NO)Tp*Cl} moiety behaviour. The electrochemistry of the dinuclear and trinuclear
complexes showed 2 and 3 reduction waves, respectively. At least one oxidation wave was
detected for all complexes which have not been reported previously. The redox behaviour of
these complexes, including the new trinuclear [{Mo(NO)Tp*Cl}3(1,3,5-O3C6H3)] complex,
were affected by the length and substitution pattern of the bridging ligands. The electronic
properties of the complexes were studied by UV/Vis and IR spectroelectrochemistry. The
mixed-valence states of the trinuclear complex behave as a Class II system according to the
Robin and Days classification and there was no evidence of inter-valence charge transfer
band (IVCT) in the mixed-valence state of the trinuclear [{Mo(NO)Tp*Cl}3(1,3,5-O3C6H3)]
complex. The IR spectroelectrochemical study showed that addition of one electron into the
metal centre caused the stretching frequency of the NO ligand to move about 100 cm-1 to a
lower frequency. The electronic properties of these molecules showed the effect of the
bridging ligand on the electron transfer process in polynuclear complexes. The evaluation the
bridging ligand ability of to facilitate electron transfer between metal centres is of great
interest in the field of optical switch and molecular wire.
th
628 Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Mohammad B. Kassim, Jon A. McCleverty and Michael D. Ward
H
B H
N N B
N N N
H
N N N
B N N N
N N N NO
N
ON O Cl N
N N Cl
N ON O Mo N
Cl O N
N
ON O B
Cl N H
N
Cl O
O NO
R Mo N Cl
N Mo
N N
N N N NO
R = (m-OC6H4O){Mo(NO)Tp*Cl} (1) N B
N N H N
( p-OC6H4O){Mo(NO)Tp*Cl} (2) B N
H
3
4
Figure 1. Structural formula of the complexes showing the numbering system.
Table 1. Formal potentials (V) for mononuclear, dinuclear and trinuclear complexes (vs. Fc+/Fc0, scan rate
0.2 Vs−1)a
Complex Reduction (E/V) Oxidation (E/V)
E1 E2 E3 E1 E2
1 0.90 1.16 1.05b ∼1.95b
2 0.85 1.32 0.78 1.08b
3 0.93 0.99 0.80 0.85
4 0.94 1.21 1.57 0.98b
a
Supporting electrolyte 0.1M [(NBu4)(PF6)] in CH2Cl2, b irreversible process
Table 2. UV/Vis absorption spectra of the nitrosyl molybdenum phenolate complexes recorded in CH2Cl2.
Complexes λmax/ nm (10–3ε / mol–1 dm3 cm–1)
λ1 λ2 λ3
1 314 (14.6) 492 (11.0) 720sh
2 312 (13.5) 577 (17.1) 741 (6.0)
3 308 (19.2) 562 (17.1) 751 (3.8)
4 315 (16.7) 512 (15.7)
sh = shoulder
(∆E) between the first and the second reduction separation between the first and second, and the
potential in the dinuclear species reflects the second and the third reduction potentials, ∆E, is
degree of interaction between the metal centres. 270 mV and 140 mV compared to 260 mV and
For example, ∆E for 2 is 470 mV, significantly 160 mV for 1, respectively (Figure 2). The
larger than that for 1, which is 260 mV. This is separation between the second and the third
expected since the para substituted ligand will reduction processes is much larger at 360 mV,
be much more effective at mediating because the third electron experiences two
delocalisation of the added electron across the unfavourable electrostatic interactions with the
bridging ligand than the comparable meta- negative charges at the other two Mo centres.
disubstituted ligand. The cv of 3 showed a Based on electrostatic arguments, therefore, the
single broad reduction wave which suggests separation between the second and the third
that metal-metal interaction is reduced when reduction processes should be approximately
the bridging ligand is longer. double the separation between the first and the
second process, which is nearly the case.
The redox behaviour of the trinuclear complex,
These observations were very similar to the
4, is similar to that of 1; the three reductive
related oxo Mo(V) species
electrode processes are believed to be * xii
[{MoTp (O)Cl}3(1,3,5-C6H3O3)].
successive one-electron reductions of the
Mo(II) metal centres to Mo(I)/Mo(I)/Mo(I). These electrochemical measurements show
The internuclear interaction between the metal that, on reduction of these multinuclear species,
centres in 4 is very similar to that of 1; the the topology and length of the bridging ligand
influence metal-to-metal interaction across the cm–1) and was shifted to 487 nm. This is
phenolate bridging ligands. This conclusion consistent with the presence of localized Mo(I)
has precedence and has been observed in a and Mo(II) centres. However, the low-energy
number of similar studies of nitrosyl and oxo IVCT band, which is a striking feature of the
molybdenum complexes.xiii spectrum of [2]–, Figure 3, was completely
absent suggesting the meta substitution pattern
UV/Vis Electronic Absorption Studies
has attenuated the metal-metal electronic
The UV/Vis absorption spectra of the dinuclear
coupling. However, the 260 mV separation
and trinuclear complexes displayed two main
between the Mo(II)/Mo(I) couples detected in
electronic transitions. A lower energy
the cv of 1 does suggest that the electronic
absorption ranged from 465 nm (ε = 5900 mol–1
interaction between the metal centres is still
dm3 cm–1) to 532 nm (ε = 7400 mol–1 dm3 cm–1) significant.xvi It is possible that this redox
and can plausibly be assigned as a ligand-to- splitting is mainly due to a through-space
metal charge-transfer (LMCT) transition, Coulombic effect because the metal centres are
phenolate → Mo. A higher energy transition relatively close to each other.13 That being so,
occurring between 310 nm and 315 nm (ε = there is likely to be little contribution to the
6300 − 6900 mol–1 dm3 cm–1) could not be so stability of the mixed-valence state arising from
easily assigned. A reasonable assignment, delocalization across the bridging ligand thus
based on previous observations, is that it may accounting for the lack of an IVCT band in the
be a Cl(π) → Mo(dπ) ligand-to-metal charge- monoanionic species. Further one-electron
transfer (LMCT).xiv reduction to dianion, [1]2–, resulted in complete
The electronic spectrums of the polynuclear disappearance of the charge-transfer band The
complexes are similar to those of their observation of spectral changes, which appears
mononuclear analogues.xv However, the to be a stepwise reduction of the total
intensities of the higher energy and the LMCT absorption spectra of the two metal centres
transitions were higher compared to those of considered separately, suggests that the mixed-
the mononuclear complexes and this maybe valence species behaves as a class I system.
due to the presence of two or more Comparison of the spectra of 4, [4]–, [4]2–, and
chromophores in the complexes (Table 2). [4]3– reveals further the effect of the
Complex 1 exhibits a phenolate → Mo LMCT substitution pattern on the bridging ligand. In
transition is at 492 nm. One-electron reduction the spectrum of 4 the LMCT transition is at 512
of 1, giving [1]–, resulted in the loss of the nm (ε = 15700 mol–1 dm3 cm–1) which is similar
LMCT transition and the intensity of the higher to the position of the LMCT transition in 1 for
energy transition was also slightly reduced. reasons similar to those described above. Upon
This process, representing formally a reduction reduction of the neutral species to the mixed-
of Mo(II) to Mo(I), is likely to result in valence species [4]–, the phenolate → Mo
addition of the single electron to the empty dxy LMCT was reduced to about two thirds of its
orbital. Partial occupation of the dxy orbital initial intensity (ε = 9800 mol–1 dm3 cm–1) and
would reduce its energy causing the ability of was shifted to 530 nm. This may be regarded
the Mo centre to accept electronic charge- formally as a species containing
transfer to decrease. Mo(I)/Mo(II)/Mo(II). On second reduction to
the dianionic species [4]2–
Comparison with the spectra of 1, [1]–, and
[Mo(I)/Mo(I)/Mo(II)] the LMCT transition was
[1]2– is interesting as the effect of substitution reduced to about a third of its original intensity
on the bridging ligand becomes apparent. The (ε = 6100 mol–1 dm3 cm–1) and was shifted to
meta-substitution pattern of the bridging ligand
551 nm (Figure 4). The 270 mV and 360 mV
results in each donor atom of the bridging
separations between the redox couples for the
ligand behaving more like an electronically three successive one-electron reductions to the
isolated metal centre than that of 2 where this
Mo(I)/Mo(II)/Mo(II), Mo(I)/Mo(I)/Mo(II) and
transition is at 577 nm. On reduction of 1 to
Mo(I)/Mo(I)/Mo(I) states of 4 respectively,
[1]–, the phenolate → Mo LMCT at 492 nm (ε indicate that the electronic interaction between
= 11000 mol–1 dm3 cm–1) was reduced to about the metal centres is significant. Thus, the
half of the initial intensity (ε = 5800 mol–1 dm3
10000
8000
ε / mol−1 dm cm−1
6000
3
4000
2000
0
225 725 1225 1725 2225 2725
λ / nm
Figure 3. The spectral changes for successive one-electron reduction 2 (─) to [2]−1 (− −) and [2]−2 (- - -),
respectively.
25000
20000
dm 3 cm -1
15000
-1
ε / mol
10000
5000
0
225 325 425 525 625 725 825 925 1025 1125 1225
λ / nm
Figure 4. UV/Vis/Nir spectra of 4 (─) for three successive one-electron reduction to [4]−1 (− −), [4]−2 (- - -)
and [4]−3 (− · · −).
Table 3. Changes in ν(NO) upon accessible oxidation and reduction of the mononuclear
and polynuclear complexes.
ν(NO) cm−1 Position of the new ν(NO) / (∆ cm−1)
st
Compounds in CH2Cl2 1 Red. 2nd Red. 3rdRed. 1st Oxd. 2nd Oxd
1 1686 1579 (107) 1571 (108) - 1721 (35) 1721 (33)
(1679) a 1688 c
2 1676 1575 (101) 1547(129) - 1713 (37) 1742 (29)
4 1686 1572 (114) 1568 (114) 1562 - -
(1682) a (1675) b (113)
a
position of unreduced ν(NO) after the first reduction process
b
position of unreduced ν(NO) after the second reduction process
c
position of unreduced ν(NO) after the first oxidation process
mixed-valence states appears to show class I Reduction
behaviour. One-electron reduction of 1 produces the
mixed-valence complex, [1]–, with a formal
Infrared-Spec-echem
Mo(II)/Mo(I), 16/17 valence electron
The presence of the NO group in all of the
configuration. The ir spectrum of the mixed-
complexes studied provides a spectroscopic
“handle” for infrared spec-echem. Changing valence monoanion showed two νNO band at
the electron density either on the metal centre 1679 cm–1 and 1579 cm–1. The resulting [1]–
or on the phenolate ligands will have an effect species, is asymmetric, with two NO stretching
on the vibrational frequency of the NO group frequencies. It manifestly is not a delocalized
due to back-donation from the Mo d-orbital to system on the ir-timescale and the added
electron is localized on one of the metal
the π∗−orbital of the NO group. The results of
centres. One-electron addition to the complex
ir spec-echem are collected in Table 3.
75
70
65
Transmittance / %
60
55
50
45
40
1750 1700 1650 1600 1550 1500 1450
Wavenumber / cm-1
Figure 5. Infra-red spectra of 4 (─) for three successive one-electron reduction to [4]−1 (− −),
[4]−2 (− · · −)and [4]−3 (- - -).
85
75
Transmittance / %
65
55
45
35
1800 1750 1700 1650 1600 1550 1500
-1
wavenumber / cm
Figure 6. Infra-red spectra of 2 (─) showing the change in ν(NO) after one-electron
oxidation to [2]+1 (− −).
produces a 107 cm–1 shift in νNO of the Mo mixed-valence [2]– and a new νNO appeared at
centre involved. There was a small shift in νNO 1575 cm–1, 101 cm–1 lower than that in the
of the unreduced centre, which could be due to neutral species. Three other bands also
the negative charge on the whole complex. appeared, at 1644 cm–1, 1618 cm–1 and 1556
This is consistent with the previous UV/Vis cm–1. The nature and origin of the band at
spec-echem experiment. The overall intensity 1556 cm–1, by similar reasoning to the
of the new NO absorptions appears mononuclear complexes, is probably due to νCC
quantitatively to be half that the initial neutral of phenolate ring. The observation of only one
species. NO stretching frequency strongly suggests that
the added electron was significantly delocalized
Further one-electron reduction of [1]– afforded
across the bridging ligand. This is no surprise
the fully reduced species [1]2– and resulted in
since the UV/Vis/Nir spec-echem studies of the
the disappearance of the NO stretching
monoanion revealed a very broad absorption
frequencies at 1679 cm1 and 1579 cm–1 and
band spanning right across the Nir region,
replaced by a new absorption at 1571 cm–1.
which is a characteristic of an IVCT band. The
These changes were expected since further
ir spec-echem results, therefore, indicate that
reduction would produce two Mo centres in
mixed-valence [2]– behaves as a class II
similar environments unless [1]2– underwent a
system.
rearrangement and produced a new species
with different structural symmetry. A shift of Sequential reduction of 4 exhibited spectral
108 cm–1 is also consistent with the earlier changes very similar to that of 1. Comparison
changes recorded for the one-electron reduction with the positions and magnitudes of the
of the neutral species. changes during the reduction of 4 with earlier
observations made with 1 suggested that the
The single NO stretching frequency in 2
additional electrons in [4]–, [4]2– and [4]3– were
disappeared completely upon generation of the
localized on the metal centres. This can be
seen from the appearance of two bands in the band grew which appeared to consist of two
mono and dianion, where the relative intensities very closely spaced bands and could not be
of the NO absorptions are approximately 1:2 resolved by the 4 cm–1 resolution used in the
and 2:1, respectively (Figure 5). The shifts of study. The cv of the second oxidation process
ca. 114 cm–1 indicate addition of an electron to shows that the process is irreversible. It is
a specific Mo centre, and the substantially possible that the dicationic species underwent
smaller shifts of the other NO absorptions are rearrangement with loss of symmetry before
due to the increasing negative charge on the slow decomposition occurred. This could
complexes. The mono- and dianionic species account for the appearance of two closely
were chemically stable and the redox process spaced NO bands.
was reversible, as discussed earlier. However,
4. Conclusion
the trianionic species decomposed slowly on
The mixed-valence states of 2 and 3, most
the timescale of the ir spec-echem experiment.
likely, exhibited class II behaviour whereas that
Oxidation of 1 and 4 are class I consistent with the
One-electron oxidation of 1 resulted in the electrochemical, UV/Vis/Nir and ir spec-echem
original νNO at 1686 cm–1 reducing in intensity observations.
by half and a new NO band appearing at 1721 5. Acknowledgement
cm–1. Oxidation of the ligand, in this case, The author wish to thank UKM/World Bank for
cannot result in formation of a semiquinone M.B.K’s study leave at the University of
radical cation. As mentioned before, removal Bristol, UK.
of an electron could occur from an orbital
which is a substantial mixture of ligand, π*-NO 6. References
I
and metal orbitals, or from an O atom of the (a) M. B. Kassim, R. L. Paul, J. C. Jeffery, J. A.
bridging group. What is clear, however, is that McCleverty and M. D. Ward, Inorg. Chim. Acta,
the resulting oxidized species is asymmetric, 2002, 327, 160; (b) M. D. Ward, Chem. Soc. Rev.,
1995, 24, 121; (c) W. Kaim, A. Klien, M. Glockle,
with two NO stretching frequencies. It Acc. Chem. Res., 2000, 33, 755; (d) F. Paul, C.
manifestly is not a delocalized system on the ir Lapinte, Coord. Chem. Rev., 1998, 431
timescale. II
A. McDonagh, S.R. Bayly, D. J. Riley, M.D.
The oxidation of 2 also displayed spectral Ward, J.A. McCleverty, M.A. Cowin, C.N.
changes consistent with oxidation of the Varanzza, R.V. Penty, I.H. White, Chem. Mater.,
bridging phenolate ligand. The first oxidation 12, 2000, 2523
process resulted in complete disappearance of III
(a) S. Drane and J. A. McCleverty, Polyhedron,
νNO at 1676 cm–1 and its replacement by a new 1983, 2, 53; (b) S. Trofimenko, J. Am. Chem. Soc.,
absorption at 1713 cm–1 (∆ = 37 cm–1). The 1967, 89, 3904; (c) S. Trofimenko, J. Am. Chem.
oxidation product exhibited only one νNO, Soc., 1969, 91, 588; (d) S. Trofimenko, Inorg.
which indicates that both nitrosyl groups exist Chem., 1969, 8, 2675
in the same environment, i.e. that the oxidized IV
S.-M. Lee, R. Kowalick, M. Marcaccio, J. A.
complex retains high symmetry (Figure 6). McCleverty and M. D. Ward, J. Chem. Soc., Dalton
There are two possible explanations for this Trans., 1998, 3443
observation: first, the oxidation process V
S. M. Charsley, C. J. Jones, J. A. McCleverty, B.
resulted in loss of an electron from the bridging D. Neaves, S. J. Reynolds and G. Denti, J. Chem.
phenolate ligand orbital thereby generating a Soc., Dalton Trans., 1988, 293
semiquinone radical anion; second, that the VI
(a) S. L. W. McWhinnie, C. J. Jones, J. A.
unique electron in the oxidized species was
McCleverty, D. Collison and F. E. Mabbs;
delocalized across the bridging ligand, Polyhedron, 1992, 11, 2639; (b) T.N. Briggs, C. J.
equivalent to class III mixed-valence Jones, H. Colquhoun, N. El Murr, J. A. McCleverty,
behaviour. However, the earlier observations B. D. Neaves, H. Adam, and N. A. Bailey, J. Chem.
of UV/Vis/Nir and ir spec-echem behaviour on Soc., Dalton Trans., 1985, 1249
the oxidation of mononuclear complexes VII
V. A. Ung, A. M. W. Chargill Thompson, D. A.
strongly suggested the former explanation. Bardwell, D. Gatteschi, J. C. Jeffery, J. A.
Further oxidation of [2]+ to [2]2+ resulted in νNO McCleverty, F. Totti, and M. D. Ward; Inorg.
increasing by ca. 30 cm–1. A broad infrared Chem., 1997, 36, 34
vi
. (a) M. B. Kassim, R. L. Paul, J. C. Jeffery, J. A. McCleverty and M. D. Ward, Inorg. Chim. Acta, 2002,
327, 160; (b) M. D. Ward, Chem. Soc. Rev., 1995, 24, 121; (c) W. Kaim, A. Klien, M. Glockle, Acc. Chem.
Res., 2000, 33, 755; (d) F. Paul, C. Lapinte, Coord. Chem. Rev., 1998, 431
vii
. A. McDonagh, S.R. Bayly, D. J. Riley, M.D. Ward, J.A. McCleverty, M.A. Cowin, C.N. Varanzza, R.V.
Penty, I.H. White, Chem. Mater., 12, 2000, 2523
viii
. (a) S. Drane and J. A. McCleverty, Polyhedron, 1983, 2, 53; (b) S. Trofimenko, J. Am. Chem. Soc.,
1967, 89, 3904; (c) S. Trofimenko, J. Am. Chem. Soc., 1969, 91, 588; (d) S. Trofimenko, Inorg. Chem.,
1969, 8, 2675
ix
. S.-M. Lee, R. Kowalick, M. Marcaccio, J. A. McCleverty and M. D. Ward, J. Chem. Soc., Dalton Trans.,
1998, 3443
x
. S. M. Charsley, C. J. Jones, J. A. McCleverty, B. D. Neaves, S. J. Reynolds and G. Denti, J. Chem. Soc.,
Dalton Trans., 1988, 293
xi
. (a) S. L. W. McWhinnie, C. J. Jones, J. A. McCleverty, D. Collison and F. E. Mabbs; Polyhedron, 1992,
11, 2639; (b) T.N. Briggs, C. J. Jones, H. Colquhoun, N. El Murr, J. A. McCleverty, B. D. Neaves, H.
Adam, and N. A. Bailey, J. Chem. Soc., Dalton Trans., 1985, 1249
xii
. V. A. Ung, A. M. W. Chargill Thompson, D. A. Bardwell, D. Gatteschi, J. C. Jeffery, J. A. McCleverty,
F. Totti, and M. D. Ward; Inorg. Chem., 1997, 36, 34
xiii
. (a). A. A. Rahman, A. A. Amoroso, T. N. Branston, A. Das, J. P. Maher, J. A. McCleverty, M. D. Ward
and A. Wlodarczyk; Polyhedron, 1997, 16, 4353; (b). R. Cook, J. P. Maher, J. A. McCleverty, M. D. Ward,
A. Wlodarczyk; Polyhedron, 1993, 12, 2111; (c). M. D. Ward, Chem. Soc. Review, 1995, 121; (d).N. C.
Harden, E. R. Humphrey, J. C. Jeffery, S. M. Lee, M. Marcaccio, J. A. McCleverty, L. H. Rees, and M. D.
Ward; J. Chem. Soc., Dalton Trans., 1999, 2417; (e). V. A. Ung, A. M. W. Chargill Thompson, D. A.
Bardwell, D. Gatteschi, J. C. Jeffery, J. A. McCleverty, F. Totti, and M. D. Ward; Inorg. Chem., 1997, 36,
3447
xiv
. V. A. Ung, D. A. Bardwell, J. C. Jeffery, J. P. Maher, J. A. McCleverty, M. D. Ward and A. Williamson,
Inorg. Chem., 1996, 35, 5290
xv
. M. B. Kassim, 2003. Studies of Nitrosyl and Oxo Molybdenum Complexes, Ph. Thesis, University of
Bristol, Bristol, United Kingdom
xvi
. M. D. Ward, Chem. Soc. Review, 1995, 121
Abstract
Senyawa TNTA (1,3,5-triazido-2,4,6-trinitrobenzena) merupakan salah satu material yang
bersifat sangat eksplosif. Reaksi penguraiannya berlangsung sangat cepat dan menghasilkan
produk akhir berupa karbon monoksida (CO) dan nitrogen (N2). Telah dilakukan studi kimia
kuantum terhadap mekanisme reaksi pirolisis (Z)-1-azido-2-nitroetena dan 2-nitrofenil azida
yang digunakan sebagai model reaksi pirolisis TNTA. Salah satu tahap awal reaksi berupa
pembentukan struktur lingkar lewat pelepasan N2. Optimasi geometri, serta perhitungan
frekuensi dan energi dilakukan awalnya pada tingkat teori Hartree-Fock (HF) dan Becke3-
Lee-Yang-Parr (B3LYP) dengan menggunakan himpunan basis 6-31G(d), dan dilanjutkan
dengan tingkat teori yang lebih tinggi. Untuk tahap pembentukan lingkar dan N2, digunakan
hipotesis dua macam mekanisme reaksi, yaitu reaksi pertahap, yang melibatkan dua keadaan
transisi (TS1 dan TS2) dan satu senyawa antara cis-I1, dan reaksi serempak, yang hanya
melibatkan satu keadaan transisi TS3. TS1 dan TS3 berhasil diperoleh pada keadaan singlet,
sedangkan TS2 dan cis-I1 berhasil diperoleh pada keadaan triplet. Perhitungan tetapan laju
(k) tahap tersebut menghasilkan nilai sekitar 18 × 10-4 s-1. Penggunaan 2-nitrofenil azida
dipilih untuk melihat pengaruh lingkar aromatik terhadap reaksi yang terjadi. Seperti telah
diduga, walaupun diamati adanya pengaruh aromatik, tetapi pengaruhnya tidak terlalu besar
terhadap mekanisme reaksi, karena gugus samping yang terlibat dalam reaksi amatlah
reaktif. Kajian awal tahap-tahap selanjutnya pada mekanisme reaksi pirolisis TNTA setelah
pembentukan lingkar benzofuroksan telah pula dilakukan melalui kedua molekul di atas
sebagai model
.
M. Utoro Yahya
Abstract
A continuity between the gaseous and the liquid state is recognized by the term fluid which
means either a liquid or a gas. For a single phase fluid system, a liquid is defined as a fluid
whose temperature is below the critical temperature and whose molar volume is less than
critical molar volume, so that its density is greater than the critical density. If these
conditions are not met, the fluid is called a gas.
Equation of state of fluid system could be obtained through the laws of thermodynamics and a
mathematical operation called variable separation method, to develop an equation of state
that would apply to liquids as well as gases, i. e.
∂U β
(P+( )T ) ( V – V0 ) = CRT or V = V0 + CR( ).
∂V α
∂U
Here ( )T is an internal pressure, V is a molar volume, V0 is a molar volume at zero
∂V
Kelvin and C is a specific factor of the fluid system.
Furthermore, α is a thermal expansibility coefficient and β is an isothermal
compressibility coefficient. Gaseous fluid has the value of C = 1 and for the liquid, C ≠ 1
(enlarging of cluster size was indicated by C < 1, and downsizing of cluster size was expected
by C > 1 ).
Keywords : fluid, equation of state, specific factor, thermal expansibility, isothermal
compressibility
fluid is called a gas (Levine, 1995). since equation (8) indicated the variation of
2. Methodology β
value at certain V (isochoric process). At
The equation of state of fluid system could be α
derived form the laws of thermodynamics and T = 0 Kelvin then V = V0 and f (V0) = 0.
using a variable separation method based on the
The relation between f (V) and f (V0) are
existence of continuity properties from gaseous
given by Taylor series as follows :
to liquid phase of the system.
f (V) = f (V0) + a (V–V0) + b (V-V0)2 + (9)
3. Discussion
Combination of the first and second laws of f ' (V0 ) f " (V0 )
where a= , b = etc.
1! 2!
thermodynamics gives, If the value of V approaching infinity then V0
is neglected, so that
dU = TdS – PdV (1)
f (V) = a (V – Vo) + b (V – Vo)2
∂U ∂S
there fore ( )T = T( )T − P (2) = aV + bV2 + ……… (10)
∂V ∂V
According to Maxwell relationship At this condition, equation (10) is fulfilled by
∂S ∂P the ideal gas since at V approaching infinity
( )T = ( ) V (3)
∂V ∂T then the pressure (P) of the system is
approaching zero as required by the ideal gas
∂U ∂P property (very low pressure).
hence ( )T = T( ) V − P (4)
∂V ∂T Therefore, for an ideal gas PV = nRT and
∂U ∂P ∂U
or P+( )T = T( ) V (5) ( )T = 0 hence the combination of
∂V ∂T ∂V
equation (8) and (10) give
Using the Chain Rule that is,
T V
∂P ∂T ∂V f(V) = a V + b V2 = = (11)
( ) V ( ) P ( )T = −1 (6) P nR
∂T ∂V ∂P
then equation (5) could be written as, As consequences, in order to be valid the
1
∂U ∂P α equation (11) should give a = and
P+ ( )T = T( ) V = T( ) (7) nR
∂V ∂T β b = 0.
Furthermore, the equation of state for the
1 ∂V
where α = ( )P = a thermal fluid system is the combination of equation
V ∂T (8) and (9) to give,
expansibility coefficient
T β 1
1 ∂V f(V)= = = (V − V0 ) (12)
and β = - ( )T = an isothermal ∂U α nR
V ∂P P + ( )T
∂V
compressibility coefficient.
Rearrangement of equation (7) give, ∂U
or (P+ ( ) T )(V −V0 ) = nRT (13)
∂V
∂T β T
( )V = = = f (V) (8)
β
∂P α P + ( ∂U ) and nR ( ) = V – V0 (14)
∂V
T
α
For n = 1 then V = molar volume and Vo
= molar volume at zero Kelvin.
Assessment of Natural Radioactivity In Water and Sediment From Tin Tailing Area
In Malaysia
Abstract
Gamma spectroscopy was performed in order to determine the concentration of natural radio
nuclides in tin tailing or amang industries. In this study 32 water samples and 26 sediment
samples were collected from 7 tin tailing plan area. The nuclides U-238 and Th-232 were
determined by measuring the emission from it’s daughters Bi-214 and Th-208. Nuclide K-40
and Ra-226 were used for measuring nuclide K and Ra respectively. Results show that the
maximum of mass concentration of uranium and thorium in water samples are 6.363 ppm and
0.695 ppm respectively. The maximum concentration of uranium and thorium in sediment
samples are 69.75 mg/kg and 157.73 mg/kg respectively. The maximum mass concentration of
radio nuclides K-40 and Ra-226 in sediment samples are 30.69 mg/kg and 6.56 x 10–6 mg/kg.
Concentration of uranium and thorium in sediment samples are higher than concentration of
uranium and thorium in water samples, and it’s due to insolubility of radio nuclides in water.
Also results show that the concentration of radio nuclides in amang processing are higher
than back ground and amang processing activity has increased the natural radio nuclides
content in water, soil and sediment.
Muhammad I. Saleh, Eny Kusrini, Rohana Adnan, Ismail A Rahman, Bahruddin Saad and
Bohari M. Yamin*
Abstract
Lanthanide are very interesting class of metals due to their similarity in their chemical and
physical properties and also their flexibility in the foormation of coordination compounds. In
combination with multipledonor atom from ligands, very interesting similarity and
dissimilarity in the formation of complexesin their solid state and liquid forms have been
observed. In the present paper, the focus will be on the formation of complexes with oxygen
donor from acyclic and cyclic polyetherrs. The observation on coocrdination bahavior of the
donor-acceptor atoms and the contribution of the counter anions to the stability of the
complexes will also discussed. The presence of bulky counter anion pcrate having oxygen
donor atoms have produced several solid state complexes with unique coordination behaviour
and hydrogen-donor atoms interaction leading towards strong and weaks hydrogen bondings.
From the observation on the ternary complex systems of lanthanide-crown ethers-picrate and
lanthanide-polyethilene glycol-picrates with the same number of oxygen atoms of ether
linkages revealed some (18C6) and pentaethylene glycol (EO5) in both of the ligand having
six O donor atoms formed rather different coordination complexes even though the acyclic
EO5 adopted ‘cyclic-like’ conformation. The cyclic ligand formed ten-coordinated complexes
with six oxygen atoms from 18C6 and four from bidentate picrates. However, the acyclic
ligand exhibitd a nine-coordinated complexes with six oxygen atoms from EO5 and two from
one bidentate and one monodentate picrates.
Further investigations at structural level revealed some distinc differences in their
coordination behaviour. Solid lanthanide complexes with cyclic (18-crown-6, 18C6 and
dicyclohexane-18-crown-6, DCH18C6) and acyclic (triethilene glycole, EO3, tetraethylene
glycol, Eo4 and pentaethylene glycol, EO5) with picrate as counter anion showed that
lanthanum formed 10 coordination complexes for all cyclic and EO5 ligands. While Ce was
able to form both 10 (crown ethers, EO3 and EO4 lidangs) and 9 (EO5 ligand). Other
lantanide elements formed 10 coordination complexes with crown ethers and 9 when the
ligands are acyclic. The stronger bonding of lanthanum (due to the highest coocrdination
number) of the solid state complexes can be used to explain the selectivity in solvent
extraction. Almost 100% of lanthanum was extracted when diaza-18-crown-6 (DD18C6) was
used as extractant compared with serium (20%) while thw rest of lanthanide elements wew
negligible extracted.
Other physical and chemical prosperties are currently being pursued in order to establish the
similarity and dissimolarity in coordination with cyclic and acyclic ligands for the entire
series of lanthanide
Kandungan Sebatian Fitokimia Dalam Daun dan Kaliks Tanaman Roselle (Hibiscus
sabdariffa L) Pada Berlainan Kadar NPK
Herman, S., Mohamad O., Bakhendri. S., Ujang. S dan Muntaz. A.B
Abstrak
Ektrak kasar daripada daun dan kaliks roselle telah disediakan menggunakan pelarut
petroleum eter, etil asetat dan metanol secara berurutan. Di dapati kadungan fitokimia ektrak
adalah alkaloid, saponin, steroid/triterpene dan BSLTLC50. Ujian ke atas anak udang pula
menunjukkan tiada kesan pada kepekatan 10 ppm tetapi menyebabkan kematian 100% pada
kepekatan 1000 ppm. Hasil dari pada kajian ini dapat memberi maklumat awal tentang
kandungan sebatian fitokimia dan kesan fitotoksiknya, disebabkan roselle digunakan sebagai
herba tradisional dan ubat-ubatan.
642
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Herman, S., Mohamad O., Bakhendri., S., Ujang., S dan Muntaz., A.B
Malvaceae Plants
2. Bahan dan Kaedah Asher, C., Grundon, N., Menzies. 2002. How to
Kaedah yang dilakukan pada kajian ini adalah Unravel and Solve Soil Fertility Problems.
penanaman dua aksesi tanaman roselle iaitu Canberra. Australian Centre For International
Aksesi 6 dan Aksesi 2 sekaligus pengumpulan Agricultural Research.
biji benih, daun, kaliks dan meliputi Departemen of Agriculture. 2000. Teknologi
penanaman roselle, pembajaan, pengurusan air, Tanaman Industri. Roselle (Hibiscus sabdariffa L.)
kawalan rumpai, pengawalan penyakit dan Corner, E. J. H., 1988 Wayside trer of Malaya.
serangga serta pemungutan hasil. Vol.2. United Selangor Prees. Kuala Lumpur .pp
3. Hasil dan Perbincangan 754.
Hasil yang diperolehi menunujukkan bahawa Faridah Mohd. Som 2000. Roselle bunga enak
daun dan kaliks roselle tidak mempunyai dimakan. Agromedia-Bil 8. MARDI.
kandungan alkaloid, terdapat kandungan Lee, M, Fah . 2004. Kajian kadungan asid lemak
steroid/triterpene dan safonin. Kandungan pada tujuh aksesi roselle (Hibiscus sabdariffa L)
safonin adalah lebih banyak didapati dalam Tesis Sarjana muda Sain kepujian Universiti
kaliks berbanding dalam daun. Adalah didapati Kebamgsaan Malaysia, Bangi.
bahawa pada keseluruhannya kandungan
Harborne, J. B., 1987. Metode Fitokimia. Edisi ke.2.
sebatian fitokimia dalam daun dan kaliks tidak Terjemahan, Penerbit ITB, Badung pp. 234-245.
menyebabkan kesan fitotoksik (Jadual 1).
Kandungan sebatian fitokimia juga tidak Heftmann, E., 1967. Chromatography. Edisi ke.2.
dipengaruhi oleh kadar baja NPK yang Reinhold publishing Corporation, New York.
berlainan. Hegnaver,R., 1978. Chemical Plant Taxonomy.
Academy press, London. Pp. 389.
4. Rujukan
Anonymous. 2002. Science and technology: getting Metcalfe, C. R & Chalk. 1950 anatomy of the
reddy; the science of autumn. Economist 365: 105 dicotyledons, leaves stem and wood in Relation to
taxonomy with notes on Eonomic Uses. Oxford at Mohammad, F. K., 2000 Kesan kolkisin dan
the Clavendon prees. London : 1030. nitrogen terhadap cirri-ciri morfo-agronomi pada
tanaman roselle (Hibiscus sabdariffa L) Tesis
Mohamad, O. and Mohd. Nazir, B. (1997). The use
Sarjana muda Sains. Universiti Kebangsaan
of induced mutation in oil and industrial crops in
Malaysia.
malalaysia. Proc. Seminar on mutation Breeding in
oil and Industrial Crops: Regional Nuclear Mohamad, O., Herman, S. Mohd. Nazir, B.,
Cooperation in Asia, 12-18 october 1997, National Bakhendri, S & Abdul Rahman, M. 2004.
Crop Experiment Station, RDA, Suwon, Korea. Germplasm Accssions and crop improvement of
roselle (Hibiscus sabdariffa L.) in
Mohamad, O., Arbayana, A., Mohd Nazir, B. and
Malaysia.MSMBB Sientific Meeting 19 – 21 July
Azhar, A. (1999). Effects of colchicines on morpho-
2004, Century Mahkota Malaka.
agronomic traits and ploidy level on roselle
(Hibiscus sabdariffa). FAO/IAEA Seminar on Mohamad, O., Herman, S., & Bakhendri, S. 2004.
Mutation Techniques and Molecular Genetics for kesan Aras Baja NPK terhadap Pertumbuhan
Tropical and Subtropical Plant Improvement in Asia Tanaman Roselle (Hibiscus sabdariffa L.) Prosiding
and the Pasific Region, 11 - 15 October 1999, Seminar bersama FST, UKM – FMIPA, UNRI ke 3,
Manila, Philippines. Universitas Riau, Pekanbaru, Indonesia.
Mohamad, O., Azhar, M. and Mohd . Nazir , B. Malaysia Agrculltural Directory & Index
(2000). Effects of colchicine on roselle. Bull. 2000/2002: major agricultural industries. 2000. Ed.
Genetics Soc. Malaysia 6(1&2):19-20. Ke-8. Malaysia: Agriquest Sdn.Bhd.
Mohamad, O., Mohd. Nazir, B., Azhar, M., Gandhi, MARDI.1998. Minit Mesyuarat Lembaga Pengarah
R., Shamsudin, S., Arbayana, A., Mohammad Marditech Corporation Sdn. Bhd.
Feroz, K., Liew, S.K., Sam, C. W., Nooreliza, C. E.
and Herman, S. (2002). Roselle improvement
through conventional and mutation breeding. In: Ng, L. Yee., 2004. Kajian pembajaan nitrogen
Proc. International Nuclear Conference 2002, 15-18 terhadap kadungan antosianin pada tiga aksesi
October 2002, Kuala Lumpur, pp. 104-123. roselle (Hibiscus sabdariffa L) Tesis Sarjana muda
Sain kepujian Universiti Kebamgsaan Malaysia,
Mohamad, O., Herman, S. Mohd. Nazir, B.,
Bangi.
Shamsudin, S. and Takim, M. (2003). A Dosimetry
Study Using Gamma Irradiation on Two Accession, Rao, P.U. 1996 Plannt foods Hum. Nutr., 49 (1): 27-
PHR and PH1, In Mutation Breeding of roselle 34.
(Hibiscus sabdariffa L). Simposium Biology 3 and 4
Sharine, C. I.Lynn., 2004. Kajian kadungan Vitamin
MINES.
C dan kesan baja nitrogen terhadap tiga aksesi
Mohd. Nazir, B., Mohamad, O.,Affrida, A. H. and roselle (Hibiscus sabdariffa L) Tesis Sarjana muda
Sakinah, A. 1998. Research highlights on the use of Sain kepujian Universiti Kebamgsaan Malaysia,
induced mutations for plant improvement in Bangi.
Malaysia. MINT, bangi, 87p.
Samuel, O.N. & Kevin, S. G. 2003. Anthocyanins in
Mohamad, O. and Herman. S., 2003. Roselle leaves: light attenuators or antioxidants?.
accession at UKM, Bangi. School of Environmental Functional Plant Biology 30: 865-873.
and Natural Resource Sciences Faculti of Science
Tan Soon Chye. 1990. Biokimia Tumbuhan Hiaju.
and Technilogi, UKM, Bangi. MSAB Symposium
on 2-4 June, 2003. (tidak diterbitkan). Kuala Lumpur: Dewan Bahasa & Pustaka.
LAMPIRAN
Keterangan:
* Alkaloid (– ve) = Tiada Alkaloid
* Steroid/Triterpene (+) = Ada Alkaloid
* Safonin = Tanaman yang paling banyak dijumpai 4 +
* BSLTLC50 = Angka-angka ini mengguna tiga sampel anak udang, bagi 10 ppm dan 1000 ppm
Abstrak
Akarmanis (Radix glycyrrhizae) secara tradisional telah lama digunakan sebagai eksipien
dalam pembuatan pil atau jamu. Serbuk radix glycyrrhizae berasal dari akar yang
dikeringkan yang kemudiannya dikisar halus, daripada tanaman glycyrrhiza glabra L. dan
beberapa spesies lain (glycyrrhiza uralensis Fisch., Liguiritae officinalis Moench). Tumbuhan
ini banyak terdapat di selatan Asia Tenggara, Mediteranian, Eropah Selatan dan India.
Tujuan kajian ini adalah untuk mengetahui sifat fizikokimia radix glycyrrhizae sebagai bahan
eksipien untuk pembuatan tablet dengan kaedah pemampatan terus dibandingkan dengan
eksipien yang telah secara luas digunakan dan tersedia di pasaran industri farmaseutik. Saiz
partikel yang digunakan dalam kajian ini adalah 200-250µm. Sifat ikatan dari serbuk ini
dikaji dengan menghitung kekuatan tegangan dengan kaedah pemampatan diametral.
Hubungan antara komposisi campuran dan kekuatan tegangan dikaji dengan menggunakan
pelbagai daya mampatan dengan keliangan. Hasil kajian didapati bahawa radix glycyrrhizae
memiliki ketumpatan sebenar serbuk 1.5746 g/cc, maksimum daya mampatan pada 20 kN
dengan kekuatan tegangan 0.1181 kN/cm², maksimum beban tablet 84.41 N manakala kajian
analisis Heckel pula menunjukan bahawa radix glycyrrhizae bersifat aliran plastik. Hasil
pengujian ke atas sifat pemampatan dan pemadatan didapati bahawa radix glycyrrhizae
boleh digunakan sebagai eksipien dalam pembuatan tablet dengan kaedah pemampatan terus.
Imbasan elektron mikroskop menunjukkan partikel yang pelbagai saiz dan bentuk yang tidak
seragam. Hasil kajian juga menunjukkan bahan ini setanding dengan bahan komersial
digunakan dalam formulasi tablet.
Kata kunci: eksipien, kekuatan tegangan, pemampatan diametral, radix glycyrrhizae
40
35
30
25
20
15
Peratus berat (%)
10
0 Radix
100 Laktosa
150
200 Puracal
250
355
400
Saiz pengayak (um) 500
12.35
12.3 4.6
4.4
12.25
4.2
12.2 4
3.8
12.15
3.6
12.1 3.4
3.2
12.05
0 20 40 60 80
0 10 20 30 40 50 60 70 80
M a sa ( j a m )
M a sa ( j a m)
5 kN 8 kN 10 kN 12 kN
5 kN 8 kN 10 kN 12 kN 14 kN 16 kN 18 kN 20 kN
14 kN 16 kN 18 kN 20 kN 22 kN 25 kN
22 kN 25 kN
4
12.14
12.13
3.75
12.12
12.11 3.5
12.1
12.09 3.25
12.08
12.07 3
12.06
12.05 2.75
0 20 40 60 80 0 10 20 30 40 50 60 70 80
M a sa ( j a m) M a sa ( j a m)
5 kN 8 kN 10 kN 12 kN
5 kN 8 kN 10 k N 12 k N
14 kN 16 kN 18 kN 20 kN
14 kN 16 k N 18 k N 20 k N
22 kN 25 kN
22 kN 25 k N
500
450
400
Beban Maksimal (N)
350 Radix
300
MCC
250
Puracal
200
150 Lactose
100
50
0
0 10 20 30
Daya Mam patan (kN)
Rajah 3.4: Perbandingan daya mampatan lawan beban maksimum bagi MCC, Puracal, laktosa dan radix
glycyrrhizae
Radix
350
Beban maksimal (N)
300
Radix 50oC
250
200 MCC
150
100 MCC 50o C
50
0 Puracal
24
48
96
2
Puracal 50o
Masa (jam )
C
L
Rajah 3.5: Kesan pengeringan terhadap beban maksimum tablet
0.1
0
-0.1 0 100 200 300 400 500 600
-0.2
Porosity
-0.3
-0.4
-0.5
-0.6
-0.7
Daya Mampatan (MPa)
MCC Puracal RG
Rajah 3.6: Kesan peningkatan daya mampatan terhadap porosity bagi MCC, Puracal dan radix
glycyrrhizae
1.6
Relative Density (g/cc)
1.4
1.2
0.8
0.6
0.4
0.2
0
0 100 200 300 400 500 600
Rajah 3.7: Kesan peningkatan daya mampatan terhadap relatif density tablet bagi MCC, Puracal dan
radix glycyrrhizae
0.9
0.8
Kekuatan tegangan(kN/cm2)
0.7
0.6
Radix
0.5 M CC
0.4 Puracal
Lact ose
0.3
0.2
0.1
0
0 5 10 15 20 25 30
Rajah 3.8: Peningkatan daya mampatan terhadap kekuatan tegangan tablet (kN/cm²) bagi MCC,
Puracal, laktosa dan radix glycyrrhizae.
keliangan/porosity tidak dapat dikurangkan lagi kN hasil ini lebih tinggi berbanding laktosa
sehingga tablet malah menjadi rapuh. Puracal semburan kering.
memiliki beban maksimum yang tertinggi iaitu:
Setelah serbuk dikeringkan pada suhu 50 darjah
465,52 N pada daya mampatan 22 kN, radix
Celcius selama 96 jam, ternyata memberi kesan
glycyrrhizae 84.41 N pada daya mampatan 20
pada beban maksimal tablet. Rajah 3.5
0
0.6
0 100 200 300 400 500 600
-1 0.5
0.4
-2
0.3
-3
0.2
-4
0.1
-5 0
278.6 318.4 358.2 398 437.8 497.5
-6 D a y a M a mpa t a n ( M P a )
menunjukkan bahawa MCC setelah memiliki plot yang menyerupai sifat bahan
dikeringkan maka beban maksimal tablet akan pemplastik, oleh itu diperkirakan mempunyai
meningkat berbanding jika serbuk tersebut sifat pemplastik meskipun harus dilakukan
tidak dikeringkan, mungkin ini disebabkan sifat kajian lebih lanjut untuk membuktikannya.
dari MCC yang higroskopik. Begitu pun pada
Merujuk pada Rajah 3.10, Puracal ternyata
radix glycyrrhizae, hal ini mungkin kerana
memiliki faktor kerapuhan yang lebih tinggi
pengolahan serbuk radix yang masih tradisional
berbanding bahan lain, mungkin ini disebabkan
hingga kandungan air masih terlalu tinggi.
sifat rapuh yang dimilikinya. Radix
Namun perkara ini tidak berlaku pada Puracal,
glycyrrhizae mempunyai kerapuhan yang
ia malahan mengalami penurunan beban
masih dapat diterima untuk digunakan sebagai
maksimal tablet setelah pengeringan, ini
eksipien tablet, iaitu 0.4%.
disebabkan sifatnya yang brittle/rapuh.
4. Kesimpulan
Rajah 3.6 menunjukkan bahawa peningkatan
Glycyrrhizae radix boleh digunakan sebagai
daya mampatan akan meningkatkan nilai
eksipien tablet dengan menggunakan kaedah
daripada porositi. Radix glycyrrhizae memiliki
pemampatan terus. Ianya memiliki sifat-sifat
nilai yang rendah berbanding serbuk lain, hal
aliran bahan pemplastik, memiliki beban
ini disebabkan kerana tablet radix memiliki
maksimum, kekuatan tegangan dan kerapuhan
kekuatan mampatan dan kekuatan tegangan
yang lebih baik berbanding laktosa.
yang rendah berbanding yang lain. Peningkatan
Glycyrrhizae radix berpeluang untuk dijadikan
daya mampatan akan meningkatkan nilai
eksipien tablet secara komersil dan meluas
ketumpatan relatif sebagaimana berlaku pada
kerana memiliki sifat yang baik dan terbukti
radix glycyrrhizae kerana tablet yang
selamat untuk digunakan secara oral.
dihasilkan memiliki isipadu yang lebih besar
berbanding yang lain (Rajah 3.7). 5. Ucapan Terimakasih
Universiti Kebangsaan Malaysia (Jabatan
Umumnya, peningkatan daya mampatan akan
Farmasi-Fakulti Sains Kesihatan Bersekutu,
meningkatkan kekuatan tegangan diikuti
Fakuti Kejuruteraan) IRPA No. 09-02-02-
dengan peningkatan beban maksimal tablet.
0095EA239
Namun sifat aliran serbuk sama ada rapuh
ataupun pemplastik serta bentuk partikel 6. Daftar Pustaka
mempengaruhi ikatan antara partikel di dalam British Pharmacopoiea ( BP). 1993. London: Her
sesuatu tablet. Rajah 3.8, menunjukkan bahawa Majesty’s Stationary Office.
Puracal memiliki nilai lebih tinggi iaitu 0.8101 B. Van Veen, K. van der Voort Maarschalk, G.K.
kN/cm², sedangkan pada radix hanya 0.1181 Bolhuis, K.Zuurman, H.W. Frijlink., (2000). Tensile
kN/cm². strength of tablets containing two materials with a
different compaction behaviour. Int. J. Pharm. 203,
Analisa Heckel yang terdapat pada Rajah 3.9 71:79.
menunjukkan bahawa radix glycyrrhizae
Luangtana- anan M and Fell J T., (1990). Bonding compression profile. International journal of
mechanisms in tableting. Int. J. Pharm. 60:19 pharmaceutics 252. 253:261.
M C I Amin and Fell J T., Tensile strength and Padma Narayan, Bruno C. Hancock., (2003). The
bonding in compacts, a comparison of diametral relationship between the particle properties,
compression and three point bending for plastically mechanical behavior, and surface roughness of
deforming materials. Drug Dev and Ind Pharm. some pharmaceutical excipient compacts. Materials
28:809. science and engineering A 355. 24:36.
Newton J M, Cook D T and Hollebon C E., (1977). Yeli Zhang, Yuet Law and Sibu Chakrabarti,.
The strength of tablets of mixed components. J. (2003). Physical properties and compact analysis of
Pharm. Pharmacol. 29:247. commonly used direct compression binders. AAPS
PharmSciTech 1:10
Osmo Antikainen, Jouko Yliruusi., (2003).
Determining the compression behaviour of
pharmaceutical powders from the force distance
Kandungan Radionuklid Tabii Dalam Sampel Amang, Tanah dan Air di Sekitar
Kawasan Industri Perlombongan di Dengkil Selangor
Abstrak
Kandungan radionuklid tabii 238U, 232Th, 226Ra dan 40K dalam sampel mineral amang tulen,
amang mentah, tanah dan air yang diambil dari loji pemprosesan amang, kawasan
perumahan dan kawasan bekas lombong di Dengkil, Selangor Darul Ehsan telah ditentukan
menggunakan kaedah spektrometri gama. Keputusan analisis menunjukkan julat
keradioaktifan tentu (Bq/kg) 238U, 232Th, 226Ra dan 40K masing-masing dalam sampel amang
tulen dan amang mentah adalah 52.83 – 3538.94, 24.45 – 13426.68, 149.63 – 22011.87 dan
108.04 – 3773.15. Manakala julat keradioaktifan tentu (Bq/kg) 238U, 232Th, 226Ra dan 40K
dalam sampel tanah pula masing-masing adalah 31.64 – 449.15, 27.37 – 103.08, 32.42 –
976.65 dan 181.74 – 462.42. Bagi sampel air pula, julat keradioaktifan tentu (Bq/L) 238U,
232
Th, 226Ra dan 40K masing-masing adalah 1.40 – 1.63, 1.57 – 1.65, tidak terkesan – 0.76 dan
11.44 – 12.06. Secara amnya keradioaktifan tentu 238U dan 226Ra paling tinggi dalam sampel
ilminit mentah dan zirkon tulen, manakala bagi 232Th keradioaktifan tentu tertinggi ditemui
dalam sampel monazit tulen dan monazit mentah. Sementara itu bagi keradioaktifan tentu
238
U, 232Th dan 226Ra dalam tanah dan air didapati lebih tinggi bagi kawasan persampelan
berhampiran dengan loji pemprosesan amang. Walaupun perkiraan menunjukkan dos setara
tahunan yang boleh diterima oleh pekerja kilang amang adalah rendah, nilai dos ini
diperngaruhi oleh kuantiti amang yang terdapat di persekitaran. Oleh yang demikian kajian
lanjut perlu dilakukan bagi menganggarkan dos sebenar yang mungkin akan diterima oleh
pekerja.
Kata kunci: amang, dos setara, air, radionuklid tabii
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Proceeding of The 6thITB-UKM Joint Seminar on Chemistry
Muhamad Samudi Yasir, Amran Ab.Majid & Redzuwan Yahaya
sampel kecuali monazit tulen (3773.15 Bq/kg) tidak terlalu berbeza kecuali di kawasan Taman
dan longgokan monazit (3239.73 Bq/kg). Dengkil Jaya yang mencatatkan nilai tertinggi
(462.42 Bq/kg). Selain dari kewujudan 40K
Keradioaktifan tentu semua radionuklid adalah
tabii, aktiviti manusia seperti pembajaan boleh
terendah pada sampel timah tulen. Keadaan ini
meningkatkan kandungannya. Kajian yang
memang dijangkakan kerana timah tulen ini
telah dilakukan oleh Muhamad Samudi Yasir
dihasilkan setelah mineral-mineral lain yang
et. al. (2001) juga mendapati taburan
mengandungi radionuklid diasingkan. Walau
keradioaktifan tabii (238U, 232Th dan 40K) serta
bagaimanapun keradioaktifan NORM dalam
radionuklid guguran 137Cs dipengaruhi oleh
mineral timah tulen ini akan dapat dikurangkan
faktor seperti perbezaan keadaan geologi dan
apabila ia melalui proses peleburan bagi
aktiviti pembangunan.
menghasilkan jongkong timah. Ini juga
menunjukkan bahawa proses pengasingan Kandungan radionuklid dalam sampel air
mineral telah dilakukan dengan sempurna. Keradioaktifan tentu 238U dalam sampel air
berada pada julat 1.40 - 1.63 Bq/L, manakala
Kandungan radionuklid dalam sampel
untuk 232Th, 226Ra dan 40K pula masing-masing
tanah
pada julat 1.57 - 1.65 Bq/L, tidak terkesan –
Lokasi pensampelan tanah dan air meliputi
0.76 Bq/L dan 11.44 - 12.06 Bq/L (Jadual 3).
berbagai corak aktiviti kegunaan tanah.
Bagi radionuklid 226Ra penentuan dilakukan
Kawasan pertama adalah sekitar loji
menggunakan kaedah langsung, iaitu
pemprosesan amang. Manakala kawasan ke
berdasarkan puncak foton 186 keV. Ini
dua adalah di sekitar E-village; iaitu kawasan
disebabkan hanya puncak ini yang dapat
bekas lombong yang kini sedang giat
dikesan pada larutan piawai yang diguna.
dibangunkan sebagai kawasan hiburan dan
Secara amnya keaktifan tentu kesemua
rekreasi. Kawasan Taman Dengkil Jaya
radionuklid yang terdapat dalam sampel air
merupakan kawasan perumahan yang terletak
tidak berbeza antara lokasi pensampelan.
berhampiran loji pemprosesan amang
dikategorikan sebagai kawasan ketiga, Dos setara bagi dedahan sampel amang
manakala kawasan perkampungan yang terletak Jadual 1 menunjukkan bahawa keradioaktifan
agak di luar dari kawasan pembangunan tentu 226Ra dalam pelbagai sampel amang
sebagai kawasan ke empat. Keradioaktifan adalah tinggi. Salah satu progeni 226Ra ialah
tentu dalam sampel tanah dari keempat-empat radon (222Rn). Oleh kerana 222Rn adalah
kawasan ini ditunjukkan dalam Jadual 2. berbentuk gas, ia boleh memasuki saluran
pernafasan dan terperangkap dalam paru-paru
Keradioaktifan tentu 238U dalam sampel tanah
sebagai 210Pb ataupun 210Po. Radium juga
dari pelbagai lokasi pensampelan berada dalam
boleh menggantikan kalsium sebagai struktur
julat 31.64 - 449.15 Bq/kg. Untuk 232Th pula
tulang. Oleh yang demikian kesan radiologi
nilainya adalah antara 27.37 - 103.08 Bq/kg, 226
Ra ke atas manusia khususnya pekerja loji
manakala untuk 226Ra dan 40K adalah masing-
pemprosesan amang adalah signifikan. Kajian
masing 32.42 - 976.65 Bq/kg dan 181.74 -
telah dilanjutkan dengan mengira dos setara
462.42 Bq/kg. Secara umumnya bacaan 238U
pada jarak dedahan 1 meter. Hasil perkiraan
tinggi di kawasan berhampiran loji
dapat dilihat dalam Jadual 4. Didapati dos
pemprosesan amang (S1) dan kawasan bekas
setara meningkat dengan keradioaktifan tentu
lombong di sekitar E-village (S2) serta 226
Ra. Walau bagaimanapun nilai maksimum
terendah pada kawasan perkampungan (S4).
yang diperolehi (9.12 x 10-3 mSv/tahun pada
Nilai yang tinggi ini adalah hasil sumbangan
monazit tulen) masih lebih rendah dari paras
aktiviti pemprosesan amang dan sisa tinggalan
maksimum dedahan orang awam (1 mSv/tahun)
aktiviti perlombongan. Corak yang sama juga
ataupun pekerja sinaran (50 mSv/tahun). Nilai
diperolehi untuk 226Ra, manakala untuk 232Th
yang dicerap ini juga masih lebih rendah dari
keradioaktifan tentunya tidak banyak berbeza
nilai 0.100 mSv, iaitu dos setara berkesan
kecuali di kawasan tepi loji pemprosesan
luaran bagi siri pereputan 238U. Sungguhpun
amang yang mana nilainya agak lebih tinggi
begitu nilai dos setara ini hanya terpakai bagi
(103.08 Bq/kg). Oleh yang demikian
kuantiti amang yang rendah (nilai dos dikira
keradioaktifan tentu yang lebih tinggi ini
hanya berdasarkan satu kg sampel). Oleh itu
berpunca dari sisa aktiviti perlombongan dan
nilai dos setara ini akan meningkat dengan
pemprosesan amang. Keradioaktifan tentu 40K
kuantiti sampel. Ini dapat dilihat dalam kajian Trading Sdn. Bhd. yang telah membekalkan
Azlina et. al. (2003). Mereka mendapati jika perbagai sampel amang yang digunakan dan
kawasan bekas loji pemprosesan amang ini Universiti Kebangsaan Malaysia yang
terus dibangunkan dos setara tahunan yang membiayai Seminar ini.
diterima oleh penduduk atau pekerja akan
6. Daftar Pustaka
melebihi had dos tahunan orang awam. Ini Amran Ab Majid, Muhamad Samudi Yasir,
disebabkan kuantiti longgokan amang yang Redzuwan Yahaya. (2004), Taburan Radionuklid
terdapat sememangnya berada dalam kuantiti Tabii (NORM) dan Kaitannya dengan Aktiviti
yang banyak. Berdasarkan hasil kajian Pembangunan di Negeri Selangor. Dalam: Indicator
menggunakan model RESRAD mereka of Sustainable Development: Assessing Changes in
seterusnya mencadangkan beberapa langkah Environmental Conditions. A. Latiff et al., (Ed),
mitigasi termasuk penimbusan lapisan tanah di Institute For Environment and Development
atas bekas tapak loji tersebut perlu dilakukan (LESTARI), Universiti Kebangsaan Malaysia, ISBN
terlebih dahulu sebelum pembangunan 983-9444-58-1, hal. 213 – 225.
dilakukan. Azlina, M.J., B. Ismail, M. Samudi Yasir, Syed
Hakimi Sakuma and M.K. Khairuddin, (2003).
4. Kesimpulan Radiological Impact Assessment of Radioactive
Hasil kajian ini mendapati keradioaktifan tentu Minerals of Amang and Ilmenite on Future Landuse
radionuklid 238U, 232Th dan 226Ra tinggi pada Using RESRAD Computer Code. Applied
sampel amang berbanding sampel tanah, Radiation and Isotope 58 413 - 419.
manakala keradioaktifan tentu 40K tidak
IAEA. The Use of Gamma Ray Data to Define The
menunjukkan perbezaan yang signifikan. Natural Radiation Environment. IAEA-TECDOC-
Kedudukan lokasi pensampelan turut 566 : 1 - 10.
mempengaruhi keradioaktifan tentu radionuklid
tersebut. Semakin hampir lokasi tersebut Jabatan Perlombongan Malaysia, (1997). Statistic
dengan kawasan bekas lombong atau loji on Commodities 1997. hal. 177 - 185.
pemprosesan amang, keradioaktifan tentu pada Jaeger, R.G., et al., (1968). Engineering
sampel tanah semakin meningkat. Bagi sampel Compendium on Radiation Shielding, vol.1.
air tidak terdapat perbezaan yang signifikan ke Springer-Verlag, New York. Hal. 21.
atas keradioaktifan tentu radionuklid. Muhamad Samudi Yasir, Ismail Bahari, Sahibin
Keradioaktifan tentu 226Ra pada sampel amang A.R., Dahlia Suriati, Halim Abd Rahman, (2001).
adalah tinggi. Walaupun perkiraan The Concentration of Natural Radionuclides and
menunjukkan dos setara tahunan yang boleh Heavy Metals in Soils From a Tin-Mining and its
diterima oleh pekerja kilang amang adalah Surrounding Area. Jurnal Sains Nuklear Malaysia,
rendah, nilai dos ini diperngaruhi oleh kuantiti 19: 50 – 56.
amang yang terdapat dipersekitaran. Oleh yang Redzuwan Yahaya, Che Rosli Che Mat, Muhamad
demikian kajian lanjut perlu dilakukan bagi Samudi Yasir, Amran Ab Majid, Ismail Bahari dan
menganggarkan dos sebenar yang mungkin Sukiman Sarmani, (1997). Analysis of Fall-out and
akan diterima oleh pekerja. Naturally Occuring Radioancitve Elements in
Selangor. Malays. J. Anal. Sci. 3 : 237 - 241.
5. Penghargaan
Setinggi ucapan terima kasih dan penghargaan
ditujukan kepada Syarikat Universal Mineral
S1 Sekitar Loji Amang 294.46 ± 103.08 ± 8.25 976.65 ± 5.25 181.74 ± 6.23
15.25
S2 Sekitar E-village 449.15 ± 37.52 ± 1.55 105.75 ± 1.75 247.28 ± 8.80
25.32
S3 Taman Dengkil Jaya 57.98 ± 6.05 49.68 ± 3.26 86.64 ± 0.49 462.42 ±
35.33
S4 Kawasan Perkampungan 31.64 ± 5.22 27.37 ± 3.25 32.42 ± 0.25 262.24 ±
15.58
(S1) Sekitar Loji Amang 1.52 ± 0.22 1.65 ± 0.35 0.71 ± 0.07 11.75 ± 1.55
(S2) Sekitar E-village 1.63 ± 0.25 1.57 ± 0.33 *t.d 11.75 ± 1.55
(S3) Tasik Taman Dengkil Jaya 1.40 ± 0.15 1.57 ± 0.33 0.76 ± 0.07 11.44 ± 2.04
(S4) Kawasan Perkampungan 1.52 ± 0.22 1.65 ± 0.35 0.66 ± 0.06 12.06 ± 2.03
t.d. : tidak terkesan
226
Nama sampel Ra dos setara dos setara tahunan
(Bq/kg) (Sv/jam) (mSv/tahun)
monazit tulen 22011.87 4.55 x 10-9 9.12 x 10-3
ilmenit tulen 2099.29 4.30 x 10-10 8.60 x 10-4
zirkon tulen 8898.21 1.84 x 10-9 3.68 x 10-3
monazit longgokan 13573.32 2.00 x 10-9 5.62 x 10-3
ilmenit longgokan 822.64 1.70 x 10-10 3.24 x 10-4
Abstract
Organic polymer would certainly be the material of choice in the fabrication of large area
and flat electronic display devices such as in advertisement and billboards. In this
application, polymer materials can easily be processed into large-area thin films using simple
and inexpensive technology. The polymers are lightweight and flexible, and many of their
properties can be adjusted to suit specific needs. In 1989, a research group from University
of Cambridge discovered that organic polymer could be incorporated in light emitting diode.
Since this discovery, the field of Polymer LEDs has attracted much attention in many
laboratories. Polymer LEDs devices are composed of three thin polymer layers, which are
called the hole transporting layer, luminescent layer and electron transporting layer. These
polymer-based devices were found to require low voltage of electricity and suitable for large
area applications. This paper will report on OLED activities in Malaysia particularly R&D
works in electronic display industry. As for the research institution, UKM has played an
important role in initiating OLED activities. UKM has successfully developed the polymer
light-emitting device with the ITO/PVK/PDPV/Alq3/Al structure with maximum brightness of
1300 cd/m2.
659
th
Departement of ChemistryProceeding of The
ITB, Jl. Ganesha 10,6Bandung
ITB-UKM Joint
40132, PhoneSeminar on2502103
: +62 (22) Chemistry
ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Muhammad Yahaya, Muhamad Mat Salleh and Mursyidah
technologies being developed in Malaysia. micron. When biased, charge is injected into
the highest occupied molecular orbital
2. Display Technology
(HOMO) at the anode, and the lowest
The industry of display technology is rapidly
unoccupied molecular orbital (LUMO) at the
changing. One of the critical question in ITC
cathode, and these injected charges known as
industry and consumer electronics is the choice
“holes” and “electrons,” respectively migrate in
of display technology used to reproduce the
the applied field until two charges of opposite
colour for viewing. The three main
polarity encounter each other, at which point
technologies in the display area are LCD
they recombine and produce a radiative state.
(Liquid Crystal Display), CRT (Cathode Ray
Early works by Burroughes2, et al. at
Tube), and Plasma. New technologies are
Cambridge have reported a single-layer device
beginning to enter the market place such as
made with a polymeric material,
OLED (Organic Light Emitting Diode); EL
poly(phenylene vinylene) (PPV). Reviews on
(Electro Luminescent), LED (Gas as Light
OLED and synthetic chemistry has been
Emitting Diode), MEMS (Micro-
extensively described by Walker3 et al.
Electromechanical System); LCOS (Liquid
Crystal on Silicon); VF (Vacuum Fluorescent);
and Cholesteric (Bi-Stable Cholesteric). The 3. Research and Development of OLED in
focus of most technologies is how to combine Malaysia
color elements of R (red), G (green) and B Malaysia is new in photonic industry and has
(Blue) so as to look like a real representation. benefited from the presence of Multinational
In the Table 1 below, the three most common companies (MNC). Some of the Malaysian
technologies are displayed for comparison companies, such as Photronics, Optical
purposes. Communication, OPCOM Cables, Photon
OLED is a very attractive candidate as display Technologies and Dominant Semiconductors
devices and for other consumer applications. have also ventured into the manufacturing of
Since Tang et al1. reported the discovery of photonics and related products. Malaysia's
organic electroluminescence devices, OLED electronic and electrical (E&E) sector remains
has been widely studied by many researchers a major contributor to its economy, registering
and even already developed as commercial a growth of 5 percent in the first quarter of
products. OLED has advantages such as low 2004. Also the global demand for electronic
power consumption, light weight and thin, products, estimated at $1.35 trillion in 2003, is
many efforts are being made to develop a anticipated to increase by about 12 percent in
mobile display with OLED. In addition, OLED 2004. E&E industry is forecast to grow
displays have excellent features such as : stronger in 2004, but the main question is
when the OLED business will be profitable.
a ) high luminescence (Over than 100 000 cd R&D in OLED has progressed at a remarkable
/m2 ) pace. The key issues are materials lifetime
b) high light emission efficiency (over 10 lm process technologies. There are some 60
/w) companies with active OLED programs and
consolidation has already begun. Table 3.
c) possible low operating voltage shows some photonic company operating in
d) fast response time ( s ) Malaysia
According to the National IRPA Registry
(Intensification of Research in Priority Area),
Organic EL is obtained simply by placing a these are projects on LED funded under the
charge-transporting and light-emitting organic sixth and seventh Malaysia Plan
material between two electrodes (one of which
is transparent) and applying a suitable bias. (UKM:Universiti Kebangsaan Malaysia,
Figure 1 shows the general structure of OLED. USM:University Sains Malaysia, UM:
Universiti Malaya)
The organic material may be either a polymer
or low molecular weight molecules deposited Currently UKM is the only university that
by evaporation in vacuum. Total device seriously pursue works on OLED . The project
thickness without substrate is less than 1
was started in 2003 with seed funding from the the charge carriers are either electrons or holes
MOSTI with the following objectives; with their mobilities in the range of 10−8 to
10−2 cm2/(V s). Electron mobility in organic
a) To study organic materials as basic
materials is generally lower than hole mobility.
components for fabricating blue light emitting
Combining organic and nanomaterials both are
diode.
expected to have major impact on the flat panel
b) To study optimum parameters for fabrication display, will bring major changes in the
light emitting diodes. manufacturing of OLED and LCD.
c) To fabricate and characterized blue organic Nanomaterials by themselves, or mixed with
light emitting diodes other materials to form a composite material,
have been shown to possess many enhanced
d) To transfer OLED technology to flat-panel- properties. These enhanced properties have
display industries. been shown to be much more beneficial than
e) To develop a low-cost fabrication process conventional materials in the micron size range.
for OLED displays adaptable by the local Nanomaterials, especially in the solid or
display industry crystalline form, are high value-added
materials. Although many exciting new
We have purchased the evaporation applications of nanomaterial have been
equipment to fabricate OLED devices. developed in the microelectronics, automotive,
Preleminary works in OLED has been aerospace, petrochemical, bio-science,
discussed by Mursyidah et al 5 . PLED were pharmaceutical and opto-electronics industries,
fabricated using poly(9-vinylcarbazole), PVK, yet the high costs of production have been a
poly(4,4’-diphenylene diphenylvinylene), significant deterring factor for more rapid
PDPV and tris(8-quinolinolato) aluminum thin development of new applications.
films. Figure 1 shows the molecular structures 6. Conclusion
of organic compounds for our OLEDs. In a highly competitive market, industries rely
Performances of the device have been on total commitment to research &
investigated through the current-voltage (I-V) development, innovation, quality, and customer
curve, electroluminescence spectrum and the satisfaction. Hence collaboration between
luminance. The device shows emission Universities and industries are essential to tap
spectrum in the range of 430-620 nm . The the valuable resources for enhancement of
device was operated with turn-on voltage of newly developed field.
7.5 V. The maximum brightness was 1300
cd/m2. UKM has successfully developed the polymer
light-emitting device with the
Figure 2 shows the normalized emission ITO/PVK/PDPV/Alq3/Al structure with
spectrum of ITO/PVK/PDPV/Alq3/Al device. maximum brightness of 1300 cd/m2. However,
The device has a broad emission spectrum, the turn-on voltage of the device Von = 7.5 V
which spans the range of 430-620 nm with a was considered too high.
peak wavelength at 540 nm. The spectrum
indicates a green light emission range. Production costs present greatest challenge in
OLED industry. The target is to get high
5. Nanostructured materials for OLED efficiency displays with low power and
Organic materials are confined to subjects in economical to manufacture.
chemistry and biology. This trend may change
in the future with the development of polymers 7. Acknowledgements
and other molecular materials that can emit We wish to thank Mr Akrajas for many helpful
light and conduct electricity. The advantages of discussions. Part of the work has been carried
organic over inorganic materials are their out with the support of the Ministry of Science,
excellent in color range and high fluorescence Technology and Environment, Malaysia and
efficiency. Light is produced in organic Universiti Kebangsaan Malaysia under the
materials by the fast decay of excited molecular IRPA -09-02-02-0041 grant.
states, and the color of light depends on the 8. References
energy difference between those excited states Tang, C.W., Van Slyke, S.A. and Chen, C.H.
and the ground level. In most organic materials (1989). J. Appl. Phys. 65, 3610
LAMPIRAN
TABLE 4 : Projects on LED funded under the sixth and seventh Malaysia Plan
Projects Institution
Fabricating Blue Organic Light Emmiting UKM
Diodes (OLED)
Developments of Blue Light Emitting USM
Devices
Development of LED and OLED UM
O
O
AlCl 3
C Cl +
THF
TiCl 4 / Zn O
[ C
C ]n
PDPV
0.35
0.30
Intensity (arb. units)
0.25
0.20
0.15
0.10
0.05
350 400 450 500 550 600 650
wavelength (nm)
FIGURE 2 Normalized emission spectrum of the device
Abstract
A sensitive stripping voltammetry methods of analysis has been developed for determination
of mercury at polypyrrole/1,10-Dibenzyl-1,10-Diaza-18-Crown-6 electrode. Prepared of
electrode by electropolimerization of pyrrole and 1,10-dibenzil-1,10-diaza-18-crown-6 with
sodium perchlorate as supporting electrolyte in acetonitril at -700 – 1100 mV vs. Ag/AgCl,
with scan rate 80 mV/s on platinum disc. Determination of mercury with this electrode,
several parameters were varied, such as deposition potential and concentration of 1,10-
Dibenzyl-1,10-Diaza-18-Crown-6. The calibration plot was linear in 5.10-13 – 5.10-12 M with
r2 0.9911 and detection limit was 4.92.10-13 M; the coefficient of variation determination at a
concentration 10-12M was 4%. Base on deposition and stripping potential, the reaction at the
electrode may be caused by chemical reaction followed electrochemical reaction.
Key words: stripping voltammetry, polypyrrole, 1,10-dibenzil-1,10-diaza-18-crown-6,
mercury(II)
666
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Muji Harsini, Buchari, Indra Noviandri, Susanto Imam Rahayu
sangat penting untuk berhasil dalam operasi sehingga voltammogram terbentuk pada output
striping. Elektroda yang biasa digunakan dalam dari komputer.
voltammetri adalah raksa, karbon, platina, dan
Pembuatan elektroda dilakukan dengan teknik
emas. Namun dengan perkembangan baru
voltammetri siklis pada potensial pindai -700-
untuk meningkatkan sensitivitas dan
1100mV dengan laju 80 mV/detik.
selektivitas, digunakan modifikasi elektroda.
Elektropolimerisasi dilakukan terhadap larutan
Salah satu modifikasi elektroda adalah dengan
pirol 0,1M mengandung 18C6 dengan elektrolit
melapiskan polipirol pada permukaan elektroda
pendukung NaClO4 0,1M dalam pelarut
melalui elektropolimerisasi pirol in situ.
asetonitril (Harsini, 2004).
Polipirol merupakan polimer konduktif yang
memiliki sifat kurang selektif karena tidak Uji elektrode PPy/DBA218C6 dengan teknik
memiliki sisi aktif spesifik pada permukaan voltammetri pulsa diferensial. Pada percobaan
polimernya (Volf, 2002). Oleh karena itu perlu ini digunakan film PPy/DBA218C6 pada kawat
dikembangkan komposit dari polimer konduktif cakram platina diameter 1,3 mm sebagai
tersebut. elektroda kerja. Pengukuran larutan uji Hg2+
dengan elektrolit pendukung
Penelitian ini bertujuan mempelajari elektroda
KNO30,1M+HNO3 0,1M dalam pelarut
polipirol/1,10-dibenzil-1,10-diaza-18-crown-6
akuadem.
(PPy/DBA218C6) sebagai sensor pada
2+
pengukuran Hg secara voltammetri striping 3. Hasil dan Pembahasan
pulsa diferensial. Dengan mengasumsikan Penentuan potensial deposisi
bahwa senyawa DBA218C6 memiliki Untuk membuktikan bahwa pada saat deposisi
kemampuan yang sama dengan senyawa 1,10- terjadi reaksi kimia, maka elektrodeposisi
diaza-18-crown-6, Kstab Hg2+ 1017,9 (Gokel, ditentukan pada potensial 850, 800, 750 dan
1995), maka elektroda PPy/ DBA218C6 dapat 700 mV yang dimaksudkan untuk
merespon ion Hg2+ secara sensitif dan selektif. mempertahankan raksa dengan muatan +2.
Dengan demikian ion Hg2+ akan terdeposisi
pada permukaan elektroda dalam bentuk
O O
kompleksnya dengan senyawa DBA218C6.
CH2 N N CH2 Dalam penelitian ini, juga dilakukan
O O
elektrodeposisi pada potensial -1000 mV yang
diharapkan semua ion Hg2+ tereduksi
1,10-dibenzil-1,10-diaza-18-crown-6 membentuk Hgº. Pengukuran arus dilakukan
pada saat striping, yaitu lepasnya ion Hg2+ dari
permukaan elektroda. Kurva hubungan antara
2. Percobaan
Bahan-bahan kimia yang digunakan dalam potensial deposisi dan arus yang dihasilkan
penelitian ini antara lain: pirol (Sigma), 1,10- dapat dilihat pada Gambar 1. Berdasarkan
dibenzil-1,10-diaza-18-crown-6 (Fluka), voltamogram dapat dilihat bahwa potensial
asetonitril (Ajax), natrium perklorat (E-Merck). yang memberikan arus tertinggi adalah +800
Semua bahan berderajat pro analisis tanpa mV. Sedangkan pada potensial deposisi -1000
pemurnian lebih lanjut. mV tidak memberikan arus puncak. Hal ini
menunjukkan bawa Hg2+ telah tereduksi
Alat yang digunakan dalam penelitian ini menjadi Hgo sehingga tidak terdeposisi pada
adalah perangkat alat elektrolisis serta peralatan permukaan elektroda.
gelas yang lazim digunakan di laboratorium
Pada penelitian ini dilakukan juga pengukuran
kimia analitik. Alat elektrolisis terdiri dari sel
dengan tiga buah elektroda yaitu elektroda larutan Hg2+ menggunakan elektroda polipirol,
kerja cakram platina (Pt disc) diameter 1,3 mm yang ternyata tidak memberikan arus puncak
(Gambar 2). Hal ini disebabkan film polipirol
(luas area 1,3273 mm2) elektroda pembanding
cenderung bermuatan positif, ada tolakan ion
Ag/AgCl KCl 3M dan elektroda bantu kawat
platina diameter 0,04 mm. Sel elektrokimia ini Hg2+ yang bermuatan sama, sehingga Hg2+
tidak dapat terdeposisi pada permukaan
dihubungkan dengan potensiostat
elektroda. Demikian juga pengukuran terhadap
PowerLabs/400 dari ADInstruments yang
dihubungkan dengan seperangkat komputer larutan KNO3 0,1M +HNO3 0,1N sebagai
elektrolit pendukung tidak memberikan arus
untuk menjalankan software Echem Versi 1.52
sehingga kompleks PPy-/DBA218C6-Hg2+ Majid, S., Mama E.R., Aziz A., Christopher
berubah menjadi PPy/DBA218C6-Hg° dan M.A.B.,2002, An Amperometric Method for the
selanjutnya distriping dari permukaan elektroda Determination of Trace Mercury(II) by Formation
of Complexes with L-Tyrosine, An.Chim.Acta, 464,
masuk ke dalam larutan dalam bentuk ion Hg2+.
123-133
Hal ini terjadi karena selusur dilakukan ke arah
oksidasi, dari -1000 sampai 0 mV. Hasilnya Vandecasteelee, C., and Bloc, C.B., 1997, Modern
akan berbeda jika dilakukan selusur ke arah Methods for Trace Element Determination, John
reduksi yang memberikan arus puncak lebih Wiley and Sons, New York
pendek (Gambar 6). Volf, R., et al, 2002, Preparation, Characterization
and Analytical Application of Elektropolymerized
Usulan mekanisme reaksi pada permukaan Film, Solid State Ionics 154-155, 57-63
elektroda adalah sebagai berikut:
Wang, J., 2000, Analytical Electrochemistry, 2nd
Proses deposisi Ed., Wiley-VCH, New York
Hg2+larutan + Ppy/DBA218C6permukaan elektroda
Wang, J., Jianmin Lu, Ulku A.K., Samo B.H, and
→ Ppy/DBA218C6-Hg2+ adsorpsi Bozidar O, 2001, Insignhts into the anodic stripping
Proses striping voltammetric behavior of bismuth film electrodes,
Ppy/DBA218C6-Hg2+ adsorpsi + 2e- An. Chim. Acta, 434, 29-34
→ Ppy/DBA218C6-Hgo adsorpsi → Hg2+larutan
+ 2e- +
Ppy/DBA218C6permukaan elektroda
4. Kesimpulan
Berdasarkan hasil penelitian dan pembahasan
dapat disimpulkan bahwa elektroda
PPy/DBA218C6 mempunyai sensitivitas tinggi,
mampu mendeteksi ion Hg2+ secara
voltammetri pulsa diferensial dengan limit
deteksi 4,92.10-13 M pada potensial deposisi
+800 mV selama 30 detik
5. Pustaka
Buhlmaa, P., Pretsch, E., Bakker, E., 1998, Carier-
based Ion Selective Electrodes and Bulk Optodes
(2). Ionophores for Potentiometric and Optical
Sensor, Chem. Review, 98, 1593-1687
Cantle, J.E., 1982, Atomic Absorption
Spectrometry, Elsevier Scientific Publishing Co.
Gokel, G.W. (editor), 1995, Comprehensive
Supramolecular Chemistry, Vol 1, Pergamon.
Harsini, M., Buchari, Indra Noviandri, dan Susanto
Imam Rahayu, 2004, Elektropolimerisasi Film
Komposit Polipirol/1,10-Dibenzil-1,10-Diaza-18-
Crown-6 secara Voltammetri Siklis, Proceeding
Seminar MIPA IV ITB, 6-7 Oktober, ISBN 979-368-
02-5, 68-71.
Huang, W., and Shenghui Z., 2002, Determination
of Mercury at a Dithizone-Modified Glassy Carbon
Electrode by Anodic Stripping Voltammetry, Anal.
Sci, Februari, 187-189.
Mahajan, R.K., Ravneet K., Inderpreet K., Vandana
S, Manoj K., 2004, Mercury(II) Ion-Selective
Electrodes Based on p-tert-Butyl Calix[4]Crowns
with Imine Units, Anal. Sci, May, 20, 811-814.
LAMPIRAN
90
80
70
60
Arus (uA)
50
40
30
20
10
0
650 700 750 800 850 900
Potensial deposisi (m V)
Gambar 1. Kurva hubungan potensial deposisi dengan arus pada pengukuran larutan Hg2+10-6M dalam
HNO3 0,1M dengan waktu deposisi 240 detik
80
i(µA)
60
40
20
Gambar 2. Voltamogram striping pulsa diferensial perbandingan antara elektroda komposit PPy/DBA218C6
dengan elektroda polipirol pada pengukuran larutan Hg2+ 10-6M
2+ -6
100
Hg 10 M
KNO3 0,1M+HNO3 0,1M
90
80
70
60
i(µA)
50
40
30
20
10
-10
-1.0 -0.8 -0.6 -0.4 -0.2 0.0
E(V vs Ag/AgCl)
Gambar 3. Voltamogram striping pulsa diferensial perbandingan penentuan Hg2+ 10-6M dan KNO3+ HNO3
0,1M dengan elektroda PPy/DBA218C6
90
80
70
60
Arus (uA)
50
40
30
20
10
0
0 0.05 0.1 0.15
Konsentrasi DB2A18C6 (%)
Gambar 4. Kurva hubungan konsentrasi DBA218C6 yang ditambahkan dengan arus yang dihasilkan dari
voltamogram striping pulsa diferensial pada pengukuran larutan Hg2+ 10-6M
180
160
140
Arus (uA)
120
y = 1.6711x + 85.347
R2 = 0.9911
100
80
60
0 10 20 30 40 50 60
2+ -13
Konsentrasi Hg x10 (M)
Gambar 5. Kurva hubungan konsentrasi Hg2+ 5.10-13-5.10-12M dan arus, waktu deposisi 30 detik
striping -1000 - 0 mV
160
striping 0 - -1000 mV
140
120
100
i(µA)
80
60
40
20
E(V vs Ag/AgCl)
Vatikanol A dan α-Viniferin, Trimer resveratrol dari ekstrak aseton kulit batang
DIPTEROCARPUS RETUSUS Blume
Abstrak
Dua trimer resveratrol, vatikanol A dan α-viniferin, telah diisolasi untuk pertama kalinya
dari ekstrak aseton kulit batang Dipterocarpus retusus Blume. Struktur molekul kedua
senyawa tersebut ditetapkan berdasarkan data spektroskopi UV, IR, 1H-NMR dan 13C-NMR
serta perbandingan dengan data sejenis yang telah dilaporkan. Vatikanol A dan α-viniferin
menunjukkan aktivitas sitotoksik terhadap sel murin leukemia P-388 dengan nilai IC50
masing-masing sebesar 27,0 dan 17,5 µg/ml.
Kata kunci : Dipterocarpaceae, trimer resveratrol, vatikanol A, α-viniferin, dan
Dipterocarpus retusus Blume
672
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Muhtadi, Euis H. Hakim, Yana M. Syah, Lia D. Juliawaty, Lukman Makmur, Sjamsul A. Achmad,
Ikram M. Said, Laily bin Din dan Jalifah Latip
vakum menggunakan Si-gel 60 GF254 (Merck), 248 oC (terurai) dan [α]D20 -130o (c 0,1 MeOH).
kromatografi radial menggunakan Si-gel 60 Spektrum UV (MeOH) λmaks (log ε) 227 (4,64),
PF254 (Merck), dan analisis KLT menggunakan dan 284 nm (3,98). Spektrum IR (KBr) ν maks
plat KLT Kieselgel 60 GF254 0,25 mm (Merck). 3550 – 3231 cm-1 (gugus -OH), 1614, 1511,
Pelarut yang digunakan semuanya berkualitas dan 1454 cm-1 (C=C benzena), dan 828 cm-1 (p-
teknis yang didestilasi. disubstitusibenzena). Spektrum 1H dan 13C
Bahan. Bahan tumbuhan yang digunakan NMR dalam Tabel 1.
adalah kulit batang D. retusus Blume, Senyawa 2, diperoleh berupa padatan berwarna
diperoleh dari Hutan Percobaan Cifort - putih kecoklatan dengan t.l. 235 oC (terurai)
Darmaga Bogor Jawa Barat, pada bulan dan [α]D20 -50o (c 0,1 MeOH). Spektrum UV
September 2003. Tumbuhan tersebut (MeOH) λmaks (log ε) 229 (4,57), dan 286 nm
diidentifikasi oleh staf Herbarium Bogoriensis, (4,19). Spektrum IR (KBr) ν maks 3456-3231
Lembaga Ilmu Pengetahuan Indonesia (LIPI) cm-1 (gugus-OH), 1614, 1515, dan 1486 cm-1
Bogor. (C=C benzena), dan 829 cm-1 (p-
Ekstraksi dan Isolasi. Tiga kilogram serbuk disubstitusibenzena). Spektrum 1H dan 13C
kering kulit batang D. retusus Blume NMR dalam Tabel 2.
diekstraksi dengan aseton. Ekstrak aseton
selanjutnya dipekatkan pada tekanan rendah HO
3a
2a
dan diperoleh gum berwarna coklat gelap (131 A1 H
OH
O OH
g). Ekstrak aseton tersebut, selanjutnya 7a B2
14a H H C2
dilarutkan kembali dalam campuran MeOH- HO 8a OH
dietileter sehingga menghasilkan fraksi terlarut 12a
A2
Tabel 1. Spektrum 1H dan 13C NMR senyawa 1 dan (-)-vatikanol A standar (1*)
1 13
H NMR C NMR
No. C
1 1* 1 1*
1a - - 134,5 134,4
2/6a 7,26 (d, J=8,8) 7,28 (d, J=8,8, 2H) 128,0 128,0
3/5a 6,81 (d, J=8,8) 6,83 (d, J=8,8, 2H) 116,1 116,0
4a - - 157,9 157,9
7a 6,16 (brd, J=4,0) 6,18 (brd, J=3,9, 1H) 86,6 86,5
8a 4,49 (d, J=4,0) 4,51 (d, J=3,9, 1H) 50,4 50,3
9a - - 144,8 144,7
10a - - 119,4 119,3
11a - - 157,8 157,7
12a 6,06 (d, J=2,2) 6,10 (d, J=2,4, 1H) 101,4 101,3
13a - - 156,4 156,3
14a 6,46 (d, J=2,2) 6,48 (d, J=2,4, 1H) 103,3 103,3
1b - - 138,7 138,7
2/6b 7,04 (d, J=8,4) 7,07 (d, J=8,8, 2H) 129,3 129,2
3/5b 6,59 (d, J=8,4) 6,60 (d, J=8,8, 2H) 114,8 115,4
4b - - 155,8 155,8
7b 5,15 (br s) 5,17 (br s, 1H) 36,1 36,0
8b 4,49 (d, J=7,0) 4,52 (d, J=7,3, 1H) 48,7 48,6
9b - - 144,9 144,9
10b - - 118,7 118,6
11b - - 159,7 159,9
12b 6,21 (s) 6,22 (s, 1H) 95,4 95,3
13b - - 155,5 155,4
14b - - 122,3 122,2
1c - - 135,8 135,8
2/6c 6,52 (d, J=8,4) 6,55 (d, J=8,8, 2H) 129,7 129,6
3/5c 6,34 (d, J=8,4) 6,37 (d, J=8,8, 2H) 114,9 114,9
4c - - 156,5 156,4
7c 3,62 (d, J=7,0) 3,65 (d, J=7,0, 1H) 64,4 64,3
8c 4,17 (br s) 4,20 (br s, 1H) 57,5 57,5
9c - - 147,6 147,5
10c 6,25 (d, J=2,2) 6,27 (d, J=2,0, 1H) 106,7 106,7
11c - - 159,4 159,2
12c 6,19 (t, J=2,2) 6,21 (d, J=2,0, 1H) 101,3 101,3
13c - - 159,4 159,2
14c 6,28 (d, J=2,0 1H 6,27 (d, J=2,0, 1H) 106,7 106,7
* Tanaka, 2000.
Tabel 2. Spektrum 1H dan 13C NMR senyawa 2 dan (-)-α-viniferin standar (2*)
1 13
H NMR C NMR
No. C
2 2* 2 2*
1a - - 132,0 132,0
2/6a 7,01 (d, J=8,8 Hz, 2H) 7,03 (d, J=8,5 Hz, 2H) 128,2 128,1
3/5a 6,70 (d, J=8,8 Hz, 2H) 6,72 (d, J=8,5 Hz, 2H) 115,7 115,7
4a - - 158,2 157,8
7a 6,07 (br s, 1H) 6,21 (br s) 86,4 86,4
8a 3,95 (br s, 1H) 3,98 (br s) 46,4 46,4
9a - - 141,2 141,2
10a - - 120,9 120,9
11a - - 160,6 161,6
12a 6,22 (d, J=1,8 Hz, 1H) 6,25 (d, J=1,8 Hz, 1H) 98,0 98,0
13a - - 159,3 159,3
14a 6,71 (d, J=1,8 Hz, 1H) 6,72 (d, J=1,8 Hz, 1H) 106,2 106,2
1b - - 132,5 132,5
2/6b 7,02 (d, J=8,8 Hz, 2H) 7,08 (d, J=8,5 Hz, 2H) 128,7 128,6
3/5b 6,78 (d, J=8,8 Hz, 2H) 6,79 (d, J=8,5 Hz, 2H) 116,1 116,1
4b - - 158,4 158,3
7b 4,90 (d, J=6,2 Hz, 1H) 4,90 (d, J=6,4 Hz, 1H) 95,6 95,6
8b 4,60 (d, J=6,2 Hz, 1H) 4,61 (d, J=6,4 Hz, 1H) 55,7 55,6
9b - - 141,2 141,2
10b - - 118,8 118,8
11b - - 161,6 161,6
12b 6,24 (d, J=2,0 Hz, 1H) 6,22 (d, J=1,8 Hz, 1H) 98,0 98,0
13b - - 159,3 159,3
14b 5,98 (d, J=2,0 Hz, 1H) 5,99 (d, J=1,8 Hz, 1H) 108,6 108,5
1c - - 132,0 132,0
2/6c 7,22 (d, J=8,8 Hz, 2H) 7,22 (d, J=8,5 Hz, 2H) 128,1 128,1
3/5c 6,76 (d, J=8,8 Hz, 2H) 6,77 (d, J=8,5 Hz, 2H) 116,1 116,2
4c - - 157,9 157,8
7c 5,92 (d, J=10,0 Hz, 1H) 5,95 (d, J=9,7 Hz, 1H) 90,0 90,0
8c 4,68 (d, J=10,0 Hz, 1H) 4,71 (d, J=9,7 Hz, 1H) 52,8 52,8
9c - - 138,7 138,7
10c - - 119,7 119,7
11c - - 161,7 161,7
12c 6,20 (d, J=2,0 Hz, 1H) 6,15 (d, J=2,0 Hz, 1H) 96,9 96,9
13c - - 160,7 160,8
14c 6,59 (d, J= 2,0 Hz, 1H) 6,46 (d, J=2,0 Hz, 1H) 105,8 105,8
OH 8,85;8,76;8,70;8,63;8,61; 8,57
(masing-masing brs, 1H)
UV **) 229 (4,57), 286 (4,19) 225 (4,68), 286 (3,92)
IR cm-1 3456-3231, 1617, 1512, 1486, 3387, 1616, 1515, 1485,
**)
829 831
[α]D20 **) -50o -58o
* Pryce, 1977. (pelarut yang digunakan aseton-d6)
**Data dibandingkan dengan data (-)-α-viniferin dari S. seminis (Aminah, 2002)
adanya enam sinyal proton alifatik, dua tersebut, maka dapat dirumuskan struktur
diantaranya khas untuk 2,3-disubstitusi-2,3- senyawa ini, dimana berdasarkan penelusuran
dihidrobenzofuran (δH 6,16 dan 4,49 ppm (d, pustaka telah ditemukan sebelumnya sebagai (-
J=4,0 Hz)), sedangkan empat sinyal lainnya )-vatikanol A. Perbandingan data NMR (Tabel
sesuai dengan unit 1,1,2,3,4,4- 1) senyawa 1 dengan (-)-vatikanol A standar
heksasubstitusibutana (δH 5,15, 4,49, 3,62, dan memperlihatkan kesesuaian yang tinggi.
4,17 ppm). Berdasarkan unit-unit struktur
Dengan demikian dapat disimpulkan bahwa Dipterocarpus dengan genus Shorea dan
senyawa 1 adalah (-)-Vatikanol A. Vatica. Walaupun demikian, hipotesis ini perlu
mendapat dukungan lebih lanjut dengan
Dengan metodologi penentuan struktur yang
melakukan kajian sejenis terhadap spesies-
sama, dapat juga ditentukan bahwa senyawa 2
spesies dari Dipterocarpus, Shorea dan Vatica.
adalah (-)-α-viniferin.
5. Uca[an Terimkasih
Tabel 2 memperlihatkan data NMR senyawa 2
Kami ucapkan terima kasih kepada Dirjen Dikti
dan (-)-α-viniferin standar yang telah Depdiknas atas bantuan beasiswa BPPs, Kebun
dilaporkan oleh Pryce, 1977. Percobaan Cifort – Darmaga Bogor atas
Hasil pengukuran sifat sitotoksik terhadap sel bantuannya dalam menyediakan sampel
murin leukemia P-388 menunjukkan bahwa (-)- tumbuhan dan staf Herbarium Bogoriensis
α-viniferin memiliki IC50 17,5 µg/ml lebih aktif Bogor dalam determinasi tumbuhan. Dr. Jalifah
daripada (-)-vatikanol A dengan nilai IC50 27,0 Latip dari Universiti Kebangsaan Malaysia
µg/ml. Nilai IC50 diatas 4 µg/ml menunjukkan (UKM) atas bimbingannya selama Program
kedua senyawa trimer resveratrol ini kurang Sandwich di UKM dan bantuannya dalam
sitotoksik terhadap sel murin leukemia P-388 mengukur spektrum 1H-NMR dan 13C-NMR.
(Hostettmann, 1991). 6. Daftar Pustakan
Makna penemuan (-)-vatikanol A dan (-)-α- Aminah N.S., Achmad S.A., Hakim E.H., Syah
Y.M., Ghisalberti E.L, Juliawaty L.D., (-)-α-
viniferin terhadap aspek kemo-taksonomi
Viniferin, suatu trimer stilbenoid dari kulit batang
Dipterocarpus Shorea seminis V.S. (Dipterocarpaceae). Dalam:
Berdasar penelusuran pustaka, penemuan (-)- Prosiding Seminar Nasional Kimia, 28-29 Mei
vatikanol A dalam genus Dipterocarpus 2002, Bandung, 117-112.
merupakan yang pertama kali dilaporkan.
Senyawa ini juga pernah ditemukan Ashton P.S., (1983). Dipterocarpaceae, Dalam:
Flora Malesiana. Series I, Spermatophyta,
sebelumnya pada S. selanica (Tukiran, 2003),
Martinus Nijhoff, London, Vol. 9, 291-326
V. rassak (Tanaka, 2000) dan V. pauciflora
(Ito, 2003). Keberadaan senyawa ini, Hakim E.H., Achmad S.A., Makmur L., Mujahidin
memberikan pengetahuan tentang kedekatan D., Syah Y.M., (2000). Review: Phytochemical
hubungan genus Dipterocarpus, Shorea dan profile of Annonaceae, Bull. Soc. Nat. Prod. Chem.,
1(1), 1-12.
Vatica berdasar kajian fitokimia. Hal ini
mendukung kedekatan hubungan ketiga genus Hostettmann K., (1991). Assays for bioactivity
ini pada Dipterocarpaceae yang telah method in plant biochemistry. Series editor P. M.
digarisbawahi oleh peneliti taksonomi Biologi Dey dan J. B. Harborne, Academic Press, London,
(Ashton, 1983). Sedangkan senyawa α- Vol 6.
viniferin ditemui hampir pada semua spesies Ito T., Tanaka T., Iinuma M., Nakaya K.,
tumbuhan famili Dipterocarpaceae yang telah Takahashi Y., Sawa R., Murata J., Darnaedi D.,
dikaji aspek fitokimianya. Hal ini memperkuat (2004). Two new resveratrol (=5-[1E)-2-(4-
dugaan bahwa α-viniferin merupakan Hydroxyphenyl)ethenyl]-benzene-1,3-diol)
tetramers with a tetrahydrofuran ring from
‘chemical marker’ dari famili
Dipterocarpus grandiflorus. Helvetica Chimica
Dipterocarpaceae. Acta, 87, 479-495.
4. Kesimpulan Ito T., Tanaka T., Nakaya K., Iinuma M., (2003).
Dua timer resveratrol telah berhasil diisolasi New resveratrol oligomers in the stem bark of
dari ekstrak aseton kulit batang D. retusus Vatica pauciflora. Tetrahedron, 59, 5347-5363.
Blume, yaitu (-)-vatikanol A (1) dan (-)-α- Kartawinata K., (1983). Jenis-jenis Keruing. LIPI,
viniferin (2). Sifat sitotoksik α-viniferin (IC50 Bogor Indonesia, Vol. 1.
17,5 µg/ml) lebih tinggi dari vatikanol A (IC50
27,0 µg/ml). Senyawa α-viniferin ditemui pada Pryce R.J., Langcake P., (1977). α-Viniferin: an
antifungal resveratrol trimer from grapevines.
hampir semua spesies dalam famili tumbuhan
Phytochemistry, 16, 1452-1454.
Dipterocarpaceae. Sedangkan keberadaan
vatikanol A dalam genus Dipterocarpus
memberi arti pada kedekatan hubungan genus
Sotheeswaran S., Pasupati V., (1993). Distribution Tukiran, (2003). Senyawa Mikromolekul dari
of resveratrol oligomers in plants. Phytochemistry, Beberapa Tumbuhan Meranti (Shorea) Indonesia.
32, 1083-1092. Disertasi Doktor, Departemen Kimia, Institut
Teknologi Bandung.
Tanaka T., Ito T., Nakaya K., Iinuma,M., Riswan,
S., (2000). Oligostilbenoids in stem bark of Vatica
rassak. Phytochemistry, 54, 63-69.
Mulyadi Tanjung1, Hery Suwito1, Alfinda Novi Kristanti1, Nanik Siti Aminah1,
Mahmiah1,Nanik Fauziah1 dan Unang Supratman2
1
Departement of Chemistry, University of Airlangga, Surabaya, Indonesia.
2
Departement of Chemistry, University of Padjadjaran, Bandung, Indonesia.
Abstract
Three flavonoids, quercetine-3,7-dimethylether (1), quercetine-3,7,4,-trimethylether (2) and
3,5,2,,3,-tetrahydroxy-7,4,-dimethoksiflavon (3) have been isolated from the tree bark of
Saccopetalum horsfieldii Benn.(Annonaceae). The chemical structures of compounds have
been determined by spectroscopic UV, IR, MS, 1H-NMR dan 13C-NMR.
1. Pendahuluan 2. Percobaan
Annonaceae merupakan salah satu famili Umum
tumbuhan yang banyak terdapat di Indonesia. Titik leleh ditentukan dengan alat Fisher Johns.
Senyawa kimia yang telah dipisahkan dari Spektrum ultraviolet ditentukan dengan
famili tanaman ini memperlihatkan berbagai spektrometer Beckman DU 7500, spektrum
aktivitas seperti antioksidan, anti radikal bebas, inframerah ditentukan dengan FTIR Shimadzu
antitumor, antikanker, inhibitor enzim, 435. Spektrum resonansi magnit inti diukur
insektisida, dan sebagainya. Senyawa tersebut dengan Brucker AM 30 yang bekerja pada
antara lain dari golongan asetogenin, alkaloid, 400 MHz. Silika gel SiO2 Merck 7731 dan
flavonoid, santon dan piron (Tanjung et.al., 7733 digunakan sebagai fasa diam dalam
2004; Wang et.al, 2002; Hakim et.al, 2001). kromatografi kolom dan kromatografi kolom
cepat.
Saccopetalum horsfieldii Benn merupakan
tumbuhan endemic Indonesia. Nama daerah Pengumpulan bahan tanaman
tumbuhan ini Janglot atau Kalak Kembang Bahan tanaman Saccopetalum horsfieldii Benn
(Heyne, 1987). dikumpulkan dan diidentifikasi di Kebun Raya
Purwodadi, Pasuruan, Jawa Timur
Penelitian ini bertujuan untuk mengisolasi dan
mengidentifikasi senyawa flavonoid yang Isolasi senyawa flavonoid
terdapat pada kulit batang Saccopetalum Bahan tanaman Saccopetalum horsfieldii Benn
horsfieldii Benn. Isolasi dan pemisahan diekstraksi dengan aseton pada suhu kamar
senyawa yang aktif pada kulit batang dengan cara maserasi. Pelarut diuapkan dengan
Saccopetalum horsfieldii dilakukan rotavapor vacuum menghasilkan ekstrak
sebagaimana lazimnya isolasi senyawa aseton, selanjutnya ekstrak aseton dilarutkan
metabolit sekunder. Struktur molekul senyawa dengan methanol-air 10% dan dipartisi dengan
fenolik ditentukan dengan metode spektroskopi n-heksan. Ekstrak methanol-air ditambahkan
ultraviolet, inframerah, dan resonansi magnit asam sitrat 5% (pH 3-4) dan diekstraksi dengan
inti. Penelitian ini merupakan rangkaian etilasetat. Ekstrak etilasetat dilakukan
penelitian sebelumnya (Tanjung et.al, 2004). pemisahan dengan kromatografi kolom dan
kromatografi kolom cepat.menghasilkan tiga
senyawa flavonoid yakni kuersetin 3,7-
dimetileter (1), kuersetin 3,7,4,-trimetileter (2),
678
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Mulyadi Tanjung, Hery Suwito, Alfinda Novi Kristanti, Nanik Siti Aminah, Mahmiah,Nanik Fauziah
dan Unang Supratman
Gambar 1
OH
OH 6,72;d;2,2 hz
3,98;s HO OH
6,72;d;2,2 hz HO OCH3
3,82;s
H
3,82;s
H
H3CO O
H3CO O H7,34d;8,80hz
H7,34d;8,80hz
H 8,82;d;8,76 hz
H 8,82;d;8,76 hz
H OCH3
H OH 6,64;d;2,2 hz 3,98;s
6,64;d;2,2 hz OH O
OH O
Gambar 3
interaksi proton aromatis pada posisi meta. Efek batokromik dengan pereaksi geser AlCl3
Sinyal doblet pada 7,55 ppm menunjukkan ada memberikan pergeseran pada λmaks 275, 346
interaksi proton pada posisi meta dari dan 395 nm yang khas dari senyawa flavonoid
pergeseran kimia 7,55 ppm. Sinyal doblet pada yang mempunyai gugus karbonil C=O pada
7,55 menunjukkan adanya interaksi orto posisi C-3 dan gugus hidroksi OH pada posisi
dengan 7,09. Sinyal doblet-doblet pada 7,55 C-5 yang membentuk senyawa komleks dengan
ppm menunjukkan bahwa proton tersebut logam Al , sedangkan dengan pereaksi geser
berinteraksi orto dengan sinyal 7,09 ppm dan NaOAc memberikan λmaks 260 dan 346 nm, hal
berinteraksi meta dengan sinyal 7,55 ppm. ini menunjukkan adanya gugus metoksi pada
Sinyal broad pada pergeseran kimia 12,61 ppm posisi C-7. Spektrum 1H-RMI senyawa
merupakan proton dari fenol. Spektrum 13C- 3,5,2,,3,-tetrahidroksi-7,4,-dimetoksiflavon
RMI senyawa kuersetin 3,7,4’-trimetileter dalam pyridin-d5 memberi informasi adanya 4
terlihat adanya 18 atom karbon. Sinyal tersebut proton aromatis dan 2 sinyal gugus metoksi.
adalah 55,55 (4’OMe), 55,85 (7-OMe); 59,49 Sinyal singlet pada 3,81 dan 3,98 ppm
(3-OMe), 92,03 (C-8), 97,51 (C-6), 105,03 (C- merupakan gugus metoksi pada posisi 7-OMe,
10) 111,73 (C-5’), 114,94 (C-2’) dan 120,16 (C- dan 4’-OMe. Sinyal proton aromatis terlihat
6’), 120,04 (C-1’), 137,97 (C-3), 146,15 (C-2), pada pergeseran 6,64 ppm (1H, d, J 2,2 Hz, H-
150,07 (C-3’), 155,31 (C-4’), 156,01 (C-9), 6), 6,72 ppm (1H, d, J 2,2 Hz, H-8), 7,34 ppm
160,69 (C-5), 164,87 (C-7) dan 177,76 ppm (C- (1H, d, J 8,80 Hz, H-5’,), dan 8,22 ppm (1H, d,
4). Sinyal pada 177,76 ppm merupakan ciri J 8,76 Hz, H-6,’). Sinyal doblet pada masing-
khas gugus karbonil. masing 6,64 dan 6,72 ppm memberikan
Posisi proton dan karbon senyawa kuersetin informasi adanya interaksi proton aromatis
3,7-dimetileter hasil isolasi diaktualisasikan pada posisi meta (H-6 dan H-8). Sinyal doblet
seperti pada gambar 2. pada 7,34 ppm menunjukkan ada interaksi
proton pada posisi orto dengan 8,22 ppm (H-5,
3,5,2,,3,-tetrahidroksi-7,4,-dimetoksiflavon dan H-6). Spektrum 13C-RMI senyawa
(3) berwujud padat berwarna kuning muda. 3,5,2,,3,-tetrahidroksi-7,4,-dimetoksiflavon
Spektrum ultraviolet senyawa 3,5,2,,3,- terlihat adanya 17 atom karbon. Sinyal tersebut
tetrahidroksi-7,4,-dimetoksiflavon dalam adalah 55,91; 59,87 ; 92,37; 98,27; 106,18;
metanol memberikan λmaks 262 dan 344 nm. 116,43 (2C); 121,29; 130,86 (2C); 138,61;
156,63; 156,98; 161,78; 162,17; 165,71; dan Hamid. A. Hadi dan Nurdin Saidi MSc. dari
178,92 (C-4). Sinyal pada 177,76 ppm Departement of Chemistry, Faculty of Science,
merupakan ciri khas gugus karbonil. University of Malaya, Kuala Lumpur ,
Malaysia atas bantuam spectrum RMI.
Posisi karbon pada C-4, dapat dipertukarkan
Terimakasih disampaikan pula kepada Kebun
pada posisi C-3, hal ini sedang dipelajari lebih
Raya Purwodadi, Pasuruan, Jawa Timur yang
lanjut posisi gugus metoksi tersebut (gambar
telah membantu pengambilan dan
3).
mengidentifikasi bahan tanaman.
4. Kesimpulan
6. Daftar Pustaka
Tiga senyawa flavonoid telah dipisahkan dari
Hakim, E.H., Achmad, S.A., Makmur, L. dan Syah,
kulit batang Saccopetalum horsfieldii BENN Y.M., 2001, Profil Kimia Annonaceae, Bull.
yang diidentifikasi sebagai kuersetin- 3,7- Indonesian Soc. Of Nat. Pro. Chem., 1(1), 1-11.
dimetileter (1),kuersetin- 3,7,4,-trimetileter (2),
dan 3,5,2,,3,-tetrahidroksi-7,4,-dimetoksiflavon Harborne, J.B. and Mabry, T.J., 1982, The
Flavonoids: Advances in Research, Chapman and
(3). Ditemukannya ketiga senyawa flavonoid
Hall Ltd., London-New York, 75-76
merupakan rangkaian penelitian sebelumnya
yakni senyawa alkaloid liriodenin, Heyne, K., 1987, Tumbuhan Berguna Indonesia
norarmepavin dan norlaudanisin. Jilid II, Jakarta, Saranawarna Jaya, 765-777
Abstrak
Kajian fitokimia telah dilakukan ke atas ekstrak petroleum eter kulit buah spesies Garcinia
mangostana. Penulenan dengan menggunakan kaedah penyediaan KLN dan penghabluran
semula menghasilkan mangostin (1). Tindakbalas penukargantian menghasilkan
dimetilmangostin (2) dan triasetoksimangostin (3). Pengenalpastian struktur dilakukan
dengan teknik spektroskopi IM, 1H, 13C and 2D RMN.
4' 4'
3'
2'
O
1' R1 4'
1''
1'
CH3O 1
7 8a 9 1a
8 3' 4'
2 2'
6 3
5a 4a
R2 O R3
5 4
(1) R1 = R2 = R3 = OH
(2) R1 = OH, R2 = R3 = OCH3
(3) R1 = R2 = R3 = OCOCH3
13
pengewapan berputar (‘rotary evaporator’) C [CDCl3]: δ142.48(C-1), 121.37(C-2),
menghasilkan ekstrak mentah petroleum eter 154.48(C-3), 103.59(C-4), 108.35(C-5),
(24.80 g, 3.02 %, t.l. 153-155OC) sebagai 136.99(C-6), 135.82(C-7), 112.16(C-8),
hablur berwarna kuning. Ekstrak mentah 182.00(C-9), 132.14(C-1a), 155.04(C-4a),
petroleum eter ditulenkan dengan 153.75(C-5a), 21.40(C-1’), 25.78(C-2’),
menggunakan kaedah penghabluran semula. 25.81(C-3’), 18.18(C-4’), 62.03(C-1’).
Ekstrak mentah petroleum eter (7.16 g)
Dimetilmangostin (2), hablur berwarna putih
dilarutkan ke dalam dietil eter (9 ml) sambil
kekuningan, t.l 105-1070C (ruj : 108-1090C)
dipanaskan. Petroleum eter (8 ml) ditambah
setitik demi setitik sehingga larutan keruh (Morton1987). IM νmaks cm-1 3451.1, 2922.0,
terbentuk dan kemudian dibiarkan semalaman. 1645.2, 1598.9 1461.9, 1278.7. RMN 1H
Penurasan hasil mendakan menghasilkan [CDCl3]: δ 1.65, 1.80, 1.90, 2.10(12H, s,
sebatian 1 (5.57 g). 4×CH3), 3.30(2H, d, CH2CH=), δ3.80, 3.98,
4.05(9H, s, 3×OCH3), 5.20, 5.23(2H, t,
Sebatian 1 (1.0g) dilarutkan di dalam aseton 2×=CHCH2) 6.48, 6.92 (2H, s, 2×H-Aromatik),
dan ditambahkan dengan metil iodida serta
13.60(1H, s, OH). RMN 13C [CDCl3]: δ
K2CO3. Campuran diaduk pada suhu bilik
155.443(C-1), 122.611(C-2), 155.531(C-3),
selama 6 jam. Penyejatan hasil turasan dengan
103.580(C-4), 111.224(C-5), 136.581(C-6),
alat pengewapan berputar menghasilkan hablur
130.843(C-7), 111.575(C-8), 182.206(C-9),
berwarna kekuningan. Penghabluran semula
130.674(C-1a), 158.802(C-4a), 159.755(C-5a),
dengan menggunakan campuran eter dan
21.217(C-1’), 25.184(C-2’), 25.251(C-3’),
heksana menghasilkan sebatian 2 (0.24 g)
17.574(C-4’), 60.219(C-1’’), 55.961(C-2’’),
Sebatian 1 (0.56 g) dilarutkan dalam piridina. 55.792(C-3’’).
Kemudian asetik anhidrida ditambah setitik
Triasetoksimangostin (3), cecair likat berwarna
demi setitik ke dalam larutan dan campuran
perang cerah. IM νmaks cm-1 2964.2, 1643.2,
diaduk pada suhu bilik selama 24 jam.
1608.0, 1581.5, 1458.1, 1280.6. RMN 1H
Penyejatan campuran tindak balas
menghasilkan cecair likat berwarna perang. [CDCl3]: δ 1.48, 1.67, 1.75, 1.82(12H, s,
Penulenan menggunakan kaedah PTLC 4×CH3), 2.02(2H, d, CH2CH=), 2.34, 2.40,
menghasilkan sebatian 3 (0.10 g) 2.45(9H, s, 3×COCH3), 3.76(3H, s OCH3),
5.03, 5.18 (2H, t, 2×=CHCH2) 7.13, 7.26(2H, s,
Mangostin (1), hablur berwarna kuning, t.l 171- 2×H-Aromatik). RMN 13C [CDCl3]: δ
1730C (ruj : 1790C) (Morton 1987). IM νmaks 146.582(C-1), 122.793(C-2), 148.610(C-3),
cm-1 : 3415.9, 3258.5, 2854.5, 1644.2, 1611.4 110.107(C-4), 108.816(C-5), 138.865(C-6),
dan 1279.7, RMN 1H [CDCl3]: δ 1.70, 1.80, 137.111(C-7), 113.402(C-8), 175.925(C-9),
1.88, 1.90(12H, s, 4×CH3), 3.48 (2H, d, 132.312(C1a), 152.958(C-4a), 148.336(C-5a),
CH2CH=), 3.80(3H, s, OCH3), 5.27, 5.30(2H, 21.036(C-1’), 23.338(C-2’), 22.492(C-3’),
t, 2×=CHCH2), 6.30, 6.80 (2H, s, 2×H- 18.028(C-4’), 60.219(C-1’’), 25.440(C-2’’),
Aromatik), 13.75, 13.77(2H, s, 3×OH). RMN 25.616(C-3’’), 26.067(C-4’’).
Bennett G.J., Lee H.H., Lee L.P. Nov-Dec, 1990. Sen A.K., Sarkar K.K, Majunder P.C., Banerji N.
Synthesis of minor xanthone from Garcinia 1986. Garcinone D, a new xanthone from Garcinia
mangostana. Journal Of Natural Product. 53 : 1463- mangostana. Indian Journal of Chemistry, Section
1470. B. 25(B) : 1157-1158
Feodor S. 1967. Structure of dimethyl-mangostin Wade L.G., JR 2003. Organic Chemistry. Pearson
and mangostin. Chemical communication. 19 : Education, INC. Upper Saddle River, New Jersey.
1015-1017. 345-430, 490-499, 544-545.
Kosela S., Hu L.H., Rachmatia T., Hanafi M. dan Whitemore T.C. 1972. Tree Flora of Malaya. Kuala
Sim K.Y. 2000. Three new pyranoxanthones from Lumpur: Longman Malaysia Sdn. Bhd. 2 : 162-170.
Garcinia dulcis. Journal Natural Product. 63 : 406-
407.
Abstrak
Membran biomolekul sol-gel telah berjaya direkabentuk dalam kajian ini untuk pembinaan
biosensor bagi pengesanan logam berat. Penunjuk pH jenis lipofilik kromoionofor (Kr,
ETH5294) telah dipegunkan dalam filem sol-gel untuk pembinaan sensor pH. Lapisan Kr
memberi respon pH yang linear pada julat pH 5 - 10 (R2 = 0.9834) dan tiada masalah larut
lesap diperhatikan dalam tempoh kajian selama 30 minit. Biosensor optik yang terdiri
daripada Kr yang terdop di dalam filem sol gel dan diselaputi dengan lapisan filem sol-gel
kedua yang dipegunkan dengan enzim urease, berjaya menghasilkan biosensor untuk
pengesanan ketoksikan logam berat. Biosensor ini memerlukan lapisan Kr dalam keadaan
berasid untuk mengesan kehadiran alkali semasa tindak balas antara enzim urease dengan
urea. Biosensor ini menunjukkan sifat optimum pada pH 6.5, muatan enzim 10 mg/mL dan
kepekatan penimbal tris-HCl 30 mM. Julat rangsangan linear diperolehi pada julat kepekatan
urea 30 – 50 mM (R2 = 0.9743, LOD = 26.5 mM). Dalam pengesanan ketoksikan logam
berat, masa pengeraman optimum biosensor ini adalah 10 minit dan jujukan ketoksikan yang
dicerap ialah Pb2+ < Cd2+ < Cu2+ pada julat kepekatan logam 5 – 100 ppm dengan julat
linear terhadap ion kuprum pada julat kepekatan 1 – 8 ppm. Biosensor ketoksikan logam
berat yang dihasilkan dalam kajian ini telah menunjukkan keputusan yang bolehbanding
terhadap keputusan yang diperolehi daripada kaedah konvensional seperti spektrometri
serapan atom (AAS).
Rajah 3: Respon optik bagi biosensor ketoksikan Rajah 4: Kesan bagi perbezaan kepekatan logam-
logam berat terhadap perubahan kepekatan substrat logam berat pada tahap perencatan untuk biosensor
urea optik
Kesan perencatan yang tinggi dapat ion Cu(II) manakala ion Pb(II) menunjukkan
diperhatikan untuk logam Cu(II) dengan kepekaan yang kurang berbanding ion Cd(II)
peratus perencatan 53 % pada kepekatan 5 ppm (Preiniger & Wolfbies 1996).
berbanding 21 % dan 2 % bagi Cd(II) dan
Oleh kerana ion Cu(II) menunjukkan kepekaan
Pb(II) masing-masingnya. Lengkung kalibrasi
yang paling tinggi, ion ini telah digunakan
bagi ion Cu(II) mencapai peratus perencatan
untuk memplotkan lengkung kalibrasi (Rajah
sehingga 78 % pada kepekatan Cu(II) 10 ppm
5). Suatu respon linear diperolehi pada
dan mencapai peratus perencatan maksimum
kepekatan kurang daripada 10 ppm. Keputusan
selepas kepekatan ini. Manakala bagi ion Cd(II)
yang diperolehi daripada kaedah biosensor dan
dan ion Pb(II) pula, peratus perencatan tersebut
kaedah AAS telah dibandingkan (Rajah 6) dan
hanya tercapai apabila biosensor didedahkan
hasil kajian menunjukkan bahawa kedua-dua
kepada kepekatan logam 100 ppm. Pengesanan
kaedah ini adalah bolehbanding.
optik berdasarkan perencatan enzim dalam
larutan bebas oleh ion logam dengan 4. Kesimpulan
menggunakan Kr dalam membran PVC Kajian ini menunjukkan bahawa biosensor
menunjukkan kepekaan yang tinggi terhadap ketoksikan logam berat yang dapat mengesan
kehadiran urea dan logam berat khususnya ion prepared by doped sol-gel immobilization
Cu2+ telah berjaya dibangunkan.Biosensor ini technique. Optics Comm. 140: 32-35.
memberikan respon linear bagi urea pada julat Koncki, R., Mohr, G.J. & Wolfbies, O.S. 1995.
kepekatan 30 – 50 mM. Biosensor ini telah Enzyme biosensor for urea based on a novel pH
menunjukkan respon linear dalam julat bulk optode membrane. Biosens. Bioelectron. 10:
kepekatan ion Cu2+ 1 - 8 ppm. Kaedah SSA dan 653-659.
biosensor ini telah menunjukkan keputusan Kovács, B., Nagy, G., Dombi, R. & Tóth, K. 2003.
yang boleh banding. Optical biosensor for urea with improved response
5. Ucapan Terimakasih time. Biosens. Bioelectron. 18: 111-118.
Kami ingin merakamkan terima kasih kepada Lee, Y.H., Teh, H.F., Loh, H.C. & Musa, A. 2003.
Kementerian Sains, Teknologi dan Innovasi Influence of methacrylic-acrylic copolymer
Malaysia untuk biasiswa NSF dan gran composition on the plasticizer-free optode films for
penyelidikan IRPA 09-03-03-006. pH sensors. Sensors 3: 83-90.
6. Daftar Pustaka Lee, W.Y., Kim, S.R., Kim, T.H., Lee, K.S., Shin,
Avnir, D., Braun, S., Lev, O. & Ottolenghi, M. M.C. & Park, J.K. 2000. Sol-gel-derived thick-film
1994. Enzymes and other proteins entrapped in sol- conductometric biosensor for urea determination in
gel materials. Chem. Mater. 6: 1605-1614. serum. Anal. Chim. Acta 404: 195-203.
Bakker, E. & Simon, W. 1992. Selectivity of ion- Montalvo, J.G. Jr. & Guilbault, G.G. 1969.
sensitive bulk optodes. Anal. Chem. 64: 1805-1812. Sensitized cation selective electrode. Anal. Chem.
41: 1897-1899.
Blyth, D.J., Aylott, J.W., Moir, J.W.B., Richardson,
D.J. & Russell, D.A. 1999. Optical biosensing of Ogura, K., Nakaoka, N., Kobayashi, M. & Fuji, A.
nitric oxide using the metalloprotein cytochrome C. 1999. Thermogravimetry/mass spectrometry of
Analyst 124: 129-134. urease-immobilized sol-gel silica and the
application of such a urease-modified electrode to
Fidaleo, M. & Lavecchia, R. 2003. Kinetic study of the potentiometric determination of urea. Anal.
enzymatic urea hydrolysis in the pH range 4–9. Chim. Acta 384: 219-225.
Chem. Biochem. Eng. Q. 17(4): 311-318
Preininger, C. & Wolfbeis, O. S. 1996. Disposable
Gulcev, M.D., Goring, G.L.G., Rakic, M. & cuvette test with intergrated sensor layer for
Brennan, J.D. 2002. Reagentless pH-based enzymatic determination of heavy metals. Biosens.
biosensing using a fluorescently-labelled dextran Bioelectron. 11(10): 981-990.
co-entrapped with a hydrolytic enzyme in sol-gel
derived nanocomposite films. Anal. Chim. Acta 457: Tsai, H.C., Doong, R.A., Chiang, H.C. & Chen,
47-59. K.T. 2003. Sol-gel derived urease-based optical
biosensor for the rapid determination of heavy
Gupta, B.D. & Sharma, D.K. 1997. Evanescent metals. Anal. Chim. Acta 481: 75-84.
wave absorption based fiber optic pH sensor
Musalmah, M.1, Sue Mian, T.1, Isnida, I.1, Gapor, M.T.2 and Wan Ngah, W.Z.1
1
Department of Biochemistry,
Faculty of Medicine,
Universiti Kebangsaan Malaysia, Kuala Lumpur
2
Malaysian Palm Oil Board , Selangor, Malaysia.
Abstract
Premature aging and neurodegeneration are some of the clinical features associated with
Down syndrome. The syndrome results from inheriting 3 copies of chromosome 21 which is
the location of the gene encoding the enzyme Cu/Zn superoxide dismutase (SOD1). Over
expression of SOD1 leads to hydrogen peroxide (H2O2) accumulation and free radicals with
resultant damage to macromolecules. H2O2 also stimulates neuron cells to undergo apoptosis.
Thus in this project, we evaluated the possible protective effect of vitamin E subfamilies, α-
tocopherol (ATF) and γ-tocotrienol (GTT) in preventing DNA damage as well as its
neuroprotective effect. Blood samples were collected from 11 normal and 8 DS patients aged
1-7 years old. Analysis were made of the basal and G2 DNA damage in lymphocytes cultured
with and without 100 µM GTT. DNA damage was determined using the single cell gel
electrophoresis or known as the comet assay. DNA damage in G2 was determined in
lymphocyte cultures treated with 5mM caffeine, 2h before harvesting. Neuroprotective effects
of vitamin E subfamilies, ATF and GTT, were compared by determining cell viability and
apoptosis with and without vitamin E pretreatment against H2O2-induced damage in
astrocytes and neurons of rat primary cultures as well as in human neuroblastoma cell
line.Results showed that vitamin E treatment decreased basal and G2 DNA damage both in
control and DS lymphocytes. ATF and GTT offered neuroprotection by increasing cell
viability and decreased rate of apoptosis induced with H2O2 treatment in astrocytes, neurons
and neuroblastoma cell line. Thus in conclusion, vitamin E was found to offer protection
against DNA damage in DS lymphocytes and H2O2-induced apoptosis in CNS cells.
Abstrak
Studi biodiversitas merupakan studi awal yang diperlukan untuk mengetahui jenis jenis
mikroorganisme termofilik yang dimiliki daerah vulkanik Indonesia. Kawah Manuk dengan
kondisi lingkungan berupa suhu 65 – 90oC dan pH 2 – 3,3 merupakan salah satu habitat yang
khas bagi mikroorganisme termofilik Indonesia. Pada penelitian ini mikroorganisme dalam
sampel air Kawah Manuk yang mengandung 40% lumpur telah berhasil dikultivasi di media
Thermus. DNA kromosom dari kultur tersebut telah diisolasi dan fragmen gen 16s rRNA dari
organisme ini telah diamplifikasikan. Hasil PCR berupa polinukleotida berukuran 323 pb ini
akan digunakan untuk analisa filogenetik mikroorganisme termofilik Kawah Manuk.
Kata kunci: biodiversitas, mikroorganisme termofilik, kawah manuk.
mikroorganisme isolat kawah Manuk pada alkohol (25:24:1, vol/vol) dengan volume yang
media Thermus. sama. Ekstraksi ini dilakukan sebanyak 3 kali.
2. Percobaan DNA diendapkan dengan penambahan 805 µL
Sampel air panas. Sebanyak 2 liter air kawah etanol absolut dan 45 µL Na- asetat 3M, dan
disimpan dalam termos untuk menjaga suhunya disentrifugasi 12000 rpm selama 10 menit.
agar tidak banyak berubah. Sesampainya di DNA dicuci dengan 50 µL etanol 70% dalam
laboratorium, sampel sesegera mungkin 100mM tris. DNA diresuspensi ke dalam
difiltrasi dengan kertas saring untuk ddH2O steril.
memisahkan endapan lumpur. Filtrat yang Amplifikasi PCR. ‘Touchdown’ PCR
diperoleh kemudian difiltrasi lebih lanjut dilakukan dengan sepasang primer untuk gen
menggunakan filter 0,2µm dengan tujuan agar 16S rRNA bakteri yang salah satunya
mikroorganisme yang ada terkonsentrasi pada dilengkapi dengan GC-clamp sebanyak 40 basa
filter. Selanjutnya filter yang mengandung pada ujung 5’nya. Siklus suhu untuk PCR
mikroorganisme kawah Manuk dilarutkan adalah 1 menit denaturasi pada 94oC, 1 menit
dalam 5 mL aqua dm steril dan dipindahkan ke annealing (lihat dibawah), dan 3 menit
tabung mikro 1,5 mL. Sebanyak 250 µL perpanjangan rantai pada 72oC. Suhu annealing
suspensi mikroorganisme ini dikulturkan di diturunkan dari 53oC menjadi 43oC dalam 10
media Thermus, Atlas(1993). siklus dan diikuti dengan 20 siklus tambahan
Kultivasi. Kultivasi mikroorganisme dilakukan pada suhu 43oC. Ferris et al. (1996).
dengan 2 metoda. Metoda pertama adalah 3. Hasil dan pembahasan
menambahkan 5 mL air kawah masing masing Parameter fisik air kawah Manuk
ke 15 mL media Thermus yang steril. Kultur Pengambilan sampel dilakukan 2 kali, pada
kemudian diinkubasi dalam termos yang berisi bulan Juli dan Oktober 2004 di empat titik yang
air panas. Sesampainya di laboratorium kultur berbeda. Parameter fisik air kawah memiliki
dipindahkan ke inkubator dengan suhu 60oC. sedikit perbedaan antara sampel yang diambil
Setelah selang waktu 22 jam kultur di bulan Juli dengan sampel yang diambil di
dipindahkan ke inkubator suhu 70oC. Metoda bulan Oktober dikarenakan kandungan air pada
yang kedua adalah menggunakan sel yang Kawah Manuk meningkat pada bulan Oktober.
merupakan hasil filtrasi di filter 0,2µm dan pH air kawah berkisar 2 – 3,3. Suhu berkisar 65
dilarutkan dalam aqua dm steril. Sebanyak 250 - 90oC. Air kawah mengandung lumpur hitam
µL suspensi sel ini ditambahkan ke dalam 5 mL yang sangat pekat dengan kandungan tanah ±
media Thermus steril kemudian diinkubasi di 40%. Walaupun air Kawah Manuk memiliki
suhu 70oC. Kultur yang dihasilkan, dibuat suhu yang tinggi dan pH yang sangat rendah
menjadi pelet sel (disimpan di –20oC) yang namun kawah ini dikelilingi oleh tanaman yang
akan digunakan untuk keperluan isolasi DNA. cukup rapat. Hal ini menunjukkan adanya
kemungkinan senyawa organik yang dikandung
Lisis sel dan Isolasi DNA. Lisis sel dan isolasi
oleh air Kawah Manuk yang berfungsi sebagai
DNA kromosom dilakukan seperti yang
sumber karbon bagi mikroorganisme yang
digambarkan oleh Baker dengan sedikit
tumbuh di dalamnya.
modifikasi. Baker et al. (2001). Pellet sel
ditambahkan 400µL buffer lisis (Lysozym Tabel 1. Parameter fisik air Kawah Manuk yang
5mg/mL dalam tris-Cl 10 mM pH 8, proteinase diukur pada bulan Juli dan Oktober 2004
K 0,5 mg/mL, SDS 2%, Na-EDTA 100mM) Parameter Juli 2004 Oktober 2004
Fisik
dan diinkubasi di 37oC selama 1 jam
pH 2-3 3,3
dilanjutkan dengan inkubasi di 55oC selama 30
suhu 90 – 92oC 65 – 87oC
menit. Selanjutnya ke dalam campuran
Kultivasi mikroorganisme. Kultivasi
ditambahkan fenol-kloroform-isoamil alkohol
dilakukan dengan 2 metoda seperti yang
(25:24:1, vol/vol) dengan volume yang sama.
digambarkan pada bagian percobaan. Metoda
Ekstraksi DNA dilakukan dengan mengambil
pertama didasarkan pada prinsip media
fasa aqueous setelah sentrifugasi di 4000 rpm
pengayaan dimana ke dalam sampel air kawah
selama 10 menit dan dilanjutkan dengan
ditambahkan media Thermus yang
ekstraksi menggunakan kloroform-isoamil
mengandung bahan bahan yang merupakan
b
Dept. of Chemistry, Institut Teknologi Bandung Jl. Ganesha 10 Bandung, 40132, Indonesia
c
Faculty of Pharmacy, Meijo University, Tempaku, Nagoya 468-8503 Japan
d
Center for Medicinal Resources, Faculty of Pharmaceutical Sciences,
Chiba University,1-33 Yayoi-cho, Inage-ku, Chiba 263, Japan
Abstract
Eight oligostilbenoid compounds had been isolated from the ethyl acetate extract of the stem
bark of Shorea seminis (Dipterocarpaceae). These compounds were distributed to monomer,
dimmer, trimmer, and tetramer resveratrol. All of them are one monomer resveratrol,
resveratrol-12-C-glucopyranoside (1); three dimmers resveratrol, (-)-ampelopsin A (2),
laevifonol (3), diptoindonesin A (4); three trimmers resveratrol, (-)-α-viniferin (5),
Viniferol D (6), Pauciflorol B (7); and tetramers resveratrol, (-)-hopeaphenol (8). The
structures of these compounds were determined on the basis of spectroscopic evidence.
Key words: Diversity Oligostilbenoids, Shorea seminis, resveratrol-12-C-glucopyranoside,
(-)-ampelopsin A, laevifonol, diptoindonesin A, resveratrol, (-)-α-viniferin, Viniferol D,
Pauciflorol B, resveratrol, (-)-hopeaphenol
696
Departement of ChemistryProceeding
ITB, Jl. Ganesha th
10, Bandung 40132,Joint
PhoneSeminar
: +62 (22)on2502103 ext 101,
of The 6 ITB-UKM Chemistry
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Nanik Siti Aminah, Sjamsul Arifin Achmad , Masatake Niwa,Yana Maolana Syah, Mariko
Kitajima,Euis Holisotan Hakim
kromatografi radial (KR), berturut-turut selanjutnya dimurnikan dengan cara KKG
menggunakan silika gel Merck 60 GF254 (230 (eluen diklorometan-aseton = 9 : 1) dan
- 400 mesh), silika gel 60 (35 - 70 mesh), silika kromatografi radial (eluen n-heksan-kloroform-
gel 60 (200 mesh), dan silika gel 60 PF254 metanol = 4 : 6 : 1), menghasilkan (-)-α-
(dengan ketebalan plat 0,5, 1, dan 2 mm). viniferin (5) (325 mg) berupa serbuk berwarna
Analisis kromatografi lapis tipis (KLT) kuning muda.
dilakukan pada pelat alumunium berlapis Si gel
Fraksi utama kedua (B = 7,2 g) difraksinasi
Merck Kieselgel 60 GF254 0,25 mm. Sebagai
lebih lanjut dengan cara KCV (eluen campuran
pereaksi penampak noda pada analisis KLT
n-heksan-aseton = 3 : 1 sampai 1 : 1),
digunakan larutan serium sulfat dalam asam
menghasilkan empat fraksi gabungan masing-
sulfat encer. Pereaksi geser untuk analisis
masing seberat 0,4; 1,1; 3,0; dan 2,0 g.
spektrofotometer UV dilakukan menggunakan
Pemurnian lebih lanjut terhadap fraksi
larutan natrium hidroksida 2%.
gabungan kedua (B2 = 1,1 g) dengan berbagai
Bahan penelitian : cara kromatografi, yaitu KCV (eluen
Kulit batang Shorea seminis diperoleh dari diklorometan-aseton = 95 : 5 sampai 8 : 2),
kebun percobaan Darmaga, Bogor. Bogor, kromatografi radial (eluen n-heksan-kloroform-
Jawa Barat, pada bulan September 2000. metanol = 4 : 6 : 1), dan KKG (eluen n-heksan-
Identitas tumbuhan ditetapkan di Herbarium kloroform-metanol = 4 : 6 : 1), menghasilkan
Bogoriensis, Lembaga Ilmu Pengetahuan tambahan (-)-α-viniferin (5) (475 mg).
Indonesia (LIPI), Bogor, Indonesia, dan Pemurnian terhadap fraksi gabungan ketiga (B3
spesimen ketiga spesies tumbuhan tersebut = 3 g) dengan KCV (eluen diklorometan-aseton
disimpan di Jurusan Biologi, FMIPA, ITB. = 95 : 5 sampai 6 : 4), KKG (eluen kloroform-
Cara Kerja : metanol = 9 : 1), dan tiga kali KKT (berturut-
1. Penyediaan bahan penelitian turut menggunakan eluen n-heksan-aseton = 6 :
4, n-heksan-etil asetat = 5 : 4, dan
Sampel tanaman yang berupa kulit batang diklorometan-aseton = 8 : 2), menghasilkan (-)-
Senna multijuga dibersihkan dari pengotornya, ampelopsin A (3) (30 mg) berupa serbuk
kemudian dikeringkan di bawah sinar matahari. berwarna kuning muda. Selanjutnya fraksi
Setelah itu dipotong-potong dan dihaluskan gabungan keempat (B4 = 2 g) dimurnikan
hingga berbentuk serbuk. dengan beberapa cara kromatografi, yaitu KCV
2. Ekstraksi dan isolasi (eluen n-heksan-etil asetat = 4 : 6), KKT (tiga
kali pengerjaan dengan eluen diklorometan-
Serbuk kulit batang S. seminis sebanyak 8 kg aseton = 4 : 1, diklorometan-metanol = 94 : 6,
diekstraksi dengan metanol menggunakan dan kloroform-metanol = 92,5 : 7,5), dan
teknik maserasi tiga kali berturut-turut @ 24 dengan kolom shepadeks (eluen metanol)
jam menghasilkan 200 g ekstrak metanol. menghasilkan laevifonol (4) (40 mg) berupa
Selanjutnya ekstrak MeOH dipartisikan, serbuk berwarna putih.
berturut-turut ke dalam n-heksan,
diklorometan, dan etil asetat, sehingga Senyawa laevifonol (4) (100 mg) diperoleh
diperoleh 15 g ekstrak n-heksan, 8 g ekstrak pula dari hasil pemurnian fraksi utama ketiga
diklorometan, 60 g ekstrak etil asetat, dan 115 dengan menggunakan metoda pemurnian
g ekstrak metanol sisa. sebagaimana yang dilakukan terhadap
pemurnian fraksi gabungan keempat dari fraksi
Sebagian dari ekstrak etil asetat (18 g) utama kedua. Selain itu, pada pemurnian fraksi
difraksinasi dengan cara kromatografi cair gabungan keempat dari fraksi utama kedua dan
vakum (KCV) dengan eluen campuran fraksi utama ketiga diperoleh pula suatu
diklorometan-aseton = 1 : 0 sampai 1 : 1 dan padatan berwarna kuning muda yang
terakhir dicuci dengan metanol, menghasilkan dikristalkan dalam metanol-kloroform
empat fraksi utama masing-masing seberat 1,5; menghasilkan (-)-hopeafenol (8) (200 mg)
7,2; 3,6; dan 4,0 g. Fraksi utama pertama (A = sebagai serbuk berwarna kuning muda.
1,5 g) difraksinasi lebih lanjut dengan cara
KKG (eluen campuran n-heksan-etil asetat = 9 : Fraksi utama keempat (D = 4,0 g) dimurnikan
1 sampai 7 : 3) sehingga diperoleh empat fraksi dengan beberapa cara kromatografi, yaitu KCV
gabungan. Fraksi gabungan keempat (eluen campuran n-heksan-etil asetat = 9 : 1
HO
OH
glu
OH
(1)
HO OH OH
glu
H
O OH
OH
HO OH H
H
OH
H O
HO H
OH
OH
H OH HO O
H HO H O
O
OH H
O
(2) H O OH
HO HO
(3)
(4)
OH HO HO HO
H H OH
O OH O OH
OH
HO OH
H OH HO HO
HO H H
H H H
H H
H OH H H H
O OH H
O
H
H
HO OH
OH OH OH
OH
(6) OH
(5) HO OH
(7)
O O
H OH HO H
H H
H
HO OH
H
H H
OH HO
OH HO
(8)
H HO
O H OH
O OH HO HO O OH
H H
O OH HO
OH H H
HO H
H H OH H H
H
OH H H
HO OH
HO OH
OH OH OH viniferol D
OH
pauciflorol B
OH
Glu OH
HO
HO
OH
H
O OH
resveratrol-12C- OH
H
glukopiranosida HO
OH
H
HO
H OH
OH H O
HO O
HO O H OH
HO
ε-viniferin
O
H (-)-ampelopsin A
HO OH
O
OH HO
Glu
H
H O O OH
HO H
HO
H
HO
laevifonol OH
OH
OH diptoindonesin A OH
HO
H OH
HO HO OH
H H
O OH H
H HO O
H
O
O HO OH
H H H
H H H H
OH
OH OH
(-)-α-viniferin
OH
OH (-)-hopeafenol OH
Gambar 2. Hubungan biogenesis senyawa hasil isolasi dari kulit batang S. seminis
Ekstraksi Cu2+ Dalam Larutan Nacl Menggunakan Teknik Membran Cair Emulsi
Sistem Aliran Semikontinu
Nikmans Hattu1)
Abstrak
Ekstraksi semikontinu ion logam Cu2+ dalam larutan NaCl 6000 ppm dengan membran cair
emulsi telah dilakukan menggunakan alat mixer-settler. Membran cair emulsi yang digunakan
dibuat dengan melarutkan asam di-(2-etilheksil) fosfat (D2EHPA) sebagai senyawa pembawa
dalam kerosen. Kondisi optimum pemisahan yang diperoleh yakni perbandingan kecepatan
alir fasa emulsi dan fasa eksternal 1:4 dan waktu keadaan tunak dimulai pada menit ke-10.
Tingkat pemisahan ion logam Cu2+ dalam larutan NaCl 6000 ppm pada kondisi optimum
adalah 65,48% untuk pengukuran pada fasa internal selama 10 menit pertama dan rata-rata
70,04% untuk pengukuran dalam rafinat setiap interval waktu 10 menit. Hasil ekstraksi
dengan sistem semikontinu untuk prekonsentrasi menggunakan zat pembawa D2EHPA 6%
dan pengemulsi sorbitan monooleat (span-80) 4%, didapatkan kenaikan konsentrasi ion
logam Cu2+ rata-rata dalam fasa internal sebesar 0,775 ppm/10 menit dan faktor
prekonsentrasi ion logam Cu2+ dalam larutan NaCl diperoleh 2,05 setelah 100 menit proses
ekstraksi berlangsung. Hasil penelitian menunjukkan membran cair emulsi dengan zat
pembawa D2EHPA dan pengemulsi sorbitan monooleat mempunya kinerja yang cukup baik
pada sistem semikontinu, walaupun untuk tujuan prekonsentrasi dengan waktu ekstraksi yang
relatif lama, faktor kestabilan emulsi perlu diperhatikan.
Pengaruh pengerjaan kitosan dan asam sitrat pada kain kapas terhadap sifat fisik
kain
Noerati
Abstrak
Kapas saat ini masih merupakan salah satu serat yang terpenting karena mempunyai absorbsi
yang tinggi sehingga nyaman dipakai. Salah satu kelemahan serat kapas adalah ketahanan
kusut yang rendah. Esterifikasi kapas dengan asam sitrat dapat meningkatkan ketahanan
kusut kapas tetapi menurunkan absorbsi bahan kapas. Penelitian ini bermaksud mengatasi
menurunnya absorbsi kapas akibat proses esterifikasi dengan melakukan pengerjaan
pendahuluan(pretreatment) sebelum proses esterifikasi. Pengerjaan pendahuluan yang
dilakukan adalah proses rendam peras kain kapas dengan larutan kitosan dengan konsentrasi
0,5 g/L sampai 3 g/L dengan selang 0,5. Selanjutnya proses esterifikasi dilakukan dengan
mengerjakan kain kapas dengan asam sitrat dan katalis natrium hipoposfit pada suhu 170 o
C dan waktu pemanas awetan 60 detik. Dari hasil percobaan dilakukan pengujian kekuatan
tarik, ketahanan kusut dan daya serap terhadap zat warna reaktif. Pengujian dilakukan
dengan membandingkan kain hasil proses pretreatment yang diikuti dengan esterifikasi
dengan kain standard dan kain hasil proses pretreatment tanpa diikuti proses esterifikasi.
Hasil pengujian menunjukkan bahwa semakin tinggi konsentrasi kitosan daya serap terhadap
zat warna reaktif semakin tinggi. Pada proses yang diikuti dengan esterifikasi menghasilkan
kain dengan ketahanan kusut kekuatan tarik kain dan ketahanan luntur zat warna yang lebih
baik daripada kain yang tidak dilakukan esterifikasi. Penggunaan kitosan dengan 2,5 g/L
menghasilkan kain dengan daya absorbsi mendekati kain standard dan ketahanan kusut serta
kekuatan yang lebih baik dari kain standard.Kondisi optimum ditetapkan pada penggunaan
kitosan 2,5 g/L.
Kata kunci ; Kitosan, asam sitrat,esterifikasi,tahan kusut,absorbsi
dan ketahanan luntur warna. Untuk memastikan menurut standar SII menunjukan sifat
terbentuknya reaksi esterifikasi dilakukan ketahanan kusut yang cukup baik. Peningkatan
penentuan struktur dengan spektroskopi Infra nilai ketahanan kusut ini kemungkinan
merah. disebabkan adanya ikatan silang yang terbentuk
antara selulosa oleh asam sitrat. Hal ini dapat
3. Hasil Dan Pembahasan
dibuktikan dengan pengujian menggunakan
Ketahanan kusut kain
spektroskopi Infra Merah. Kenaikkan
Untuk mengetahui ketahanan kusut kain
konsentrasi kitosan ternyata tidak terlalu
dilakukan pengujian sudut kembali dari lipatan
berpengaruh terhadap kenaikan nilai sudut
sesuai dengan SII No 0122-75 yang disajikan
kembali dari lipatan.Hal ini dapat dilihat dari
gambar 2
perbedaan nilai sudut kembali dari lipatan yang
Sudut Kembali dari Lipatan (o)
125
120
115
110
Pembanding
105
100
95
90
0 0.5 1 1.5 2 2.5 3
Konsentrasi Kitosan (g/L)
Keterangan :Pembanding :Kain standar : kain tanpa perlakuan (blanko ) Sudut Kembali = 95 o
Kain 1 : kain mengalami perlakuan pre-treatment kitosan 3 g/L, tanpa esterifikasi sudut kembali = 98 o
Gambar 2
Keterangan : I = Spektrum IR kain hasil pengerjaan kitosan tanpa esterifikasi dengan asam sitrat
II = Spektrum IR kain hasil penegrjaan kitosan dilanjutkan dengan proses esterifikasi dengan asam asetat
Gambar 3
Spektrum IR dari kain yang mengalami rantai molekul selulosa membentuk gugus
pretreatmen dengan kitosan saja menunjukkan aldehid atau karboksilat, jika berlanjut akan
adanya serapan karbonil amida terjadi pada menyebabkan penurunan kekuatan , kendatipun
bilangan gelombang 1639. Pada spektrum demikian jika pengontrolan suhu dan waktu
tersebut tidak terlihat adanya serapan karbonil pengerjaan dikombinasikan dengan baik
dari ester. Pada spectrum IR kain yang kerusakan serat akan dapat dihindari (3 ).
mengalami pretreatment dengan kitosan
Pada pengujian kekuatan tarik kain yang
kemudian diikuti pengerjaan dengan asam sitrat
dilakukan sesuai dengan SII no 0106-75 tidak
muncul adanya serapan karbonil dari ester pada
terdapat perubahan kekuatan tarik kain yang
bilangan gelombang 1701, dan 1234. Dari data
berarti karena adanya proses perlakuan kitosan
spectrum tersebut dapat dibuktikan adanya
maupun esterifikasi. Pada proses pengerjaan
reaksi esterifikasi pada kain yang mengalami
dengan kitosan tanpa esterifikasi terdapat
pretreatmen dengan kitosan dan dilanjutkan
penurunan kekuatan tarik kain, hal ini
dengan pengerjaan asam sitrat.
disebabkan perlakuan panas yang dialami kain
Dengan terbentuknya ikatan ester antara gugus kapas pada saat proses pengerjaan dengan
karboksilat dengan gugus hidroksil akan kitosan.Hasil Pengujian kekuatan tarik
terbentuk ikatan silang diantara molekul disajikan pada gambar 4 berikut .
selulosa dan kitosan sehingga mampu
Pada proses pengerjaan kitosan yang diikuti
mempertahankan posisi ikatan ketika dikenai
dengan esterifikasi terdapat kenaikan kekuatan
gaya deformasi( misalnya lipatan ) sehingga
tarik kain. Hal ini menunjukkan bahwa
ketika gaya dihilangkan akan kembali kebentuk
meskipun terjadi penurunan kekuatan akibat
semula atau dikatakan tahan kusut.
pengerjaan panas pada bahan kapas, tetapi
Kekuatan Tarik kain dengan adanya ikatan silang akan mengurangi
Suhu yang terlalu tinggi memungkinkan efek penurunan kekuatan tersebut, sehingga
terjadinya kerusakan serat dengan terbukanya
16.40
16.20 Pembanding
16.10
16.00
0 0.5 1 1.5 2 2.5 3
Konsentrasi Kitosan (g/L)
Keterangan : Pembanding Kain standar : kain tanpa perlakuan (blanko ) Kekuatan Tarik 16,25 Kg
Kain 1 : kain dengan perlakuan pre-treatment kitosan 3 g/L, tanpa esterifikasi, Kekuatan Tarik = 16,15 Kg
Gambar 4
5.00
Reflektansi (%)
4.50
4.00 Pembanding
3.50
3.00
0 0.5 1 1.5 2 2.5 3
Konsentrasi Kitosan (g/L)
penurunan kekuatan dari kain standar relatif menunjukkan % R yang lebih kecil dari kain
kecil. standar, hal ini menunjukkan ketuaan warna
yang lebih besar. Kain yang tidak mengalami
Ketuaan warna hasil celupan
pengerjaan dengan kitosan tetapi langsung
Pada hasil proses esterifikasi dilakukan proses
mengalami pengerjaan dengan asam sitrat
pencelupan dengan menggunakan zat warna
ketika dicelup menghasilkan reflektansi yang
reaktif. Pengukuran ketuaan warna hasil
lebih besar dari kain standar, artinya warna
pencelupan ditunjukkan dengan nilai persen
lebih muda dari kain standar, hal ini disebabkan
reflektansi yang diukur pada panjang
adanya ikatan silang antara rantai selulosa
gelombang maksimal 620 nm. Hasil pengujian
menyebabkan absorbsi yang relatif lebih rendah
disajikan pada gambar 5.
sehingga menghasilkan warna celupan yang
Hasil pengukuran ketuaan warna menunjukkan relatif lebih muda.. Kain yang mengalami
adanya perbedaan antara kain standar dengan pengerjaan dengan kitosan dan dilanjutkan
kain yang mengalami pengerjaan kitosan. Kain dengan esterifikasi menunjukkan perubahan
yang mengalami pengerjaan kitosan tanpa nilai reflektansi.
diikuti pengerjaan dengan asam sitrat
kethanan luntur terhadap pencucian yang lebih dapat sedikit menaikkan kekuatan tarik
baik daripada kain yang mengalami pengerjaan kain, sedangkan pengerjaan kitosan
kitosan tanpa diikuti pengerjaan dengan asam tanpa diikuti pengerjaan asam sitrat
sitrat seperti yang disajikan pada table 1 Hal ini terjadi penurunan kekuatan tarik kain.
menunjukkan bahwa pada pengerjaan kain
Pengerjaan Kapas dengan Kitosan yang
dengan kitosan dapat menaikkan ketuaan warna
diikuti dengan pengerjaan asam sitrat
kain. Kondisi ini disebabkan kitosan yang
dapat menaikkan menaikkan ketuaan
menempel pada permukaan serat kapas tidak
warna, sedangkan pengerjaan kitosan
mempunyai ikatan kimia dengan kain kapas,
tanpa diikuti pengerjaan asam sitrat
tetapi hanya ikatan fisik yang mudah lepas
terjadi peningkatan ketuaan warna tetapi
kembali, sehingga pada saat proses pencucian
mempunyai ketahanan luntur relatif
zat warna yang terikat oleh kitosan akan
rendah
4. Kesimpulan
Kondisi Optimum Pengerjaan adalah
Pengerjaan kapas dengan asam sitrat
pada konsentrasi kitosan 2,5 g/L
dapat menaikkan ketahanan kusut kain,
tetapi menurunkan absorbsi terhadap zat 5. Daftar Pustaka
warna. 1. Andrew,etal. Fabric Whitness Retention in
Durable Press Finishing with Citric Acid
Pengerjaan Kapas dengan Kitosan yang Textile Chemist and Colourist, 1993
diikuti dengan pengerjaan asam sitrat
2. Andri M Azis, Noerati Pengaruh esterifikasi
dapat menaikkan ketahanan kusut kain,
kain kapas dengan asam sitrat terhadap sifat
sedangkan pengerjaan kitosan tanpa fisik kain. Laporan penelitian tugas akhir
diikuti pengerjaan asam sitrat STTT 1997
Crystallography in Japan
Nobuo Tanaka
Abstrak
There are a lot of crystallographers in Japan, who have studied in the physics, mineralogy,
chemistry, biochemistry, and molecular biology including proteins and nucleic acids.
Especially, many biologically reports have been submitted in the structural journals.
In the laboratory, the X-ray is generated with the target made of metal by the collision of the
high energy electrons accelerated with the high tension. In Japan, a rotating anode generator
is quite popular, which is a quite powerful device in the laboratory. By rotating the target at
high speed, it is designed so that the thermal load may be made to disperse in the whole
surface of the target. We use the machine which is operated at 6kW with the focus size of
0.3x0.8mm2.
The other progress on the X-ray diffraction is the development of the area detector which
installs either CCD or IP. It is quite useful to gather many diffractions quite quickly,
especially from protein crystals. If you operate it skillfully, you will get a lot of diffractions
until the high resolution in a day.
Strong and brilliant X-ray in Japan is obtained with SRs which were constructed at Tsukuba
and Hyougo, respectively. When the electrons are accelerated to around velocity of light,
they radiate lights whose wavelength is distributed from x-ray to ultraviolet ray, depending on
the added tension. Although the light must be monochromatic by mirror and crystals prior to
the experiment, it becomes quite easy and automatic to get the necessary beam with the
skillful computer program. The machine is quite expensive and two Institutes can be operated
in Japan. To use the instrument in each institute, we have to submit the proposal to each
Institute. Each review committee is discussed whether the proposal is accepted. If accepted,
the schedule on the machine time is fixed to prepare the sample.
Protein crystallography is one of the most active research field in Japan, because the
government put much money for structural and genomic project. It is a goal of Japan to
decide the structure of 3000 proteins until 2007. Crystallographers promote this project in
cooperation with many researchers in the filed of biochemistry and molecular biology. Apart
from the popular hydrophilic proteins, some structures of membrane proteins like cytochrome
oxidase have been solved. The disease related proteins are also important target to elucidate
the relation between the structure and function of the protein. The research, however,
advances quite slowly, because the disease related proteins are very difficult to purify for
crystallization. Our recent structure of the protease from Norvirus is one of exciting result in
this field.
Some researchers in the chemistry and protein crystallography are interesting about the
dynamical structure of molecules. I hope that the molecule can be drawn from the process of
the chemical reactions.
Abstrak
Sinamoil klorida dan sinamoil isotiosianat mudah mengalami hidrolisis menghasilkan asid
sinamoilkarboksilat dan ammonium sinamoilkarboksilat . Dalam keadaan terkawal tindak
balas dengan morfolinetiltiourea dapat menghasilkan1-(2-morfolin-4-il-etil)-3-(3-fenil-
akriloil)-tiourea [1]. Ia mempunyai sistem hablur triklinik dengan kumpulan ruang P-1,
a=6.1452(14), b=9.731(2) dan c=14.690(3)Å, α= 98.71(1), β = 93.97(1) ,γ= 104.44(1)°, V=
835.6(3) Å3 dan Z=2. Molekul sebatian ini mempunyai tiga ikatan hidrogen intramolekul dan
dalam struktur hablur terdapat dua ikatan hidrogen intermolekul, C-H…O dan N-H…O yang
mencantumkan molekul menjadi susunan rantaian satu-dimensi [1]. Tindak balas dengan
analin pula menghasilkan sebatian heterosiklik, 3-dimetil-5-metil-6-fenil-2,5-dihidro-
pirimidin-2-tion [2]. Struktur siklik dan kehilangan kumpulan karbonil tidak membenarkan
pembentukan ikatan intrahidrogen. Namun demikian dalam struktur hablur, ikatan hidrogen
intermolekul mencantumkan dua molekul menbentuk dimer dan tersusun selari dengan
permukaan bc. Mekanisme tindak balas sudah pasti berbeza kerana melibatkan pengsiklikan
akan juga dibincangkan
Norela Sulaiman1, Mohd Rozali Othman2, Maimon Abdullah1, Salmijah Surif1 dan Wong
Pick Foon1
Abstrak
Kajian ini dijalankan bagi mengetahui komposisi zarahan termendap yang terdapat dalam air
hujan yang dikutip dari sekitar kawasan perindustrian kecil Balakong, Selangor, Malaysia.
Sebanyak lima stesen persampelan telah dipilih di sekitar kawasan perindustrian ini.
Persampelan zarahan termendap dilakukan berdasarkan kaedah piawai yang telah
disarankan oleh Jabatan Alam Sekitar, Malaysia. Kajian zarahan termendap melibatkan
kepekatan pepejal terlarut dan pepejal tidak terlarut, anion (nitrat, sulfat, klorida, ), kation
(kalium, magnesium, natrium, kalsium dan ammonium) dan juga unsur-unsur surih seperti
plumbum, kadmium, ferum, kalsium, kalium, kromium, magnesium, kobalt dan mangan. Selain
itu, kepekatan abu dan nilai pH juga disukat. Purata kepekatan jumlah zarahan termendap
didapati tinggi (380.45 ± 44.44 mgm-2hari-1) dan telah melebihi nilai yang disarankan oleh
Jabatan Alam Sekitar Malaysia (133 mgm-2hari-1). Bagi logam-logam surih, purata
kepekatannya dalam air hujan sepanjang tempoh persampelan adalah 0.04 ± 0.01 (kadmium),
0.49 ± 0.02 (mangan), 1.33 ± 0.08 (kobalt), 2.83 ± 0.09 (plumblum) dan 0.56 ± 0.03 (ferum).
Nilai purata kepekatan logam-logam surih dalam abu ialah 1.87 ± 0.31 (kalium), 0.50 ± 0.04
(magnesium), 0.81 ± 0.10 (kalsium), 0.02 ± 0.01 (kadmium), 0.30 ± 0.05 (mangan), 0.50 ±
0.10 (kobalt), 1.79 ± 0.17 (plumblum) dan 3.18 ± 0.68 (ferum). Selain itu, hujan berasid
didapati berlaku di kawasan perindustrian kecil Balakong ini kerana nilai purata pH (3.78 ±
0.63) sepanjang tempoh persampelan di kawasan ini adalah lebih rendah daripada pH air
hujan yang normal (5.6).
Kesan Penambahan Karbon Hitam ke Atas Sifat Mekanik dan Morfologi Adunan
Getah Asli / Polistirena
Abstrak
Kesan penambahan pengisi karbon hitam (CB) ke atas sifat mekanik dan morfologi adunan
getah asli polistirena (NR/PS) telah dikaji. Adunan NR/PS/CB disediakan dengan kaedah
adunan leburan menggunakan mesin pengadun dalaman. Dua komposisi adunan telah
disediakan iaitu 60/40 dan 40/60 menggunakan 0.5 phr dikumil peroksida (DCP) sebagai
agen taut silang dan 5% LNR sebagai pengserasi. Sifat adunan dinilai melalui ujian
regangan, hentaman, kekerasan, pembengkakan, peratus getah terjerap, kajian morfologi dan
analisis terma mekanik dinamik. Kajian mendapati, bagi kedua-dua komposisi NR/PS,
kekuatan regangan, modulus Young dan kekerasan adunan meningkat dengan pertambahan
kandungan pengisi karbon hitam (CB). Peningkatan sifat mekanik ini menunjukkan wujud
interaksi yang kuat di antara matriks dan pengisi. Terikan putus dan kekuatan hentaman bagi
adunan NR/PS 60/40 berkurang dengan penambahan CB tetapi meningkat bagi adunan
40/60. Adunan NR/PS adalah tidak serasi terutama bagi adunan yang kaya dengan plastik.
Penambahan CB ke dalam adunan dapat meningkatkan keserasian adunan dan seterusnya
memperbaiki sifat-sifat mekanik dan morfologi adunan. Morfologi yang lebih halus dan
seragam dapat diperhatikan bagi kedua-dua komposisi adunan apabila CB ditambah.
Kandungan getah terjerap meningkat bagi kedua-dua komposisi adunan manakala indeks
pembengkakan pula berkurang. Analisis terma mekanik dinamik memberikan dua puncak
redaman (tan δ) pada julat -47oC - -39oC mewakili suhu peralihan kaca (Tg) fasa NR, dan
112oC - 118oC mewakili Tg fasa PS.
Abstrak
[4](1)(1,4-dimetil-2,3-diazabuta-1,3-diena)ferosenofan (2) mempunyai sistem hablur
monoklinik dengan kumpulan ruang P21/c, a=10.4863(10) Å, b=7.7514(8) Å, c=12.8153(13)
Å dan β=108.409(2)°. Analog yang lebih mudah [4](1)(2,3-diazabuta-1,3-diena)ferosenofan
(3) juga mempunyai sistem monoklinik dengan kumpulan ruang P21/c, a=7.5844(11) Å, b=
10.0804(14) Å, c=12.1698(16) Å dan β =105.727(3)°. Kedua-dua sebatian ferosenofan
tersebut bersifat diskret dan sentrosimetri pada pertengahan ikatan N-N. Gelang
siklopentadienil bagi kedua-dua kumpulan ferosena di dalam molekul tersebut berkonformasi
gerhana dan terletak pada kedudukan trans antara satu sama lain. Kajian siklik voltametri
(CV) kedua-dua ferosenofan dan terbitan ferosena iaitu FeC12H12O (1), FeC12H11OCl (4),
FeC17H16 (5), FeC16H13O2N (6) dan FeC16H14 (7) mempunyai nilai keupayaan pengoksidaan
E1/2 yang meningkat mengikut jujukan Fc < (5) < (7) < (2) < (6) < (1) < (3) < FeC11H10O
dan seterusnya menunjukkan kesan gantian penarik dan penderma elektron yang terikat pada
gelang siklopentadienil(Cp) ferosena. Kesemua terbitan tersebut memberikan
siklovoltamogram yang baik. Kajian terhadap sebatian (5), (6) dan (7) dalam sistem
biosensor yang mengandungi enzim GOD memberikan rangsangan arus yang positif. Walau
bagaimanapun, rangsangan arus tidak dikesan dalam kehadiran glukosa terhadap
keupayaan yang diberikan. Sebaliknya ferosena tanpa kumpulan gantian memberikan
rangsangan arus. Ketidakrangsangan ini perlu dikaji dengan mendalam dari segi
kemungkinan interaksi sampingan dengan kehadiran enzim dan glukosa atau ketidaksesuaian
monomer HEMA bagi sistem matriks terbitan ferosena semasa pembentukan filem. Masalah
ini merupakan satu peluang kajian lanjutan yang lebih mendalam.
Kata kunci : ferosenofan, biosensor
1CH3 Fe
6 7 7 6 7
3 C N Fe
O 6 2 N C
2 3 2
5 3 5 N N
C C C
4 5 4 CH3 4
Fe Fe Fe
1 CH 3 H H
JADUAL 1 Mikroanalisis unsur dan ciri-ciri fizikal terbitan ferosena (1) hingga (7)
Sebatian Formula Warna Peratusan Takat Mikroanalisis Unsur:
Molekul Sebatian Hasil Lebur Eksperimen (Kiraan) (%)
(%) (°C) C H N
(1) FeC12H12O Jingga 47.0 82-84 64.22 5.20 -
(63.20) (5.30)
(2) Fe2C24H24N2 Jingga 42.0 216- 63.82 5.93 6.05
gelap 217 (63.75) (5.35) (6.20)
(3) Fe2C22H20N2 Jingga 40.0 213- 61.60 4.60 6.22
gelap 216 (62.31) (4.75) (6.61)
(4) FeC12H11OCl Jingga 32.2 91-93 55.53 4.06 -
(55.20) (4.13)
(5) FeC17H16 Jingga 37.0 - 72.21 5.40 -
(73.94) (5.84)
(6) FeC16H13O2N Jingga 42.0 - 61.89 4.19 4.43
gelap (62.57) (4.27) (4.56)
(7) FeC16H14 Jingga 51.0 - 72.89 5.20 -
(73.31) (5.38)
Ferosena - - - -
(1) - - - 1373m
1456m
(2) 1598s 895m - 1359m
(3) 1628s - - -
(4) - - 1452m -
1239m
(5) - 1525m - -
1451m
1451m
(6) - 1600m - -
1496m
(7) - 1597m - -
1450m
s=tajam, m=medium
Kehadiran kumpulan nitro (6) dibuktikan Spektrum resonan magnetik nukleus (RMN) 1H
dengan puncak tajam pada panjang gelombang (I) hingga (7) (Jadual 3) menunjukkan
1342 and 1524 cm-1 masing-masing kehadiran isyarat seperti triplet asimetri pada
mempunyai regangan simetri dan asimetri anjakan kimia, δ 4.30-4.90 ppm untuk Hα dan
kumpulan N-O. Hβ. Walau bagaimanapun, puncak ini
JADUAL 3 Anjakan kimia 1H dan 13C terbitan ferosena (1) hingga (7) dalam CDCl3
Kedudukan struktur atau kumpulan
Sebatian/ 1 2 3 4,7 5,6 2’ 3’ 4’ 5’ 6’ 7’ Cp
nukleus
1 H 2.40s - - 4.78dd 4.51dd - - - - - - 4.21s
C 27.43 202.30 79.11 67.77 72.23 - - - - - - 69.74
2 H 2.39s - - 4.77dd 4.50dd - - - - - - 4.18s
C 29.68 161.64 73.17 69.52 71.17 - - - - - - 69.64
3 H - 8.49s - 4.71dd 4.46dd - - - - - - 4.25s
C - 161.27 77.99 68.64 70.93 - - - - - - 69.34
4 H 4.43s - - 4.85dd 4.61dd - - - - - - 4.26s
C 46.01 195.31 75.92 69.55 73.05 - - - - - - 70.17
5 H 2.34s - - 4.62dd 4.29dd - 7.12d 7.38d - 7.38d 7.12d 4.05s
C 21.14 - 85.79 66.34 68.63 135.50 129.00 126.10 136.00 126.10 129.00 69.52
6 H - - - 4.73dd 4.43dd - 8.03d 7.45t 7.78d - 8.29s 4.07s
C - - 82.46 66.79 69.87 149.03 120.49 129.22 131.66 142.13 120.38 69.81
7 H - - - 4.64dd 4.31dd - - - - - - 4.04s
C - - 85.46 66.50 68.86 125.90 128.29 126.13 139.21 126.13 128.29 69.57
(a) (b)
(c) (d)
JADUAL 4 Data elektrokimia terbitan ferosena (1) hingga (7) (V melawan Ag/AgCl)
Sebatian Epa Epc E1/2 a ∆Ep b ipa ipc ipa/ ipcc
(V) (V) (V) (mV) (x 10-7 A) (x 10-7 A)
(5) 0.38 0.30 0.34 80 7.00 10.00 0.7
(6) 0.51 0.38 0.45 130 4.00 3.00 1.3
(7) 0.39 0.30 0.35 90 6.25 6.10 1.0
JADUAL 5 Data elektrokimia elektrod fotopolimer terpegun terbitan ferosena Fc/HEMA (5)
hingga (7) (V melawan Ag/AgCl)
Sebatian Epa Epc E1/2 a ∆Ep b ipa ipc ipa/ ipcc
-5 -5
(V) (V) (V) (mV) (x 10 A) (x 10 A)
Ferosena 0.43 0.34 0.39 90 2.00 2.00 1.0
FeC11H10O 0.76 0.66 0.71 100 4.50 3.84 1.2
(1) 0.72 0.62 0.67 100 2.25 1.96 1.1
(2) 0.60 0.44 0.52 160 4.50 3.50 1.3
(3) 0.77 0.63 0.70 140 3.50 2.50 1.2
(5) 0.47 0.39 0.43 80 5.62 4.23 1.3
(6) 0.60 0.47 0.54 130 4.55 3.45 1.3
(7) 0.51 0.37 0.44 140 4.95 3.50 1.4
enzim GOD memberikan rangsangan arus yang larutan asetonitril dan jujukan nilai E½ adalah
positif serta mempunyai siklovoltamogram seperti berikut : Fc < (5) < (7) < (2) < (6) < (1)
yang baik (Jadual 5). Walau bagaimanapun, < (3) < FeC11H10O. Walau bagaimanapun,
rangsangan arus tidak dikesan dalam kehadiran dalam kajian biosensor, ferosenofan (2) dan (3)
glukosa terhadap keupayaan yang diberikan. yang mempunyai jambatan molekul terdiri
Sebaliknya ferosena tanpa kumpulan gantian daripada kumpulan konjugat azometina, C=N-
memberikan rangsangan arus. N=C yang diharap dapat mempertingkatkan
Ketidakrangsangam ini perlu dikaji dengan konduktiviti perpindahan elektron dalam proses
mendalam daripada segi kemungkinan interaksi redoks tidak dapat menunjukkan hasil yang
sampingan dalam kehadiran enzim dan glukosa memuaskan.
atau ketidaksesuaian monomer HEMA bagi
5. Ucapan Terimakasih
sistem matriks terbitan ferosena semasa
Penyelidikan ini dijalankan di bawah
pembentukan filem.
peruntukan IRPA 09-02-02-0163 Universiti
4.Kesimpulan Kebangsaan Malaysia dan biasiswa National
Tujuh sebatian terbitan ferosena iaitu Science Felllowship (NSF) Kementerian Sains
FeC12H12O (1), Fe2C24H24N2 (2), Fe2C22H20N2 dan Inovasi (MOSTI), Malaysia.
(3), FeC12H11OCl (4), FeC17H16 (5),
6. Daftar Pustaka
FeC16H13O2N (6) dan FeC16H14 (7) telah Watanabe, J., Hisatome, M. & Yamakawa, K. 1987.
berjaya disintesis. Struktur semua sebatian Synthesis of [4][34](1,2,3,4,5) ferrocenophane.
tersebut disokong oleh data mikroanalisis unsur Tetrahedron Lett. 28 (13) : 1427-1430.
dan spektroskopi inframerah dan resonan
Bu, H-Z,. Mikkelsen, S.R. & English, A.M. 1995.
magnet nukleus. Empat daripada terbitan
Characterization of a ferrocene-containing
ferosena tersebut telah diperolehi sebagai polyacrylamide-based redox gel for biosensor use.
hablur iaitu sebatian (1), (2), (3) dan (4). Anal. Chem. 67 : 4071-4076.
Melalui kajian siklik voltametri, siklik
voltamogram (CV) yang baik telah Heo, R.W. & Lee, T.R. 1999. Review :
diperolehi bagi semua terbitan ferosena dalam ferrocenophane with all carbon bridges. J.
Organomet. Chem. 578 : 31-42.
Abstrak
Kajian kimia ke atas bahagian batang Acronychia pedunculata telah dijalankan. Pelbagai
kaedah pemisahan telah dilakukan ke atas ekstrak metanol batang dan berjaya mengasingkan
satu sebatian dipiranoasetofenon iaitu o-metiloktandrenolona. Struktur o-
metiloktandrenolona di cirikan berdasarkan data analisis spektrum Resonans Magnet
Nukleus (RMN). Berdasarkan data literatur, o-metiloktandrenolona merupakan sebatian yang
pertama kali diasingkan daripada Acronychia pedunculata.
Kata kunci: o-metiloktandrenolona, dipiranoasetofenon, Acronychia pedunculata, Rutaceae
720
th
Departement of Chemistry ITB, Jl. Ganesha
Proceeding 10,6Bandung
of The 40132,
ITB-UKM Phone
Joint : +62 (22)
Seminar on2502103 ext 101,
Chemistry
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Noor Hapeedah M. A, Jalifah L., Yana M. S., Euis H. H.
Pengekstrakkan dan pemisahan dan δ 6.61 (H-4”) serta pada δ 5.55 (H-3”’) dan
Batang Acronychia pedunculata telah δ 6.51 (H-4”’) dengan pemalar penggandingan
diperolehi daripada kawasan Hutan Simpan, masing-masing adalah 9.9 Hz merupakan
Taman Negeri Endau-Rompin, Pahang dan isyarat bagi dua pasang proton olefinik yang
spesimen baucer (SK217/02) disimpan di terdapat dalam dua gelang piran. Isyarat singlet
herbarium UPM, Malaysia. Setelah kering, pada δ 3.75 merupakan isyarat bagi proton
serbuk batang diekstrak dengan peralatan soxlet metoksi manakala satu isyarat singlet pada δ
dalam pelarut petroleum eter, etil asetat dan 2.51 dicirikan sebagai proton metil yang
metanol. Seterusnya ekstrak mentah metanol berikatan dengan atom atau kumpulan
(2.96g) dipisahkan dengan kromatografi cecair elektronegatif menyebabkannya teranjak ke
vakum (KCV) dengan pelarut n-heksana medan rendah. Isyarat selebihnya merupakan
sebagai pengelusi yang ditingkatkan dua pada δ 1.43 dan δ 1.44 yang merupakan
kekutubannya dengan penambahan pelarut etil isyarat bagi dua kumpulan dimetil geminal
asetat dan diakhiri dengan metanol bagi pada dua gelang piran yang berbeza.
memperolehi 6 fraksi gabungan (KG1-KG6).
Penulenan awal fraksi KG4 (0.218 g) dilakukan Spektrum RMN 13C menunjukkan isyarat yang
dengan kaedah pemendapan sejuk dan larutan bersesuaian dengan sebatian
yang diperolehi dituras. Hasil turasan yang dipiranoasetofenon. Isyarat bagi empat karbon
dipekatkan seterusnya ditulenkan dengan metina diberikan oleh puncak pada δ 127.9 (C-
kromatotron menggunakan campuran pelarut n- 3”), δ 116.4 (C-4”), δ 127.9 (C-3”’) dan δ
heksana:etil asetat sebagai pengelusi bagi 116.9 (C-4”’) manakala puncak pada δ 63.8
memperolehi sebatian o-metiloktandrenolona merupakan isyarat bagi karbon metoksi
(0.007 g). aromatik. Sementara itu, dua puncak pada δ
O-metiloktandrenolona, Pepejal amarfus 32.8 (CH3CO) dan δ 201.2 (C=O)
kuning. UL (MeOH) λmak : 212, 263, 264, 318 membuktikan kehadiran kumpulan metil keton
atau asetil. Dua isyarat tajam di medan tinggi
nm, IM νmaks : 2934, 2833, 1635, 1637, 1506
cm-1. MS: m/z = 314 [M]+, C19H22O4, 299, 281, pada δ 28.2 dan δ 28.1 merupakan isyarat
karbon bagi kumpulan dimetil geminal ( C-5”,
269, 251. RMN 1H (CDCl3, 400 MHz) : δ 5.53
C-6”, C-5”’ dan C6”’). Tujuh isyarat
(d, J = 9.9, H-3”), 6.61 (d, J = 9.9, H-4”), 5.55
selebihnya merupakan isyarat bagi karbon
(d, J = 9.9, H-3”’), 6.51(d, J = 9.9, H-4”’) 3.75
(s, OMe-6), 2.51 (s, COCH3-2’), 1.44 (CH3- kuartener iaitu pada δ 117.8 (C-1), δ 151.6 (C-
5”/6”), 1.43 (CH3-5”’/6”’). RMN 13C (CDCl3) : 2), δ 106.7 (C-3), δ 150.7 (C-4), δ 108.4 (C-5),
117.8 (C-1), 151.6 (C2), 106.7 (C3), 150.7 δ 153.9 (C-6), dan δ 77.4 (C2”) dan δ 77.3
(C4), 108.4 (C5), 153.9 (C6), 63.8 (OMe-6), (C2”’).
201.1 (C1’), 32.8 (C2’), 77.30 (C2”), 127.9 Kedudukan kumpulan tertukarganti metoksi
(C3”), 116.4 (C4”), 28.2 (2CH3-2”), 77.4 dan asetil serta perlakuran gelang piran kepada
(C2”’), 127.9 (C3”’), 116.9 (C4”’), 28.1 rangka asetofenon ditentukan melalui
(2CH3-2”’). eksperimen 2D 1H-1H NOESY (Rajah 1).
3. Hasil dan perbincangan Isyarat proton metoksi pada δ 3.76
Pemisahan ke atas ekstrak metanol bahagian menunjukkan interaksi nOedengan isyarat
batang A. pedunculata telah berjaya proton metil pada δ 2.51 dan isyarat dublet
memencilkan sebatian o-metiloktandrenolona pada δ 6.51. Maka, kumpulan asetil dan
yang diperolehi sebagai pepejal amorfus kumpulan metoksi masing-masing perlu
berwarna kuning. Spektrum UL menunjukkan berikatan secara orto pada gelang benzina. Di
jalur serapan maksimum pada 263 dan 318 nm samping itu, interaksi nOe juga dicerap di
manakala puncak ion molekul, M+ yang dicerap antara proton metil keton dengan kumpulan
pada m/z 314 berpadanan dengan formula gem-dimetil pada δ 1.43. Ini bermakna dua
molekul C19H22O4. gelang dimetilpiran masing-masing perla
terlakur pada kedudukan orto dan meta
Spektrum RMN 1H menunjukkan ciri-ciri bagi
terhadap kumpulan asetil (C-2 dan C-3) serta
terbitan asetofenon yang berikatan dengan dua
metoksi (C-5 dan C4). Interaksi dalam ruang
unit dimetilpiran yang tidak simetri [Timar et
lain yang dicerap ialah di antara isyarat
al. 1988]. Empat set dublet pada δ 5.53 (H-3”)
kumpulan gem-dimetil pada δ 1.44 dan δ 1.43
LAMPIRAN
O O 2'
2'
1'
1'
"5 "5 O
O 1
1
OMe OMe
2" 2 6 2" 2 6
"6 "6
"3 "3 3 5 H
3 5 H
4" 4 4 "' 4" 4 4 "'
H H
H O 3 "'
H O "' 3 "'
"'
2 2 H
H
(a) (b)
Rajah 1. Interaksi NOE (a) dan HMBC (b) yang dicerap dalam spektrum NOESY dan NBC bagi o-
metiloktandrenolona.
Norizan Ahmat 1 Abdul Hamid1, Jalifah Latip2, Ikram M. Said2 and Laily B. Din2
1
Faculty of Applied Sciences
Universiti Teknologi MARA
40450, Shah Alam
Selangor, MALAYSIA
2
Faculty of Science and Technology
Universiti Kebangsaan Malaysia
43600, Bangi
Selangor, MALAYSIA
Abstract
Alseodaphne perakensis (Lauraceae) is a moderate sized tree locally known as medang
tandok or medang payong. Phytochemical screening on the leaf, stem and root parts showed
that this plant is rich in alkaloid. In continuing our interest on the chemistry of A. perakensis
we now report the isolation of two alkaloids from the roots of this plant : 6, 7-dimethoxy-2-
methyl-1(2H)-isoquinolone and laurolitsine. Their structures were elucidated and identified
by means of the UV, IR, GC-MS, 1D and 2D NMR spectroscopic analysis.
Keywords: Lauraceae, Alseodaphne perakensis, alkaloid, isoquinolone, aporphine.
724
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Norizan Ahmat, Abdul Hamid, Jalifah Latip, Ikram M. Said and Laily B. Din
spectra was obtained with MeOH as a solvent (C-13a), 127.9 (C-13), 130.0 (C-7a), 144.7 (C-
on a Perkin-Elmer FT-IR 1725-X. 1H NMR 1), 147.4 (C-9), 148.1 (C-10).
(400 MHz) and 13C NMR (100.56 MHz)
3. Results and discussion
measurements were carried out on a JEOL
Isoquinoline and aporphine alkaloids were
ECP-400 spectrometer. Chemical shifts are
found to be the common constituents of
reported in ppm and the coupling constants are
Lauraceae, Ranunculaceae, Menispermaceae,
given in Hz. Gas chromatography-mass
Berberidaceae, Papaveraceae and Hernandiacee
spectrometer were obtained on a Macromass
(Cheng et al. 1994). Oxidation of
LCT.
benzylisoquinoline led to the formation of
6,7-Dimethoxy-2-methyl-1(2H)-isoquinolone isoquinolone which besides aporphine occurred
(1) as the major constituent of A. perakensis
(Lauraceae).
Colorless needles. C12H13NO3. Mol. wt. : 219.
EIMS m/z : [M+] 219, 204, 176, 161, 146, 133, 6, 7-dimethoxy-2-methyl-1(2H)-isoquinolone
105. 1H NMR (δ) : 3.55 (3H, s, NCH3), 3.93 (1) was isolated as colourless needle crystals.
(3H, s, OCH3-6), 3.96 (3H, OCH3-7), 6.36 (1H, The IR spectrum showed a strong and sharp
d, J=7.32 Hz, H-4), 6.82 (1H, s, H-5), 6.96 (1H, band at 1640 cm-1 which was charasteristic of
d, J=7.32 Hz, H-3), 7.75 (1H, s, H-8). 13C lactam functionality. The UV absorption band
NMR (δ) : 37.1 (NCH3), 56.2 (6 & 7-OCH3), of 1 at 302, 259 and 225 nm were typical
105.6 (C-4), 106 (C-5), 107.5 (C-8), 120.1 (C- characteristic of the isoquinolone moiety. The
9), 131.2 (C-3), 132.6 (C-10), 149.3 (C-7), mass spectrum showed a molecular ion peak at
153.3 (C-6), 161.9 (C-1) m/z 219 which corresponded to the molecular
formula C12H13NO3. In addition, intense peaks
Laurolitsine (2) at m/z 204, 176, 161, and 133 reflected the loss
Amorphous solid. C18H19NO4. Mol. wt. 313. of two methyl and two carbonyl moieties from
UV(EtOH) λmax : 221, 282, 307nm. IR(KBr) the molecule, indicated the presence of two
νmax : 3300 (OH). EIMS m/z : [M+] 298, 298, methoxyl substituents.
296, 284, 282, 255, 239. 1H NMR (δ): 2.62 The 1H NMR spectrum of 1 exhibited two
(1H, dd, J=13.92, 13.92 Hz, ½ H-7), 2.69 (1H, singlets at δ6.82 and 7.75 which consistent with
m, ½ H-4), 2.74 (1H, dd, J=13.92, 4.76 Hz, ½ the para substituted aromatic protons. In
H-7), 2.99 (1H, m, ½ H-5), 3.01 (1H, m, ½ H- addition two ortho coupled aromatic protons (J
4), 3.37 (1H, m, ½ H-5), 3.57 (3H, s, OCH3-1), = 7.32 Hz) were observed at δ6.36 and 6.96.
3.84 (3H, s, OCH3-10), 3.78 (1H, dd, J=13.92, The remaining signals are three singlets at
4.76 Hz, H-6a), 6.56 (1H, s, H-3), 6.69 (1H, s, δ3.93, 3.96 and 3.55 attributable to two
H-8), 7.96 (1H, s, H-11) 13C NMR (δ): 28.2 (C- methoxyls and one N-methyl proton
4), 36.2 (C-7), 43.5 (C-5), 54.8 (C-6a), 56.7 respectively. The 13C NMR spectrum revealed
(10-OCH3), 60.5 (1-OCH3), 113.0 (C-11), 12 carbon resonances which were assignable to
115.6 (C-3), 116.0 (C-8), 124.7 (C-12), 125.3 two methoxyls, one N-methyl, five
HO
3 4
H3CO 5
5 4 2 3a
6 10 3 1 13a NH
6a
7 9 N H3CO
13
8 1
H3CO CH3 12 7
7a
11
O
10 8
9
(1) H3CO
OH
(2)
quarternary,two olefinic and two methylene The 1H NMR spectrum of 2 confirmed the
carbons. Signals at δ153.3 and 149.3 presence of two methoxyls (OMe-1&10), two
corresponded to two oxygenated aromatic para substituted (H-8 & 11) and an isolated
quarternary carbons with methoxy groups aromatic protons (H-3) at δ3.57, 3.84, 6.69,
attached as the substitution group. The most 7.96 and 6.56 respectively. Signal at δ3.78 was
downfield signal at δ161.9 (C=O) indicated an assigned to methine proton (H-6a, dd, J =
amide functionality, thus confirmed the 13.92, 4.76 Hz) in the α-orientation which
isoquinolone nature. displayed an axial-axial coupling with ½ H-7 at
The exact position of the two methoxyl groups δ2.62 (dd, J = 13.92, 13.92 Hz). ½ H-7 on the
was confirmed by means of 1H-1H NOESY other hand also showed geminal coupling with
experiment. NOE interaction was observed the other ½ H-7 at 2.74 (dd, J = 13.92, 4.76
Hz). This observation, hence placed the ½ H-7
between the methoxyl signal at δ3.93 and the
(δ2.74) in the axial-equaterial position with H-
aromatic proton at δ6.82 (H-5) (Figure 1). This
6a. The rest of the signals belonged to two
aromatic proton H-5 was further interacted
methylenes, in which all exist as geminal
through space with another aromatic proton (H-
protons, were observed at δ2.69, δ3.01 (H2-4),
4) at δ6.36, thus placing the methoxyl (δ3.93)
at C-6 position. So, the other methoxy group at and δ2.99, δ3.37 (H2-5).
δ3.96 has to be attached to C-7. This The 13C NMR indicated 18 resonances which
assignment was further supported by NOE assignable to two methoxyls (δ 56.7 and 60.5),
interaction between the methoxyl (δ3.96) and four oxygenated aromatic carbons (δ151.4,
aromatic proton (H-8) at δ7.75. 147.4, 144.7 and 148.1) which ascribable to
two phenolic hydroxy and two methoxyl
The 3J interactions observed in the HMBC
carbon respectively, and five quarternary
spectrum of 1 were also consistent with the
aromatic carbons at δ129.6, 129.7, 124.7, 127.9
placement of methoxyls at δ3.93 and δ3.96 at
and 125.3. The remaining signals belonged to
C-6 and C-7 respectively, i.e. δ3.93 (OCH3-6)
three methine aromatic carbons (δ115.6, 116.0
and δ153.3 (C-6) and δ3.96 (OCH3-7) and
and 113.0), three methylenes (δ28.2, 43.5 and
δ149.3 (C-7). The presence of methylated
36.2) and one aliphatic carbon at δ54.8.
nitrogen was confirmed by the dipolar
interaction between the methyl signal (δ3.55) The placement of substitution groups in the
and the aromatic proton, H-3 (δ6.96) and 3J aporphine skeleton was confirmed by means of
interactions between the methyl (δ3.55) with C- the NOESY and HMBC experiments. The
3 (δ131.2) and C=O (δ161.9) observed in the methoxyl proton (δ3.57) showed 3J interaction
NOESY and HMBC spectrum of 1 with C-1 (δ144.7), thus placing its location at
respectively. On the basis of these spectral C-1. At the same time H-3(δ6.56) also showed
3
evidence, compound 1 was characterised as J interaction with C-1, hence placing the
6,7-dimethoxy-2-methyl-1(2H)-isoquinolone methoxyl (δ3.57), H-3 and C-1 in one ring
which has been previously synthesized system. The same phenomena could be
(Kametani et al. 1968) . observed whereby another methoxyl (δ3.84)
Laurolitsine (2) was obtained as dark brown showed 3J interaction with C-10 (δ148.1),
solid amorphous. The IR spectrum of 2 while H-8 (δ6.69) also displayed 3J interaction
exhibited a broad absorption at 3300 cm-1 with C-10. These observation suggested that
which indicated the presence of phenolic the two methoxyls have to be located in two
hydroxyl moiety. The UV absorption bands at different ring systems. The NOE interactions
221, 282 and 307 nm suggested a 1, 2, 9 and 10 observed between methoxyl at δ3.57 with H-11
tetrasubstituted aporphine skeleton (Shamma and between H-11 with another methoxyl at
1960, Sangster & Stuart 1965). The MS gave δ3.84 suggested that H-11 was located between
an [M+] value of 313 which was consistent the two methoxyls in space, hence leaving only
with the molecular formula C18H19NO4. Other two vacant places for two hydroxyls which
prominent fragmentation ions at m/z 298, 284, were at C-2 and C-9. Based on these spectral
255 and 239 reflected the loss of amine or data and comparison with literature (Tewari et
methyl, formyl and methoxyl moieties from the al. 1972), compound 2 was deduced as
molecule.
H H
HO
H3CO
H
NH
H3CO
N
H3CO CH3
H
H O
(1)
H3CO H
OH
(2)
laurolitsine, which was also known as Lajis, N. H., Mahmud, Z., Din, L. B. and Toia, R. F.
norboldine. 1989. Pertanika. 12 : 421-424.
Normah Awang 1), Ibrahim Baba 2), Yang Farina Abd. Aziz 3) dan Bohari M. Yamin 4)
Abstrak
Empat sebatian baru trifenilstanum(IV) ditiokarbamat yang berformula
(C6H5)3Sn[S2CNR’R”] (R’ = CH3, C2H5, iC3H7, s-C4H9; R” = C6H11, C3H7) telah berjaya
disediakan melalui kaedah in-situ. Spektrum inframerah telah menunjukkan kehadiran tiga
jalur penting hasil regangan ikatan C N, C S dan Sn-S masing-masing pada julat
1475-1478 cm-1, 976-998 cm-1 dan 346-376 cm-1. Spektrum RMN 13C pula menunjukkan
kehadiran signal hasil resonans atom karbon karbamat pada moeiti NCS2 pada julat 195.18-
198.25 ppm. Kajian kristalografi sinar-X pula menunjukkan mod pengkelatan kumpulan
ditiokarbamat dalam sebatian adalah sama ada secara bidentat atau isobidentat. Analisis
termogravimetri pula mendapati sebatian stabil secara terma pada suhu di bawah 130°C.
Sebatian trifenilstanum(IV) ditiokarbamat ini menunjukkan aktiviti sitotoksik yang tinggi
terhadap sel leukemia manusia HL-60 dengan nilai CD50 berada pada julat 0.17-0.25 µg/mL.
Ujian aktiviti antimikrob pula mendapati sebatian menunjukkan aktiviti yang sederhana
terhadap mikrob ujian yang tertentu dengan diameter zon perencatan pertumbuhan mikrob
ialah 8-10 mm.
Kata kunci: aktiviti antimikrob, mod pengkelatan, ditiokarbamat, trifenilstanum
728
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Normah Awang , Ibrahim Baba , Yang Farina Abd. Aziz dan Bohari Md. Yamin
s-C4H9; R” = C6H11, C3H7). Di samping itu propilamina) dalam pelarut etanol (30 ml) yang
juga struktur hablur sebatian ini akan disejukkan dalam takung ais. Suhu campuran
dibincangkan juga. tindak balas dikawal supaya tidak melebihi 4°C
2. Percobaan dan dikacau selama setengah jam. Larutan
Bahan Kimia kuning pucat yang terhasil akhirnya
N-metilsikloheksilamina, N- ditambahkan secara stoikiometri sebatian
etilsikloheksilamina, N- trifenilstanum(IV) klorida yang dilarutkan
isopropilsikloheksilamina dan dalam 20 ml etanol. Campuran tindak balas
trifenilstanum(IV) klorida diperoleh secara dikacau menggunakan pengacau bermagnet dan
komersial yang dibekalkan oleh Fluka selepas beberapa minit, mendakan terhasil.
sementara N-sek-butil-N-propilamina pula Selepas 1 jam dibiarkan bertindak balas,
dibekalkan oleh TCI-EP. Karbon disulfida mendakan yang terhasil akhirnya dituras dan
dibekalkan oleh Fisher sementara kloroform dibilas beberapa kali menggunakan etanol sejuk
dan etanol dibekalkan oleh Merck. Kesemua dan dikeringkan dalam balang pengering
bahan kimia dan pelarut digunakan tanpa menggunakan silika gel. Penghabluran semula
dilakukan sebarang penulenan. sebatian menggunakan campuran pelarut
kloroform dan etanol dengan nisbah isipadu 1:1
Kaedah dilakukan dan pemeruapan secara perlahan-
Sebatian trifenilstanum(IV) ditiokarbamat lahan larutan sebatian pada suhu bilik telah
disediakan dengan menambahkan secara berjaya menghasilkan hablur yang tidar
perlahan-lahan karbon disulfida (30 mmol) berwarna untuk dua daripada empat kompleks
dalam 10 ml etanol ke dalam 30 mmol larutan yang telah disediakan.
amina sekunder (N-metilsikloheksilamina, N-
etilsikloheksilamina, N- Pencirian
isopropilsikloheksilamina dan N-sek-butil-N- Pencirian sebatian seperti penentuan takat lebur
R' R'
S
C6H5 3SnCl
+ :N H + CS2 Sn C N + HCl
S
R" R"
Jadual 1. Data sifat fizikal dan analisis unsur sebatian trifenilstanum(IV) ditiokarbamat
Jadual 3. Data penting spektrum RMN 13C sebatian trifenilstanum(IV) ditiokarbamat (δ, ppm)
Sebatian 1 2 3 4
ditiokarbamat. Jalur serapan yang kuat pada iaitu merupakan frekuensi regangan ikatan Sn-
julat 1475-1479 cm-1 hasil getaran ikatan C-N S.
yang dikenali juga sebagai jalur “tioureida”
Spektrum RMN 13C untuk semua sebatian pula
(Bonati & Ugo, 1967). Ikatan ini mempunyai
menunjukkan kehadiran signal yang paling
ciri-ciri ikatan separa ganda dua. Manakala
penting untuk sebatian ditiokarbamat iaitu
jalur serapan yang lemah pada julat 976-998
anjakan kimia karbon karbamat, N13CS2 pada
cm-1 adalah hasil getaran ikatan C-S. Kehadiran
julat 195.18- 198.25 ppm (Jadual 3). Manakala
jalur serapan tunggal ν(C S) ini signal pada julat 66.65-25.32 ppm pula adalah
menunjukkan ciri-ciri bidentat ligan merupakan anjakan kimia karbon sikloheksil
ditiokarbamat (Sharma et al. 1981). Keputusan untuk sebatian 1-3 (Hall & Tiekink 1998).
ini disokong oleh data hasil kajian kristalografi
sinar-X yang menunjukkan bahawa ligan Kajian kristalografi sinar-X keempat-empat
ditiokarbamat telah mengkelat secara bidentat sebatian telah dilakukan dengan memilih hablur
dalam sebatian 1-4. Pembentukan ikatan di yang sesuai. Data hablur dan penghalusan bagi
antara logam stanum dengan ligan sebatian 1-4 ditunjukkan dalam Jadual 4.
ditiokarbamat dapat dibuktikan dengan Hablur sebatian 1 dan 2 didapati bersistem
kehadiran jalur serapan pada julat 346-377 cm-1 monoklinik dengan kumpulan ruang yang sama
iaitu P-1. Manakala sebatian 3 dan 4 didapati
Sebatian 1 Sebatian 2
Sebatian 3 Sebatian 4
Jadual 6. Ujian awal aktiviti sitotoksik sebatian trifenilstanum(IV) ditiokarbamat terhadap sel leukemia
manusia jenis “promyelocetic”, HL60
TriPhSn(MeCychexDtc) 8 - 10 -
TriPhSn(EtCychexDtc) - - - 10
TriPhSn(iPrCychexDtc) 9 - 9 -
TriPhSn(s-BuPrDtc) 8 10 - -
Streptomysin 19 20 15 20
(standard)
bipiramid trigon terherot dengan sudut ikatan suhu 134-252 ºC. Ini menunjukkan sebatian ini
pada paksi axialnya ialah 156.22(10)º iaitu jauh adalah selamat dan sesuai disimpan pada suhu
lebih kecil jika dibandingkan dengan nilai bilik.
sudut yang normal iaitu 180º. Panjang ikatan
Aktiviti biologi seperti ujian aktiviti sitotoksik
N(1)-C(28) ialah 1.319(5) Å iaitu lebih pendek
yang dilakukan terhadap sel leukemia manusia
jika dibandingkan dengan nilai panjang ikatan
jenis“promyelocetic”, HL-60 menunjukkan
N-C tunggal iaitu 1.47 Å (Carr & 1974). Ini
sebatian trifenilstanum(IV) ini mempunyai
menunjukkan bahawa ikatan N-C tersebut
aktiviti yang sangat baik dengan nilai CD50
mempunyai ciri-ciri ikatan ganda dua. Data ini
pada julat 0.17-0.25 µg/mL (Jadual 6). Sebatian
dapat menyokong keputusan hasil analisis
inframerah. yang mempunyai nilai CD50 < 5.0 µg/mL
dikategorikan sangat aktif (Ali et al. 1996).
Ujian kestabilan terma dalam atmosfera Keputusan ujian aktiviti sitotoksik ini
nitrogen yang dilakukan melalui analisis menunjukkan sebatian mempunyai potensi
termogravimetri menunjukkan sebatian sebagai agen antikanser yang baik. Sementara
trifenilstanum(IV) ditiokarbamat ini adalah itu, ujian awal aktiviti antimikrob menunjukkan
stabil di bawah suhu 130 ºC. Jadual 5 sebatian adalah sederhana aktif terhadap
menyenaraikan data analisis termogravimetri mikrob yang tertentu. Diameter zon perencatan
yang dilakukan. Data yang ditunjukkan mikrob yang diperoleh adalah berada pada julat
merupakan julat suhu penguraian keempat- 8-10 mm (Jadual 7). Keputusan ini juga
empat sebatian ini. Berdasarkan jadual tersebut, mendapati sebatian trifenilstanum(IV)
sebatian 1-4 didapati mula mengurai pada julat
ditiokarbamat ini juga berpotensi bertindak Bonati, F & Ugo, R. (1967). Organotin(IV) N,N-
sebagai agen antimikrob. disubstituted dithiocarbamates. J. Organomet.
Chem., 10, 257-268.
4. Kesimpulan
Data analisis unsur, analisis spektroskopi Hall, V. J. & Tiekink, R. T. (1998). The importance
of varying the Lewis acidity of R2Sn in determining
inframerah dan spektroskopi RMN 13C di
the molecular structure of R2Sn(1,1-dithiolate)
samping kajian kristalografi sinar-X compounds: The crystal and molecular structures of
menunjukkan sebatian trifenilstanum(IV) three divinyltin N, N-dialkyldithiocarbamates. Main
ditiokarbamat yang berformula Group Met. Chem., 21(5), 245-254.
(C6H5)3Sn[S2CNR’R”] (R’ = CH3, C2H5, iC3H7,
Hibbert, T. G., Mahon, M. F. & Molloy, K. C.
s-C4H9; R” = C6H11, C3H7) telah berjaya
(1999). Organotin dithiocarbamate chlorides: X-Ray
disintesis menggunakan kaedah in-situ. structures of n-BuSn(S2CNEt2)Cl2 and n-
Stoikiometri di antara sebatian trifenilstanum BuSn(S2CNEt2)2Cl. Main Group Met. Chem., 22(4),
dengan ligan ditiokarbamat adalah 1:1 dan 235-241.
pengkelatan ligan adalah secara isobidentat
Kana, A. T., Hibbert, T. G., Mahon, M. F., Molloy,
atau bidentat.
K. C., Parkin, I. P. and Price, L. S. (2001).
5. Ucapan Terimakasih Organotin unsymmetric dithiocarbamates: synthesis,
Terima kasih diucapkan kepada Kerajaan formation and characterization of tin(II) sulfide
Malaysia di atas bantuan kewangan melalui films by atmospheric pressure chemical vapour
geran IRPA 09-02-02-0048-EA144 yang deposition. Polyhedron, 20, 2989-2995.
membolehkan penyelidikan ini berjalan dengan Lindley, P. F. & Carr, P. (1974). Crystal and
lancar. Tidak lupa juga penghargaan kepada molecular structure of bis(N,N’-
semua pembantu makmal di Pusat Pengajian diethyldithiocarbamato)diphenylstannane,
Sains Kimia dan Teknologi Makanan, Fakulti C22H30N2S4Sn. J. Cryst. Mol. Struct., 4, 173-185.
Sains dan Teknologi UKM yang membantu di Sharma, J., Singh, Y., Bohra, R. & Rai, A. K.
sepanjang penyelidikan ini dijalankan. (1996). Synthesis and spectral studies of diorganotin
heterocyclic dithiocarbamate complexes: The
6. Daftar Pustaka crystal structure of
Ali, A. M., Mackeen, M. M., Safinar, I. I., Hamid,
(CH3)2Sn[S2CNCH2CH2CH2CH2CH2]2. Polyhedron,
M., Lajis, N. H., El-sharkawy, S. H. & Murakoshi,
15(7), 1097-1102.
M. (1996). Antitumour-promoting and antitumor
activities of the crude extract from the leaves of Sharma, C. P., Kumar, N., Khandpal, M. C.,
Juniperus chinensis. J. Ethnopharmacology, 53, Chandra, S. & Bhide, V. G. (1981). Studies on
165-169. the preparation and characterization of bis-
dithiocarbamato derivatives of di-n-butyl- and di-n-
hexylSn(IV). J. Inorg. Nucl. Chem., 43, 923-930.
Senyawa Flavon Terisoprenilasi dan Steroid Dari Kayu Akar Cempedak Jantan
(Artocarpus heterophyllus )
Abstrak
Dua flavon terisoprenilasi, yaitu artokarpin (1) dan kudraflavon C (2), bersama-sama dengan
satu steroid, β -sitosterol (3) telah berhasil diisolasi dari ekstrak metanol kayu akar cempedak
jantan (Artocarpus heterophyllus). Struktur ketiga senyawa tersebut telah ditetapkan
berdasarkan data spetroskopi UV dan IR, serta melalui perbandingan spektrum data
spektroskopi, putaran optik, dan titik leleh terhadap data senyawa yang sama yang telah
dilaporkan.
Kata kunci : β -Sitosterol, artokarpin, kudraflavon C, Artocarpus heterophyllus.
OH O
OH O
1 2
IR dari senyawa ini memperlihatkan gugus senyawa 3 dengan senyawa β - sisterol yang
fungsi utama dari suatu flavon , dimana gugus - memperlihatkan nilai Rf yang sama pada tiga
C=O terkonjugasi muncul pada 1621 cm-1 dan sistem eluen yang berbeda serta dilakukan
vibrasi ulur C=C aromatik terlihat pada 1358- pengujian putaran optik terhadap senyawa ini
1564 cm-1, sementara serapan untuk gugus -OH sehingga dengan demikian dapat disimpulkan
terlihat pada 3361 cm-1 (lebar), selain itu bahwa senyawa 3 adalah β - sitosterol.
serapan C-H alifatik tampak di daerah 2913 cm-
1
yang memperkuat adanya gugus isoprenil 4 Kesimpulan
pada senyawa ini. Dari analisis di atas Dari fraksi metanol kayu akar cempedak jantan
disarankan bahwa senyawa hasil isolasi adalah telah ditemukan dua senyawa flavon
suatu flavon terisoprenilasi pada posisi C-3. terisoprenilasi, yaitu artokarpin (1) dan
Perbandingan spektrum IR senyawa 2 dengan kudraflavon C (2). Hasil uji biologis
spektrum kudraflavon C ternyata keduanya memperlihatkan bahwa kedua senyawa
adalah identik. Bukti lebih lanjut senyawa 2 memiliki sifat sitotoksik yang kuat. Hal ini
sebagai kudraflavon C diperoleh dari menunjukkan bahwa tumbuhan ini mempunyai
perbandingan langsung dengan kudraflavon C potensi sebagai sumber bahan kimia yang
standar pada analisis KLT. bermanfaat. Bersama dengan kedua senyawa di
atas ditemukan pula satu senyawa steroid, β -
Adanya senyawa artokarpin dan kudraflavon C, sitosterol (3).
dalam Artocarpus, mengindikasikan bahwa
kedua senyawa ini merupakan prekursor dari
sejumlah senyawa turunan flavon
terisoprenilasi yang terdapat dalam genus ini.
Beberapa genus Artocarpus yang telah
dilaporkan menunjukkan adanya kedekatan
secara kemotaksonomi dari A. heterophyllus
dengan A. champeden, A. glauca dan A.
HO
maingayi (Hakim, 1998, Agustini, 1999 dan
Eliza, 1998). 3
Ahmad, S.A; Hakim, E.H; Makmur, L; Mujahidin, Hakim, E.H; Marlina, E.V; Mujahidin, D; Achmad,
D; Syah, Y.M. Prosiding Seminar Nasional Kimia S.A; Ghisalberti, E.L; Makmur, L. “Artokarpin dan
Bahan Alam ’99,1999, hal 1-9. Heteroflavon A, dua senyawa Flavonoid bioaktif
dari Artocarpus champeden”, Proseding ITB, 1998,
Agustini, D.M; Makmur, L; Achmad, S.A;
30 (1), 31-36.
Ghisalberti, E.L ; Hakim, E.L; Syah, Y.M.
Prosiding Seminar Nasional Kimia Bahan Alam Heugnauer, R., “ Chemotaxonomie Der Pflanzen”,
’99,1999, hal 198-204. Band S. Birkhauser Verlag Basel, Stuttgart, 1969.
Eliza. “ Artokarpin dan Turunannya dari Kayu Hano, Y; Nomura T, “Isoprenoid-Substituted
Akar Artocarpus maingayi King”, Tesis, Flavonoid From Artocarpus Plants (Moraceae),
Departemen Kimia , Institut Teknologi Bandung, 1998, Heterocycles, 47(2), 1779-1202
1998.
Pusat Pengajian Sains Kimia & Teknologi Makanan, Fakulti Sains dan Teknologi, Universiti Kebangsaaan
Malaysia, 43600 Bangi, Selangor, Malaysia
Emel: nurziana_ngah@yahoo.com, bohari@pkrisc.cc.ukm.my, mbk@pkrisc.cc.ukm.my
Abstrak
Tindak balas bis[asetatotrifenilfosfinargentum(I)] biasanya melibatkan tindak balas
penggantian kumpulan asetat oleh kumpulan karboksilat sebatian pengganti. Tindak balas
bis[asetatotrifenilfosfinargentum(I)] dengan N-benzoil-N’-feniltiourea dalam etanol telah
menghasilkan [Ag(PPh3)3S]. Produk yang sama juga diperolehi daripada tindak balas
dengan asid-3-(3-benzoiltiouredo)propionik. Sebaliknya dalam kloroform kompleks dimer
[C47H42AgN2O3P2S] 2 terbentuk dan mempunyai sistem hablur triklinik dengan kumpulan
ruang Pī, a = 12.691(3)Ǻ, b = 13.080(3)Ǻ, c = 14.267(3) Ǻ, α = 94.888(5)o, β = 93.818(6)o
dan γ = 97.254(5)o . Tindak balas deangan asid-2-(3-benzoiltiouredo)pentanadioik dalam
pelarut kloroform tidak membentuk kompleks yang setara tetapi dimer yang dihubung
melalui jejambat NCS, [C37H30AgN2P4S] 2 .Tindak balas dengan asid-2-(3-benzoiltiouredo)-3-
metilbutirik dalam pelarut asetonitril pula menghasilkan kompleks polimerik
[C49H45AgN2O3P2S] .CH3CN. Hablur yang diperolehi mempunyai sistem ortorombik dengan
kumpulan ruang P212121, a = 14.665(3)Å, b = 15.475(3)Å, c = 21.024(4)Å.
Kata kunci: Bis[asetatotrifenilfosfinargentum(I)], asid-3-(3-benzoiltiouredo)propionik, asid-
2-(3-benzoiltiouredo)pentanadioik, asid-2-(3-benzoiltiouredo)-3-metilbutirik.
RAJAH 2 Struktur molekul [Ag(PPh3)3S] pada paras kebarangkalian 50% mengikut skema
penomboran yang ditunjukkan.
RAJAH 3 Struktur molekul [C47H42AgN2O3P2S]2 pada paras kebarangkalian 50% menggunakan skema
penomboran yang ditunjukkan.
RAJAH 4 Struktur molekul [C37H30AgN2P4S]2 pada paras kebarangkalian 50% menggunakan skema
penomboran yang ditunjukkan.
al. 1996), [Ag(PPh3)3I] (Hibbs et al. 1996), yang bersifat dimerik dengan formula molekul
[Ag(PPh3)3X] (X = Cl, Br dan I) (Engelhardt et [C47H42AgN2O3P2S]2. Setiap atom argentum
al. 1987) dan [Ag(O2NO)(PPh3)3] (Bruce et al. mempunyai geometri tetrahedron terherot
1986). dengan sudut sekitar atom ini antara 85.10(14)o
- 116.67(7)o.
Tindak balas yang sama dalam pelarut
kloroform memberikan larutan hitam likat, dan Tindak balas asid-2-(3-
apabila dicairkan dengan sedikit aseton dan benzoiltiouredo)pentanadioik dengan (I) telah
etanol memberikan larutan jernih. Filtrat menghasilkan hablur perang (hasil 30%)
larutan tersebut telah memberikan hablur tanpa dengan takat lebur 510-511K. Analisis sinar-X
warna (hasil 50%; takat lebur 452-453K) menunjukkan hablur tersebut mempunyai
mempunyai sistem dan kumpulan ruang yang sistem triklinik dengan kumpulan ruang Pī, a =
sama tetapi berbeza dimensi sel unit, a = 10.310(7)Å, b = 13.163(9)Å, c = 13.456(9)Å, α
12.6913 Ǻ, b = 13.0803 Ǻ, c = 14.2673 Ǻ, α = = 113.165(11)o, β = 92.023(12)o dan γ =
94.888(5)o, β = 93.818(6)o dan γ = 97.254(5)o. 100.556(12)o. Rajah 4 menunjukkan struktur
Rajah 3 menunjukkan struktur molekul produk [C37H30AgN2P4S]2 dengan skema penomboran.
Anion NCS- didapati berkelat kepada kedua- Campuran (I) dengan asid-2-(3-
dua atom Ag melalui atom S dan N, dan benzoiltiouredo)-3-metilbutirik yang dikacau
seterusnya membentuk kompleks dimerik. dalam pelarut asetonitril menghasilkan sedikit
Dalam kekisi hablur, molekul ini distabilkan mendak putih. Filtrat jernih campuran bahan
oleh ikatan hidrogen intermolekul C3-H3A…S1 tersebut didapati memberikan hablur tanpa
dan membentuk rangkaian satu dimensi selari warna (hasil 70%; takat lebur 410-411K).
pada paksi b (Rajah 4a). Sudut di sekitar atom- Analisis sinar-X mendapati hablur tersebut
atom argentum antara 97.13(12)-124.63(6)o. bersistem ortorombik dengan kumpulan ruang
P212121, a = 14.665(3)Å, b = 15.475(3)Å dan c
Metil Linderon, Senyawa Calkon Termodifikasi dari Kayu Batang Lindera polyantha
(Lauraceae)
*Kelompok Penelitian Kimia Organik Bahan Alam, Departemen Kimia, Institut Teknologi Bandung, Jalan
Ganeca 10, Bandung 40132
**School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti
Kebangsaan Malaysia, 43600 UKM Bangi, Selangor D.E, Malaysia
Abstrak
Satu senyawa calkon termodifikasi, metal linderon, telah berhasil diisolasi dari ekstrak
metanol kayu batang Lindera polyantha. Struktur senyawa tersebut ditetapkan berdasarkan
data spektroskopi UV, IR, 1H-NMR, dan 13C-NMR, serta melalui perbandingan dengan
senyawa standar.
Kata kunci : Lindera polyantha, Lauraceae, metil linderon
744
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Nyoman S. Suastri, Euis H. Hakim, Yana M. Syah, Lia D. Juliawaty, Sjamsul A. Achmad, Lukman
Makmur, Zalifah Latif, Laily bin Din, Ikram M. Said
ppm. Berdasarkan data spektrum 1H-NMR menjadi suatu turunan kuinon-calkon (3).
maka dapat diperkirakan bahwa cincin B dari Turunan kuinon-calkon tersebut kemudian
calkon tersebut tidak tersubstitusi, sementara mengalami oksidasi lebih lanjut, sehingga
cincin A termodifikasi menjadi cincin-C5 dan membentuk cincin-C5 (4). Tautomerisasi
tersubtitusi penuh. Spektrum 13C-NMR senyawa 4 yang dilanjutkan metilasi pada C-9
senyawa 1 juga menunjukkan adanya dua menghasilkan metil linderon (1).
sinyal karbon karbonil (δC 187,3 dan 184,8
4. Kesimpulan
ppm), dan selebihnya adalah adanya 12 sinyal
Dari fraksi etil asetat kayu batang L. polyantha
C-sp2, termasuk tiga sinyal C-oksiaril (δC
telah ditemukan senyawa calkon yang
147,9, 149,0, dan 165,5 ppm). Data spektrum
termodifikasi yaitu metil linderon (1). Dalam
NMR tersebut ternyata sesuai dengan struktur
makalah ini diusulkan biogenesis pembentukan
metil linderon (1). Perbandingan data NMR
senyawa 1 dari suatu calkon yang tersubtitusi
senyawa 1 dengan data yang sama dari metil
penuh pada cincin A.
linderon (Tabel 1) yang diisolasi dari L. lucida
memperlihatkan kesesuaian yang tinggi pada 5. Ucapan Terimakasih
harga geseran kimianya. Dengan demikian Ucapan terimakasih disampaikan kepada staf
dapat disimpulkan bahwa senyawa 1 adalah Kebun Raya Cibodas yang telah menyediakan
metil linderon. sampel tumbuhan. Penelitian ini juga dibiayai
oleh Research Grant dari Proyek Hibah B
MeO
O Batch I, Departemen Kimia, Institut Teknologi
3' 5'
4
Bandung.
A 1 B
MeO 9 6. Daftar Pustaka
1'
Achmad, S.A., “Kimia Organik Bahan Alam”,
7
O OMe Modul 3-4, Penerbit Karunia, Jakarta,1986.
Heyne K., “Tumbuhan Berguna Indonesia II ”,
1 Badan Litbang Kehutanan, Jakarta. 1987.
Metil linderon (1) adalah senyawa calkon yang Lee, S.M., Baek, S.H., Lee, C.H., Lee, H.B.,
telah mengalami modifikasi pada cincin A Kho,Y.H., (2002). Cytotoxicity of lignans from
sehingga membentuk cincin siklopentenadion. Lindera erytherocarpa Makino, Nat. Prod. Sci., 8,
Pembentukan senyawa 1 dapat dijelaskan 100-102
berasal dari suatu calkon yang tersubstitusi Leong, Yuan-Wah, Harrison L.J., Bennet, G.J.,
penuh pada cincin A, yaitu 3’,4’-dimetoksi- Kadir, A.A., Connoly J.D., (1998). A
2’,5’,6’-trihidroksicalkon (2). Senyawa 2 dihydrochalcone from Lindera lucida,
pertamakali mengalami oksidasi pada cincin A Phytochemistry, 47, 891-894
OH
O
H3 CO
OH
H3 CO OH
[O ]
H3 CO H3 CO
OH O
O O
2 3
[O]
OCH 3
H 3CO
O
Tautomerisasi OH
H 3 CO
H 3CO
O
OH O
O
4 H
Metilasi
O CH3
O
H 3 CO
O
OCH 3
R. Y. Perry Burhan1)
1)
Jurusan Kimia, Institut Teknologi Sepuluh Nopember
Kampus ITS Keputih, Surabaya 60111, Indonesia.
E-mail : pburhan@chimie.its.ac.id
Abstrak
Minyak mentah dan sedimen dari formasi Wonocolo, Kawengan telah dikarakterisasi melalui
metoda geokimia organik. Minyak mentah diidentifikasi mengandung biomarka n-alkana C14-
C34 dengan kelimpahan yang tinggi pada homolog di bawah C20, golongan isoprenoida asiklik
dengan perbandingan pristan/fitan > 1, kelompok hopan yang didominasi oleh isomer
17α(H), 21β (H)-hopana. Ekstrak organik sedimen menunjukkan adanya kandungan senyawa
n-alkana dalam jumlah yang sangat sedikit, isoprenoid asiklik, terpena bisiklik dan golongan
hopanoid. Sebaran biomarka ini menggambarkan bahwa bahan organik minyak mentah
formasi Wonocolo berasal dari daratan dan mengalami pengendapan dalam lingkungan-
purba yang oksidatif. Keberadaan senyawa hopan dengan konfigurasi yang lebih stabil
menunjukkan kematangan termal minyak mentah sudah cukup tinggi.
Kata kunci : n-alkana, biomarka, formasi Wonocolo, hopana
748
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
R. Y. Perry Burhan
Gambar 1. Kromatogram gas fraksi hidrokarbon alifatik dari minyak mentah formasi Wonocolo.
Gambar 2. Kromatogram gas fraksi hidrokarbon alifatik dari sedimen formasi Wonocolo.
mikrobial dan alga (< C19) (Volkman, et al., isoprenoid pristan dan fitan. Hal tersebut
1983). menunjukkan bahwa senyawa hidrokarbon
pada sedimen di Formasi Wonocolo
Pada kromatogram contoh sedimen formasi
dimungkinkan mengalami biodegradasi.
Wonocolo (Gambar 2) tidak dijumpai senyawa-
Tingkat biodegradasi berturut-turut ditunjukkan
senyawa n-alkana dan isoprenoida asiklik
dengan hilangnya biomarka n-alkana,
dalam kelimpahan yang berarti, disebabkan
isoprenoida asiklik, hilangnya senyawa hopana,
konsentrasinya yang rendah. Biomarka yang
steran, kemudian senyawa-senyawa golongan
mendominasi pada contoh sedimen adalah
aromatik (Moldowan, et al., 1995).
Klorofil-a
fitol OH
+O2 +H2
O
OH OH
asam fitenik dihidrofitol
-CO2 -H2O ,+H2
pristen fitan
+H2
pristan
Gambar 3. Pembentukan senyawa pristan dan fitan dari fitol selama pemendaman.
Gambar 4. Fragmentogram m/z 123 fraksi hidrokarbon alifatik dari sedimen formasi Wonocolo.
(CH2)nCOH
OH OH
O
OH OH
Asam hopanoik
C35 Bakteriohopanetetrol
H
OH
8,14-Sekohopana Drimenol
17 (H),21 (H),22R-Hopana
Driman
Gambar 6. Fragmentogram m/z 191 fraksi hidrokarbon alifatik dari sedimen formasi Wonocolo.
dari termal alterasi senyawa terpena berbobot Senyawa terpenoid pentasiklik yang
molekul tinggi seperti squalena akibat proses diidentifikasi adalah hopana reguler C29-C33 C30
enzimatik Pada Gambar 5 senyawa driman dengan stereokimia 17α(H),21β(H)-hopana dan
pada mempunyai dua kemungkinan asal 8,14-sekohopan ditunjukkan pada
sumber, yaitu berasal dari fragmen cincin A,B fragmentogram m/z 191 (Gambar 6)
sekohopan, kemungkinan lain berasal dari Keberadaan senyawa-senyawa tersebut dapat
reduksi drimenol yang juga berasal dari dirangkaikan menjadi jalur penurunan
mikrobial. Senyawa trisiklik terpenoid biomarka polisiklik hidrokarbon dari senyawa
kemungkinan diturunkan dari asam abietat atau C35 bakteriohopanatetrol (Gambar 5).
asam pimarat. Asam abietat dan asam pimarat
Senyawa bakteriohopanetetrol terdapat pada
dibentuk dari siklisasi geranilgeraniol pada
membran bakteri prokariotik yang diduga
tanaman tingkat tinggi (Richardson dan Miller,
disintesa melalui siklisasi dari skualen. Selama
1982).
exploration and reservoir management, Org. Tiercelin, J.-J., Potdevin, J.-L., Morley, C. K.,
Geochem., 33, 5-36. Talbot, M. R., Bellon, H., Rio, A., Le Gall, B.,
Vétel, W., (2004), Hydrocarbon potential of the
Petersen, H. I., Nytoft, H. P., Nielsen, L. H., (2004),
Meso-Cenozoic Turkana Depression, northern
Characterisation of oil and potential source rocks in
Kenya. I. Reservoirs: depositional environments,
the northeastern Song Hon Basin, Vietnam:
diagenetic characteristics, and source rock-reservoir
indications of a lacustrine-coal sourced petroleum
relationships, Marine and Petroleum Geol., 21, 41-
system, Org. Geochem., 35, 493-515.
62.
Pringgoprawiro, H., Sukido, (1992), Geologi
Tissot, B., Welte, D., (1984), Petroleum Formation
Lembar Bojonegoro, Jawa, Pusat Penelitian dan
and Occurrence, 2nd ed., Springer-Verlag,
Pengembangan Geologi, Bandung.
Heidelberg
Richardson, J. S., Miller, D. E., (1982),
Volkman, J. K., Farrington, J. W., Gagosian, R. B.,
Identification of Dicyclic dan Tricyclic
Wakeham, S. G. (1983), Lipid composition of
Hydrocarbon in the Saturate Fraction of a Crude Oil
coastal marine sediments from the Peru upwelling
by Gas Chromatography/Mass Spectrometry, Anal.
region. In: Advances in Organic Geochemistry
Chem., 54(4), 765-768.
1981, Bjorøy, M. et al., (Eds.), Wiley, New York,
Ries-Kautt, M., Albrecht, P., (1989), Hopane- pp. 228-240.
Derived Triterpenoids in Soil, Chem. Geol., 76, 143-
Wade, T. L., Quinn, J. G., (1978), Geochemical
151.
Distribution of Hydrocarbonds in Sediments from
Svarouskaya, L. I., Altunia, L. K., (1999), Mid-Narragansett Bay, Rhode Island, Org.
Biodegradation of Petroleum Hydrocarbons by Geochem., 1, 157-167.
Formation Microflora, Petroleum Chemistry, 39(2),
128-131.
Abstract
Benzotriazole (BTAH) was investigated as a corrosion inhibitor for Type API 5L X65 carbon
steel in sodium chloride (NaCl) solution in the presence of carbon dioxide (CO2). The effect of
immersion time and temperature were studied. These tests were conducted in 1% NaCl (pH
7.02) in the presence of CO2 with and without 1000 ppm BTAH at various immersion times
and temperatures of 25, 45, 65 and 85oC using electrochemical impedance spectroscopic
technique. The observed inhibition efficiency was found to depend on the immersion time and
temperature. The longer the immersion time of carbon steel in 1% NaCl containing CO2 and
BTAH the higher is the inhibition efficiency. In general, the inhibition efficiency decreased as
the temperature increased, although inhibition efficiencies at 85oC after immersion time of 25
and 30 hours are higher than those at 65oC after the same immersion times due to the
decrease in FeCO3 and CO2 solubility.
Key words: Benzotriazole, corrosion inhibition, immersion time, temperature and Type API
5L X65 carbon steel.
756
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
P. Yatiman, N. M. Surdia, S. Purwadaria, B. Ariwahjoedi and R. Suratman
1977). Most of the studies in using BTAH as e. Inhibition efficiency was calculated
corrosion inhibitor for copper and its alloys according to the following equation:
were carried out in the acidic media at room R p − R p (0 )
temperature. Whereas, the studies of corrosion Inhibition efficiency ( IE ) = x100% (1)
inhibitor for iron using BTAH were focused on R
the effect of BTAH on the anodic and cathodic where Rp(0) and Rp are the polarization
dissolution in acid solution at room resistance in the absence and presence of
temperature. BTAH, respectively.
In the present work, the effects of immersion 3. Results and Discussion
time and temperature on corrosion inhibition of The effect of immersion time on the inhibition
Type API 5L X65 carbon steel in sodium of 1000 ppm BTAH on the corrosion of Type
chloride solution (pH 7.02) with and without API 5L X65 in 1% NaCl in the presence of
BTAH in the presence of carbon dioxide were CO2 at various temperatures was studied using
investigated. This study was conducted using EIS measurements. Figures 1 to 4 show the
electrochemical impedance spectroscopic (EIS) Nyquist curves obtained after immersion times
technique to determine the inhibition efficiency 0 h (in the absence of BTAH), 0.167, 1, 5, 25
of BTAH for the Type API 5L X65 carbon and 30 h (in the presence of BTAH) at
steel corrosion in sodium chloride solution at temperatures 25, 45, 65 and 85oC, respectively.
various immersion times and temperatures. It can be seen that the polarization resistance
2. Experimental (Rp) increases with the immersion time. The
a. The working electrode was Type API 5L longer the immersion time the higher is the
X65 carbon steel with 0.78 cm2 surface area polarization resistance. From equation (1),
and the composition 0.0533% C, 0.2374% Si, because the polarization resistance increases so
1.153% Mn, 0.0282% P, 0.0292% Cr, 0.1733% the inhibition efficiency (I E) also increases
Mo, 0.0465% Ni, 0.0865% Cu, 0.0022% V, with the immersion time. Figure 5 shows the
and bal. Fe. Specimens were polished with a inhibition efficiency of BTAH on the corrosion
1200-grade silicon carbide (SiC) paper, of carbon steel in NaCl solution as a function of
degreased with acetone (CH3COCH3) and air immersion time.
dried before immersion into the test electrolyte. The increase in inhibition efficiency with
The total volume of solution was 1200 mL. longer immersion time in NaCl solution
b. All solutions were prepared from analytical containing BTAH can be explained by the
reagent (AR)-grade NaCl (Merck®) with and growth of a protective film on the surface of the
without BTAH (Merck®) using aquabidest. carbon steel, which is time dependent. BTAH is
a triazole compound possessing an abundance
c. The impedance experiments were conducted of π-electrons and unshared electron pairs on
using a Radiometer® potentiostat/galvanostat the nitrogen atoms, which can interact with d
with software VoltaLab® 40. All experiments orbitals of iron to provide a protective film
were carried out using a three-cell electrode (Bentiss, et.al., 2002) on the surface of carbon
with saturated calomel electrode (SCE), a Pt steel. In addition, the large magnitude of the
electrode and Type API 5L X65 carbon steel as impedance at low frequencies indicates that the
reference, auxiliary and working electrodes, film is protective (Agarwal, et.al., 1993). At the
respectively. The test electrolyte was 1% NaCl low frequency, the longer the immersion time
solution (pH 7.02) with and without 1000 ppm the larger is the magnitude of the impedance.
BTAH in the presence of CO2. The pressure of
CO2 was 6 mbar. The effect of temperature on the inhibition of
1000 ppm BTAH on the corrosion of type API
d. All impedance measurements were 5L X65 in 1% NaCl in the presence of CO2 at
performed at the open circuit (corrosion) various immersion times was studied using EIS
potential. The frequency range was 100 kHz to measurements. Figures 1 to 4 show the Nyquist
100 mHz. All experiments were conducted at curves obtained at temperature 25, 45, 65 and
immersion times 0, 0.167, 1, 5, 25 and 30 h, 85oC after immersion times 0 h (in the absence
and temperatures 25, 45, 65 and 85oC. of BTAH), 0.167, 1, 5, 25 and 30 h (in the
presence of BTAH), respectively. In general,
a. 0 h
2000
- Zi (ohm.cm )
b. 0.167 h
2
1500
c. 1 h
1000
d. 5 h
500
e. 25 h
0
0 500 100 150 200 250 300 350 400 f. 30 h
0 0 0 0 0 0 0
2
Zr (ohm.cm )
Figure 1. Nyquist plot of Type API 5L X65 carbon steel in 1% NaCl in the presence of 1000 ppm
BTAH and CO2 at 25oC after immersion times (a). 0 h, (b). 0.167 h, (c). 1 h, (d). 5 h, (e). 25 h and (f).
30 h.
a. 0 h
600
b. 0.167 h
- Zi (ohm.cm )
2
400 c. 1 h
d. 5 h
200
e. 25 h
0 f. 30 h
0 200 400 600 800 1000 1200
2
Zr (ohm.cm )
Figure 2. Nyquist plot of Type API 5L X65 carbon steel in 1% NaCl in the presence of 1000 ppm
BTAH and CO2 at 45oC after immersion times (a). 0 h, (b). 0.167 h, (c). 1 h, (d). 5 h, (e). 25 h and (f).
30 h.
250
a. 0 h
- Zi (ohm. cm )
2
200 b. 0.167 h
150
100 c. 1 h
50
d. 5 h
0
0 50 10 15 20 25 30 35 40 45 50 55 e. 25 h
0 0 0 0 0 0 0 0 0 0
f. 30 h
Zr (ohm.cm2)
Figure 3. Nyquist plot of Type API 5L X65 carbon steel in 1% NaCl in the presence of 1000 ppm
BTAH and CO2 at 65oC after immersion times (a). 0 h, (b). 0.167 h, (c). 1 h, (d). 5 h, (e). 25 h and (f).
30 h.
the inhibition efficiency (I E) decreases as the steel in NaCl solution in the presence of CO2 as
temperature increases. The higher the a function of temperature.
temperature the lower is the inhibition
When the inhibition efficiency decreases the
efficiency. However, inhibition efficiencies at
corrosion rate increases. At low temperatures
85oC after immersion time of 25 and 30 hours
(below 60 - 70oC) the corrosion rate increases
are higher than those at 65oC after the same
(the inhibition efficiency decreases) as the
immersion times. Figure 6. shows the inhibition
temperature increases due to increase of mass
efficiency of BTAH on the corrosion of carbon
transfer and charge transfer rates. At high
a. 0 h
300
- Zi (ohm.cm )
2
200 b. 0.167 h
100 c. 1 h
0 d. 5 h
0 10 20 30 40 50 60 70
0 0 0 0 0 0 0 e. 25 h
2
Zr (ohm.cm ) f. 30 h
Figure 4. Nyquist plot of Type API 5L X65 carbon steel in 1% NaCl in the presence of 1000 ppm
BTAH and CO2 at 85oC after immersion times (a). 0 h, (b). 0.167 h, (c). 1 h, (d). 5 h, (e). 25 h and (f).
30 h.
.
a. 25 deg.C
100
b. 45 deg.C
I E (%)
50
c. 65 deg.C
0 d. 85 deg.C
0 5 101520253035
Immersion Time (h)
Figure 5. Effect of immersion time on the inhibition of 1000 ppm BTAH on the corrosion of Type
API 5L X65 in 1% NaCl in the presence of CO2 at temperatures (a). 25oC, (b). 45oC, (c). 65oC and
(d). 85oC.
a. 0.167 h
100
80 b. 1 h
I E (%)
60 c. 5 h
40
20 d. 25 h
0
e. 30 h
20 40 60 80 100
o
Temperature ( C)
Figure 6. Effect of temperature on the inhibition of 1000 ppm BTAH on the corrosion of Type API
5L X65 in 1% NaCl in the presence of CO2 after immersion times (a) 0.167 h, (b). 1 h, (c). 5 h, (d).
25 and (e). 30 h.
temperature at immersion times 0.167, 1, Brossia, C.S., Cragnolino, G.A., (2000). Effect of
5, 25 and 30 h. The higher the Environmental Variables on Localized Corrosion of
temperature the lower is the inhibition Carbon Steel, Corrosion, 56 (5) 505-514.
efficiency, although inhibition Eldakar, N., Nobe, K., (1981). Effect of Substituted
efficiencies at 85oC after immersion time Benzotriazoles on The Anodic Dissolution of Iron in
of 25 and 30 hours are higher than those H2SO4, Corrosion, 37 (5) 271-278.
at 65oC after the same immersion times Eldakar, N., Nobe, K., (1977). Electrochemical and
due to the decrease in FeCO3 and CO2 Corrosion Behavior of Iron in The Presence of
solubility. Substituted Benzotriazoles, Corrosion, 33 (4), 128-
130.
5. Acknowledgment
This work was supported by the DUE-Like Frignani, A., Tommesani, L., Brunoro, G.,
project of the Directorate General of Higher Monticelli, C., Fogagnolo, M., (1999). Influence of
Education, Department of National Education, The Alkyl Chain on The Protective Effects of 1,2,3-
Indonesia. Benzotriazole toward Copper Corrosion, Part I:
Inhibition of The Anodic and Cathodic Reactions,
6. References Corrosion Science, 41, 1205-1215.
Agarwal, P., Moghissi, O.C., Orazem, M.E., Garcia
Gunaltun, Y.M., (1996). CO2 and H2S Corrosion in
–Rubio, L.H., (1993). Application of Measurement
Oil and Gas Production Systems. One Day Seminar,
Models for Analysis of Impedance Spectra,
Institut Teknologi Bandung., p 1-44.
Corrosion, 49 (4) 278-289.
Jinturkar, P., Guan, Y.C, Han, K.N., (1998).
Babic, R., Metikos-Hucovic, M., Loncar, Dissolution and Corrosion Inhibition of Copper,
M., (1999). Impedance and Photochemical Zinc, and Their Alloys, Corrosion, 54 (2), 106-114.
Study of Surface Layers on Cu and Cu- Matos, J.B., Elia, E.D., Barcia, O.E., Mattos, O.R.,
10Ni in Acetate Solution Containing Pebere, N., Tribolett, B., (2001). Rotating Disc and
Benzotriazole, Electrochimica Acta, 44, Hemisperical Electrodes for Copper Dissolution
2413-2421. Study in Hydrochloric Solution in The Presence of
Benzotriazole, Electrochimica Acta, 46, 1377-1383.
Bentiss, F., Langrenee, M., Elmehdi, B., Mernari,
B., Traisnel, M., Vezin, H., (2002). Electrochemical Quraishi, M.A and Sardar, R., (2002). Aromatic
and Quantum Chemical Studies of 3,5-Di(n-Tolyl)- Triazoles as Corrosion Inhibitors for Mild Steel in
4-Amino-1,2,4-Triazole Adsorption on Mild Steel in Acidic Environmentals, Corrosion, 58 (9), 748-755.
Acidic Media, Corrosion, 58 (5) 399-407. Walker, R., (2000). Aqueous Corrosion of Tin-
Bronze and Inhibition by Benzotriazole, Corrosion,
56 (12). 1211-1219.
Abstrak
Protein eRF1 diketahui berperan pada proses terminasi translasi di sistem eukariot termasuk
Saccharomyces cerevisiae. Studi struktur kristal protein eRF1 manusia menyarankan adanya
tiga domain, yaitu domain I pada daerah ujung N, domain II ditengah protein dan domain III
pada daerah ujung C. Interaksi eRF1 dengan eRF3 diprediksikan terjadi pada domain III.
Analisis struktur eRF1 dilakukan dengan mengirimkan urutan asam amino melalui e-mail ke
SwissProt Automated Protein Modelling Server, dan dianalisis dengan program Rasmol dan
VMD. Hasil analisis menunjukan posisi residu tirosin (Y410) dan treonin (T295) terletak pada
permukaan molekul dan lekukan turn. Kedua residu ini diduga berperan penting dalam
interaksi eRF1-eRF3, karena residu fungsional umumnya terletak pada permukaan molekul
dan lekukan turn. Untuk mempelajari peran kedua residu ini akan dilakukan studi
mutagenesis. Pemilihan asam amino pengganti didasarkan pada dua pendekatan, yaitu
peranan ikatan hidrogen dan keruahan molekul rantai samping. Untuk mengetahui peranan
ikatan hidrogen, tirosin (Y410) diganti dengan fenilalanin (F410), dan treonin (T295) diganti
dengan alanin (A295). Sedangkan untuk mengetahui peranan halang ruang rantai samping,
tirosin (Y410) diganti dengan serin (S410) dan treonin (T295) diganti dengan serin (S295). Dari
hasil komputer analisis struktur tersier (3D) menyarankan meskipun terjadi mutasi Y410S,
Y410F, T295S dan T295A pada eRF1, struktur keseluruhan protein itu tidak berubah. Untuk
memperoleh mutan-mutan tersebut, akan dilakukan mutasi terarah (Site Directed
Mutagenesis) menggunakan PCR. Primer dirancang menggunakan program komputer
”Genmon” dan ”Primer Detectif”. Mutasi untuk mengubah residu tirosin (Y410) menjadi serin
(S410) telah dilakukan dan menyebabkan kinerja eRF1 pada proses terminasi translasi
menurun sampai 78% dari semula.
Kata kunci: eukaryote release factor (eRF), SUP45, Saccharomyces cerevisiae, terminasi
translasi
Gambar 1. Residu pada dua buah lekukan turn eRF1 diduga merupakan
tempat interaksi dengan eRF3. Pada lekukan pertama terdapat aspartat294
dan treonin295, sedangkan pada lekukan kedua tirosin410 dengan
arginin409 disampingnya (Subandi, 2002).
Motif GGQ
Motif NIKS
eRF1 Wild type eRF1 Y410S eRF1 Y410F
Gambar 2. Struktur 3D eRF1 wild type dan mutan (Y410S, Y410F, T295S dan T2951S). Pada eRF1 wild type
posisi 295 dan 410 masing-masing adalah treonin (T295) dan tirosin (Y410). Pada masing-masing mutan posisi
tirosin digantikan oleh serin (mutanY410S) dan fenilalanin (mutan Y410F). Pada posisi treonin digantikan oleh
serin (mutanT295S) dan alanin (mutan T295A).Struktur keseluruhan kelima protein tidak berbeda
yang lain pada eRF1 (motif GGQ dan NIKS), menyarankan bahwa mutasi tirosin (Y) menjadi
juga terletak pada permukaan protein dan serin (S) pada posisi ke-410 eRF1 telah
lekukan turn. mengurangi daya interaksi protein ini terhadap
eRF3, dan menyebabkan kinerja eRF1 pada
Mutasi titik (point mutation) pada gen SUP45
proses terminasi translasi menurun. Hal ini
S. cerevisiae telah dilakukan dengan cara
mengindikasikan bahwa posisi mutasi (Y410)
mutasi terarah (Site Directed Mutagenesis).
pada eRF1 ragi berperan penting dalam
Nukleotida ke 1229 gen eRF1 diubah dari A
mempertahankan interaksinya dengan eRF3.
menjadi C, sehingga kodon ke 410 eRF1
Disamping itu, masih adanya kemampuan
berubah dari TAC (kodon tirosin) menjadi TCC
eRF1 mutan untuk mengikat eRF3,
(kodon serin). Hasil uji interaksi antara eRF1
mengindikasikan bahwa titik interaksi eRF1
mutan Y410S dan wild type dalam berinteraksi
terhadap eRF3 lebih dari satu tempat
dengan eRF3, menunjukan eRF3 yang terikat
(Subandi,2002). Indikasi ini sesuai dengan
pada eRF1 mutan hanya sekitar 22% dibanding
percobaan terdahulu yang membuktikan bahwa
yang terikat pada eRF1 wild type. Hasil ini
titik interaksi pada eRF1 manusia (terhadap mutan); mispriming sedikit. Berdasarkan
eRF3) berada di dua tempat (Merkulova et el., parameter tersebut, telah diperoleh primer
1999). untuk mutan eRF1 (Tabel 1.).
Perubahan fungsi eRF1 mutan Y410S, terutama Urutan primer mutan ditentukan berdasarkan
dalam interaksinya dengan eRF3, diduga posisi dan perubahan basa yang akan dimutasi,
disebabkan oleh perubahan sudut dan panjang karena posisi mutasi sudah pasti maka primer
ikatan –CH2−OH karena perubahan rantai mutan hanya dimodifikasi jumlah basanya
samping tirosin (-CH2-C6H4-OH) berubah untuk memenuhi syarat primer yang baik.
menjadi rantai samping serin (-CH2-OH). Primer RPB (daerah reverse) dan FPK
Perubahan rantai samping itu juga (Forward) ditentukan menggunakan program
diprediksikan menyebabkan hilangnya sebagian komputer “Primer Detectif”dan semi manual.
tonjolan permukaan protein, sehingga daya 4. Kesimpulan
interaksinya dengan eRF3 menurun (Subandi, Analisis komputasi struktur tersier (3D)
2002). menyarankan residu treonin (T295) dan tirosin
Hasil analisis komputasi struktur tersier (3D) (Y410) terlibat langsung dalam interaksi dengan
menyarankan meskipun terjadi mutasi Y410S, eRF3. Meskipun berdasaran anlisis komputasi
Y410F, T295S dan T295A pada eRF1, struktur mutasi Y410S, Y410F, T295S dan T295A pada
keseluruhan protein itu tidak berubah. Ini eRF1 tidak menyebabkan perubahan yang
disebabkan mutasi tersebut tidak menyebabkan berarti pada keseluruhan struktur protein, hanya
perubahan pada bentuk rantai eRF1 (Gambar menyebabkan berkurangnya tonjolan
2). permukaan.
Perancangan Primer Mutan Sudah diperoleh rancangan primer untuk
Primer dirancang berdasarkan template yang pembuatan mutan eRF1, berdasarkan
akan digunakan, yaitu gen SUP45 (terdapat parameter-parameter yang harus dipenuhi oleh
pada plasmid pUKC1901). Parameter dalam primer.
merancangan primer, antara lain: %GC cukup 5. Daftar Pustaka
tinggi (≥50%); harga Tm (melting point) antar Akhmaloka, Subandi, M.R. Moeis, S. Soedigdo
pasangan primer hampir sama (perbedaan ≤ (2002). Probing The Role of SUP45 Gene Product
50C); tidak Self homology; tidak Cross of Tranlation Termination Process: Case study of
homology antar pasangan primer (pembuatan
sup45 Y410S. Seminar Bersama UKM-ITB ke V, Inagaki, Y., C. Blouin, W.F. Doolittle, A.J. Roger
Melaka, Malaysia. (2002) Convergence and Constraint in Eukaryotic
Release Factor 1 eRF1 is Primary Binding Site for
Betram, G., S. Innes, O. Minella, J.P. Richardson, I.
eRF3 of Fission Yeast, J. RNA, 4: 958-972
Stansfield (2001) Endless Possibilities: Translation
Termination and Stop Codon Recognition, Reviev Ma, B., T. Elkayam, H. Wolfson, R. Nussiriov
Article, microbiology, 147: 255-269 (2003) Protein-protein Interactions: Structurally
Conserved Residues Distinguish between Binding
Eurwilaithtr, L., F.M. Graves, L. Stansfield, M.F.
Sites and Exposed Protein Surfaces, PNAS, vol. 100
Tuite (1999), The C-Terminus of eRF1 Defines a
no.10: 5772-5777
Functionally Important Domain for Translation
Termination in Saccharomyces cerevisiae, Mol. Merkulova, T.I., L.Y. Frolova, M.Lazar, J.
Microbial, 32: 485-496 Camonis, L.L. Kisselev, (1999). C-Terminal
Domain of Human Translasi Termination Factor
Frolova, L.Y., Simonsen, J., Merkulova, T.,
eRF1 and eRF3 Mediate their In Vivo Interaction,
Litvinov, D., (1998). Functional Expression of
FEBS Letter, 443: 41-47
Eukaryotic Polypeptide Chain Release Factor 1 and
3 by Means of Baculovirus/ Insect Cells and Mugnier, P., and M.F. Tuite (2001) Mini-Review:
Complex Formation between the Factor, Translation Termination and its Regulation in
Eur.J.Biochem, 256:36-44 Eukaryotes: Recent Insights by Studies in Yeast,
Biokhimia, 64: 1360-
Frolova, L.Y., R.Y. Tsivkovskii, G.F. Sivolobova,
N.Y. Oparina, O.I. Serpinsky, V.M. Blinov, S.I. Subandi, (2002). Pengaruh Mutasi Y410S eRF1
Tatkov, L.L. Kisselev, (1999). Mutation in higly pada Interaksi eRF1-eRF3 Saccharomyces
conserved GGQ Motif of Class 1 Polypeptida cerevisiae, Disertasi Doktor, ITB, Bandung
Release Factors abolosh ability of Human eRF1 to
Trigger Peptidyl-tRNA Hidrolysis, RNA, 5: 1014-
1020
Pudjiastuti, P1)., Suwito, H1)., Nurul, A.1) Nugroho,DA1), Kosela, S.2), Suwarso, W.P.2), Dai3),
Krohn, K.3)
Abstract
The liverwort Plagiochila sandei Dozy belongs to the family Plagiochilaceae which is grows
on soil, cold and wet places in Indonesia. Research into Plagiochila sandei Dozy species has
not been reported yet. In this paper, the identification of compounds as well as structure
elucidation of this plant is reported. Plagiochila sandei Dozy was collected from Mount
Halimun, Sukabumi, West of Jawa, Indonesia. It was collected in March 2004. The dried
sample was powdered mechanically and extracted with ether to provide the crude extract. In
the same time the sample was also extracted using n-hexane and methanol, sequentially giving
crude and methanol extracts. After removing of the solvents, the crude extract of ether was
purified by column chromatography on silica gel using (n-hexane-acetone) gradient system.
Number fractions of 11-16 were then analysed using GC-MS. The GC-MS data showed that
this fractions consist of fatty acids, viridiflorol, maliaan-5-ol, 2(3), 5(6)-fusicoccadien and
fusicogigantepoxide. After separated and purification with silica gel, Cosmosil 75C18 and
Sephadex LH-20 and the mobile phase were used (n-hexane-EtOAc) and (n-hexane-acetone)
gradient system and (CHCl3 : MeOH=1:1), respectively, three crystalline solid were
obtained. The structures were determined based on 400 and 500 MHz Bruker FTNMR
spectrometers showed the existence ethyl-p-methoxy cinnamic (EPMC), derivate of glycerol
and ent-spathulenol.
Key words: liverwort, Plagiochila sandei Dozy, EPMC, derivate of glycerol, ent-spathulenol
766
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Pudjiastuti, P, Suwito, H, Nurul, A. Nugroho, DA, Kosela, S. Suwarso, W.P, Dai, Krohn, K
Indonesia. It was collected in March 2004. assignable to ortho and para located aromatic
Samples were powdered mechanically and protons, respectively.
140g of sample was extracted with ether,
The 13C-NMR and DEPT experiment of 1
whereas 1125 g of the sample was extracted
disclosed the presence of two methyl carbons at
sequentially using n-hexane and methanol.
δ14.1 and 55.3 ppm, one methylene carbon at δ
After removing of the solvents, the three crude
60.3, five methine carbons and one quartenary
extracts were purified by column
carbon were also observed. Two peaks were
chromatography many times on silica gel
Merck 60, Cosmosil 75C18 and Sephadex LH- longer than the others at δ 114.9 and 129.7 and
20. The mobile phase were used (n-hexane- quartenary carbon of carbonyl ester at 172.4
EtOAc), (n-hexane-acetone) gradient system ppm were observed.
and (CHCl3:MeOH=1:1), respectively. The The 1H-NMR and 13C-NMR spectrum were
isolated compounds were identified with also compared to the previous publication data
GCMS HP instrument for analysis of the ether of Tanjung, 1997. From the above data, it was
with number fractions 11-16 and three concluded that compounds 1 is ethyl-p-
structures from n-hexane and methanol methoxy cinnamic (EPMC). This compound is
fractions of 1 (2 mg), 2 (3 mg) and 3 (5 mg) a constituent has insecticidal properties found
were determined using 400 MHz and 500 MHz in four species of zingerberaceae, namely
Brucker FTNMR spectrometers. Curcuma galanga, C. zedoaria, Kaempeferia
3. Results and Discussions galanga and K. pandurata (Panji et al., 1993)
Compound 1: Compound 2:
1
H-NMR (CDCl3, δ ppm): 1.29 (t, 3H), 3.86 (s, The 1H-NMR spectrum of 2 represented three
3H), 4.30 (q, 2H), 6.34 (d, 1H), 6.93(dd, 4H, kinds of proton signals methyl at δ 1.35 (t, 3H),
J=9.7 Hz), and 7.50 (dd, 4H, J=9.7 Hz), 7.65 methyl carbonyl (CH3-CO-) at δ 2.50 (s,3H),
(d, 1H). and methoxy group at δ 3.85 (s, 3H). Three
13
C-NMR (δ ppm): 14.1, 55.3, 60.3, 114.9, methylene groups were observed, two were
126.6, 129.7, 131.3, 145.5, 159.9, and 172.4 displayed as proton signals indicating two
methylenes attached to a methyne groups as (–
Compound 2: CH2-CH-CH2-) at δ 3.75 (m, 4H) and the other
1
H-NMR (CDCl3, δ ppm): 1.35 (t, 3H), 2.50 (s, one as a signal bonded between a double bond
3H), 3.75 (m, 4H), 3.85 (s, 3H), 3.95 (m, 2H), and methyl group at δ 3.95 (m, 2H). The
and 6.27-8.30 (dd of 14 crowded peaks, 12 H) complex conjugate proton signals of methyne
13
appeared at δ 6.27-8.30 (dd of 14 crowded
C-NMR (δ ppm): 14.1, 21.0, 50.9, 111.8, peaks, 12 H).
114.3, 115.6, 122.1, 124.6, 125.7, 126.0, 126.7,
127.7, 128.6, and 129.7 The 13C-NMR and DEPT experiments of 2
exhibited the presence of three methyl carbon
Compound 3: signals at δ 14.1, 21.0 and 50.9 ppm, three
1
H-NMR (CDCl3, δ ppm): 0.86 (s, 9H), 1.23 methylene carbon signals at δ 22.5, 31.6 and
(m, br), 1.25 9 (m, br), 3.63 (s, 3H) and 7.24 (d, 60.4 ppm also one methyne carbon at δ 55.4
2H) ppm were obsserved. Eleven conjugated double
bond methyne carbon signals (one peaks is
The 1H-NMR of 1 displayed the proton signals
longer than the other) were detected at δ 111.8,
methyl at δ 1.29 (t, 3H), and methoxy groups at
114.3, 115.6, 122.1, 124.6, 125.7, 126.0, 126.7,
δ 3.86 (s, 3H).One methylene proton at δ 4.30 127.7, 128.6, and 129.7 ppm. Two faint signals
(q, 2H) was attached to the ester and methyl indicating two carbonyl ester groups signals.
group. Two double bonds of methyne were One signal is canjugated with double bond of
represented by signal at δ 6.34 (d, 1H) and 7.65 methine group and the other one (very small
(d, 1H) which were attached between ester and signal). Based on the datas, compound 2 can be
aromatic groups. Remaining proton signals identified as glycerol derivate.
were observed at δ 6.93 (dd, 4H, J=9.7 Hz) also
7.50 (dd, 4H, J=9.7 Hz) as AB type doublet Compound 3:
O CH 2 - O- CO- CH 3
O CH - O-CH
3
O 1
CH 2 -O-CO
H H
HO H HO H
3
Hapipah Mohd Ali1, Puvaneswary Subramaniam1, Endom Ismail2, Nordin Hj. Lajis3,
SharifudinM. Zain1, Wan Jefri Basirun1 and Ng Seik Weng1
1
Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur, Malaysia,
2
School of Chemical Sciences and Food Technology, Universiti Kebangsaan Malaysia, Bangi, Malaysia.
3
Institut Biosains,Laboratory Natural Product, University Putra Malaysia, 43400, Serdang, Malaysia
hapipahali@yahoo.com, Fax: 603-79674193, 019-3782538
Abstract
Several new benzoylhydrazone had been prepared in ethanol by condensation of
benzhydrazide with substituted salicylaldehyde. Metal complexes had been obtained by
template condensation by reacting metal acetate (M=Zn and Ni) with the Schiff bases in the
presence of triethylamine. The IR, UV-Vis, TGA, 1H and 13C NMR data indicate the Schiff
bases are coordinated to metal via O, N, O atoms. The Schiff base ligands and the metal
complexes are tested against the MCF-7 cancer cell-lines (human breast cancer cells) and the
IC50 values were determined and compared to the positive control drug, tamoxifen. The
antioxidant property was also investigated on both ligands and complexes. The results are
comparable to antioxidant activity of quercetin, vitamin E or butylated hydroxytolouene
(BHT).
Keywords: Substituted salicylaldehyde-hydrazide Schiff bases, metal complexes, Cytotoxicity
and antioxidant properties
N
N
OH
X = 5 C l, 5 B r, 5 O M e , 5 N O 2 , 3 B r5 O M e
absorbance of red colour (conversion to Fe3+) compared to that of free ligands show that the
was measured at 500 nm. The measurement ν(N-H) of the free ligand disappears in the
was taken every 24 h interval one day after spectra of the complexes supporting
absorbance of the control reached its maximum deprotonation of the ligand upon complex
value. formation. The ν(C=O) bands of the free ligand
also disappears in the spectra of the complexes
3. Results and Discussions
indicating destruction of the keto group
The Zn(II) and Ni(II) complexes are yellow and
presumably via enolisation of the ligands and
red in colour respectively, non-hygroscopic and
facilitates the formation of metal complexes.
stable in air. They are insolouble or sparingly
The ligands also showed strong band at around
soluble in common organic solvents and quite
1602 cm-1 which are assigned as the ν(C=N)
soluble in DMSO and pyridine. All the
bands. In the metal complexes, this stretching
complexes melt over 250 oC.
band has shifted to lower frequencies, due to
3.1. IR Spectra the lowering of the ν(C=N) bond order as a
The IR spectra of the complexes when result of metal-nitrogen bond formation. The
Abstrak
Enzim glukosa oksidase digunakan pada pembuatan sensor glukosa secara elektrokimia
termediasi. Elektroda enzim dikonstruksi dengan mencampurkan bubuk karbon aktif, glukosa
oksidase dan p-benzokuinon sebagai mediator yang direkatkan oleh minyak parafin. Optimasi
terhadap komposisi material tersebut dilakukan untuk mendapatkan baik karakter fisika
maupun kimia yang diinginkan. Hasil pengukuran siklik voltametrinya menunjukan bahwa
elektroda enzim memiliki respon terhadap penambahan glukosa yang dapat dilihat dengan
adanya peningkatan arus reaksi quasi reversibel quinon-hidroquinon dengan Ep,a = ± (+120
mV) dan Ep,c = = ± (-36 mV) versus Ag/AgCl. Sensor glukosa ini memiliki kelinieran terhadap
konsentrasi glukosa 0 – 30 mM dengan R2=0,9929.
Kata kunci: biosensor; glukosa oksidase; p-benzokuinon; voltametri siklik
fenomena yang terjadi di permukaan elektroda. dimasukkan secara manual ke dalam tabung
Selain itu gambaran aplikasinya sebagai gelas (∅ = 2 mm) yang dihubungkan dengan
biosensor glukosa dijabarkan. Biosensor kawat tembaga untuk kontak elektriknya dan
generasi kedua ini difabrikasi menggunakan dipoles permukaannya dengan kertas silikon
serbuk karbon yang direkatkan dengan minyak karbida hingga didapatkan permukaan yang
parafin, p-benzokuinon sebagai mediator dan halus (mengkilat). Sedangkan elektroda karbon
enzim glukosa oksidase sebagai biorecognition pasta yang dimodifikasi dibuat seperti di atas
molecule. dengan menambahkan mediator (Q) dan enzim
2. Percobaan (GOx) dengan komposisi yang divariasikan.
2.1. Bahan kimia dan peralatan 2.3. Pengukuran elektrokimia
Glukosa oksidase (GOx) (EC. 1.1.3.4) type II-S Pengukuran elektrokimia (voltametri siklik)
dari Aspergillus niger dan minyak parafin dilakukan dengan menggunakan konfigurasi 3
(mineral oil) diperoleh dari Sigma. Karbon elektroda dengan elektroda karbon pasta
aktif, p-benzokuinon (Q), D-glukosa diperoleh modifikasi sebagai elektroda kerja, elektroda
dari Merck dan digunakan tanpa pemurnian lembaran platina (flag) sebagai elektroda
lebih lanjut. Beberapa reagen lain untuk counter dan Ag/AgCl sebagai elektroda
pembuatan elektrolit (KH2PO4, K2HPO4.3H2O pembanding yang dihubungkan dengan sebuah
dan KCl) diperoleh dari Merck dengan tingkat potensiostat. Pengukuran dilakukan di bawah
kemurnian tinggi (analytical grade). Larutan kondisi atmosfer nitrogen (N2)
elektrolit bufer fosfat pH 7,0 diatur dengan
3. Hasil dan pembahasan
menambahkan larutan encer NaOH atau HCl
menggunakan Orion pH meter. Larutan stok 3.1. Komposisi material elektroda
Percobaan pendahuluan pembuatan karbon
glukosa dibiarkan bermutarotasi selama 24 jam
pasta dilakukan dengan memvariasikan
pada temperatur 4 oC sebelum digunakan.
sejumlah tertentu karbon aktif dan mineral oil.
Pengukuran elektrokimia dilakukan
Hal ini umum dilakukan pada pembuatan
mengunakan potensiostat (VersastatTM Model
elektroda bebasis karbon. Yang menjadi acuan
270/250 dari Perkin Elmer) yang dihubungkan
pada eksperimen ini adalah diperolehnya
dengan personal komputer.
kondisi fisik elektroda (kekuatan/kerapuhan)
2.2. Pembuatan elektroda karbon pasta dan hambatannya. Dari hasil percobaan yang
Elektroda kerja yang digunakan pada dilakukan diperoleh komposisi optimum 65%
percobaan ini berbahan dasar karbon pasta. karbon dan 35% minyak parafin. Komposisi ini
Sebelum digunakan, serbuk karbon dipanaskan memberikan nilai hambatan yang relatif lebih
pada temperatur 70 oC selama 2 jam untuk kecil (74 Ω) dengan karakteristik fisik kualitatif
menghilangkan molekul yang terserap dan yang kuat berada di dalam tabung gelas selang
mengaktifkan permukaannya. Selanjutnya pasta waktu penggunaannya. Peningkatan minyak
dibuat dengan mencampurkan karbon aktif parafin sebesar 5% meningkatkan nilai
tersebut dengan minyak parafin dengan hambatan menjadi 120 Ω. Sedangkan
komposisi yang divariasikan ke dalam sebuah komposisi minyak parafin 5% di bawah
alat penghalus. Pasta yang telah terbentuk komposisi optimum tidak cukup efektif
44
(b)
22 (a)
00
A)
ii (( A)
-2
-2
-4
-4 tanpa
tanpa
benzo
benzokuino
kuinonn
-6
-6 benzo
benzokuino
kuinonn
-8
-8
-0.3
-0.3 -0.1
-0.1 0.1
0.1 0.3
0.3 0.5
0.5
EEvs
vs Ag/AgCl
Ag/AgCl (V)
(V)
Gambar 1. Kurva CV elektroda karbon pasta tanpa (a) dan dengan mediator Q (b) pada larutan
buffer fosfat 0,1 M pH 7,0 dengan scan rate 50 mV/s dalam atmosfer N2
2
2,5
0
2
-2
i (uA)
i (uA)
-4 1,5
-6
1
-8
0,5
-10
-12 0
-0,3 -0,2 -0,1 0 0,1 0,2 0,3 0,4 0,5 0 2 4 6 8 10 12 14 16
Benzoquinon (mg)
E vs Ag/AgCl (V)
(a) (b)
Gambar 2. (a) Kurva siklik voltamogram elektroda karbon pasta yang dimodifikasi oleh Q
dalam larutan buffer fosfat 0,1 M pH 7,0 pada scan rate 50 mV/s pada atmosfer N2. (b) Plot
tinggi puncak arus anoda terhadap Q yang digunakan
60
b
40
G
20
i (uA)
-20
-40
-60
-80
-0,3 -0,2 -0,1 0 0,1 0,2 0,3 0,4 0,5
E vs Ag/AgCl (V)
Gambar 3. Kurva siklik voltamogram elektroda karbon pasta yang dimodifikasi oleh Q dan
GOx dalam larutan buffer fosfat 0,1 M pH 7,0 pada scan rate 50 mV/s pada atmosfer N2 tanpa
(a) dan dengan (b) kandungan glukosa 0,1M
menyebabkan terdistorsinya tinggi puncak arus katoda yang menandakan proses redoks Q/H2Q
anoda, sehingga arus anoda mengalami tetap berlangsung. Pada penambahan glukosa
kejenuhan (saturated current). Fenomena 0,1 M ke dalam larutan uji, terlihat peningkatan
penting lain yang diamati adalah peningkatan Q arus yang sangat signifikan yaitu naik lebih dari
meningkatkan juga residual current yang 2 kali lipatnya. Ini menandakan bahwa reaksi
dihasilkan, karena semakin banyak gugus elektrokatalitik terjadi di permukaan elektroda
fungsi keton terprotonasi selama pemberian karbon pasta modifikasi. Skema rangkaian
muatan (charging) akan menarik ion bermuatan transfer elektron pada proses elektrokatalitik
berbeda ke permukaan elektroda. Hal ini yang terjadi di permukaan elektroda tersebut
menyebabkan permukaan elektroda dan larutan digambarkan dalam Gambar 4.
yang membentuk suatu kapasitor akan mampu
Eksperimen kontrol untuk mengetahui peran
menampung ion bermuatan lebih banyak lagi
mediator Q dalam proses elektrokatalitik
(Mariana, 2004). Berdasarkan hasil percobaan
elektroda modifikasi tersebut dilakukan dengan
ini, ditentukan komposisi optimum karbon,
melakukan voltametri siklik terhadap elektroda
minyak parafin dan Q berturut-turut sebesar
yang dimodifikasi hanya dengan enzim GOx
57,01%; 40,15% dan 2,85%
tanpa adanya mediator dalam larutan yang
3.2. Modifikasi elektroda karbon pasta mengandung konsentrasi glukosa 20 mM. Hasil
dengan glukosa oksidase (GOx) eksperimen kontrol tersebut dapat dilihat pada
Untuk keperluan analitis sebagai biosensor, Gambar 5. yang menunjukkan bahwa proses
elektroada karbon pasta dimodifikasi dengan faradaik tidak terjadi pada rentang potensial
enzim GOx. Gambar 3. merupakan kuva CV yang diberikan. Pusat aktif enzim GOx-falvin
dari elektroda yang dimodifikasi dengan enzim adenin dinukleotida(FAD)- merupakan spesies
GOx dalam larutan buffer fosfat 0,1 M pH 7,0 elektroaktif. Walaupun demikian proses
tanpa (a) dan dengan kandungan glukosa 0,1 M faradaik yang melibatkan proses redoks
(b). Terlihat bahwa walaupun di uji dalam FAD/FADH2 tidak teramati. Hal ini dapat
larutan tanpa kandungan glukosa, pada kurva dimengerti bahwa pusat aktif tersebut terisolasi
CV-nya tampak adanya puncak arus anoda dan (terselubungi) oleh protein sehingga tidak ada
2e- + 2H+
30
i ( A)
0
B uffer
-30
gluko sa 20 mM
-60
-0.3 -0.1 0.1 0.3 0.5
E (volt)
Gambar 5. Kurva CV elektroda karbon pasta yang dimodifikasi dengan GOx tanpa mediator
dalam larutan buffer fosfat 0, M pH 7,0 yang mengandung glukosa 0,1 M dengan scan rate 50
mV/s pada atmosfer N2.
70,00
150,0 60,00
100,0 50,00
50,0 40,00
i (uA)
I (µA)
0,0 30,00
20,00
-50,0
10,00
-100,0
0,00
-150,0
0 20 40 60 80 100 120 140
-0,3 -0,1 0,1 0,3 0,5
[Glukosa] / mM
E vs Ag/AgCl (V)
(a) (b)
Gambar 6 (a) Kurva koltamogram siklik sebagai fungsi konsentrasi glukosa berturut-turut 0;
4,98; 9,90; 14,78; 19,61; 24,69; 29,56; 39,32; 48,78; 58.25; 95.24; 122,01 mM. (b) kurva
kalibrasi respon i terhadap konsentrasi glukosa
kontak langsung dengan permukaan elektroda. dari perubahan kontrol kinetik (pada kisaran
konsentrasi rendah) menjadi reaksi yang
3.3. Aplikasi sebagai biosensor glukosa
dikontrol oleh transfer massa (pada kisaran
Untuk mengetahui kemampuan elektroda
konsentrasi lebih tinggi) (Gross et. al, 1995).
modifikasi tersebut memiliki respon yang baik
Dari Gambar 6(b). dapat pula dikalkulasi
pada aplikasinya sebagai biosensor, eksperimen
hubungan respon terhadap konsentrasi yang
voltametri siklik dilakukan dengan
memberikan nilai koefisien keliniearan
menambahkan larutan stok glukosa secara
mencapai 0,9929 dengan dynamic range sekitar
bertahap ke dalam sel elektrokimia. Gambar
60 mM glukosa .
6(a). menunjukkan hasil yang diperoleh dari
pengukuran tersebut. Dari kurva tersebut dapat 4. Kesimpulan
dilihat bahwa respon yang diberikan semakin Elektroda karbon pasta yang dimodifikasi
meningkat dengan bertambahnya konsentrasi dengan mediator benzokuinon dan enzim
glukosa dalam larutan. Sedangkan Gambar glukosa oksidase telah berhasil difabrikasi
6(b). Merupakan kurva kalibrasi arus respon (i) secara sederhana di laboratorium. Penetuan
terhadap konsentrasi glukosa. Terlihat bahwa komposisi materail penyusun elektroda tersebut
pada peningkatan konsentrasi glukosa sampai merupakan parameter penting diperolehnya
sekitar 30 mM masih memberikan peningkatan elektroda dengan kondisi fisik yang
respon yang linier. Peningkatan konsentrasi mendukung aplikasinya sebagai biosensor
glukosa selanjutnya tidak berpengaruh terhadap elektrokimia. Hasil pengujian dengan teknik
peningkatan arus (keadaan saturated). voltametri siklik menunjukkan bahwa elektroda
Perubahan respon yang dihasilkan sebagi akibat tersebut cukup responsif terhadap penambahan
glukosa dalam larutan. Kisaran kerja (dynamic L-lactate, Analytica Chimica Acta, 401 (1-2), 155-
range) elektroda sampai pada konsentrasi 162.
glukosa sekitar 60 mM dengan kelinieran Motta, N., Ana R.G., (1994), Activated carbon paste
berada pada kisaran 5-30 mM dimana electrodes for biosensors, Analytical Chemistry,
pengukuran kadar gula darah manusia mungkin 66(4), 566-571.
dilakukan. Penelitian ini memberikan implikasi Petel, H., Li X., Karan HI., (2003). Amperometric
bahwa dengan material yang sederhana, glucose sensors based on ferrocece containing
kemampuan lokal dalam hal rancang bangun polymeric electron transfer systems-a preliminary
biosensor dapat dilakukan dan ditingkatkan. report, Biosensors & Bioelectronics, 18 (8), 1073-
1076.
5. Ucapan terima kasih
Penulis mengucapkan terima kasih kepada Razola, S.S., Blankert B., Quarin G., Kauffman JM.,
Departemen Kimia atas Hibah Starter (2003). Phenothiazine drugs as mediators in
Penelitian yang diberikan untuk melaksanakan horseradish peroxidase bioelectrocatalysis,
penelitian ini. Analytical Letters, 36(9), 1819-1833.
Santha, H., Dobay R., Harsani G., (2003).
6. Daftar Pustaka
Amperometric uric acid biosensors fabricated of
Gros, P., Bergel A., (1995), Improved model of
various types of uricase enzymes, IEEE Sensors
polypyrrole glucose-oxidase modified electrode,
Journal, 3(3), 282-287.
Journal of Electroanalytical Chemistry, 399 (1-2),
107-107. Situmorang, M., Gooding J. J, Hibbert D. B.,
Barnett D., (2002), The development of a pyruvate
Kulys, J., (1999), The carbon paste electrode
biosensor using electrodeposited polytyramin,
encrusted with a microreactor as glucose biosensor,
Electroanalysis, 14 (1) 17-21.
Biosensors & Bioelectronics, 14, 473-479.
Wibowo, R., (2003), Novel approaches for enzyme
Mariana, F.R., (2005), Sensor glukosa secara
immobilization using latex polymers or carbon
voltametri siklilk dengan menggunakan elektroda
nanotubes: Application to enzyme biosensors,
karbon pasta yang dimodifikasi dengan glukosa
Master thesis: The University of New South Wales,
oksidase dan p-benzokuinon, Skripsi S-1,
Australia.
Departemen Kimia, Universitas Indonesia.
Wibowo, R., Joshua F., David B.H.,Robert G. G.,
Molina, C.R., Boutjita M., El Murr N., (1999), A
John J. G., (2003), Using the aggregation of latex
carbon paste electrode modified by entrapped
polymers in the fabrication of reproducible enzyme
toluidine blue-O for amperometric determination of
electrodes, Electroanalysis, 15(17), 1364-1368.
Rani Maharani1), Euis H. Hakim1), Yana M. Syah1), Lukman Makmur1), Lia D. Juliawaty1),
Sjamsul A. Achmad1), Ikram M. Said,2) Laily B. Din2), Jalifah Latip2)
1)
Kelompok Penelitian Kimia Organik Bahan Alam, Departemen Kimia, Institut Teknologi Bandung, Jalan
Ganeca 10 Bandung 40132, Indonesia
2)
School of Chemical Sciences & Food Technology, Faculty of Science and Technology, Universiti
Kebangsaan Malaysia, 43600 UKM Bangi, Selangor D.E., Malaysia
Abstrak
Satu senyawa stilbenoid, trans-4-isopentenil-3,5,2’,4’-tetrahidroksistilben (1), dan tiga
senyawa flavonoid, artokarpanon (2), kudraflavon C (3), dan artokarpin (4), telah diisolasi
dari ekstrak metanol kayu akar Artocarpus integer (Thunb.) Merr. Struktur senyawa tersebut
ditetapkan berdasarkan data spektroskopi UV, IR, 1H NMR dan 13C NMR, serta melalui
perbandingan langsung dengan data senyawa yang sama yang telah dilaporkan.
Kata kunci: Artocarpus integer (Thunb.) Merr., artokarpin, artokarpanon, kudraflavon C,
trans-4-isopentenil-3,5,2’,4’-tetrahidroksistilben
OH
OH
OH 7’
MeO O
OH
8’
OH
HO OH O
1 2
OH OH
HO O MeO O
OH OH
OH O OH O
3 4
OH
OH
OH
5
HO
penetapan titik leleh mikro Fisher-John. Lembaga Ilmu Pengetahuan Indonesia, Bogor,
Spektrum UV dan IR diukur masing-masing dan spesimennya tersimpan di herbarium
dengan spektrofotometer Varian Cary 100 tersebut.
Conc. dan ONE Perkin Elmer. Spektrum 1H
Ekstraksi dan isolasi. Kayu akar yang telah
NMR dan 13C NMR diukur menggunakan
dikeringkan dan digiling (2,3 kg) dimaserasi
spektrofotometer JEOL ECP400 yang bekerja
dengan metanol (9 l). Setelah pelarut diuapkan
pada 400,0 MHz (1H) dan 100,0 MHz (13C).
pada tekanan rendah, diperoleh ekstrak metanol
Kromatografi cair vakum (KCV) dilakukan
berupa residu berwarna cokelat tua (100 g).
menggunakan Si gel Merck 60 GF254,
Ekstrak metanol tersebut kemudian difraksinasi
kromatografi radial menggunakan Si gel Merck
dengan teknik kromatografi KCV
PF254, kromatografi tekan dengan Si gel Merck
menggunakan berturut-turut eluen heksana,
60 (400 mesh), analisis kromatografi lapis tipis
campuran heksana-etil asetat, etil asetat,
(KLT) pada pelat aluminium berlapis Si gel
campuran etil asetat-metanol, dan metanol
Merck Kieselgel 60 F254, 0,25 mm. Semua
dengan kepolaran yang terus ditingkatkan.
pelarut yang digunakan adalah yang berkualitas
Fraksi-fraksi yang diperoleh digabungkan
teknis yang didestilasi. Larutan 1,5% Ce(SO4)2
berdasarkan analisis KLT, menghasilkan tujuh
dalam 2N H2SO4 digunakan sebagai pereaksi
fraksi utama (A-G). Fraksi F dan G masing-
penampak noda.
masing difraksinasi lebih lanjut dengan teknik
Pengumpulan bahan tumbuhan. Bahan KCV menggunakan eluen heksana, campuran
tumbuhan berupa kayu akar Artocarpus integer heksana-etil asetat, etil asetat, dan campuran
(Thunb.) Merr. dikumpulkan pada bulan Juli etil asetat-metanol dengan kepolaran yang
2004 dari Kampung Sawah, Depok. Spesies ini terus ditingkatkan menghasilkan masing-
diidentifikasi oleh Herbarium Bogoriense, masing lima fraksi gabungan (F1-F5) dan enam
Pusat penelitian dan Pengembangan Biologi, fraksi gabungan (G1-G6). Gabungan fraksi F1-
F2-G1 (F1) difraksinasi lebih lanjut dengan Artokarpanon (2), diperoleh sebagai padatan
teknik KCV menggunakan eluen heksana, amorf berwarna putih kekuningan, t.l. 208-
campuran heksana-etil asetat, etil asetat, dan 210oC; UV (MeOH) λmaks (nm): 202, 229 (bh),
campuran etil asetat-metanol dengan kepolaran 286 dan 334; (MeOH + NaOH) ) λmaks (nm):
yang terus ditingkatkan menghasilkan lima 205, 286, dan 443; IR (KBr) νmaks (cm-1): 3405,
fraksi gabungan (F11-F15). Fraksi F13 3215 (OH), 2919 (C-H alifatik), 1640 (C=O),
dipisahkan lebih lanjut dengan teknik 1605, 1502, 1455, 1355 (C=C aromatik), 1157
kromatografi radial menggunakan eluen (C-O), dan 831 (benzena tersubstitusi para); 1H
campuran kroroform-heksana-metanol (9:1:0,5) NMR (aseton-d6, 400 MHz) δ (ppm): 5,73 (1H,
menghasilkan senyawa 1. Fraksi E (1,2 g) dd, J=2,9;13,0 Hz, H-2), 3,21 (1H, dd,
difraksinasi lebih lanjut dengan teknik KCV J=13,0;17,0 Hz, H-3ax), 2,74 (1H, dd, J=2,9;
menggunakan eluen heksana, campuran 17,2 Hz, H-3eq), 6,47 (1H, d, J=2,5 Hz, H-3’),
heksana-etil asetat, etil asetat, dan campuran 6,43 (1H, dd, J=2,2;8,4 Hz, H-5’), 7,32 (1H, d,
etil asetat-metanol dengan kepolaran yang J=8,4 Hz, H-6’), 6,05 (1H, d, J=2,2 Hz, H-6),
terus ditingkatkan menghasilkan empat fraksi 6,02 (1H, d, J=2,5 Hz, H-8), 3,84 (3H, s, -
gabungan (E1-E4). Fraksi E4 dipisahkan lebih OMe), dan 8,50;12,17 (OH); 13C NMR (aseton-
lanjut dengan teknik kromatografi radial d6, 100 MHz) δ (ppm): 75,4, 42,6, 198,1, 159,5,
menggunakan eluen campuran kloroform-etil 94,4, 168,7, 95,3, 164,6, 103,7, 117,3, 156,3,
asetat (9,5:0,5) menghasilkan delapan fraksi 103,4, 165,0, 107,9, 129,0, dan 56,1.
gabungan (E41-E48). Fraksi E46 dipisahkan
lebih lanjut dengan teknik kromatografi radial Kudraflavon C (3), diperoleh sebagai padatan
menggunakan eluen kloroform (100%) amorf berwarna kuning jingga, t.l. 97-100oC;
menghasilkan senyawa 2. Sedangkan fraksi E3 UV (MeOH) ) λmaks (nm): 203, 264, dan 322
dipisahkan lebih lanjut dengan teknik (bh); (MeOH + NaOH) ) λmaks (nm): 205, 269,
kromatografi radial dengan eluen kloroform dan 359; IR (KBr) νmaks (cm-1): 3382 (OH),
(100%) menghasilkan senyawa 3. Fraksi D (1,3 2963, 2924 (C-H alifatik), 1649 (C=O), 1620,
g) difraksinasi lebih lanjut dengan teknik KCV 1562, 1464, 1359 (C=C aromatik), dan 815
menggunakan eluen heksana, campuran (benzena tersubstitusi para); 1H NMR (aseton-
heksana-etil asetat, etil asetat, dan campuran d6, 400 MHz) δ (ppm): 6,38 (1H, s, H-8), 3,08
etil asetat-metanol dengan kepolaran yang terus (2H, d, J=6,9 Hz, H-9), 5,10 (1H, m, H-10),
ditingkatkan, menghasilkan empat fraksi 1,41 (3H, s, H-12), 1,55 (3H, s, H-13), 3,33
gabungan (D1-D4). Fraksi D4 kemudian (2H, d, J=6,9 Hz, H-14), 5,25 (1H, m, H-15),
dikristalisasi dengan campuran heksana-etil 1,75 (3H, s, H-17), 1,62 (3H, s, H-18), 6,53
asetat menghasilkan senyawa 4 (200 mg). (1H, d, J=2,2 Hz, H-3’), 6,48 (1H, dd,
trans-4-Isopentenil-3,5,2’,4’- J=8,4;2,2 Hz, H-5’), dan 7,14 (1H, d, J=8,4,
tetrahidroksistilben (1), diperoleh sebagai H-6’); 13C NMR (aseton-d6, 100 MHz) δ
padatan amorf berwarna cokelat muda, t.l. 200- (ppm): 162,1, 121,4, 182,9, 104,9, 159,9,
202oC; UV (MeOH) λmaks (nm): 216, 292, 303, 111,7, 162,4, 93,4, 157,0, 24,5, 122,7, 131,9,
25,8, 17,8, 21,9, 123,3, 131,3, 25,7, 17,6,
dan 328; (MeOH + NaOH) ) λmaks (nm): 205,
112,9, 157,2, 103,7, 161,4, 107,9, dan 132,1.
247, 292, dan 346; IR (KBr) νmaks (cm-1): 3291
(OH), 2963, 2925 (C-H alifatik), 1613, 1599, Artokarpin (4), diperoleh sebagai jarum
1509, 1451, 1429 (C=C), 1281, 1159 (C-O), berwarna kuning pucat, t.l. 174-177oC; UV
dan 855 (benzena tersubstitusi para); 1H NMR (MeOH) λmaks (nm): 203, 279, dan 320 (bh);
(aseton-d6, 400 MHz) δ (ppm): 6,55 (2H, s, H- (MeOH + NaOH) λmaks (nm): 205, 277, dan
2;H-6), 6,41 (1H, d, J=2,2 Hz, H-3’), 6,35 (1H, 347; IR (KBr) νmaks (cm-1): 3393 (OH), 2959,
dd, J=2,2;8,4 Hz, H-5’), 7,34 (1H, d, J=8,4 Hz, 2927, 2862 (C-H alifatik), 1621 (C=O), 1621,
H-6’), 7,24 (1H, d, J=16,4 Hz, H-7’), 6,79 (1H, 1479, 1452, 1352 (C=C aromatik), 1206 (C-O),
d, J=16,4 Hz, H-8’), 3,32 (2H, d, J=8,0 Hz, H- dan 847 (benzena tersubstitusi para).
1”), 5,30 (1H, t, J= 8,0 Hz, H-2”), 1,61 (1H, s,
H-4”), 1,74 (1H, s, H-5”), 8,18 (2H, s, OH-3;5), 3. Hasil dan Pembahasan
Senyawa 1 diperoleh sebagai padatan amorf
8,50 (1H, s, OH-2’), dan 8,69 (1H, s, OH-4’).
berwarna putih kecokelatan dengan titik leleh
200-202oC. Spektrum UV dalam metanol
4 - - 198,1 198,5
5 - - 159,5 160,0
6 6,05 (1H, d, J=1,0) 6,06 94,4 94,8
7 - - 168,7 169,1
8 6,02 (1H, d, J=2,5) 6,03 95,3 95,7
9 - - 164,6 165,1
10 - - 103,7 104,1
1’ - - 117,3 117,1
2’ - - 156,3 156,7
3’ 6,47 (1H, d, J=2,5) 6,52 (1H, d, J=2,2) 103,4 103,9
4’ - - 165,0 165,4
5’ 6,43 (1H, dd, J=2,5;8,4) 6,54 (1H, dd, J=2,2;8,0) 107,9 108,3
6’ 7,32 (1H, d, J=8,4) 7,42 (1H, d, J=8,0) 129,0 129,4
-OMe 3,84 (3H, s) 3,77;3,85 56,1 56,6
-OH 8,50;12,17 8,82;12,16 - -
*Artokarpanon (Lu, 1995)
memberikan serapan pada panjang gelombang (855 cm-1), –OH (3291 cm-1), dan C-O (1281,
216, 292, 303, dan 328 nm yang khas untuk 1159 cm-1). Adanya pita serapan untuk gugus -
senyawa golongan stilben. Penambahan reagen CH alifatik pada 2963, dan 2925 cm-1
geser NaOH menyebabkan pergeseran mengarahkan pada dugaan adanya gugus
batokromik sebesar 43 nm yang menunjukkan isoprenil pada kerangka stilben tersebut.
adanya gugus OH bebas. Dugaan adanya Spektrum 1H NMR menunjukkan adanya ikatan
stilben didukung oleh analisis spektrum IR rangkap trans disubstitusi terhadap dua karbon
yang menunjukkan adanya pita-pita serapan kuarterner dengan munculnya dua proton
untuk gugus C=C aromatik (1613, 1599, 1509, olefinik doblet (δH 7,24, d, J=16,4 Hz dan δH
1451, dan1429 cm-1), benzena tersubstitusi para 6,79, d, J=16,4 Hz), Adanya dua buah proton
menunjukkan adanya gugus isoprenil bebas analisis di atas disarankan bahwa senyawa hasil
pada cincin B. Gugus isoprenil dan gerakan isolasi adalah suatu flavon yang terisoprenilasi
rotasi ini akan menyebabkan halangan sterik pada posisi C-3. Spektrum 1H NMR
terhadap keplanaran sistem kromofor sinamoil memperlihatkan bahwa senyawa 3
sehingga konjugasi elektron pada sistem mempunyai tiga proton aromatik di cincin B
kromofor tersebut tidak dapat berlangsung yang muncul sebagai sistem ABX pada δH
baik. Penambahan reagen geser NaOH 6,53 (1H, d, J=2,2 Hz, H-3’), 6,48 (1H, dd,
menyebabkan pergeseran batokromik sebesar J=8,4;2,2 Hz, H-5’), dan 7,14 (1H, d, J=8,4
37 nm mengindikasikan bahwa senyawa 3 Hz, H-6’). Adanya sinyal-sinyal tersebut
memiliki gugus hidroksi bebas pada C-4’. menunjukkan bahwa cincin B dari senyawa 3
Spektrum IR dari senyawa ini memperlihatkan memiliki substituen OH pada C-2’ dan C-4’
gugus fungsi utama dari suatu flavon, dimana sebagaimana lazimnya flavonoid yang berasal
gugus C=O terkonjugasi muncul pada 1649 cm- dari tumbuhan Artocarpus. Adanya sinyal
1
dan vibrasi ulur C=C aromatik muncul pada singlet pada δH 13,40 adalah karakteristik untuk
1620-1359 cm-1, sementara serapan untuk gugus OH pada C-5 yang membentuk khelat
gugus –OH terlihat pada 3382 cm-1, selain itu dengan gugus karbonil pada C-4. Spektrum 1H
serapan C-H alifatik tampak didaerah 2963 dan NMR senyawa 3 juga memperlihatkan sinyal
2924 cm-1 yang memperkuat dugaan adanya pada δH 6,38 (1H, s, H-8) yang memberi
gugus isoprenil pada senyawa ini. Berdasarkan petunjuk bahwa pada cincin A tersubstitusi
oleh gugus OH pada posisi C-5 dan C-7 dan dan 4 diketahui bersifat sitotoksik terhadap sel
substituen isoprenil pada posisi C-6. Dari murine P-388 dengan aktivitas yang kuat,
analisis spektrum 1H NMR tersebut, maka dengan nilai IC50 berturut-turut 3,30 dan 1,90
dapat disarankan bahwa senyawa 3 adalah µg/mL (Hakim, 1998). Senyawa 4 dilaporkan
5,7,2’,4’-tetrahidroksi-3,6-diisoprenil-flavon juga dapat menghambat transport asam amino
atau kudraflavon C. Bukti lain yang menunjang leusin melalui membrane usus ulat sutera
analisis ini adalah dari spektrum 13C NMR Bombyx mori, dengan nilai IC50 3,65 mmol/L
yang menunjukkan adanya 25 atom karbon , 6 (Parenti, 1997).
diantaranya adalah karbon jenis oksi aril (δC
4. Kesimpulan
157,0, 157,2, 159,9, 161,4, 162,0, 162,4), satu
Dari ekstrak metanol kayu akar A. integer telah
karbon karbonil pada δC 182,9, empat karbon berhasil ditemukan satu senyawa stilben
metil (δC 17,6, 17,8, 25,7, 25,8), serta dua terprenilasi, trans-4-isopentenil-3,5,2’,4’-
karbon metilen (δC 21,9, 24,5). Bukti tambahan tetrahidroksistilben (1), satu senyawa turunan
spektrum 1H dan 13C NMR yang menunjang flavanon, artokarpanon (2), dan dua senyawa
struktur senyawa 3 adalah dengan flavon terprenilasi, kudraflavon C (3) dan
membandingkan data spektrum 1H dan 13C artokarpin (4). Hasil uji biologis menunjukkan
NMR dengan data yang sama dari kudraflavon bahwa senyawa 1 memiliki aktivitas sebagai
C yang telah dilaporkan sebagaimana anti malaria dengan EC50 sebesar 8,2 µg/mL
dinyatakan pada Tabel 3. Sedangkan senyawa 3 dan 4 bersifat sitotoksik
Senyawa 4 diperoleh sebagai kristal jarum terhadap sel murine P-388 dengan nilai IC50
berwarna kuning pucat dengan titik leleh 174- berturut-turut 3,30 dan 1,90 µg/mL Hasil
177oC. Spektrum UV senyawa ini dalam penelitian ini memberi gambaran bahwa
metanol memberikan serapan maksimum pada tumbuhan dari genus Artocarpus ini berpotensi
λmaks 320 (bahu) (pita I) dan 279 (pita II) nm. sebagai sumber bahan kimia yang bermanfaat.
Pola spektrum UV ini mengindikasikan flavon 5. Ucapan Terimakasih
yang terisoprenilasi pada C-3. Penambahan Ucapan terimakasih disampaikan kepada staf
reagen geser NaOH memberikan pergeseran Herbarium Bandungense Departemen Biologi,
batokromik sebesar 39 nm pada pita I, yang Institut Teknologi Bandung yang telah
menunjukkan adanya gugus -OH bebas pada mengidentifikasi spesimen tumbuhan.
posisi C-4’ dicincin B. Keberadaan gugus -OH
ini didukung oleh spektrum senyawa 4. yang 6. Daftar Pustaka
menunjukkan adanya pita serapan pada 3393 Achmad, S.A., Hakim, E.H., Juliawaty, L.D.,
cm-1.Spektrum senyawa 4 juga memperlihatkan Makmur, L., Suyatno, Aimi, N., dan Ghisalberti,
E.L. (1996). “New Prenylated Flavone from
serapan untuk gugus fungsi utama dari suatu
Artocarpus champeden”, J.Nat.Prod., 59, 878.
flavon yaitu serapan karbonil pada 1621 cm-1
dan vibrasi ulur C=C aromatik (1352-1621 cm- Boonlaksiri, C., Oonanat, W., Kongsaeree, P.,
1
), sementara serapan untuk C-H alifatik terlihat Kittakoop, P., Tanticharoen, M., dan Thebtaranonth,
pada 2959 cm-1. Data spektrum IR senyawa 4 Y. (2000). “An Antimalarial Stilbene from
Artocarpus integer”, Phytochemistry, 54:4, 415-418,
tersebut identik dengan data yang sama dari
Abstract.
artokarpin yang sebelumnya telah diisolasi dari
tumbuhan A. champeden (Hakim, 1998). Bukti Hakim, E.H., Marlina, E.E., Mujahidin, D.,
tambahan terhadap senyawa 4 diperoleh dari Achmad, S.A., Ghisalberti, E.L., dan Makmur, L.
hasil perbandingan KLT antara senyawa 4 (1998). “Artokarpin dan Heteroflavanon-A, Dua
Senyawa Bioaktif dari Artocarpus champeden”,
dengan senyawa artokarpin yang
Lembaga Penelitian ITB.
memperlihatkan nilai Rf yang sama pada tiga
sistem eluen yang berbeda. Dengan demikian Hakim, E.H., Fahriyati, A., Kau, M.S., Achmad,
dapat disimpulkan bahwa senyawa 4 adalah S.A., Makmur, L., Ghisalberti, E.L., dan Nomura, T.
artokarpin. (1999). “Artoindonesianins A and B, Two New
Prenylated Flavones from the Root of Artocarpus
Senyawa 1 diketahui menunjukkan aktivitas champeden”, J.Nat.Prod., 62:4, 613-615, Abstract.
anti malaria in vitro terhadap P. falciparum Hano, Y, and Nomura, T, Heterocycles, 1990, 31
dengan harga EC50 sebesar 8,2 µg/mL (7), 1339-1344
(Boonlaksiri, 2000). Selain itu juga, Senyawa 3
Heyne, K. (1987). “Tumbuhan Berguna Indonesia Parenti, P., Pizzigoni, A., Hazonet, G., Hakim, E.H.,
II”, Jilid II, Yayasan Sarana Wana Jaya, Jakarta. Makmur, L., Achmad, S.A., dan Giordana, B.
(1997). “A New Prenylated Flavone from
Kundu, G.C., dan Sinha, N.K. (1989). “Purification
Artocarpus champeden Inhibits the K+-Dependent
and Characterization of Proteinase Inhibitor from
Amino Acid Transport in Bombyx mori Midgut”,
Artocarpus integrifolia”, Phytochemistry, 28:3, 725-
Biochem. Biophys. Res. Communic.
728, Abstract.
Syah, Y. M., Achmad, S.A., Ghisalberti, E.L.,
Likhitwitayawuid, K., dan Sritularak, B. (2001). “A
Hakim, E.H., Makmur, L., dan Mujahidin, D.
New Dimeric Stilbene with Tyrosinase Inhibitory
(2002). “Artoindonesianis Q-T, Four Isoprenylated
Activity from Artocarpus gomezianus”, J.Nat.Prod.,
Flavones from Artocarpus champeden Spreng.
64:11, 1457-1459, Abstract.
(Moraceae)”, Phytochemistry, 61:8, 949-954,
Lu, C. –M., Lin, C. –N., Huang, P. –L., Abstract.
Phytochemistry, 1995, 39 (6), 1441-1451
Zerega, Noor, dan Motley. (2004). “Artocarpus
Lu, Y., Lin, C., Ko, H., Yang, S., Tsao, L., dan Phylogeny”, dalam In Preparation for Post Doctoral
Wang, J. (2003). “Novel Anti-inflamatory Research, http://geo.cbs.umn.edu/~nyree/
Constituents of Artocarpus rigida”,
Helv.Chim.Acta., 86:7, 2566-2572, Abstact.
Abstract
One of the major problem facing oil processing industries is the accumulation of oil sludge
contaminated with naturally occurring material (NORM). This is generated through the
reprocessing of crude oil drawn from the ground with numerous concentration of natural
radionuclides of 238U, 232Th, 226Ra and 40K. One of the common method is through the storage
of the oil sludge. But due to large volume accumulated through the years these have pose a
major problem in term of storage space and of the level of radioactivity concentration
present. This study was conducted to see whether a suitable alternative method such as
incineration can be employed in the disposal of oil sludge contaminated with NORM. The
specific activity of NORM were determined using HPGe-Gamma spectrometry system, The
result shows that the specific radioactivity of 238U, 232Th, 226Ra and 40K after incineration at a
temperature of 1150 0C indicate no significant risk of external exposure to both personnel and
environment. This suggest a suitability of using incineration method in disposal of the NORM
contaminated oil sludges.
Key words: oil sludge, natural radionuclides, 238U, 232Th, 226Ra and 40K, incineration.
radiation measurements were conducted at the the specific activity for 238U increases from
storage site of a Crude Oil Terminal in the East 25.3 Bq/kg to 97.3 Bq/kg. Estimates have
Coast of Malaysia and at the Waste shown that total activity of 238U decreases by
Management Centre in Seremban, Negri 4.4 % compared to 13.9 % for 232Th after
Sembilan, Malaysia, before and after incineration. A much higher loss in 226Ra of
incineration using portable survey meters. Area about 34.3 % is because of its lower meting
and personnel monitoring using point ( < 1000 0C). Estimates of the loss for
238
thermoluminescent dosimetry (TLD 4500 U and 232Th are acceptable due to the
Harshaw-Bicron) system with TLD100H inhomogeneity of NORM in oil sludge waste
chipstrates, were conducted at various location used.
of the incinerator complex and to every
4. Conclusions
personnel involved during incineration and
There no significant increase in terms of dose
storage.
exposure to the workers and the environment.
Oil sludge waste that have been incinerated NORM specific activity level in local oils
were in the form of ash and slag, where activity sludge wastes is low and is comparable to
for 238U 232Th, 226Ra and 40K were counted normal soil. Incineration process used have
using a calibrated HPGe-PCA system. reduced the weight of oil sludge waste by half.
Identification and activity counts were done The study shows that the incineration of
using SAMPO 90 with SRM IAEA 375 (Soil) NORM contaminated oil sludge is one of the
as standard. most suitable method of disposal in Malaysia.
3. Results and Discussion 5. Acknowledgements
The radiation dose at the Crude Oil Terminal We would like to thank supporting staff of the
was found to be between 0.10 – 0.20 µSv/hr Nuclear Science Programme, School of
while the radiation dose at the Waste Applied Physics in assisting this research.
Management Centre was 0.30 µSv/hr (before
6. References
incineration) and was between 0.25 – 0.35 Heaton, B. and Lambley, J. 1995. Tenorm in oil, gas
µSv/hr (after incineration). Both facilities gave and mineral mining. Appl. Radiat. Isot. 46: 577 –
different readings due to the geological 581.
structure of the area, with higher readings at the
Shawky, S., Amer, H. Nada, A.A., Abd El-
Waste Management Centre. There is a slight
Maksoud, T.M. and Ibraheim, N.M. 2001.
increase in radiation dose after incineration but Characteristics of NORM in the oil industry from
the value is very much less even for a normal Eastern and Western deserts of Egypt. App. Radiat.
clean area of about 2.5 µSv/hr. Isot. 55: 135 – 139.
The equivalent dose for various locations in the Amran Ab. Majid, Muhamad Samudi Yasir,
Waste Management Centre recorded values of Redzuwan Yahaya dan Suzana Abu Bakar. 2003.
between 52.22 – 142.08 µSv/month while for Analisis Radionuklid Tabii dalam Sampel Sisa
personnel radiation dose, values of between Enapcemar Petroleum Tempatan. Analytical
9.31 – 14.38 µSv/month. Chemistry: Application and Current Issues, pg 142
– 148.
A summary of NORM present and NORM
specific activity for the study are given in Table
1 and 2 respectively. Results have shown that
LAMPIRAN
Table 1: Summary of Specific Activities of NORM radionuclides in oil sludge wastes before and after
incineration (Bq/kg)
Sample Specific Activity (Bq/kg)
U-238 Ra-226 Th-232
Before After Before After Before After
Ash Slag Ash Slag Ash Slag
Range
7.2 – 12.9 –
17.5 – 37.5 26.4 – 81.7 13.6 – 18.0 13.7 – 20.3 6.0 – 9.6 23.6 – 44.2 13.4 – 14.2
28.2 30.0
Average 13.5 ±
25.3 ± 6.0 58.4 ± 19.9 15.8 ± 2.2 19.2 ± 3.5 7.7 ± 1.8 21.6 ± 5.6 43.1 ± 11.8 13.7 ± 0.4
7.8
Total
Estimates 97.24 30.68 31.97 14.95 71.76 26.60
activity
loss 133.84 127.92 71.42 46.92 114.26 98.36
(Bq/kg)
% change
- 4.42 - 34.30 - 13.91
(+/-)
Table 2: Summary of Specific Activities of NORM radionuclides in oil sludge wastes before and after
incineration (Bq/kg)
Sample Specific Activity (Bq/kg)
Th-228 (Ra-228) K-40
Before After Before After
Range 12.6 – 18.6 23.7 – 48.2 13.5 – 15.1 238.1 – 410.4 563.2 – 1004.9 257.8 – 336.6
Average 15.8 ± 2.3 41.5 ± 9.2 14.13 ± 0.9 322.6 ± 53.1 873.5 ± 166.6 291.2 ± 40.7
Total 69.10 27.44 1454.4 565.5
Estimates
activity loss
(Bq/kg) 83.58 96.54 1706.6 2019.9
% change
+ 15.50
(+/-) + 18.36
*Notes : Total Activity Estimates (kBq) = average specicic activity of radionuclides (Bq/kg) x total
sample weight (kg). For initial NORM activities (before incineration, weight used = 6250 - 960 = 5290
kg)
Abstrak
Tongkol dried fish (Ikan Kayu Tongkol) is lumps of less salted dried fish usually used as
popular ingredient for some traditional fish dishes in Aceh as well as in Malaysia. In Japan it
is further processed to Katsou-bushi for preparation of special sup. The objective of this
research was to find out water relation parameters in the less salted dried fish as related to
shelf life, characteristic changes during storage and estimate analysis of it’s expired date.
Dried fish samples were eguilibrated in 15 levels of RH at 280C and their equilibrium
moisture contents were determined.
Moisture sorption isotherm derived from the correlation of equilibrium moisture content data
indicated a typical sigmoidal curve implying 3 regions of water adsorption. The water
sorption regions accounted for three fractions of bound water as analyzed using three
different mathematical models. The firs water fractions ranged 0 – 5.95 %, the second 5.95 –
17.52 % and the third fraction ranged 17.52 – 91.12 % dry basis, equivalent to 0 – 5.6 %, 5.6
– 14.9 % and 14.9 – 47.4 % wet basis respectively.
Keywords : Tongkol, dried, sorption isotherm
790
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Rita Hayati, Aminah Abdullah, Mohd.Khan Ayob, Soewarno T. Soekarto
sekunder dan air terikat tersier. Menurut bagi produsen ikan kayu tongkol. Data ISA
Anguilera dan Stanley (1990) dan Fellow ikan kayu tongkol sangat penting untuk
(1992), keunikan bentuk kurva ISA disebabkan memahami daya simpan, kondisi pengeringan
oleh perbedaan struktur fisik, komposisi kimia dan parameter kritikal pada pengeringan dan
dan kondisi pengikatan air didalam bahan penyimpanan.
pangan.
2. Percobaan
Nilai aw dan Me merupakan variable yang dapat Dalam penelitian ini digunakan bahan ikan
digunakan untuk analisis pendugaan kerusakan kayu tongkol yang dibuat di Malaysia dan 15
pangan atau untuk menentukan waktu jenis bahan kimia untuk mengatur kelembaban
pengeringan yang diperlukan untuk stabilitas relatif (RH) dalam desikator. Bahan kimia
produk. Labuza (1984) menyatakan bahwa aw diperoleh dari Jurusan Teknologi Pangan dan
bahan pangan sangat menentukan kondisi Gizi IPB, Bogor. Untuk mengatur RH desikator
penerimaan atau kehilangan air dari bahan digunakan larutan garam jenuh (Tabel 1).
pangan, sehingga dikembangkan model
Peralatan yang digunakan dalam penelitian ini
matematik yang dapat digunakan untuk
terdiri dari peralatan gelas untuk penyiapan
memperkirakan umur simpan produk. Tidak
larutan garam jenuh, desikator kecil untuk
adanya data dan informasi umur simpan pada
penentuan isotermi sorpsi, inkubator suhu 28
ikan kayu tongkol, memerlukan penelitian lebih 0
C untuk penempatan desikator, alat pengering
lanjut.
kemoreaksi oven bersuhu 105 0C untuk
Ikan kayu yaitu suatu produk ikan kering menentukan kadar air, neraca analitik dan
ukuran besar dengan pemberian sedikit garam desikator besar berisi gel silika.
dan menjadi bahan dasar untuk pengolahan
Masing masing larutan garam jenuh dibuat
lebih lanjut. Di Aceh ikan kayu banyak
sebanyak 100 ml untuk setiap desikator. Bahan
digunakan untuk pembuatan masakan seperti
contoh ikan kayu diturunkan kadar airnya
tumis ikan kayu, asam ke’eng dan otak-otak.
dengan pengering kemoreaksi sampai tercapai
Di Jepang ikan kayu diolah lebih lanjut menjadi
kadar air 2 %. Contoh ditimbang kurang lebih
Katsou-bushi yang sangat populer sebagai
2 garam kemudian dimasukkan ke dalam
bahan pembuatan sup (Akio Kanazawa, 1961).
cawan dan disetimbangkan di dalam desikator.
Penelitian ini bertujuan untuk menentukan ISA Desikator disimpan dalam ruang inkubator
pada ikan kayu tongkol serta untuk menentukan suhu 280C, dan setiap hari dilakukan
kondisi proses penggudangan dan penimbangan contoh sampai setimbang.
penyimpanan. Informasi tersebut dapat Keseimbangan kadar air bahan contoh
digunakan untuk dijadikan bahan penyuluhan kemudian diukur dengan metoda oven (AOAC,
Tabel 1. Nilai RH uadara di atas larutan garam jenuh dan keseimbangan kadar air (Me) ikan kayu
tongkol pada suhu 28 0C.
Aktivitas air kritikal sangat penting dan terkait dimana adalah Y kadar air dan x aktivitas air.
dengan stabilitas atau kerusakan produk kering. Dengan memasukkan nilai x = aw = 1, pada
Apabila reaksi deteriorasi kimiawi terjadi pada rumus (7) maka diperoleh nilai Y yaitu nilai
daerah fraksi air kedua maka kerusakan produk kapasitas air terikat tersier (Mt) = 91.2 %.
kering oleh pertumbuhan mikroba terjadi di Dengan cara extrapolasi manual (Gambar 2)
daerah fraksi air ketiga. Aktivitas air dapat diperoleh nilai Mt = 90 % bk.
memberikan indikasi batas terendah untuk Ikan tongkol segar sebelum dikeringkan dan
pertumbuhan mikroorganisme tahan garam (aw hasilnya setelah menjadi ikan kayu disajikan
0.60), sebagian besar jamur (aw 0.80), yeast (aw pada Gambar 3. Sebelum diproses lebih lanjut
0.87) dan bakteri patogen (aw 0.91) (Aguilera biasanya ikan kayu disimpan dalam wadah
dan Stanley, 1999). sebagai persediaan (stok) bahan pangan.
Analisis Air Terikat Tersier Berbagai analisis telah dihasilkan parameter
Daerah air terikat tersier merupakan daerah kritikal yang berguna untuk prediksi
fraksi air ketiga yang terikat lemah dan karakteristik daya simpan ikan kayu tongkol
mempunyai sifat mendekati air bebas (bulk (Tabel 3). Dari ketiga batas daerah sorpsi air
water). Pada daerah ini mikroba dapat tumbuh Tabel 3 dapat diperoleh besarnya fraksi air
dan produk akan dirusak oleh pertumbuhan terikat masing-masing primer (ATP) 5.95 %,
mikroba. sekunder (ATS) 11.57 % dan tersier (ATT)
Penentuan kapasitas air terikat tersier 73.68 %.
didasarkan pada konsep bahwa air bebas (air
Tabel 3.Parameter kritikal ikan kayu tongkol dan prediksi karakteristik produk dalam penyimpanan
Gambar 1. Kurva ISA dan plot ISA menurut plot BET, plot logaritma, plot polinomial
ordo 2 dari ikan kayu tongkol
Gambar 2. Ekstrapolasi Pada Penentuan Air Terikat Tersier Ikan Kayu Tongkol
Gambar 3A. Ikan tongkol segar (Euthynnus affinis) Gambar 3B. Ikan kayu tongkol
X ATP) dan tersier (ATT) 73.6 % bk (12 X and Water Activity Shift to Two Dehydrates
ATP). Foods.Journal Food Science (50) : 385-391.
Application of Cluster Variables and Factor Analysis in Al (III) sensor using PAN sol
gel film entrapment
Abstract
This is a novel study about the application of multivariate analysis in terms of clustering
variables and factor analysis to determine factors affecting error index in terms of learning
rate, training cycles and hidden neuron which are key variables in order to minimize error
index in neural network training. The case study used in this network training is related with
Al (III) sensor employing 1-(2-pyridylazo)-2-naphthol (PAN) doped in sol gel film based on
fluorescence measurement. A 6.1 version Matlab toolbox has been used to conduct the feed
forward network training with back propagation technique. Using the sorted rotated loadings
under varimax rotation, the results show good performance in error index display in terms of
0.0005 learning rate, 3000 training cycles and 25 hidden neurons. The invention can be used
as a noteworthy contribution to chemometric application combined with optochemical sensor.
Keywords: cluster variables; factor analysis ; error index ; network training
Table-1
The operational setting for network training
Parameter Value
Group A B C D E F G H L M N K
lr 0.001 0.001 0.001 0.001 0.0001 0.0001 0.0001 0.0001 0.0005 0.0005 0.0005 0.0005
epoch 1000 1000 1000 1000 2000 2000 2000 2000 3000 3000 3000 3000
neuron 30 3 25 7 25 7 30 3 30 3 25 7
1 10.50 16862 21.05 619 14.01 94.79 12.41 2001 5.25 2648 4.25 109.27
2 13.68 80255 12.29 886 13.14 105.24 8.41 1942 6.71 5145 5.80 172.56
3 8.92 19062 19.63 516 12.23 95.17 8.24 1964 4.78 3162 6.64 63.77
4 13.68 16089 14.78 463 24.41 120.26 11.83 2041 5.88 14084 5.43 57.75
….. …… …… ….. …… …… …… …… …… …… …… …… ……
11 14.37 18841 7.85 1232 11.74 101.44 12.81 2105 9.67 11954 8.80 62.93
12 6.95 4647 25.82 1078 8.63 110.99 16.81 2003 5.34 13830 6.62 207.70
13 13.70 5080 11.66 1069 16.61 118.94 18.42 1900 6.16 5118 8.11 71.92
14 22.09 6050 8.59 1591 25.71 100.28 22.82 2136 4.72 3635 4.64 80.10
15 11.41 16854 6.16 910 17.82 100.04 17.73 2000 5.00 4790 3.68 85.64
software. The matrix of data groups (Table-2) likely to possess higher hidden neuron
have been simulated under amalgamation steps numbers. In this factor analysis, as we can see
with average linkage in cluster variables. After from the scree plot (Fig.3) only two
processing by cluster variables, the reduced components are suitable to be extracted based
groups have been algorithm simulated under on their eigen values. From the loading plot
sorted rotated loadings using varimax rotation (Fig.4) groups C and G are dominant to the
with maximum likelihood factor analysis. learning rate factor, while the other three
groups (A, L and N) are likely to the epoch
3. Results and discussion
factor. The so-called epoch factor is respect to
Fig.1 displays the error index progress which
higher epoch numbers in the dominant group L,
presented by typical smooth convergence
while the so-called learning rate factor
performances executed under 0.0001 learning
corresponding to group C.
rate, 2000 epochs and for respective 3, 7, 25
and 30 hidden neurons. The display results From Table-4, the varimax rotation is used in
expressed as error index data shown in Table-2 order to ensure that the resulting factors are
have been used in cluster analysis. uncorrelated (Kallithraka et al., 2001), while
the sorted rotated loadings are taken in order to
Table-3 shows the output data of the cluster
obtain more accurate results. In this study, the
variables with average linkage method and
factor analysis has been taken in order to
displayed in a dendogram (tree diagram)
estimate the effect of learning rate, epoch and
illustrated in Fig.2. From the final partition
hidden neuron on error index contributing by
(Table-3) the original 12 groups are
selected groups and to measure the variance
compressed to 5 groups which further
within each selected group.
examined by factor analysis.
In Table-4, the highest value in factor 1 (sign
The selected five groups (A,C,G,L and N) are
neglected) is contributed by group G, while
based on their low error index values in order
group L is dominating in factor 2. This
to meet the network training target and all are
information indicates that the two groups (G
Fig.1 The progress display of error index under 2000 epoch with lr 0.0001 at different number of hidden neuron, i.e.
(a)3, (b)7, (c)25, (d)30
similarity
44.99
63.32
81.66
100.00
A D G E H B C K F M L N
group
Fig.2 A tree-diagram (dendogram) for error index among grouping data. based on similarity in squared Euclidean
distance
Step Number of Similarity level Distance level Clusters joined Final partition
clusters
1 11 77.42 0.452 C–K Cluster 1 A – D – E – G
2 10 74.70 0.506 F–M Cluster 2 B
3 9 73.50 0.530 D–G Cluster 3 C – K
4 8 67.77 0.645 D–E Cluster 4 F – L – M – N
5 7 65.96 0.681 F–L Cluster 5 H
6 6 60.17 0.797 A–D
7 5 59.70 0.806 F–N
8 4 54.11 0.918 C–F
9 3 52.75 0.945 A–M
10 2 46.20 1.076 B–C
11 1 44.99 1.100 A–B
and L) are the potential contributors to give position from the lowest value (factor 2). From
effect in error index. On the contrary, the the term of network training, the stability factor
lowest value in factor 2 contributed by group C is more important, thus group C is one to be
(G excluded) is an indication of stability in the chosen. However, the training target prefers to
error values, and group N taken the second choose group N on account of very low noise,
0.9 L
epoch 0.8
1.0
factor 0.7
Eigenvalue
0.6
A
0.5
0.5 0.4
0.3
0.2 N
0.1
0.0 0.0 G C
1 2 3 4 5
Factor Number -0.8 -0.6 -0.4 -0.2 0.0 0.2 0.4
Fig.3 The extracting factors based on eigen value Fig.4. Loading plot of extracted data group
Factor Analysis: A, C, G, L, N
Maximum Likelihood Factor Analysis of the Correlation Matrix
Varimax Rotation
Sorted Rotated Factor Loadings
Geladi P., (1995). Sampling and local models for Ni Y., Zhang G., Kokot S., (2005). Simultaneous
multivariate image analysis, Mikrochim. Acta, 120, spectrophotometric determination of maltol, ethyl
211-230. maltol, vanillin and ethyl vanillin in foods by
multivariate calibration and artificial neural
Geladi P., Bengtsson E., Esbensen K., Grahn H.,
networks, Food Chem., 89(3), 465-473.
(1992). Image analysis in chemistry. Part 1.
Properties of images, greylevel operations, the Shya T.J. (2001). Penderia Rasa Pakai Buang:
multivariate image, TRAC, 11, 41-53. Alatan Analisis Baru berasaskan Penderia Global
dan Pengecaman Pola. Master Thesis, Department
Kallithraka S., Arvanitoyannis I.S., Kefalas P., El-
of Chemistry, Science University of Malaysia.
Zajouli A., Soufleros E., Psarra E., (2001).
Instrumental and sensory analysis of Greek wines; Zbytniewski R. & Buszewski B., (2004).
implementation of principal component analysis Characterization of natural organic matter (NOM)
(PCA) for classification according to geographical derived from sewage sludge compost. Part 2:
origin, Food Chem., 73(4), 501-514. multivariate techniques in the study of compost
maturation, Biresource Technol., (in press).
Abstract
The electrooxidation of ethanol to acetic acid in alkaline (0.1 M KOH) and acid (1.0 M
HClO4) has been studied on platinum wire electrodes. The electrochemical study by cyclic
voltammetry (CV) in different concentrations of ethanol and electrolyte (alkaline and acid). In
this research potential range oxidation of ethanol from 600-1065 mV in 0.1 M KOH and 700-
1125 mV in 1.0 M HClO4. Reaction yields of acetic acid and acetaldehyde was detected by
high performance liquid chromatography (HPLC).
Keywords: Ethanol, Platinum wire, Acetic acid, Electrooxidation, Product analysis
for low temperature fuel cells. Nevertheless, in Analyses were carried out by high performance
spite of an incomplete oxidation, the use of liquid chromatography (HPLC) equipment
ethanol can be of advantage because such composed of a pump (Waters 1515 Isocratic
oxidation products can be, depending on the HPLC Pump), a column (C18) and two
reaction conditions, either acetaldehyde or detectors an UV-visible detector (Waters 2487,
acetic acid. These products possess a high Duel λ Absorbance detector) and a differential
commercial interest. Its drawbacks are that refractometer set on line. Chromatograms were
ethanol is not easily evaporated at room recorded and integrated by an integrator-
temperature and not readily oxidized (Liao, calculator (Merck-Hitachi D-2500). All
et.al. 2004). Its non toxicity and its availability experiments were carried out at room
from biomass resources advocate (Lamy, et.al. temperature. The mobile phase of acetonitrile
2004). in 0.1% H3PO4 was applied during 5 min.
Research about ethanol electrooxidation for cell Experimental procedure
fuel and study mechanism reaction have done Electrolysis was performed in a solution of 0.5
many, but research of ethanol electrooxidation M ethanol in 0.1 M KOH or 1.0 M HClO4, at
for the electrosynthesis of acetic acid have room temperature. The electrochemical study
never been done. In this work we studied the by cyclic voltammetry (CV) and oxidation of
ethanol electrooxidation to acetic acid on ethanol by steady state potentiostatic method
platinum wire electrodes in alkaline and acid was performed in a polyethylene cell with a
medium. Platinum (Pt) is known as an inert platinum wire counter and working electrodes.
metal with a strong catalytic for many The potential of the working electrodes as
electrochemical reactions. Many components measured against a SCE reference electrode.
can be adsorbed on Pt surfaces and the Electrolysis samples were analyzed by high
adsorption of hydrogen is a well known performance liquid chromatography (HPLC).
phenomenon in electrochemistry. In this
3. Result and discussion
connection, the effect of electrolyte, time
electrolysis, concentration ethanol and Oxidation of ethanol in alkaline medium
Before running the electrolysis, cyclic
potential. These products were also confirmed
voltammetry was used to check the reactivity of
by HPLC.
ethanol on platinum wire in two different
2. Experimental media, perchloric acid and potassium
Solution and instrumentation hydroxide. The voltammograms allowed a
All solution were prepared with deionised choice of the convenient potential range to
water and analytical grade (Merck) chemicals. obtain a suitable rate of oxidation. Fig. 1a-1b.
1.0 M HClO4 and 0.1 M KOH was used as presents the voltammograms of a platinum wire
supporting electrolyte. Nitrogen were used to electrode in ethanol. Fig. 1a. presents the
deareate the solutions and to keep an air free voltammograms of a platinum wire electrode in
atmosphere over the solution during 10 min. ethanol with 0.1 M KOH and Fig. 1b.
Ethanol solutions were prepared by dilution of presents the voltammograms of a platinum wire
absolute ethanol (BDH laboratory supplies) electrode in supporting electrolyte 0.1 M KOH
with deionised water. (without ethanol).
A model PGZ 402 Universal Pulsa Dynamic From Fig. 1a. seen that oxidation of ethanol at
EIS, Voltammetry, Voltalab potentiostat was potential range -250 mV until 1600 mV there
used for electrochemical measurements and are two peaks. First peaks at area 600-1065
data acquisition was accomplished by using the mV. This peaks designate process oxidation
Voltamaster 4 software. Voltammetric from ethanol follow the following reaction
experiments were done in a three electrode cell mechanism by Periera, et.al. (2004) and Filho,
using a platinum wire working electrode, a et.al. (1998):
Ag/AgCl (saturated KCl) or SCE reference CH3CH2OH + 4OH- → CH3COOH + 3H2O + 4e-
electrode and a platinum wire as a counter
CH3COOH + CH3CH2OH → CH3COOCH2CH3 + H2O
electrode. All the potentials are given with
respect to the SCE reference electrode. From reaction of above ethanol
electrooxidation will yield acetic acid and of
ethyl acetate. Process forming of acetic acid
800
5
700
600 4
300 2
200
1
100
0 0
-100
-0.5 0.0 0.5 1.0 1.5 -0.5 0.0 0.5 1.0 1.5
Potential [ V] Potential [ V]
(a) (b)
Fig. 1. Cyclic voltammograms for platinum wire electrode in 0.1 M KOH 5.0 mL + 0.5 M ethanol 45.0
mL (a) and 0.1 M KOH (b). Scan rate: 10 mVs-1. Electrode surface area 1.0 cm2.
800
40
700
600
30
500
di [µA/cm²]
400
di [µA/cm²]
20
300
200
10
100
0 0
-100
-0.5 0.0 0.5 1.0 1.5 2.0 2.5 -0.5 0.0 0.5 1.0 1.5 2.0 2.5
Potential [ V] Potential [ V]
(a) (b)
Fig. 2. Potential squares for platinum wire electrode, up to the following positive potential limits 2500 mV
in (a) 0.1 M KOH 5.0 mL + 0.5 M ethanol 45.0 mL (b) 0.1 M KOH 5.0 mL. Scan rate: 50 mVs-1.
2
Electrode surface area 1.0 cm
told by Xia, et.el. (1997), passing mechanism and seen at Fig. 1b. At Fig 1b. seen there no
reaction on the surface of electrode of Pt the peaks at area 600-1065 mV of current density
following: very high. Of data above can be used by
C2H5OH + Pt(H2O) → Pt (C2H5OH) + H2O electrolysis reference with Chrono Coulometry
(CC) to know product oxidation of ethanol that
-xH+, -xe- is done at area 600-1065 mV. To support cyclic
PtC2H5OH + Pt → Pt (CO) + Pt(res)
voltammograms needed by potential squares
Pt(C2H5OH) → Pt (CH3CHO) + 2H+ + 2e- curve, because possibility there is too low
peaks like at CV of ethanol with KOH.
Pt(H2O) → Pt (OH) + H+ + e-
At Fig. 2. Potential squares with limit potential
Pt (CH3CHO) + Pt (OH) → CH3COOH+ H+ + e- + 2 Pt
2500 mV. Fig 2a. seen clearly there are three
-xH+, -xe peaks at potential above 500 mV. Peaks 1 at
Pt(CO).Pt(res) + Pt(OH) → CO2 + Pt potential 600 mV, second peaks at potential
1100 mV and third peaks at potential 1400 mV.
For second peaks (Fig 1a.) there are at area This peaks seen clearly if compared with CV
1100-1600 mV, this peaks represent area (Fig. 1b.), this matter because big enough water
oxidize from H2O with the following reaction: concentration. Potential squares oxidation of
ethanol happened at peaks 1 and 2 with area of
2H2O → 2OH. + 2H+ + 2e- Eo = 1,470 V (SCE)
around 500-1100 mV. Fig. 2b. potential squares
Oxidation process have to be ascertained to for KOH showing inexistence culminate at area
happened at ethanol, this matter is conducted
by special CV for electrolyte (0.1 M KOH)
200
400
150
200
100
Current density [µA/cm²]
-200 0
-5 0
-400
-1 0 0
-600
-1 5 0
-0.5 0.0 0.5 1.0 1.5 -0 .5 0 .0 0 .5 1 .0 1 .5
Pote ntial [ V] P o te n tia l [ V ]
(a) (b)
Fig. 3. Cyclic voltammograms for platinum wire electrode in 1.0 M 5.0 mL HClO4 + 0.5 M 45.0 mL
ethanol (a) and 1.0 M HClO4 (b). Scan rate: 10 mVs-1. Electrode surface area 1.0 cm2
3 .5
1000
3 .0
800 2 .5
2 .0
600
di [µA/cm²]
di [mA/cm²]
1 .5
400 1 .0
0 .5
200
0 .0
0
-0 .5
Potential [ V] P o te n tia l [ V ]
(a) (b)
Fig. 4. Potential squares for platinum wire electrode, up to the following positive potential limits 1500 mV
in (a) 1.0 M HClO4 5.0 mL + 0.5 M ethanol 45.0 mL (b) 1.0 M HClO4 5.0 mL. Scan rate: 50 mVs-1.
Electrode surface area 1.0 cm2
500-1100 mV. This matter show only happened squares can be used to assist to determine
oxidation at water. potential oxidation of ethanol. Curve of
potential squares can be seen at Fig. 4. From
Oxidation of ethanol in acid medium
Fig. 4a. seen peaks which is equal to CV of
Potential oxidation of ethanol at yielded by acid
ethanol at acid medium of area is oxidation of
medium of curve form which is very differ
ethanol happened at potential 600-1100 mV
from CV at alkaline medium, but area
and irrigate happened at potential above 1300
oxidation of ethanol much the same to with
mV. At Fig. 4b. curve of potential squares for
alkaline medium. CV of ethanol in acid
HClO4 to show there no peaks oxidation
medium can be seen at Fig. 3.
ethanol at area 600-1100 mV.
Fig. 3a. there are two peaks which also
Scan rate effects
designate oxidation of water and ethanol with
One of the way of to clarify oxidation area can
reaction of same at condition of alkaline. For
be done by boosting up scan rate. Scan rate
first peaks residing in at area of potential
effect can be seen at Fig. 5. Fig. 5a-d. seen
700-1125 mV and for second peaks residing in
excelsior of excelsior scan rate culminate and
at bigger potential 1125 mV. Fig. 3b.
excelsior of current density so that area
representing cyclic voltammograms of
oxidation of ethanol progressively looked to be.
electrolyte 1.0 M HClO4. There are difference
From Fig. 5. suggested to use big scan rate
between of alkaline medium and acid medium,
between 100-250 mVs-1 if will determine
of alkaline medium bigger density current
oxidation area. Besides its clear peaks looked
compared to at acid medium.
to be, analysis time become quickerly. At Fig.
Low peaks at CV of ethanol in acid complicate 5. The higher the scan rate, the bigger the
to determine oxidation area. Curve of potential peaks.
1 .5 1 .4
1 .0 1 .2
0 .5 1 .0
0 .6
-0 .5
0 .4
-1 .0
0 .2
-1 .5
0 .0
-2 .0
- 0 .2
-2 .5
-0 .5 0 .0 0 .5 1 .0 1 .5 -0 .5 0 .0 0 .5 1 .0 1 .5
P o te n tia l [ V ] P o t e n t ia l [ V ]
(a) (b)
1 .6 2 .5
1 .4
2 .0
1 .2
1 .0 1 .5
0 .8
1 .0
0 .6
0 .4 0 .5
0 .2
0 .0
0 .0
-0 .2 -0 .5
-0 .4
-0 .5 0 .0 0 .5 1 .0 1 .5 -0 . 5 0 .0 0 .5 1 .0 1 .5
P o te n tia l [ V ] P o te n tia l [ V ]
(c) (d)
Fig. 5. Scan rate effect on cyclic voltammograms for platinum wire electrode in 1.0 M HClO4 2.0 mL +
0.5 M C2H5OH 25.0 mL (a) Scan rate: 50 mVs-1 (b) Scan rate: 100 mVs-1 (c) Scan rate: 150 mVs-1 and (d)
Scan rate: 250 mVs-1. Electrode surface area 1.0 cm2
Table 1. Reaction yields of acetic acid obtained by the HPLC analysis of the electrolysis (E = 1065 mV)
experiments of 0.1 M KOH 2 mL + 0.5 M C2H5OH 25 mL. Electrode surface area 1.0 cm2
Electrolysis time Reaction yields (acetic acid %)
(minit) 0.1 M KOH 1.0 M HClO4
15 - -
30 7.83 2.37
120 30.21 8.99
240 49.22 17.24
conducted by electrolysis with surface of Lamy, C., Rousseau, S., Belgsir, E.M.,
broader electrode and other optimum condition. Countanceau, J.M., and Leger, (2004). Recent
progress in the direct ethanol fuel cell development
4. Conclusions of new platinum-tin electrocatalysts, Electrochim.
The electrochemical oxidation of ethanol on Acta. (49), 3901-3908.
platinum electrode in 0.1 M KOH and 1.0 M
Liao, S., Linkov, V., and Petric, L., (2004). Anodic
HClO4 was evaluated. Potential oxidation of oxidation of ethanol on inorganic membrane
ethanol in 0.1 M KOH at range 600-1065 mV. alkalined electrodes, Applied Catalysis, (258), 183-
Potential oxidation of ethanol in 1.0 M HClO4 188.
at range 700-1125 mV. From these cyclic
Pereira, M.G. Jimenez, M.D. Elizalde, M.P.
voltammetry experiments, the potential
Robledo, A.M. and Vante, N.A., (2004). Study of
program suitable for prolonged electrolyses the electrooxidation of ethanol on hydrophobic
was chosen at 1065 mV. Concentration effects electrodes by DEMS and HPLC. Electrochim. Acta.
at cyclic voltammograms is ever greater of (49), 3917-3925
concentration progressively go up density
Schmidt, V,M. and Iannielo, R., (1996).
current and will not influence area range of
Electrochemical reactivity of ethanol on porous Pt
potential oxidation of ethanol. According to and PtRu: Oxidation/reduction reaction in 1 M
result of HPLC analysis of longer ever greater HClO4. J. Phys.Chem. (100), 17901-17908.
electrolysis time of formed acetic acid.
Alkaline medium compared to good of acid Tarasevich, M.R, Karichev, Z.R., Bogdanovskaya,
medium to yield acetic acid. V.A, Lubnin, E.N., and Kapustin, A.V., (2005).
Kinetics of ethanol electrooxidation at RuNi
6. References catalysts, Electrochemistry Communications, (7),
Camara, G.A., de Lima, R.B., Iwasita, T., (2004). 141-146.
Catalysis of ethanol electrooxidation by PtRu: the
Thomas, C.M. and Fink, G.S., (2003) Ligand effects
influence of catalysts composition,
in the rhodium-catalyzed carbonylation of
Electrochemistry Communications, (6), 812-815.
methanol, Coor.Chem.Rev. (243), 125-142.
Chang, S.C, Leung, L.W.H. and Weaver, M.J.,
Tripkovic, A.V., Popovic, K.D. and Lovic, J.D.,
(1990). Metal crystallinity effects in electrocatalysis
(2001). The influence of the oxygen containing
as probed by real time FTIR spectroscopy:
species on the electrooxidation of the C1-C4
Electrooxidation of formic acid, methanol and
alcohols at some platinum single crystal surfaces in
ethanol on ordered low index platinum surfaces. J.
alkaline solution, lectrochim. Acta. (46), 3163-3173.
Phys. Chem. (94), 6013-6021.
Wang, X. Fang, K. Zhang, J. and Cai, T., (2002)
Filho, G.T., Gonzalez, E.R. Motheo, A.J. Belgsir,
Synthesis of acetic acid on Pd-H4SiW12O40 alkalined
E.M. Leger, J.M., Lamy, C., (1998).
catalysts by direct oxidation of ethylene. J. Natural
Electrooxidation of ethanol on gold: analysis of the
Gas Chem .(11), 51-56.
reaction products and mechanism, J. Electroanal.
Chem. (444), 31-39. Weinberg, N.L., (2002). Industrial organic
electrosynthesis with some advice on approaches to
Iwasita, I. Dalbeck, R. Pastor, E. and Xia, X.,
scaleup. Electrochemistry encyclopedia. New York.
(1993). Progress in the study of electrocatalytic
reaction of organic species. Electrochemica Acta. Wittcoff, H.A. Reubeun, B.G., (1996). Industrial
(39), 1817-1823. organic chemical. New York. A-wiley intersciences
publication.
Iwasita, I. and Pastor, E., (1993). A dems and FTir
spectroscopic investigation of adsorbed ethanol on Xia, X.H. Liess, H.D. and Iwasita, T., (1997). Early
polycrystalline platinum. Electrochemica Acta. (39), stages in the oxidation of ethanol at low index single
551-537. crystal platinum electrodes, J. Electroanal. Chem.
(437), 233-240.
Iwasita, I. Rasch, B. Catteneo, E, and Vielstich, W.,
(1989). A snifters study of ethanol oxidation on
platinum. Electrochemica Acta. (34), 1073-1079.
R.J. Talib, A.H. Hashim, J.J. Mohamed, M.S. Shaari, M.A. Hamid
Abstract
A commercial AISI 316 stainless steel was used as a substrate in this plasma carbonitriding
process using microwave plasma enhanced chemical vapour deposition (MPECVD)
technique. The substrates were subjected to four-difference methane, nitrogen, hydrogen
ratios of 89:1:10, 88:2:10, 87:3:10, 86:4:10. The other coating parameters such as
microwave power, deposition times and chamber pressure were kept constant throughout this
study. The effects of nitrogen, methane, hydrogen ratio on the hardness, tribological and
morphological characteristics on the carbonitrided samples were investigated using a pin-on-
disk tribometer, atomic force measurement (AFM), and scanning electron microscopy (SEM).
Test results showed that the nitrogen, methane and hydrogen ratio of 90:3:7 gives the best
mechanical and tribological characteristics on the carbonitrided specimens.
Keyword: plasma carbonitriding, AISI 316, MPECVD, AFM, SEM
(a) (b)
(c) (d)
Figure 1. 3D topographic image of AFM under different methane, nitrogen and hydrogen ratios, (a)
sample A (b) sample B (c) sample C, (d) sample D.
sample A was the lowest with a reading of microscopy under different nitrogen, methane,
600.4 HV. The microhardness increases with hydrogen ratios. The surface roughness
increasing methane gas up to 3 % with a properties of the carbonitrided samples show
reading of 752.2 HV and then reduces to 642.8 the same trend as the microhardness
HV when the methane gas increased to 4%. In characteristics when the methane gas ratio
this process carbonitriding reaction not only increased. Table 4 shows that the surface
occurs at the surface but also in the subsurface roughness of the carbonitrided sample becomes
region of the specimen owing to diffusion of rougher with increased methane ratio up to 3
the N and C atoms into the substrate. This %, and then becomes smoother again when the
phenomenon resulted in the formation of methane ratio increased to 4%. When the
carbonitrides and nitrides of iron, chromium methane and nitrogen ratio of 1:89 was
etc., in stainless steel, thus greatly enhances the introduced into the chamber (Figure 1a),
surface hardness of the carbonitrided sample. nitrogen and carbons atoms condense into
suitable nuclie site. A strong substrate/ coating
Surface Roughness
atom interaction result in low adatom mobility
Figure 1 shows 3D surface modulation of the
and a high density of nuclei. This phenomenon
carbonitrided surface obtained by atomic force
produced smaller grain size of the carbonated
layer with smoother surface. As the methane atoms in solid solution. It was observed that a
ratio increased up to 3 %, high adatom mobility smaller nitride and carbide grain participates
and ease for the nuclei to spread laterally which was deposited on the substrate surface when the
increases the formation of pores at the interface methane and nitrogen ratio of 1:89 was
(Figure 1a and 1c). Subsequently, increase the introduced into the chamber (Figure 2a). As the
surface roughness of the carbonitrided layer. methane gas increased to 2%, the agglomerate
Figure 1d shows the grain size becomes smaller of nitride and carbide participate is formed on
as well as decreases the pores intensity as a the substrate surface. Subsequently, when the
result of saturated formation of nitride and carbon ratio increased to 3 %, solubility limit of
carbide. nitrogen and carbon in the ferritic matrix will
be reached, and finally a coherent nitride and
Table 4: Surface roughness of carbide precipitates are formed on the
carbonitrided layer carbonitrided layer covering the substrate
Sample Surface roughness surface with pores as shown in Figure 3c.
Rms (nm) When the methane ratio increased to 4%,
A 125.1 formation of nitride and carbide is saturated,
B 219.8 resulting in the formation of smoother
C 362.4 carbonitrided layer (Figure 2d).
D 300.4 Friction and Wear
Test results showed that the plasma
carbonitriding process had reduced the friction
Microstructure coefficient (Figure 3). In the early stage of
The microstructure of untreated and sliding, a static alumina ball was sliding on the
carbonitrided samples under different methane, carbonitriding layer and the friction coefficient
nitrogen and hydrogen ratios is shown in Figure was about 0.2 for sample B, C, and D. Sample
2. Microstructural examination showed that the A coefficient reading was about 0.3. As the
N and C have mainly been incorporated into sliding progressed, the carbonitriding layer is
the existing iron lattice as interstitial atoms or started to deteriorate resulting increase in
as a finely dispersed alloy precipitate into the friction coefficient depending on the methane,
diffusion layer. Microstructure was changed by nitrogen, and hydrogen ratios. In this test, the
the introduction of single interstitial N and C carbonitriding layer still not damaged even
(a) (b)
(a) (b)
Figure 2. SEM images of plasma carbonitrided under different gas ratio (a) sample A, (b)
sample B, (c) sample C, (d) sample D
(a) (b)
(a) (b)
Figure 4. Optical micrographs of worn surfaces: (a) untreated (20x), (b) sample B (20x), (c) sample
C (20x), (d) sample D (20x).
after 20,000 laps (300 meters) of alumina Based on the hardness (Table 3), surface
sliding on it. If the carbonitriding layer had roughness (Table 4) and friction coefficient
damaged, the alumina ball will be slided on the (Figure 3) results, it was observed that there is
untreated surface. The friction coefficient no direct correlation between hardness, surface
reading shall show a reading of about 0.8, roughness with the friction coefficient. For
which is the reading of untreated sample as example, sample B and sample D had the same
shown in Figure 3. This indicates that the trend of friction coefficient even though had
carbonitriding layer had a good adhesion different hardness, surface roughness and
between the carbonitriding/substrate interface microstructure.
and at the same time reduces the friction
coefficient.
Abstrak
Senyawa kompleks nikel(II) dengan ligan N,N-dimetil-etilendiamin(dmed) telah disintesis dari
garam nikel tiosianat. Kompleks yang berhasil diisolasi merupakan kompleks berinti tunggal
dengan rumus kimia [Ni(dmed)2(NCS)2]. Senyawa kompleks ini berupa padatan kristalin
berwarna biru, dengan ligan tiosianat berkonfigurasi cis (pengukuran difraksi sinar-X
kristal tunggal). Spektrum VIS-NIR menunjukkan puncak serapan pada 10142 cm-1 yang
berarti kekuatan medan ligan dmed sedikit lebih lemah dari ligan en, ini disebabkan karena
adanya dua gugus metil pada ligan dmed. Hasil pengukuran kerentanan magnet kompleks
[Ni(dmed)2(NCS)2] menunjukkan kompleks bersifat paramagnetik normal untuk Ni(II) dengan
momen magnet 3,23 BM.
Kata kunci: nikel(II), dmed, kristal tunggal.
(ν3)
Absorbtivitas Molar
40
(ν2)
30 (ν1)
20
10
0
7500 12500 17500 22500 27500
Bilangan Gelombang (cm-1)
a
Kelompok Penelitian Kimia Organik Bahan Alam, Departemen Kimia, Institut Teknologi Bandung, Jalan
Ganeca 10, Bandung 40132, Indonesia
b
School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti
Kabangsaan Malaysia, 43600 UKM Bangi, Selangor D.E. Malaysia
Abstrak
Satu trimerstilben, ampelopsin E (1), dan satu tetramerstilben, vatikanol B (2), telah diisolasi
untuk pertama kali dari ekstrak aseton kulit batang Shorea mecistopteryx Rild. Struktur kedua
senyawa tersebut ditetapkan berdasarkan data spektroskopi meliputi data spektroskopi UV,
IR dan 1H-NMR serta dibandingkan dengan data sejenis dari senyawa yang sama yang telah
dilaporkan.
Kata kunci : Ampelopsin E, vatikanol B, Shorea mecistopteryx Rild., Dipterocarpaceae.
spektrum IR diukur dengan spektrofotometer d6, 400 MHz) δH senyawa 1 (ppm) lihat tabel
FTIR Perkin Elmer Spectrum One. Spektrum 1.
NMR ditentukan dengan JEOL JNM A500
yang beroperasi pada 400 MHz (1H) dan 100 Senyawa 2 diperoleh berupa serbuk coklat
MHz (13C). Kromatografi Vakum Cair (KVC) muda, t.l. 215-218oC; [α]20D –31o (c=0,1 dalam
dan Kromatografi Radial dilakukan dengan MeOH); UV (MeOH) λmaks 203, 229 (bahu),
menggunakan silika gel Merck 60 GF254, 279 nm; UV (MeOH+NaOH) λmaks 207, 249
sedangkan Kromatografi Lapis Tipis (KLT) (bahu), 288 nm; IR (KBr) νmaks 3369, 1613,
dikerjakan dengan plat aluminium berlapis Si 1514, 1453, 1337, 1243, 1174, 1007, 831 cm-1;
gel Merck Kieselgel 60 GF254 setebal 0,25 mm. 1
H-NMR senyawa 2 (aseton-d6, 400 MHz) δH
Semua pelarut yang digunakan berkualitas (ppm) lihat tabel 2.
teknis yang didestilasi terlebih dahulu sebelum
3. Pembahasan
digunakan kecuali CHCl3. Larutan 1,5%
Serbuk kulit batang Shorea mecistopteryx (3,0
Ce(SO4)2 dalam 2N H2SO4 digunakan sebagai
kg0 dimaserasi dengan aseton selama 24 jam.
pereaksi penampak noda.
maserasi diulang sebanyak tiga kali. Ekstrak
Bahan Tumbuhan. Bahan tumbuhan yang aseton (200 g) kemudian dicampur dengan eter
digunakan adalah kulit batang Shorea untuk mengendapkan tannin dan diperoleh
mecistopteryx yang diperoleh dari kebun ekstrak kering (92 g) yang relatif bebas tannin.
percobaan Darmaga, Bogor, Jawa Barat pada Sebagian dari ekstrak kering tersebut (20 g)
bulan Maret 2004. Contoh tumbuhan ini telah selanjutnya difraksinasi dengan KVC sehingga
diidentifikasi di Herbarium Bogoriense, Bogor, diperoleh 6 fraksi gabungan A - F (1.5 g, 8.8 g,
Indonesia. 2.3 g, 0.9 g, 8.3 g dan 6.2 g). Fraksinasi dan
pemurnian terhadap fraksi E dengan berbagai
Ekstraksi dan Isolasi. Serbuk kulit batang
teknik kromatografi menghasilkan senyawa 1
Shorea mecistopteryx Rild. (3,0 kg) dimaserasi
(51 mg) dan senyawa 2 (28 mg).
dengan aseton selama 24 jam, maserasi diulang
sebanyak tiga kali. Ekstrak aseton (200 g) Senyawa 1 diperoleh berupa serbuk berwarna
kemudian dicampur dengan eter untuk abu-abu, dengan titik leleh 197-199oC, [α]20D -
mengendapkan tannin. Filtrat diuapkan hingga 31 (c=0,1 dalam MeOH). Spektrum UV
diperoleh ekstrak kering (92 g) yang relatif senyawa 1 dalam metanol menunjukkan adanya
bebas tannin. Sebagian dari ekstrak kering serapan maksimum yang khas untuk kromofor
tersebut (20 g) selanjutnya difraksinasi dengan stilben pada λmaks 228 (bahu), 285 (bahu), 311
KVC menggunakan silika gel G60 GF254 nm dan mengalami pergeseran batokromik
dengan eluen yang ditingkatkan kepolarannya pada penambahan pereaksi geser NaOH.
(n-heksana-EtOAc, EtOAc, EtOAc-MeOH) Spektrum IR senyawa 1 memperlihatkan
sehingga diperoleh 6 fraksi gabungan A (1.5 adanya pita-pita serapan untuk gugus hidroksil
gr), B (8.8 gr), C (2.3 gr), D (0.9 gr), E (8.3 gr), (3343 cm-1), C=C aromatik (1604, 1513, 1448
dan F (6.2 gr). Fraksi E difraksinasi kembali cm-1), serta adanya benzena 1,4 disubstitusi
menggunakan kromatografi radial (CHCl3- (833 cm-1). Berdasarkan data tersebut, dapat
MeOH) dan KVC (n-heksana-EtOAc) disarankan senyawa 1 sebagai suatu
menghasilkan 8 fraksi gabungan E1 - E8. oligostilben yang memiliki kerangka stilben.
Pemurnian fraksi E3 (3.4 gr) dengan berbagai
Spektrum 1H-NMR senyawa 1 memperlihatkan
teknik kromatografi meliputi kromatografi
adanya proton-proton pada daerah alifatik dan
kolom cepat dan Kromatografi Radial dengan
aromatik. Adanya 3 gugus p-hidroksifenil
berbagai eluen menghasilkan senyawa 1 (51
ditunjukkan pada geseran kimia δH (ppm) 7,24
mg) dan senyawa 2 (28 mg).
(2H, d, J=8,6 Hz) dan 6,85 (2H, d, J=8,6 Hz);
Senyawa 1 diperoleh berupa serbuk abu-abu, 7,24 (2H, d, J=8,6 Hz) dan 6,85 (2H, d, J=8,6
t.l. 197-199oC; [α]20D –13o (c=0,1 dalam Hz) serta 6,94 (2H, d, J=8,8 Hz) dan 6,61 (2H,
MeOH); UV (MeOH) λmaks 228 (bahu), 285 d, J=8,8 Hz). Empat sinyal proton aromatik
(bahu), 311 nm; UV (MeOH+NaOH) λmaks 250 dari 2 gugus 3,5-m-dihidroksifenil ditunjukkan
(bahu), 339 nm; IR (KBr) νmaks 3343, 1605, pada geseran kimia δH 6,25 (4H, d, J=2,2 Hz)
1513, 1448, 1238, 833 cm-1; 1H-NMR (aseton- dan 6,19(2H, t,J=2,2 Hz). Geseran kimia δH
6,46(1H, s) merupakan sinyal proton aromatik
Tabel 1. Data spektrum 1H-NMR senyawa 1 dan literatur (Oshima, 1993 dan Jayuska, A. 2001)
3c 3a
HO
HO 2c
OH A1 H
2a
A1 O
C1 12b 7a
5c O O 5a
H OH
6c 7c 7a 6a HO 8a B2 OH
B2
8c 8a
HO 9a OH A2 H
8b C2
9c 7b 8c
C2 A2 H
7c
12c 8b 12a
OH H H H O
7b 8d
7d H
B1 C1 HO
OH OH D2
6b 2b
B1 D1
5b 3b HO HO
OH
OH OH
(1) (2)
dari H-12b. Karakteristik sinyal proton dalam Ampelopsin E (1), berdasarkan penelusuran
bentuk gugus diaril benzofuran juga literatur yang telah dilakukan, adalah trimer
ditunjukkan pada spektrum 1H-NMR yaitu pada resveratrol yang untuk pertama kalinya
δH 5,45 (2H, d, J=5,1 Hz) dan 4,56 (2H, d, ditemukan dalam akar tumbuhan Ampelopsis
J=5,1 Hz). Adanya pasangan multiplisitas brevipenduculata var. hancei (Vitaceae).
doublet pada δH 6,66 (1H, d, J=16,7 Hz) dan
Senyawa 2 diperoleh berupa serbuk berwarna
6,56 (1H, d, J=16,7 Hz) mengindikasi adanya
coklat muda, TL 215-218oC, [α]20D -31 (c=0,1
vinil dengan konfigurasi trans. Unit-unit
dalam MeOH). Spektrum UV senyawa 2 dalam
struktur yang diperoleh dari spektrum 1H-NMR
metanol menunjukkan adanya serapan
tersebut sesuai dengan ampelopsin E (1).
maksimum yang khas untuk kromofor fenol
Konfirmasi senyawa 1 sebagai ampelopsin E
sederhana pada panjang gelombang maksimum
selanjutnya diperoleh dari perbandingan data
1 (λmaks) 204, 230 (bh) dan 284 nm) dan
H-NMR dengan data yang sama yang telah
mengalami pergeseran batokromik pada
dilaporkan (Tabel 1).
penambahan pereaksi geser NaOH. Spektrum
Tabel 2. Data spektrum 1H-NMR senyawa 2 dan literatur (Tanaka, 2000-c dan Atun 2004)
IR senyawa 2 yang memperlihatkan adanya (ppm) 6,03 (1H, s). Adanya sinyal alifatik dari
pita-pita serapan untuk gugus hidroksil (3369 dua cincin dihidrofuran ditunjukkan pada
cm-1), C=C aromatik (1613, 1514, 1453 cm-1), geseran kimia δH (ppm) 5,76 (1H, d, J=10,8
serta adanya benzena 1,4 disubstitusi (831 cm- Hz) dan 4,44 (1H, d, J=10,8 Hz); 5,37 (1H, d,
1
). Berdasarkan data tersebut, dapat disarankan J=5,1 Hz) dan 4,67 (1H, d, J=5,1 Hz). Unit-
senyawa 2 sebagai suatu oligomer resveratrol. unit struktur yang diperoleh dari spektrum 1H-
NMR tersebut sesuai dengan vatikanol B (2).
Spektrum 1H-NMR senyawa 2 memperlihatkan
Konfirmasi senyawa 2 sebagai vatikanol B
adanya empat kelompok proton aromatik yang
selanjutnya diperoleh dari perbandingan data
berkopling orto dari empat gugus p- 1
H-NMR dengan data yang sama yang telah
hidroksifenil pada geseran kimia δH (ppm) 7,23
dilaporkan (Tabel 2). Dari data yang telah
(2H, d, J=8,6 Hz), 6,78 (2H, d, J=8,6 Hz): 7,18
dilaporkan menunjukan bahwa senyawa
(2H, d, J=8,6 Hz), 6,76 (2H, d, J=8,6 Hz): 7,16
vatikanol B merupakan senyawa yang jarang
(2H, d, J=8,6 Hz), 6,69 (2H, d, J=8,6 Hz) dan
ditemukan dari tumbuhan genus Shorea
6,50 (2H, d, J=8,4 Hz), 6,40 (2H, d, J=8,4 Hz).
(Aminah, 2003).
Selanjutnya satu buah gugus 3,5-m-
dihidroksifenil ditunjukkan pada geseran kimia 4. Kesimpulan
δH 6,28 (1H, t, J=2,2 Hz), 6,09 (2H, br, s). Dua Dua senyawa oligomerresveratrol telah berhasil
kelompok proton aromatik yang berkopling di isolasi untuk pertama kalinya dari kulit
meta pada cincin benzena 1,2,3,5-tetra- batang Shorea mecistopteryx Rild. Kedua
substitusi ditunjukkan pada 6,27 (1H, d, J=2,2 senyawa tersebut adalah satu trimer resveratrol,
Hz), 6,11 (1H, d, J=2,2 Hz) dan 6,46 (1H, d, ampelopsin E, dan tetramer resveratrol,
J=2,2 Hz), 6,18 (1H, d, J=2,2 Hz). Suatu vatikanol B.
proton aromatik dari cincin benzena penta-
subtitusi ditunjukkan pada geseran kimia δH
5. Ucapan Terima kasih Kitanaka, S,; Takido, M.; Mizoue, K.; Kondo, H.;
Kami mengucapkan terima kasih kepada staf Nakaike, S. Oligomeric stilbenes from Caragana
Herbarium Bogoriense, bogor yang telah Chamlagu lamarck root”, Chem. Pharm. Bull.,
mengidentifikasi bahan tumbuhan yang 1990, 44, 565-567
digunakan dalam penelitian ini. Newman, P.F.; Whitmore, T.C. 1999Pedoman
Identifikasi Pohon-pohon Dipterocarpaceae Pulau
6. Daftar Pustaka Kalimantan, Prosea Indonesia, Penerbitan Perdana,
Aminah, N.S., 2003, “Fitokimia beberapa spesies Bogor, 389-390
Shorea (Dipterocarpaceae) Hutan Tropika
Kalimantan”, Disertasi Doktor, Institut Teknologi Oshima, Y.; Ueno, Y.; Hisamichi, K.; Takeshita, M.
Bandung, Indonesia, 126-127. Ampelopsin F and G, novel bridged plant
oligostilbenes from Ampelopsis brevipedunculata
Atun, S., 2004, “Fitokimia beberapa spesies var.hancei roots”, Tetrahedron, 1993, 5801-5804
Dipterocarpaceae Indonesia dari genus Vatica,
Anisoptera hopea dan Dipterocarpus”, Disertasi Oshima, Y., Ueno, Y., Ampelopsins D, E, H and
Doktor, Institut Teknologi Bandung, Indonesia. cis-Ampelopsin E, Oligostilbenes from Ampelopsis
brevipedunculata Var. Hancei Roots“,
Bokel, M.; Diyasena, M.N.C., GunatilakaA.A.L.; Phytochemistry, 1993, 33, 179-182
Kraus, W.;Sotheeswaran, S. Calikulatol, an
antifungal resveratrol trimer fram Stemonoporus Pryce, R.J., Langcake, P. “ α-viniferin: an antifungal
canaliculatus“, Phytochemistry, 1988, 27, 377-380 resveratrol trimer from grapevine”, Phytochemistry,
1977, 16, 1452-1454
Cronquist, A., 1981, An integrated system of
classification of flowering plant, Columbia Tanaka, T.; T. Ito, K. Nakaya, M.; Iinuma, Y.;
University Press, New York, 317-318 Takashashi, H.; Naganawa, N.; Matsuura, M.;
Ubukata. Vaticanol D a novel resveratrol hexamer
Dai, J,R.; Hallock, Y.F.; Cardellina, J.H.; Boyd, isolated from Vatica rassak, Tetrahedron letters,
M.R. “HIV-Inhibitoryand cytotoxic oligostilbenes 2000-b, 41, 7929-7932
from the leaves of Hopea malibato”, J. Nat. Prod.,
1998, 61, 351-353 Tanaka, T.; T. Ito, K. Nakaya, M.; Iinuma,
M.;Riswan, S. Oligostilbenoids in steam bark of
Geewananda, Y.A.; Gunawardena, P.; Vatica rassak, Phytochemistry, 2000-c, 54, 63-69
Sotheeswaran, S.; Sultanbawa, M.U.S.;
Surendrakumar.S.; Bladon, P. Another antibacterial Tukiran, 2003, “Senyawa mikromolekul dari
polyphenol, coppaliferol B, from Vaterian beberapa tumbuhan meranti (Shorea) Indonesia”,
copallifera (Dipterocarpaceae)”, Phytochemistry, Disertasi Doktor, Institut Teknologi Bandung,
1986, 25, 1498-1500 Indonesia, 92-95
Jayuska, A, 2001, Senyawa baru hasil degradasi Sultanbawa, m.U.S.; Surendrakumar.S.; Bladon, P.
Ampelopsin E dan resveratrol oligomer lainnya dari “Disticol an antibacterial polyphenol from Shorea
kulit batang Shorea pinanga SCHEFF., Tesis distica”, Phytochemistry, 1987, 26, 799-801
Magister Kimia ITB.
Abstract
The idea to genetically engineer oil palm for biodegradable plastics production was based on
its fairly established in vitro protocol and their susceptibility to foreign gene transfer, either
using biolistic or Agrobacterium that are not limited to specific target tissues or varieties.
Instead, different target tissues of Elaeis guineensis (var. dura, pisifera, tenera) and E.oleifera
were susceptible to foreign gene uptake. Oil palm has abundant acetyl-CoA, the common
precursor for both fatty acids and biodegradable plastics. Here, oil palm was genetically
engineered to produce two biopolymers, polyhydroxybutyrate-co-hydroxyvalerate (PHBV)
and polyhydroxybutyrate (PHB). Engineering of bktB, phaB and phaC genes will convert
acetyl-CoA to PHB. For PHBV production, an additional gene, tdcB, is needed to produce
propionyl-CoA. Cassettes containing the genes driven by CaMV35S, modified CaMV35S,
actin and ubiquitin promoters were constructed, each flanked by a promoter, plastid targeting
sequence and polyA signal. The expression cassettes were cloned into pCAMBIA1301 and
pCAMBIA1305.2 yielding pMR606, pMR706, pJLPHB3 and pSAPHA1305.2. pMR606 and
pMR706 contains all 4 genes driven by CaMV35S promoter were designed for PHBV
production. Comparatively, pJLPHB3 and pSAPHA1305.2 have bktB, phaB and phaC driven
by modified CaMV35S and ubiquitin promoter, respectively, were designed for PHB. Except
for pSAPHA1305.2 (transformed into A. rhizogenes A4), all other expression vectors were
transformed into A. tumefaciens LBA4404. Various target tissues were co-cultivated with
Agrobacterium carrying individual expression vectors and successful gene transfer was
observed from gus assay on putative transformed target tissues, callus and plantlets derived
from them. Stable GUS expressions were detected in leaf and root tissues of 9-month old
putative transformants. Integration of the bktB, phaB, phaC and tdcB genes were evident from
PCR, RT-PCR, multiplex PCR and Real Time PCR analyses and the transgenes integrity were
further confirmed using PCR-Southern analysis and nucleotide sequencing analyses. The
presence of additional granules, possibly PHB, was observed in tissues analysed using TEM.
Keywords: Oil palm, genetic engineering, Agrobacterium-mediated gene transfer,
biodegradable plastics,
FLAVANOIDS
PLASTIDS
I
S Acetyl-CoA ACCase Malonyl-CoA
O
P ß-ketothiolase
C4:0 ACP
R
E Acetoacetyl-CoA C6:0 ACP
N C8:0 ACP
Acetoacetyl-CoA
O reductase
C10:0 ACP
I C12:0 ACP
3-Hydroxybutyryl-CoA C14:0 ACP
D
S PHB C16:0 ACP
synthase C18:0 ACP
Polyhydroxybutyrate
LIPIDS
Coincidently, acetyl-coA is also the main roots and inflorescences. Preparation of the
precursor for polyhydroxybutryrate (PHB). respective target tissues have been described
PHB is the main building block for elsewhere (Alizah & Abdullah, 1996, Abdullah
biodegradable polymers (Figure 1), which et al, 1997, 2005).
commands high commercial value.
Gene and plasmids
However, unlike biosynthesis of fatty acids, the The respective phaA, phaB and phaC and tdcB
production of PHB in oil palm would require genes were cloned into binary and superbinary
the introduction of several novel genes. These vectors complete with their own promoter and
include β-ketothiolase (bktb or phaA), plastid targeting sequence. Vectors used in this
acetoacetyl-CoA reductase (phaB), study are shown in Figure 2. Cloning was
polyhydroxybutryrate synthase (phaC) and carried out using standard molecular biology
threonine decarboxylase B (tdcB). Except for techniques described by Sambrook et al, (1989)
bktb (phaA), all other genes are not naturally with modifications where necessary.
present in oil palm and therefore have to be
Gene transfer system
introduced. However, through gene
Foreign gene transfer into oil palm target
manipulation, it is possible to genetically
tissues were carried out using both biolistic
engineer all these foreign genes into oil palm
(Alizah and Abdullah, 1996) and
for the production of biodegradable plastics.
Agrobacterium-mediated (Rashdan &
Ralstonia eutropha, through the activity of Abdullah, 1999). Plants were regenerated from
phaA, phaB and phaC is able to produce PHB, putative transformed target tissues and were
naturally. Thus, this study evaluates the subjected to several molecular analyses such as
possibility of engineering oil palm with phaA, PCR, PCR-Southern, multiplex-PCR, RT-PCR,
phaB and phaC and tdcB genes for the sequencing and analysis through transmission
production of bioplastics (Abdullah 2004). electromicroscopy.
2. Experimental 3. Results and Discussion
Plant Materials Gene transfer into oil palm
Several tissue types from various variety and We have demonstrated that, with the
species of oil palm were used as target to appropriate pre-treatment, oil palm tissues
receive the foreign genes. They include irrespective of their species and varieties, are
immature embryo, primary and secondary calli susceptible to foreign gene transfer using both
derived from various explants such as leaf, biolistic and Agrobacterium-mediated gene
HindIII AvrII-EcoRI
14.5 kb
BR BL
gus ubi bar nos ubi pts phaC nos ubi pts bktb nos ubi pts phaB nos hyg
8.9 kb
pJLPHB3 (22.4 kb)
BR BL
gus 35S pts tdcB nos 35S pts phaB nos 35S pts bktb nos 35S pts phaC nos hyg
pMR607/707 (37.1kb)
Figure 2. Binary and superbinary vector constructs used to deliver phaA, phaB, phaC and tdcB genes into oil
palm target tissues. pSApha1305.2 consists of phaA, phaB and phaC genes each driven by ubiquitin promoter
and a targeting sequence cloned into pCAMBIA1305.2. pJLPHB3 consists of phaA, phaB and phaC genes each
driven by modified 35S promoter and a targeting sequence cloned into pCAMBIA1304. pMR607 and pMR 707
are superbinary vectors consisting phaA, phaB phaC and tdcB genes each driven by CaMV35 promoter and a
targeting sequence cloned into pCAMBIA1305.2
transfer. Here and in our earlier studies, we transformants was only possible if the gus gene
shows that target tissues from Elaeis guineensis is expressed by plant gene expression system.
Jacq. variety tenera, dura and pisifera, and This is due to the presence of intron within the
Elaeis oleifera were successfully transformed gus gene that could not be spliced out during
with binary and superbinary plasmids carrying gene expression by bacterial system. Thus, the
the respective PHB genes. Figure 3 shows the ability of the gus gene to be transcribed, intron
pathway involved in a typical Agrobacterium- spliced out and later translated into protein
mediated gene transfer for oil palm using (ezymes) that in turn act upon 5-bromo-4-
immature embryos as the target tissues. Similar chloro-3-indoyl glucuronide (x-gluc) indicates
sequence was also followed when using other that the gus gene has been successfully
target tissues such as primary and secondary transferred into plant cells and was able to be
calli. act upon by plant gene expression system. This
resulted in the conversion of x-gluc into 5,5’-
Successful gene transfer
dibromo 4,4’-dichloro indigo (highly insoluble
In this study, genes successfully transferred
and highly coloured indigo dye) at the site of
into the target tissues are phaA, phaB phaC and
gus enzyme activity. However, as indicated by
tdcB, that are necessary for the production PHB
our earlier work, positive gus expression may
in oil palm. Evidence for successful gene
not necessarily indicate stable integration of
transfer was first demonstrated from gus assay
transgenes into target tissues. Thus further
carried out on putative transformants (Figure
4). The presence of blue deposits in putative
Figure 3. Agrobacterium-mediated gene transfer of oil palm immature embryo showing (a) immature fruits as
source of one of the target tissues, immature embryo (b) undergoing pre-treatment (c) followed by co-cultivation in
Agrobacterium carrying the respective plasmids (e) and subsequent plant regeneration (d, f, g and h).
Figure 4. Gus assay on putative transformants showing blue deposits at sites of gus gene activity (a) on
bombarded immature embryos, (b) on co-cultivated immature embryos, (c) along vascular bundles of co-
cultivated immature embryos, (d) on the co-cultivated immature embryos and (e) in shoots and leaf tissues of a
plantlet regenerated from target tissues
evaluation was carried out on the putative techniques to ascertain successful gene transfer.
transformants. PCR analyses were carried out on gus positive
samples using primers corresponding to the
Molecular evidence for successful gene
respective genes. Analyses carried out either
transfer
for single amplification or through multiplex
Putative transformants (freshly bombarded or
PCR shows that all phaA, phaB, phaC and tdcB
co-cultivated target tissues, target tissues-
were present in putative transformants derived
derived callus, plantlets and their respective
from target tissues transformed with the
parts) were analysed using common molecular
a b
c d
Figure 5. PCR analyses of genomic DNA from putative transformants derived from co-cultivated immature
embryos showing the presence of (a) phaB amplified individually, (b) phaA and phaB, (c) phaC and tdcB genes
and (b) phaA, phaB and phaC genes amplified simultaneously
respective genes. This was evident from transferred. The functionality of PHB
successful amplification of the expected bands synthesizing genes was further tested using
using primers for the respective gene(s) of other techniques including multiplex PCR and
interest (Figure 5). In the case of phaA (bktb) RT-PCR (Rashdan et al 2004). Results obtained
harboured in pSApha1305.2, the expected showed that, the genes are transcribed
0.8kb fragment was successfully amplified indicating that the genes are fully functional in
using primers specific to the phaA (bktb) gene. its new environment.
Similarly, the expected 637bp was amplified
Electron Microscopy
for phaB genes from genomic DNA of putative
Given that the PHB synthesizing genes were
transformants analysed (Siti Azma & Abdullah,
successfully transferred, integrated and
2004). Unlike pJLPHB3 and pMR607 or
functional, the next stage would be to evaluate
pMR707, pSApha1305.2 uses Agrobacterium
the end products following expression of
rhizogenes as the vector for transformation into
transgenes in its new environment. Evaluation
oil palm. These observations further confirmed
of leaf tissues from putative transgenic plants
that oil palm tissues, given the right pre-
shows the presence of additional granules very
treatment are susceptible to both A.
similar to those of PHB (Figure 6). These
tumefaciens and A. rhizogenes.
granules, however, were absent in leaf tissues
Evidence for successful transfer and integration of control non-transformed plants. This
of transgenes for PHB production in putative suggests that the presence of PHB synthesizing
transgenic oil palm was further confirmed from genes in the putative transformed plants may
nucleotide sequence analyses carried out on the have resulted in the possible production of the
respective PCR products produced with 100% desired end product (Joseph & Abdullah,
homology to the original transgenes 2004). The PHB synthesizing genes may be
a b
Figure 6. Analyses of leaf tissues from (a) non-transformed control and (b) putative transformed plants using
transmission electron microscopy. Additional granules were observed in the chloroplast of leaf tissues of putative
transformed plants. No similar granules were observed in chloroplast of non-transformed control plants.
involved in shunting the pathway from lipid through the construction of various multi-gene
synthesis to PHB production, as shown with the constructs harbouring the necessary genes
presence of the granules. Nevertheless, the required for biosynthesis of PHB. Successful
number of granules observed was low transfer and integration of PHB synthesizing
suggesting poor efficiency of the system. This genes was evident from gus assay, PCR,
may be due to competition between enzymes multiplex PCR, nucleotide sequence analyses
involved in lipid biosynthesis and those for carried out on tissues from putative
PHB production, for the common substrate, transformants. And most importantly,
acetyl CoA. It is therefore suggested that the observation using transmission electron
activity of bktb must be up-regulated to ensure microscopy further indicates the production of
the acetyl CoA flux towards PHB production is additional granules in leaf tissues of putative
higher than those for lipid biosynthesis. Only transformants. These granules were, however,
then the production of PHB can be improved. absent in control, non-transformed plants. Even
However, the true identity and its property though the true nature of the postulated PHB
needs further studies. Therefore the next stage observed in the putative transgenic oil palms
would to improve the efficiency of the system needs further verification, but, results obtained
followed by the extraction of putative PHB showed that oil palm can be metabolically
granules for identification analyses. engineered for the production of value added
products.
4. Conclusion
Our study further confirmed that oil palm is 5. Acknowledgement
amenable to genetic engineering using both The project was supported by the Ministry of
direct and vector mediated gene transfer Science, Technology and Innovation, under the
system. The systems developed to genetically Malaysia-MIT Biotechnology Partnership
engineer oil palm are independent of species, Programme.
varieties and types of target tissues used. In
6. References
addition both A. tumefaciens and A. rhizogenes Abdullah, R, Alizah, Z, Wee YH, Rashdan MM
could be used as vectors to transfer foreign Yeun LH, Siti Zubaidah, S & Leaw CL (1997).
genes into oil palm such as those for the Development of genetic transformation methods for
production of biodegradable plastics. A multi- oil palm improvement. The Plant Molecular
gene system is required for metabolic Biology Reporter 15(3).
engineering of oil palm for biodegradable Abdullah R, Chari C, Yap WSP & Yeun LH (2003).
plastic production. These were achieved Transgenic oil palm with stably integrated CpTI
gene confers resistance to bagworm larvae. In: IK Rashdan MM, & Abdullah R (1999).
Vasil (ed) Plant Biotechnology 2002 and Beyond: A Agrobacterium-mediated transformation of oil palm
celebration and a showcase. Kluwer Academic (Elaeis guineensis J.). In Proc. of the 5th
Publishers. pp163-165. International Conference on Plant Protection in the
Tropics. 15th March 1999, Kuala Lumpur. Pp 422-
Abdullah R (2004). Current status of metabolic
424.
engineering of oil palm for bioplastic production.
Paper presented at the 3rd MMBPP Workshop, 26- Rashdan MM, Siti Azma J, Joseph JL, Yeun LH,
28th July 2004, Putrajaya. Nik Marzuki S, Ismanizan I & Abdullah R
Abdullah R, Alizah Z, Wee YH, Leaw CL, Yeap CB, Agrobacterium-mediated transformation for the
Yap WSP, Yeun LH, Rashdan MM, Joseph JL, Siti production of polyhydroxyalkanoates in oil palm.
Azma J, Lee MP & Salwa AS. (2005). Immature Paper presented at the 3rd MMBPP Workshop, 26-
Embryo: A Useful Tool for Oil Palm Genetic 28th July 2004, Putrajaya.
Transformation Studies. Electronic Journal of
Sambrook J, Fritsch EF, & Maniatis T (1989).
Biotechnology (in press).
Molecular cloning: A laboratory manual. Second
Alizah Z & Abdullah R (1996). Transformation of Edition. New York. Cold Spring Harbour
oil palm (Elaeis guineensis J.) immature embryoes Laboratory Press.
by particle bombardment. In Proc. of the 2nd
Siti Azma J & Abdullah R (2004). Stability of
National Congress on Genetics. 13-15th November,
transgenes in putative transgenic oil palm
Kuala Lumpur. pp 246-249.
expressing polyhydroxyalkanoate (PHA) genes
Joseph JL, Salwa AS & Abdullah, R (2004). Early mediated by Agrobacterium rhizogenes. In
indication of bioplastic production in putative Proceeding of 2004 MSMBB Scientific Meeting,
transformed oil palm mediated by Agrobacterium 19-21st July 2004, Melaka.
tumefaciens. . In Proceeding of 2004 MSMBB
Scientific Meeting, 19-21st July 2004, Melaka.
Abstrak
Metil-tersier-butileter (MTBE) banyak digunakan sebagai aditif oksigenat pengganti timbal
(Pb) pada bensin reformulasi dan oxyfuels. Studi komputasi ab initio tahap awal mekanisme
reaksi oksidasi fasa gas MTBE yang diawali oleh radikal OH sudah dilakukan untuk
memahami perilaku MTBE di atmosfer dan pada proses pembakaran. Penelitian dilakukan
menggunakan metode perhitungan MP4/6-31G(d)//HF/6-31G(d) untuk menghitung energetika
spesi-spesi yang terlibat dalam reaksi, yang digunakan untuk membangun diagram
permukaan energi potensial dan meramalkan tetapan laju reaksi. Reaksi ditemukan terjadi
melalui dua jalan abstraksi H oleh radikal OH, yaitu pada: gugus metoksi (reaksi-1) yang
lebih disukai dan lebih bersifat eksoterm, dan melalui gugus t-butil (reaksi-2), dengan harga
energi pengaktifan (Ea) dan entalpi reaksi (∆H) masing-masing Ea1a = 3,243 kkal/mol,
Ea1b = 8,953 kkal/mol, dan ∆H1a = -13,502 kkal/mol, ∆H1b = -5,975 kkal/mol. Tahap reaksi
oksidasi dengan O2, reaksi-1 bereaksi tanpa hambatan energi sedangkan reaksi-2 melewati
sedikit hambatan energi. Tetapan laju reaksi masing-masing tahap yang dihitung
menggunakan teori keadaan transisi menunjukkan kesimpulan yang sama dengan
peramalan diagram energi potensial yaitu: k1a = 5,420 x 103 L.mol-1.detik-1, k1b = 4,705
x 10-1 L.mol-1.detik-1, k2a = 6,009 x 105 L.mol-1.detik-1 dan k2b =1,909 x 103 L.mol-1.detik-1.
Kata kunci: MTBE, Metil t-butileter, ab initio, studi komputasi, reaksi oksidasi
830
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Rustaman dan Muhamad A. Martoprawiro
CH3OC(CH3)3 + OH
reaksi 1 reaksi 2
O2
OOCH2OC(CH3)3 CH3OC(CH3)2CH2OO
NO NO
-NO2 -NO2
OCH2OC(CH3)3 CH3OC(CH3)2CH2O
O2 O2
OH secara teoretis menggunakan metode dan menghitung korelasi elektron dengan cara
perhitungan orbital molekul ab initio. gangguan.
2. Teori Operator Fock untuk sistem n-elektron sebagai
2.1. Teori Gangguan Moller-Plesset7 Hamilton tanpa gangguan, H(0),
Penyelesaian eksak persamaan Schrodinger n ⎡
n ⎤ (1)
hanya mungkin diperoleh untuk sistem-sistem H (0 ) = ∑ F (i ) = ∑ ⎢ h(i ) + ∑ J j (i ) − K j (i )⎥
i ⎣ ⎦
yang sangat sederhana seperti atom H. Untuk i j
sistem-sistem yang lebih kompleks diperlukan dari perbedaan antara Hamiltonian tanpa-
metode pendekatan. Dua metode pendekatan gangguan yang dipilih dan Hamiltonian yang
yang sudah sangat dikenal yaitu metode variasi sebenarnya untuk sistem n-elektron, dapat
dan teori gangguan. diperoleh gangguan sebagai berikut:
V = ∑ rij−1 −∑ (J j (i ) − K j (i ) )
Motode Hartree-Fock adalah salah satu metode
(2)
pendekatan yang paling banyak digunakan. (<) i, j
Metode ini menggunakan prosedur perulangan
medan konsisten diri (Self Consistent Field) akibatnya, energi tingkat ke-nol secara
sistem berelektron banyak dalam potensial sederhana merupakan jumlah energi-energi
Coulomb dengan posisi inti tetap. Model orbital Ψ(0) yang terisi,
Hartree-Fock mengabaikan korelasi
⎛ n ⎞
kebolehjadian keberadaan elektron relatif E ( 0) = ⎜ ∑ ε i ⎟ = E orb (3)
terhadap elektron lainnya, yaitu suatu ⎝ i ⎠
kenyataan bahwa kebolehjadian menemukan
elektron pada suatu tempat dipengaruhi oleh Dengan menggunakan teori gangguan lebih
elektron lainnya disebabkan adanya gaya lanjut dari Rayleigh-Schrodinger, koreksi orde
tolakan antar elektron. Formalisme interaksi pertama dan kedua dengan mudah diturunkan
konfigurasi (configuration interaction) adalah sebagai,
suatu pendekatan sistematik untuk menangani 1
korelasi elektron ini, tetapi perhitungan E (1) = Ψ (0) V Ψ (0) = − ∑ ij
2 i, j
ij (4)
variasinya seringkali tidak mungkin
diselesaikan. Pendektan lain yang lebih praktis ( ab )
2 2
yaitu teori gangguan. Teori gangguan Moller- Ψ0 V Ψij ij ab
Plesset (Moller-Plesset Perturbation Theory,
E ( 2)
= ∑
a <b ,i < j E (0) − Eijab
= ∑
a <b ,i < j εi + ε j − εa − εb
MPPT) menggunakan fungsi gelombang SCF (5)
dan MCSCF sebagai keadaan tanpa gangguan
dengan i,j sebagai orbital spin terisi, a,b orbital 3. Metode Penelitian
kosong pada Ψ(0) dan ΨijB { } mewakili 3.1. Perangkat dan Lokasi Penelitian
Penelitian dilakukan menggunakan komputer
determinan Slater dengan energi tanpa- berprosesor ganda (dualprocessor) Intel
{ }
gangguan EijB . Koreksi Moller-Plesset Third Pentium III 800 MHz dengan RAM 1 GB di
Order (MP3) dan Moller-Plesset Fourth Order Laboratorium Kimia Teori dan Komputasi
(MP4) dapat dihitung dengan cara memperluas Departemen Kimia ITB dengan sistem operasi
perlakuan di atas untuk memperbaiki energi Linux Mandrake versi 10.0. Perangkat-
yang dihitung tetapi dengan sendirinya biaya perangkat lunak komputasi yang digunakan
komputasi menjadi lebih mahal. dalam penelitian ini adalah Chem3D (berbasis
Windows), Gaussian988,9 dan Molden10
2.2. Himpunan Basis7,9 (berbasis Linux).
Himpunan basis adalah deskripsi matematika
dari sekumpulan orbital sistem yang telah 3.2 Metode Perhitungan
diketahui, yang dikombinasikan untuk Perhitungan komputasi molekul dilakukan
mendekati fungsi gelombang total dari sistem dengan menggunakan metode struktur elektron
yang dikaji. Untuk mendapatkan orbital-orbital ab initio pada tingkat MP4/6-31G(d)//HF/6-
pendekatan yang lebih akurat digunakan 31G(d). Komputasi yang dilakukan meliputi:
himpunan basis yang diperbesar dengan tiga optimasi geometri, perhitungn frekuensi dan
cara, yaitu: perhitungan energi satu titik (single point
energy) pada semua spesi reaksi (pereaksi,
1. Himpunan basis valensi terpisah (split senyawa antara, keadaan transisi dan hasil
valence basis set) yaitu dengan menambah reaksi). Spesifikasi molekul sebagai data
jumlah fungsi basis per atom. Himpunan masukan diambil dari data keluaran hasil pra-
basis valensi terpisah, misalnya 3-21G optimasi menggunakan program Chem3D
dan 6-31G, memiliki dua (atau lebih) menggunakan metode perhitungan semi-
ukuran fungsi basis untuk tiap orbital empirik Parametric Method 3 (PM3). Hal ini
valensi. dilakukan agar waktu yang diperlukan untuk
2. Himpunan basis terpolarisasi, yaitu: perhitungan optimasi geometri menggunakan
berbeda dengan himpunan basis valensi Gaussian98 menjadi lebih efektif. Program
terpisah yang memperbolehkan ukuran Molden (berbasis Linux) dipakai untuk
orbital diubah tetapi bentuknya tetap. membantu menafsirkan struktur molekul yang
Himpunan basis terpolarisasi mengatasi dihasilkan program Gaussian98 (file teks)
kesulitan ini dengan menambahkan dengan cara menampilkannya secara visual.
orbital-orbital yang momentum sudutnya Data-data energi hasil perhitungan dirajah pada
lebih tinggi daripada yang dibutuhkan. diagram permukaan energi potensial (PEP)
3. Himpunan basis fungsi baur (diffuse untuk mempelajari mekanisme reaksi yang
functions), yaitu: kekurangan himpunan terjadi dan dipakai untuk menghitung energi
basis terpolarisasi adalah pengaktifan.
ketidakmampuannya untuk Tetapan laju reaksi dihitung menggunakan teori
menggambarkan molekul yang memiliki keadaan transisi11 dari data hasil perhitungan
kerapatan elektron jauh dari inti, seperti frekuensi. Tetapan laju reaksi orde kedua
anion atau molekul yang memiliki dihitung dengan rumus:
pasangan elektron bebas. Hal ini
disebabkan amplitudo fungsi basis k BT Q ‡ ⎛ E ⎞
Gaussian agak rendah pada daerah jauh k = exp ⎜ − c ⎟ (6)
dari inti. Untuk mengatasi masalah ini
h Q ⎝ k BT ⎠
digunakan fungsi baur. Himpunan basis di mana kB adalah tetapan Boltzmann, T suhu ,
fungsi baur ditandai oleh “+”. 6-31+G(d) h tetapan Plank, Q fungsi partisi molekul dan
adalah himpunan basis 6-31G(d) dengan Ec energi kritis.
menambahkan fungsi baur pada atom non-
hidrogen. Sedangkan 6-31++G(d), 4. Hasil dan pembahasan
menambahkan fungsi baur juga pada atom Pada Gambar 2, terlihat bahwa Mekanisme
hidrogen. Reaksi oksidasi MTBE yang diawali dengan
O H H
O
-H2O
TS1a
O
O O O O
O O
+ OH
2a TS2a
O
3a
+ OH O
O O O
O O
-H2O O
H
H O
O
2b TS2b
TS1b 3b
Tabel 1. Energi pengaktifan dan tetapan laju reaksi hasil perhitungan menggunakan
metode MP4/6-31G(d)//HF/6-31G(d)
No Spesi Ea (kkal/mol) k (L / mol.s)
1 TS1a 3,24265053 5,420 x 103
2 TS1b -1,00663408 4,705 x 10-1
3 TS2a 8,95310125 6,009 x 105
4 TS2b 2,91229284 1,909 x 103
-218,000
0 0,5 1 1,5 2 2,5 3 3,5
H
-218,005 -218,005 H O
O
O TS1b
-218,010
-218,011
Energi (Mkal/mol)
-218,015 O H O
-218,014 H
O
TS1a
-218,020 -218,020
-218,025 O
-218,027
-218,030
Koordinat reaksi
-264,300
3,5 4 4,5 5 5,5 6 6,5
-264,304
-264,305 O O
O
O
-264,307
-264,310
TS2b
-264,315
O
-264,315
Energi (Mkal/mol)
-264,320 -264,316
-264,325 O O
O O
O
O
-264,330
TS2a
-264,337
-264,335
-264,340
O O
-264,345 O
-264,346
-264,350
Koordinat reaksi
6. Baldridge, K.K., Siegel, J.S., Gregerson, 12. Atadinc, F., Selcuki, C., Aviyente, V. Phys.
L.N., J. Phys. Chem. A. 2000, 104, 11106- Chem. Chem. Phys., 2002, 4, 1797-1806.
11110.
Abstrak
Kajian rekabentuk sensor ion amonium berasaskan kepada membran fotopolimer poli(n-butil
akrilat) telah dikerjakan menggunakan elektrod bercetak skrin (SPE) sebagai elektrod kerja.
Kajian ini memberikan nilai Nernstian 55.2 ± 2.2 mV/dekad dengan julat pengesanan ion
amonium 10-1-10-5 M dan had pengesanan 5.47 x 10-5 ± 1.53 x 10-6 M. Sensor ion amonium
ini mempunyai keselektifan yang tinggi daripada kation gangguan seperti Ca2+, Mg2+, Li+ dan
juga Na+. Pada kajian ini, sensor mempunyai kebolehhasilan yang baik (RSD 3.99%, n = 3).
Kata kunci : sensor amonium, elektrod bercetak skrin, fotopolimer, poli(n-butil akrilat).
menunjukkan prestasi yang cukup baik natrium amonium, magnesium, kalsium dan
berbanding membran konvensional. litium yang diperolehi daripada Fluka.
Polimer poli(n-butil akrilat) mempunyai 2.2.Peralatan
banyak kelebihan sebagai matriks membran Meter ion Orion 420A, Elektrod SPE Ag/AgCl
untuk sensor ion. Polimer ini dapat bekerja sebagai elektrod kerja, Elektrod rujukan jenis
tanpa menggunakan sebarang pemplastik dan dua persimpangan dengan menggunakan litium
boleh disediakan dengan teknik fotopolimer . asetit sebagai jambatan garam pepejal (Heng et
Kelekatan daripada polimer ini pada al, 2004).
permukaan elektrod cukup baik, sehingga
2.3.Penyediaan Sensor
sesuai digunakan untuk berbagai aplikasi
Disediakan suatu campuran poli(n-butil akrilat)
sensor ion dalam bentuk pepejal (Heng et
tanpa pemplastik Campuran mengandungi
al,2004).
monomer n-butil akrilat, 0.1% w/w ejen taut
Salah satu teknologi elektrod sensor ion yang silang 2-heksanedioldiakrilat,1.9 % w/w
sedang berkembang setakat ini ialah elektrod fotoinisiator 2,2-dimetoksil-2-fenilasetofenon,
bercetak skrin (screen printed electrode, SPE). 2.4% w/w ionofor nonaktin dan 24 % mol
Teknologi ini mempunyai berbagai kelebihan (relatif kepada ionofor) daripada natrium
berbanding dengan elektrod konvensional, tetrakis [bis-3,5(trifluorometeil)fenil]borat.
diantaranya seperti kos yang murah, pembuatan Selanjutnya campuran ini disalutkan di atas
yang mudah, bentuk yang kecil serta digunakan lapisan Ag/AgCl yang terdapat pada SPE, dan
secara pakai buang, kerana boleh dihasilkan selanjutnya difotopolimer dalam kotak ultra
secara masal (Robert et al 1999, Vidal et al, lembayung (RS Ltd) dan di bawah aliran
1995, Wang et al, 1998). Selain daripada itu, nitrogen selama 3 minit.
teknolgi ini boleh disediakan dalam bentuk
2.4.Penilaian Sensor
susun atur, sehingga boleh mengukur berbagai
Sel elektrokimia yang dibina terdiri daripada
spesis dalam sampel hanya dengan satu
elektrod rujukan Ag/AgCl dua persimpangan,
elektrod (Mourzina et al,2001)
seperti yang dilakukan oleh Heng dan Hall [8].
Langkah-langkah asas dalam pembuatan SPE Larutan dalaman elektrod rujukan yang
ini ialah dengan melapisi suatu bahan elektrod digunakan adalah 0.1 M Tris-HCl (pH = 7), di
secara planar dengan mengikuti pola pencetak mana litium asetat digunakan sebagai elektrolit
yang telah direka bentuk. Bahan elektrod yang jambatan garam pepejal. Kedua-dua elektrod
digunakan antara lain adalah emas, platinum, rujukan dan sensor amonium dihubungkan
karbon ataupun Ag/AgCl. Selanjutnya, dengan Orion meter ion. Nilai perbezaan
dilakukan proses termal untuk pengeringan keupayaan daripada sel elektrokimia atau emf
(Wang et al, 1998). SPE telah banyak dalam mV dicatit setelah nilai yang stabil
digunakan dalam berbagai aplikasi pembuatan diperolehi (Heng et al, 2004). Kajian ion
sensor (Robert et al 1999, Vidal et al, 1995, pengganggu dilakukan dengan menggunakan
Wang et al, 1998, Mourzina et al,2001, Wang kaedah larutan berasingan (SSM)
et al, 1993). Kajian ini bertujuan untuk (IUPAC,1994), dengan menggunakan 0.1 M
merekabentuk suatu sensor ion amonium larutan klorida daripada kalium, natrium,
dengan menggunakan teknik fotopolimer dan kalsium, magnesium serta litium sebagai ion
SPE. pengganggu.
3.1. Hasil dan Pembahasan
2. Percobaan Respon Nernstian terjadi ketika respon elektrod
2.1.Bahan Kimia ion pemilih mengikuti keseimbangan
Bahan membran seperti n-butil akrilat, 2- termodinamik setempat. Respon Nernstian
heksanedioldiakrilat dan 2,2-dimetoksil-2- ditunjukkan oleh plot perbezaan keupayaan
fenilasetofenon, 2 yang diperoleh daripada antara sel melawan logaritma keaktifan analit
Sigma. Nonaktin, Natriumtetrakis[bis-3,5 (aA) adalah linear dengan kecerunan secara
(trifluorometil) fenil] borat, teori 59.16 mV/dekad pada suhu 298.15 K
tris(hidroksimetil)aminometan (Tris), litium (IUPAC,1994). Perubahan nilai emf sensor
asetit anhidrat, agar, garam klorida bagi kalium, kalium ditunjukkan dalam rajah 1, untuk
350.0
300.0
250.0
mV/dekad
200.0 mV SPE 1
mV SPE 2
150.0 mV SPE 3
100.0
50.0
0.0
-9 -8 -7 -6 -5 -4 -3 -2 -1 0
+
Log[NH4 ]
Rajah 1. Respon sensor ion amonium yang dibuat dengan teknik fotopolimer serta
menggunakan SPE.
Jadual 2. Selektiviti sensor ion amonium dengan membran tanpa pemplastik dalam
kehadiran 0.1 M beberapa ion pengganggu.
Ion Penggangu Log KA,Bpot
-1.389 ± 0.02
+
K
Na+ -3.000 ± 0.08
Ca2+ -4.057 ± 0.22
Mg2+ -4.083 ± 0.27
Li+ -3.846 ± 0.15
perubahan kepekatan larutan ion amonium Sensor amonium ini mempunyai julat
daripada 0.1 M hingga 10-8 M. -5
kelinearan 0.1 hingga 10 M, dengan nilai
kecerunan yang mendekati Nernstian, iaitu 55.5
Respon yang diperlihatkan oleh sensor
amonium ini adalah baik, dengan
± 2.2 mV/dekad (n = 3) seperti dalam jadual 1.
Prestasi sensor amonium ini adalah cukup
kebolehhasilan yang memuaskan, iaitu 3.99%
baik, dan menyamai hasil yang pernah
RSD (n = 3). Kebolehulangan yang baik ini
dilaporkan sebelum ini (Ambrose et al
menunjukkan bahawa elektrod SPE yang
1996,Abranova et al 2000).
dipergunakan itu stabil. Ini disebabkan darjah
kelekatan film fotopolimer poli(n-butil akrilat) Teknik fotopolimer yang digunakan dalam
tanpa pemplastik pada permukaan SPE adalah penyediaan poli(n-butil akrilat) adalah sesuai
kuat. Keadaan ini pernah dilaporkan walaupun tidak ada sebarang pemplastik
sebelumnya (Borchardt, et al 1994). Kelekatan digunakan. Ini disebabkan bentuk struktur
membran polimer pada permukaan elektrod daripada poli(n-butil akrilat) yang cukup
yang baik akan menyebabkan membran tidak fleksibel (Heng et al,2004), sehingga
mudah terlucut dan ini akan meningkatkan membolehkan terjadinya tindak balas kompleks
persentuhan antara membran dengan elektrod. antara ionofor nonaktin dengan ion amonium
dalam keadaan pepejal. Sensor amonium tanpa the neutral carrier nonactin. Talanta, vol 35. No 9 :
pemplastik ini memperlihatkan prestasi had 728-730.
pengesan yang memuaskan, iaitu 5.47 x 10- Borchardt,M., Diekmann,C., Dumschat,C.,
5
± 1.53 x 10-6 M. Selektiviti sensor ion Cammann,K., Knoll,M., 1994. Disposable sodium
amonium dengan membran poli(n-butil akrilat) electrodes. Talanta vol 41, No 6 : 1025 – 1028.
tanpa pemplastik dengan kehadiran beberapa Chin,J., Christian,W., Brents,S., 1999. A rotional
ion pengganggu utama, seperti yang approach to selective recognition of NH4+ over K+.
diperlihatkan oleh jadual 2. Angew Chemistry International Editions 38: 2756 –
Keselektifan sensor kepada amonium adalah 2759.
lebih tinggi daripada Ca2+, Mg2+, Li+ dan Na+, Chin,J., Oh,J., Jon,S.Y., 2002. Tuning and
tetapi rendah terhadap ion kalium. Ini dissecting electronic and steric effects in ammonium
disebabkan saiz ion amonium hampir sama receptors: nonactin Vs artificial receptors. Journal
dengan ion kalium(Chin et al 1999, Chin et al American Chemical Society 124 : 5374-5379.
2002). Claudia,P., Gerhard,J.H., Ingo,K., Wolfbois,O.S.,
1996. Ammonia fluorosensors based on reversible
4.Kesimpulan
lactonization of polymer entrapped rhodamin dyes
Sensor ion amonium yang disediakan and effect of plasticizers. Analytica Chimica Acta
mengunakan teknik fotopolimer beraasaskan 334 : 113-123.
bahan n-butil akrilat tanpa pemplastik serta
menggunakan elektrod SPE memberikan Gotterman,H.L., 1978. Methods for physical and
prestasi yang sebanding dengan polimer yang chemical analysis fresh water. Oxford Blackwell
Scientific Publications.
lain. Membran polimer yang digunakan dapat
berfungsi, walaupun tanpa kehadiran sebarang IUPAC. 1994. Recommendation for nomenclature
pemplastik. Film poli(n-butil akrilat) juga of ion selective electrodes. Pure Applied Chemistry
menunjukkan kelekatan yang kuat pada 66 : 2527-2536.
permukaan elektrod SPE yang digunakan. Ini Heng,L.Y., and Hall,E.A.H., 1996. Methacrylates-
meningkatkan prestasi sensor. acrylate based polymers of low plasticiser content
for potassium ion-selective electrodes. Analytical
5.Ucapan Terimakasih Chimica Acta 324 : 47-56.
Penghargaan yang setingginya diberikan
kepada Kementerian Sains, Teknologi dan Heng,L.Y., and Hall,E.A.H., 2000. Producing “self-
Inovasi Malaysia, National Biotechnology plasticizing” ion selective membranes. Anal.Chem.
72 : 42-51.
Directorate dan juga kepada Universiti
Kebangsaan Malaysia untuk bantuan kewangan Heng,L.Y., and Hall,E.A.H., 2000. One-step
melalui projek IRPA 09-02-02-006-EAR057 synthesis of K+-selective methacrylic-acrylic
dan projek IRPA 09-03-03-0006NBD. copolymer containing grafted ionophore and
requiring no plasticizer. Electroanalysis 12: 178-
6. Rujukan 186.
Abranova, N.Y, Bratov, A.V, Vlasov, Y.G.,
Bartoli,D., 1998. Photopolymerized polyacrylates as Heng,L.Y., and Hall,E.A.H., 2000. Taking the
ion selective membranes of chemical sensors. plasticizer out of methacrylic-acrylic membranes
Journal of Analytical Chemistry 53 (8) : 756 -761. for K+-selective electrodes. Electroanalysis 12 : 187
-193.
Abranova, N.Y., Borisov.Y., Bratov, A.V.,
Gavrilenko,P., Dominguez,C., Spiridonov,V., Heng,L.Y., and Hall,E.A.H., 2001. Assessing a
Suglobova,E., 2000. Application of an ion-selective photocured self-plasticised acrylic membrane recipe
field effect transitor with a photocured polymer for Na and K ion selective electrodes. Analytica
membrane in nephrology for determination of Chimica Acta 443 : 25-40.
pottasium ions in dialysis solution and in blood Heng,L.Y., Chern,L.H., Ahmad,M. 2002. A
plasma. Talanta 52 : 533-538. hydrogen ion selective sensor based on non-
Ambrose,T.M., Meyerhoff,M.E., 1996. plasticised methacrylic-acrylic membranes. Sensors
Characterization of photopolymerized decyl 2 : 339-346.
methacrylate as a membrane matrix for ion-selective Heng,L.Y., Fang,T.H., Chern,L.H, Ahmad,M. 2003.
electrodes. Electroanalysis 8: 1095-1100. Influence of methacrylic-acrylic copolymer
Beer,D.D., and Den Heuvel,J.C.V., 1988. Response composition on plasticiser-free optodes films for pH
of ammonium selective microelectrodes based on sensors. Sensors 3 : 83-90.
Abstrak
Empat dimer resveratrol telah berhasil diisolasi dari kulit batang H. dryobalanoides, yaitu (-
)-balanokarpol, (+)-parviflorol, (-)-hopeafuran, dan (-)-heimiol A. Struktur molekul senyawa-
senyawa tersebut ditetapkan berdasarkan data spektroskopi, yang meliputi spektrum UV, IR,
NMR 1-D, dan NMR 2-D. Pengujian sifat sitotoksik keempat senyawa tersebut terhadap sel
murin leukemia P-388 menghasilkan nilai IC50 berturut-turut 14,3, 65,3, 52,0 dan > 100 ppm.
Keberartian penemuan senyawa-senyawa tersebut pada kemotaksonomi Hopea juga dibahas
pada makalah ini.
Kata Kunci : dimer resveratrol, H. dryobalanoides, Dipterocarpaceae, sel murin leukemia P-
388.
HO HO
HO
OH HO
OH
OH
HO
O HO OH
O
HO HO
(1) (2)
HO OH
HO
HO O
O OH
OH
HO
OH
O OH
HO HO
(3) (4)
54o (c 0.1 MeOH), UV absorption λmaks d, J=8.8 Hz, H-3/5a), 6.49 (1H, d, J=2.2 Hz, H-
(MeOH) 227 (4.64), 284 nm (4.05), showed 14b), 6.40 (1H, d, J=2.6 Hz, H-14a), 6.25 (1H,
bathochromic shift (MeOH + NaOH), IR d, J=2.2 Hz, H-12b), 6.15 (1H, d, J=2.2 Hz, H-
spectrum (cm-1) 3352 (OH), 1613, 1513 and 12a), 4.98 (1H, d, J=3.2 Hz, H-8b), 5.58 (1H,
1346 (C=C benzene), and 834 (para- br s, H-7a), 4.33 (1H, d, J=3.2 Hz, H-7b), 4.24
disubstituted benzena). 1H NMR spectrum (1H, br s, H-8a). -OH {8.18 (2H, s), 8.12 (1H,
(aseton-d6, 399.78 MHz) δH (ppm): 7.48 (2H, d, s), 8.07 (2H, d, J= 4.0 Hz), 7.59 (1H, s)}. 13C
J=8.4, H-2/6a); 6.94 (2H, d, J=8.4, H-3/5a); NMR spectrum (aseton-d6, 100,53 MHz) δC
6.73 (2H, d, J=8.4, H-2/6b), 6.41 (2H, d, J=8.4, (ppm) 157.8 (C-11b), 157.6 (C-13a), 157.6 (C-
H-3/5b), 6.24 (1H, d, J=2.2, H-14b), 6.18 (1H, 13b), 157.5 (C-4a), 156.6 (C-4b), 147.5 (C-
br s, H-12b), 6.09 (1H, d, J=1.1, H-12a), 5.95 11b), 155.1 (C-11a), 147.5 (C-9b), 143.1 (C-
(1H, d, J=2.2, H-14a), 5.69(1H, d, J=9.5, H- 9a), 137.4 (C-1a), 137.7 (C-1b), 130.5 (C-2/6a),
7a), 5.38 (1H , br s, H-8b), 5.15 (1H, d, J=9.5, 128.4 (C-2/6a), 117.3 (C-10b), 116.6 (C-10a),
H-8a), 4.89 (1H, br s, H-7b), and OH 115.8 (C-3/5b), 115.7 (C-3/5a), 107.7 (C-14a),
{4.41(1H, br d), 8.65, 8.09, 8.06, 7.91, 7.81 (b 105.1 (C-14b), 102.7 (C-12b), 102.5 (C-12a),
rs)}. 13C NMR spectrum (aseton-d6, 100.53 81.9 (C-8b), 81.8 (C-7a), 51.3 (C-7b), dan 47.4
MHz) δC (ppm): 133.2 (C-1a), 131.3 (C-2(6)a), (C-8a).
113.9 (C-3(5)a), 155.5 (C-4a), 50.0 (C-7a),
3. Results and Discussions
72.9 (C-8a), 140.6 (C-9a), 113.6 (C-10a), 159.5
Compound 2, a yellow amorphous powder, mp.
(C-11a), 94.8 (C-12a), 158.9 (C-13a), 104.2 (C-
172 -176 oC, [α]D20 +122o (c 0.1 MeOH),
14a), 133.4 (C-1b), 130.3 (C-2/6a), 116.2 (C-
showed UV absorption at λmaks 222 nm (4.99),
3/5b), 158.3 (C-4b), 93.3 (C-7b), 58.3 (C-7b),
339 nm (4.27), characteristic for an extended
142.6 (C-9b), 120.2 (C-10b), 157.2 (C-11b),
conjugation of a phenolic chromophore. The
101.8 (C-12b), 156.5 (C-13b), and 106.5 (C-
maxima were shifted to the longer wavelengths
14b).
on addition NaOH. The IR spectrum of 2
Hopeafuran (3), a yellow amorphous powder, exhibited the presence of hydroxyl (3350 cm-1),
mp. 204 - 206 oC, [α]D20 +21o (c 0.1 MeOH), carbonyl (1649 cm-1), and aromatic (1614,
UV absorption λmaks (MeOH) 396 nm, showed 1512, and 1456 cm-1) groups, including also the
bathochromic shift (MeOH + NaOH). IR absorption for para-disubstituted benzene (837
spectrum (KBr) ν maks (cm-1) 3365 (OH), 1613, cm-1). The 13C NMR spectrum of 2 (Table 1)
1512, and 1451 (C=C benzena), and 833 (para- showed 19 well separated signals for 21
disubstitutedbenzena). 1H NMR spectrum carbons, which is distributed into 5 C-oxyaryl,
(aseton-d6, 399.78 MHz) δH (ppm): 7.69 (2H, d, 13 C-aromatic, 1 C-carbonyl, and 2 C-aliphatic
J=8.8, H 2/6a), 7.32 (1H, d, J=2.2, H 14b), 7.03 carbons. Assuming that the compound is a
(1H, d, J=2.2, H 12b), 6.97 (2H, d, J=8.8, H resveratrol oligomer, these spectroscopic data
3/5a), 6.84 (2H, d, J=8.8, H 2/6b), 6.69 (1H, d, suggested 2 is a modified dimer resveratrol by
J=2.5, H 14a), 6.56 (1H, d, J=2.5, H 12a), 6.54 the loss of benzyl moiety. Supporting these
(2H, d, J=8.8, H 3/5b), 6.11 (1H, br s, 7b), OH data, the 1H NMR spectrum of 2 (Table 1)
{8.87 (br s, 1 H, H-4a), 8.74 (br s, 1 H, H-11a), exhibited a few aromatic signal that represented
8.32 (br s, 1 H, H-13a), 7.94 (br s, 1 H, H-4b), a p-hidroxyphenyl (δH 6,85 and 6,48 ppm,
and 8.75 (br s, 1 H, H-13b)}. respectively), two pairs of meta coupled proton
for 1.2.3.5-tetrasubstitutedbenzen unit (δH 7.40
Heimiol A (4), a yellow amorphous powder,
and 6.73 ppm, 6.75 and 6.09 ppm) and two
mp. 229 - 231 oC, [α]D20 - 17o (c 0.1 MeOH),
aliphatic proton signals at δH 5.30 and 5.15 ppm
UV absorption (MeOH) λmaks (log ε) 226
for 1.2.2-tetrasubstitutedethanol. In addition,
(4.70), and 283 nm (4.10), showed 1
H NMR spectra of 2 showed an aliphatic
bathochromic shift (MeOH + NaOH). IR
hydroxyl proton signal at δH 5.30 ppm, four
spectrum (KBr) ν maks (cm-1) 3306 (OH), 1613,
phenolic proton signal at δH 8.01, 8.61, 8.79,
1512, and 1455 (C=C benzena), and 838 (para-
9.35 ppm and a chelated phenolic proton signal
disubstitutedbenzena). 1H NMR spectrum
at δH 14.13 ppm. According to these structural
(aseton-d6, 399.78 MHz) δH (ppm) 7.14 (2H, d,
units and comparison of the data with those
J=8,4 Hz, H-2/6b): 6.91 (2H, d, J=8.8 Hz, H-
reported in literatures, 2 is similar to parviflorol
2/6a), 6.72 (2H, d, J=8.4Hz, H-3/5b), 6.61 (2H,
or hemsleyanol E. Parviflorol has cis
HO HO
4a 4a
H
1a 1a
OH OH
H H
OH H H H
4b 7a 8a 9a 14a
OH
2b 4b 7a 8a 9a 14a
1b OH 2b
6b 7b 1b OH
HO 7b
12a HO
H
O 6b 12a
O
H
O HO
(a) (b)
Figure 1. HMBC (a) and NOESY (b) spectra of compound 2
Table 1. The NMR Spectra of 2 (1), Parviflorol (1*)4 and Hemsleyanol E (1**)3
1 13
H NMR C NMR
No
1 1* 1** 1 1* 1**
1a 130,7 131,1 132,6
2 (6)a 6,85 (d, 8,1) 6,86 (br d, 8,6) 6,80 (d, 8,6) 130,0 130,5 129,9
3 (5)a 6,48 (d, 8,8) 6,49 (d, 8,6) 6,56 (d, 8,6) 114,5 115,0 115,5
4a - - - 155,7 155,8 156,2
7a 5,15 (br s) 5,15 (br s) 6,24 (d, 6,2) 47,9 48,4 47,5
8a 5,30 (br s) 5,32 (br s) 5,14 (br d, 6,2) 74,3 74,8 79,0
9a - - - 148,1 148,8 147,0
10a - - - 111,2 111,7 111,5
11a - - - 168,5 168,8 167,6
12a 6,09 (d, 2,9) 6,10 (d, (2,5) 6,18 (d, 2,0) 101,7 102,1 103,0
13a 164,1 164,5 163,5
14a 6,75 (br d, 6,74 (br d, 2,5) 6,04 (d, 2,0) 106,7 107,1 108,0
2,8)
1b - - - 141,1 141,5 141,5
2b - - - 121,7 122,1 119,5
3b - - - 155,5 156,2 156,9
4b 6,73 (d, 2,6) 6,73 (d, 1,9) 6,69 (d, 2,0) 107,7 108,1 109,8
5b 156,8 157,2 157,7
6b 7,40 (d, 2,6) 7,41 (d, 1,9) 7,44 (d, 2,0) 110,0 110,5 111,5
7b 195,1 195,7 196,4
OH 5,30 (br s) 5,20 (d, 4,0; C- 4,53 (br s,
8,01; 8,61; 8a) C8a,1H)
8,79; 9,35 7,87; 8,48; 8,02 (br s, 1H)
(each br s) 8,65; 9,15 8,50 (br s, 3H)
14,13 (s; C- (each br s) 13,34 (s, 1H)
3b) 14,10 (s; C-3b)
*Tanaka, T., 2000; **Ito, T., 2001
orientations at H-7a and H-8a, while Comparation of NMR data of 2 with those of
hemsleyanol E showed trans orientations. The parviflorol and hemsleyanol E further
NOESY spectrum of 2 showed the orientation confirmed the structure of 2 (Table 1).
of H(7a) and H(8a) of 2 was cis, therefore 2 is
Using the same methodology as that of 2, it
parviflorol.
can be cloncluded that 1 is (-)-balanocarpol
(Tanaka, 2000), 3 is (-)-hopeafuran (Tanaka,
2001), and 4 is heimiol A (Weber, 2001).
HO
HO
HO
OH
HO
O [O] 4 OH
OH
HO HO
OH
HO
O O
OH
O H
2, 4
HO
HO Balanocarpol, 1 OH
Hopeafuran, 3 OH
HO
HO
HO
Heimiol A, 4
HO
OH
HO
OH OH
HO
OH
HO O HO
HO
Parviflorol, 2
HO 2
Figure 2
thankful for the Herbarium Bogoriense staffs, Nitta, T., Arai, T., Takamatsu, H., Inatomi, Y.,
Bogor, for the identification of the sample. Murata, H., Iinuma, M., Tanaka, T., Ito, T., Asai, F.,
Ibrahim, I., Nakanishi, T., and Watanabe, K.,
6. References 2002,”Antibacterial Activity of Extracs Prepared
Alley, M.C., Scudiero, D. A., Monks, A., Hursey, from Tropical and Subtropical Plants on Methicillin
M. L., Czerwinski, M. J., Fine, D. L., Abbott, B. J., Resistant Staphilococcus aureus”, J. of Health
Mayo, J. G., Shoemaker, R. H., and Boyd, M. R., Science, 48(3):273-276.
1988, “Feasibility of drug screening with panels of
human tumor cell lines using a Ohguchi, K., Tanaka, T., Ito, T., Iinuma, M.,
microculturetetrazolium assay”, Cancer Research, Matsumoto, K., Akao, Y., Nozawa, Y., 2003,
48 : 589-601. “Inhibitory Effects of Resveratrol Derivatives from
Dipterocarpaceae Plants onTyrosinase Activity,
Aminah, N.S., Achmad, S.A., Aimi, N., Ghisalberti, Biosci. Biotechnol. Biochem., 67 (7):1587-1589.
E.L., Hakim, E.H., Kitajima, M., Syah, Y.M.,
Takayama, H., 2002,”Diptoindonesin A, a new C- Pryce, R. J., Langcake, P., 1977,”α Viniferin : An
glucoside of ε-Viniferin from Shorea seminis Antifungal Resveratrol Trimer from Gravevines”,
(Dipterocarpaceae), Fitoterapia, 73 :501-507. Phytochemistry, 16 : 1452-1454.
Ashton, P. S., 1983, Flora Malesiana, Martinus Sotheeswaran, S., Pasupathy, V. 1993, “Distribution
Nijhoff, London. of resveratrol oligomers in plants”, Phytochemistry
32 (5), 1083-1092.
Ito, T., Akao, Y., Yi, H., Ohguchi, K., Matsumoto,
K., Tanaka, T., Iinuma, M., Nozawa, Y., 2003, Tanaka, T., Ito, T., Ido, Y., Son, T.K., Nakaya, K.,
“Antitumor effect of resveratrol oligomers against Iinuma, M., Ohyama, M., Chelladurai, V., 2000,
human cancer cell lines and the molecular “Stilbenoids in stem bark of Hopea parviflora”,
mechanism of apoptosis induced by vaticanol C”, Phytochemistry, 53, 1009-1014.
Carcinigenesis, 24 (9) : 1489-1497. Tanaka, T., Ito, T., Ido, Y., Nakaya, K., Iinuma, M.,
Ito, T., Tanaka, T., Ido, Y., Nakaya, K., Iinuma, M., Chelladurai, V., 2001,”Hopeafuran and a C-
Riswan, S. 2001, “Stilbenoids isolated from stem Glucosyl Resveratrol Isolated from Stem Wood of
bark of Shorea hemsleyana”, Chem. Pharm. Bull., Hopea utilis”, Chem. Pharm. Bull., 49 (6) 785-787.
48 (7), 1001-1005. Tukiran, 2004,”Senyawa Mikromolekul dari
Kang, H. J., Park, H. Y., Choi, S. W., Yang, E. K., Beberapa Tumbuhan Meranti (Shorea) Indonesia”,
and Lee, W. J., 2003, “Resveratrol derivatives Disertasi, ITB, Bandung.
potently induce apoptosis in human promyelocytic Weber, J. F., et.al., 2001,”Heimiol A, a new dimeric
leukemia cells”, Experimental and Molecular stilbenoid from Noebalanocarpus heimii”,
Medicine, 35 (6) : 467-474. Tetrahedron Letter 42 : 4895-4897.
Kitanaka, S., Ikezawa, T., Yasukawa, K., Wood, G.H.S., and Meijer, W., 1964, Dipterocarps
Yamanouchi, S., Takido, M., Sung, H. K., and Kim, of Sabah, Sabah Forest Record No. 5, Forest
I. H., 1990,”(+)-α-Viniferin, an Anti-inflammatory Departement, Sandakan.
Compound from Caragana chamlagu Root”, Chem.
Pharm. Bull., 38(2):432-435.
Saraswati1)
Abstrak
Bagas merupakan limbah organik dari pabrik gula. Kandungan selulosanya cukup tinggi
sehingga bagas dapat dimungkinkan sebagai bahan baku pembuatan glukosa dengan proses
hidrolisa. Dalam penelitian ini sebelum dilakukan proses hidrolisa dengan enzim, dilakukan
proses pretreatment secara kimia terlebih dahulu. Variabel pada proses pretreatment : jenis
pretreatment agent (NaOH dan H2SO4) dan konsentrasinya (1%; 3%; 5%). Variabel pada
hidrolisa enzimatik adalah perbandingan enzim selulase terhadap bagas dengan larutan
buffernya (0.1; 0.05; 0.005 ml enzim selulase)/gram (bagas + buffer). Pretreatment dilakukan
pada suhu 121oC selama 30 menit sedang hidrolisa dengan enzim selulase pada suhu 50oC
sampai tercapai kadar gula konstan. Hasil penelitian menunjukkan bahwa pretreatment agent
yang terbaik adalah NaOH dengan konsentrasi 5% dan untuk hidrolisa 0.1 ml enzim
selulase/gram bagas + buffer dengan hasil akhir yield 14.046 gram glukosa/100 gram bagas
awal dan konversi selulosa 79.738%.
Abstrak
Telah dilakukan interkalasi besi oksida ke dalam antarlapis silikat lempung montmorilonit,
dan dilanjutkan dengan karakterisasi sifat-sifat fisikokimia montmorilonit sebelum dan
setelah diinterkalasi. Montmorilonit sebelum dan setelah diinterkalasi besi oksida
dikarakterisasi untuk mempelajari perubahan sifat-sifat fisikokimianya yang meliputi: jarak
dasar d001, ditentukan dengan X-Rays Difractometer; morfologi permukaan, dianalisis
dengan SEM/EDAX; luas permukaan spesifik, distribusi ukuran pori, volume pori total,
dipelajari dengan Gas Sorption Analyzer; serapan gugus fungsional, dipelajari dengan
spektrofotometer FTIR; dan kandungan logam besi, ditentukan dengan X-Ray Fluorescent
Analyzer. Hasil penelitian menunjukkan terjadi peningkatan pada: jarak dasar d001, dari
14,11Å menjadi 16,85Å; luas permukaan spesifik dari 69,71 m2/g menjadi 126,49 m2/g;
volume pori total dari 50,70x10-3 mL/g menjadi 107,89x10-3 mL/g; serta peningkatan
kandungan besi dari 4,57 %(b/b) menjadi 23,61 %(b/b). Morfologi permukaan montmorilonit
menampakkan struktur berlapis (laminated), sedangkan montmorilonit hasil interkalasi besi
oksida memperlihatkan morfologi lapisan oksida eksternal, dengan struktur delaminasi
(delaminated).
Abstrak
Enzim DNA Polimerase berperan dalam menambahkan deoksinukleotida pada ujung
pertumbuhan dari primer selama proses replikasi berlangsung. Enzim ini merupakan enzim
multifungsi yang memiliki aktivitas polymerase 5’ 3’, eksonuklease 5’ 3’ dan eksonuklease
3’ 5’. Gen DNA pol I dari bakteri termofilik isolat lokal telah diklon dan ditentukan urutan
nukleotidanya. Konstruksi gen DNA pol mutan telah dilakukan dengan cara mutasi delesi in
frame dengan menggunakan enzim restriksi. Dalam penelitian ini telah dilakukan konstruksi
dan ekspresi DNA Polimerase mutan delesi (∆)EcoRI, ∆XhoI dan delesi ganda ∆XhoI-
∆EcoRV. Ekspresi tinggi heterolog gen mutan delesi (∆)EcoRI dan ∆XhoI telah dilakukan di
E.coli strain GI724 sebagai protein fusi thioredoksin. Bobot molekul protein mutan hasil
ekspresi tinggi telah dikonfirmasi dengan SDS-PAGE.
Kata kunci: DNA Polimerase, delesi in frame, mikroorganisme termofilik
menunjukkan menunjukkan bahwa gen DNA Supernatan yang diperoleh merupakan protein
polimerase isolat tersebut memiliki homologi ekstrak kasar (crude extract protein) dan
tertinggi (99%) dengan gen pol A (DNA Pol I) disimpan pada suhu – 200C.
dari Bacillus caldotenax. Berdasarkan analisis
2.4 Elektroforesis Protein Gel
urutan asam amino disarankan bahwa DNA Pol
Poliakrilamida
I hasil isolat lokal mempunyai 3 domain yang
Elektroforesis gel poliakrilamida-natrium
berperan dalam aktivitas katalitik yang
dodesil sulfat (SDS-PAGE) protein dilakukan
berbeda, yaitu eksonuklease 5’ 3’,
dengan metode Sambrook (1989), yang
eksonuklease 3’ 5’ dan polimerase 5’ 3’
penyiapan gel atas (stacking gel) dan gel bawah
(Kiefer, 1992).
(separating gel) yang dimodifikasi. Gel atas
Analisis biokimia gen pengkode DNA 4% dibuat dari 1,33 mL akrilamida 30%;
Polimerase dari bakteri isolat lokal sedang aquades 6,1 mL; 2,5 mL Tris-HCl 1M (pH 6,8);
dilakukan. Langkah awal analisis ini adalah 100 µL SDS 10% (b/v); 50 µL
dengan mempelajari letak domain-domain yang amoniumpersulfat 10% (b/v) dan 10 µL
bertanggung jawab terhadap fungsi tertentu TEMED. Gel bawah 12,5% terbuat dari 4,0 mL
dengan melakukan mutasi di daerah-daerah akrilamida 30%; aquades 3,35 mL; 2,5 mL
tertentu. Kemudian mengekspresikan gen-gen Tris-HCl 1,5 M (pH 8,8), 100 µL SDS 10%
mutan tersebut di E.coli GI724. (b/v); 50 µL amoniumpersulfat 10% dan 5 µL
2. Percobaan TEMED. Pembuatan gel, dibekukan dengan
2.1 Penyiapan mutan delesi menuangkan gel bawah ke dalam kaca-kaca
Pembuatan mutan delesi dilakukan dengan alat elektroforesis yang sudah diset terlebih
memotong fragmen DNA dengan enzim dahulu. Setelah gel bawah memadat, gel atas
restriksi yang sesuai. Fragmen DNA yang dituang diatas gel bawah dan dipasang "sisir"
diperoleh disambung kembali dengan T4 DNA untuk cetakan sumur tempat sampel.
Ligase. Semua pengerjaan rekayasa genetika 3. Hasil dan pembahasan
dilakukan dengan menggunakan metoda Dalam mempelajari struktur-fungsi suatu enzim
standar (Sambrook, et.al., 1989). diperlukan enzim wild-type maupun enzim-
2.2 Reaksi ligasi enzim mutannya dalam jumlah cukup banyak
Reaksi ligasi fragmen DNA mutan dengan dan murni. Studi domain-domain yang penting
vektor pTRxFus™ dilakukan sesuai prosedur bagi struktur enzim ataupun bagi suatu aktivitas
yang direkomendasikan oleh produsen vektor memerlukan enzim mutan yang telah
dan enzim ligase (Invitrogen,USA; Amersham, mengalami perubahan pada asam amino
USA) Reaksi ligasi dilakukan di dalam tabung tertentu atau penghilangan satu atau lebih asam
Eppendorf 0,5 mL dengan mencampurkan 5 µL amino di daerah tertentu. Untuk memenuhi hal
bufer ligasi 2x, 1µL vektor pTrxFus (50 diatas, pada penelitian ini dilakukan konstruksi
enzim-enzim DNA Polimerase mutan hasil
ng/µL), 25-80 ng fragmen DNA hasil
mutasi delesi secara in frame dengan
amplifikasi, 1µL T4 DNA ligase (3 unit/mL)
menggunakan enzim restriksi. Konstruksi gen
dan aquabides bebas nuklease hingga 10 µL. DNA Polimerase mutan dilakukan dalam
Campuran dihomogenkan dengan pipet vektor ekspresi tinggi untuk kemudian
kemudian diinkubasi pada 40C selama diekspresikan secara heterolog di E.coli
semalam. sehingga enzim mutan dapat diperoleh dalam
2.3 Isolasi protein dari sel transforman jumlah besar. Hasil ekspresi heterolog ini
E.coli dianalisa dengan elektroforesis SDS-PAGE.
Sel dipanen dengan cara sentrifugasi. Pelet sel Produk gen hasil konstruksi merupakan protein
yang telah diresuspensi dalam bufer lisis (50 fusi thioredoksin dengan DNA Polimerase.
mM Tris-Cl pH 8 ; 2,5 mM EDTA), kemudian 3.1 Analisis Homologi DNA Polimerase
dilisis dengan sonikasi selama 60 detik Analisis terhadap urutan basa gen DNA
sebanyak 5-10 kali dengan interval waktu 30 polimerase wild type mengindikasikan bahwa
detik. Selama proses sonikasi berlangsung , gen DNA polimerase WT dari bakteri isolate
suspensi sel selalu diletakkan di dalam es. lokal mempunyai homologi tinggi (99%)
Debris sel berupa pelet dipisahkan dengan cara dengan gen DNA polymerase I bakteri
sentrifugasi 12.000 xg selama 10 menit, 4o C.
Gambar 3.1 Hasil analisis homologi asam amino DNA Polimerase WT isolat lokal
(www.ncbi.nih.nlm.gov)
termofilik Bacillus caldotenax. Hal ini 3.2 Konstruksi DNA Polimerase mutan
ditunjang dengan analisis urutan asam amino delesi
DNA Polimerase WT menggunakan CDD Penelitian yang dilakukan telah menghasilkan
(Conserved Domain Database) GenBank. Hasil tiga macam gen mutan delesi DNA Polimerase
analisis menunjukkan bahwa struktur DNA yaitu mutan ∆ecoRI, mutan ∆xhoI dan mutan
Polimerase WT isolat lokal menunjukkan delesi ganda ∆XhoI-∆EcoRV di vektor ekspresi
kesamaan dengan keluarga DNA Polimerase I. pTrxFus™. DNA Pol mutan ∆EcoRI akan
Kesamaan ini ditunjukkan dengan adanya kehilangan 209 asam amino di daerah ujung C
domain POLAc (domain polimerase pada dan diduga kehilangan sebagian domain
keluarga DNA Pol I), domain eksonuklease polimerase dan juga akan kehilangan salah satu
5’ 3’ dan domain eksonuklease 3’ 5’. aspartat yang lestari yaitu Asp653 sehingga
Berdasarkan data domain-domain DNA mutan ini diduga akan memiliki aktivitas
Polimerase I, dilakukan analisis restriksi secara polimerase yang jauh lebih rendah
in silico untuk kepentingan delesi secara in dibandingkan enzim WT-nya. Proses delesi in
frame dengan mencari enzim restriksi yang frame dengan enzim EcoRI dilakukan pada
memiliki 2 sisi pemotongan pada gen DNA pITB9 yaitu plasmid ekspresi pTrxFus™ yang
polimerase WT. Dari sejumlah enzim yang ada membawa gen DNA polimerase WT. Hasil
dilakukan seleksi terhadap enzim restriksi yang restriksi menunjukkan 2 pita DNA berukuran
memotong secara in frame. Peta restriksi sekitar 5,6 Kb dan 627 pb pada elektroforesis
berbagai enzim pada gen DNA pol WT agarosa. Fragmen 627 pb didelesi dari gen
ditampilkan pada gambar 4.2. DNA polimerase WT dengan melalukan self-
ligation fragmen 5,6 Kb. Hasil ligasi adalah
plasmid pTrxFus-mutan∆EcoRI (pITB11).
Delesi gen DNA polimerase WT dengan menghasilkan dua fragmen DNA yang
menggunakan enzim XhoI menyebabkan berukuran sekitar 4,8 Kb dan 285 pb (data
hilangnya 1116 pb. Enzim DNA Polimerase tidak ditampilkan). Delesi fragmen 285 pb dari
mutan ∆XhoI akan kehilangan 372 asam amino gen pol I ∆XhoI dilakukan dengan meligasi
di daerah ujung N. Berdasarkan informasi yang kembali (self-ligation) fragmen 4,8 Kb. Hasil
diperoleh di CDD, DNA Polimerase mutan ligasi yang diperoleh digunakan untuk
∆xhoI akan kehilangan hampir seluruh domain mentransformasi E.coli strain GI724 dengan
eksonuklease 5’ 3’ dan eksonuklease 3’ 5’. tujuan menghasilkan klon yang membawa
Proses delesi in frame mutan ∆XhoI dilakukan plasmid pTrxFus- pol I mutan ganda ∆XhoI-
pada plasmid pITB9. Hasil restriksi pITB9 ∆EcoRV.
dengan enzim XhoI menunjukkan 2 pita DNA
berukuran sekitar 5,1 Kb dan 1116 pb. Fragmen
1116 pb didelesi dengan melakukan self-
ligation fragmen 5,1 Kb (pITB12).
Berdasarkan hasil analisis restriksi secara in
silico, enzim EcoRV memiliki tiga sisi
pengenalan restriksi pada gen pol I WT. Sisi
pemotongan pertama yaitu pada basa ke 468
dan terdapat pada daerah ujung 5' dari gen. Sisi
pengenalan restriksi kedua dan ketiga terletak
pada basa ke 2040 dan 2325 yang terletak pada
daerah ujung 3' dari gen pol I. Daerah diantara
sisi pemotongan kedua dan ketiga yang
berukuran 285 pb yang akan didelesi pada gen.
Gambar 3.5. Elektroforegram plasmid
Gen pol I ∆EcoRV akan kehilangan 95 asam
pITB12∆EcoRV .
amino di daerah C-terminal yang diduga Plasmid pITB9 (1); pITB12 (2);
sebagai domain untuk aktivitas polimerase. pITB12∆EcoRV dari koloni 10, 21 dan
Karena pada gen pol I terdapat tiga sisi restriksi 11 (lajur 3,4 dan 5)
EcoRV maka digunakan pITB12 (pTrxFus-pol
I ∆XhoI) yang hanya memiliki dua sisi
pengenalan restriksi EcoRV. pITB12 3.3. Ekspresi DNA Polimerase Mutan Delesi
mengandung insert gen pol I yang telah E.coli yang membawa plasmid pITB11 dan
mengalami delesi fragmen XhoI. Restriksi pITB12 ditumbuhkan dan diinduksi dengan
sempurna pITB12 dengan enzim EcoRV akan menambahkan triptofan (konsentrasi akhir 100
Gambar 3.6. Elektroforegram SDS-PAGE protein ekstrak kasar dari koloni E.coli
(GI724(pITB9)), (GI724(pITB11)) dan (GI724(pITB12)).
ug/mL) dengan thujuan enzim-enzim DNA Joyce, C. M., Steitz, T. A. (1994), Function and
Polimerase mutan dapat terekspresi. Adanya structure relationship in DNA polymerases, Annu.
ekspresi tinggi ditandai dengan munculnya pita Rev. Biochem., 63, 777-822
tebal pada elektroforegram SDS-PAGE. Kiefer, J.R., Mao, C., Hansen, C.J., Basehore, S.L.,
Hogrefe, H.H., Braman J.C. (1997), Crystal
4. Kesimpulan
structure of a thermostable Bacillus DNA
Penelitian yang telah dilakukan telah polymerase I large fragment at 2.1 Å resolution,
menghasilkan 3 macam gen pol I mutan delesi Structure, 5, 95-108.
dengan harapan mutan-mutan tersebut
mewakili delesi enzim di daerah N-terminal, Konberg, A. (1988), Minireview : DNA replication,
The Journal of Biological Chemistry, 236, 1-4.
daerah C-terminal maupun dikeduanya. Gen
pol I mutan ∆EcoRI dan ∆XhoI telah berhasil Li, Y., Mitaxov, V., Waksman, G. (1999), Structure-
diekspresikan, sedangkan gen pol I mutan based design of Taq DNA polimerase with
delesi ganda XhoI-EcoRV baru berhasil improved properties of dideoxynucleotide
dikonstruksi dalam vektor ekspresi pTRxFus™. incorporation, Proc. Natl. Acad. Sci., 9491-9496
Pramono, H. (2004), Kloning dan ekspresi di E.coli
5. Ucapan terima kasih gen DNA Polimerase I bakteri termofilik isolat
Penelitian ini tidak dapat terselenggara dengan Cimanggu, Disertasi Doktor, Institut Teknologi
baik tanpa bantuan dari Proyek Penelitian Riset Bandung
Unggulan Terpadu (RUT).
Sambrook, J., Fritsch, E.T., Maniatis, T. (1989),
6. Daftar Pustaka Molecular Cloning : A Laboratory Manual, 2nd Ed.,
Akhmaloka, Pramono, H., Suharto, A., Cold Spring harbor, Lab. Press, NY.
Retnoningrum, D., Padmawinata, K., and Oei B.L.
(2000), Cloning of DNA Polymerase Gene From Shima, Y., Hasegawa, A., Arakawa, T., Tanaka, K.,
Thermophilic Bacterium. 18th International Ikeda, K., Komatsubara, H., Inoue, H., Kawakami,
Congress of Biochemistry and Molecular Biology, B., Oka, M., Emi, S., Yomo, T., Negoro, S., Urabe,
Birmingham, UK. I. (1996), Construction and characterization of N-
terminally truncated DNA polymerase from
Amblar, M., de Lacoba, M.G., Corrales, M.A., Thermus thermophilus, Journal of Fermentation and
López, P. (2001), Biochemical analysis of point Bioengineering, 81, 504-510.
mutations in the 5’-3’ exonuclease of DNA
Polymerase I of Streptococcus pneumoniae, The Vieille, C., and Zeikus, G. J. (2001),
Journal of Biological Chemistry, 276, 19172-19181 Hyperthermophilic enzymes : sources, uses and
molecular mechanisms for thermostability,
Daniel, R. M., Dines, M., Petach, H. (1996), The Microbiology and Molecular Biology Reviews, 65,
denaturation and degradation of stable enzymes at 1-43
high temperatures, Biochem.J., 317, 1-11.
Satirah Zainalabidin1), Jalifah Latip2), Engku Norbaya Muda1) and Paden Morat1)
1) Dept. of Biomedical Science, Faculty of Allied Health Sciences, National University of Malaysia, Jalan
Raja Muda Aziz, 50300 Kuala Lumpur.
e-mail: paden@medic.ukm.my
2) School of Chemical Sciences and Food Technology, National University of Malaysia,
43600 Bangi, Selangor.
e-mail: jali@pkrisc.ukm.my
Abstract
The effect of Garcinia atroviridis on lipid composition in the blood serum of normal rats was
studied. The male Sprague-Dawley rats were used and divided into five groups, in which each
group was treated with distilled water (control), G. atroviridis ethyl acetate (EtOAc) crude
extract (50 & 100 mg/kg BW) and G. atroviridis ethanol (EtOH) crude extract (50 & 100
mg/kg BW) respectively. The extracts were given on alternate days, three times per week and
through oral force-feeding. After 12 weeks of treatment, the serum of each rat was taken for
total cholesterol, LDL-cholesterol, HDL-cholesterol, triglyceride and total protein analyses
using the spectrophotometric method. Overall, the result showed that the cholesterol, LDL,
triglyceride, LDL/HDL ratio (atherogenic index) and total protein serum level were increased
significantly (p<0.05) in all of the treated groups, as compared to the control. In conclusion,
EtOAc and EtOH crude extracts of G. atroviridis might not contain the bioactive compounds
that can lower lipid levels in normal rats.
Keywords: Garcinia atroviridis, chronic treatment, lipid profile
854
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Satirah Zainalabidin, Jalifah Latip, Engku Norbaya Muda and Paden Morat
Total Cholesterol
90
*
80
Concentration (mg/dl)
70
60
50
40
30
20
10
0 1
LDL
60 *
*
*
Concentration (mg/dl)
50
40
*
30
20
10
0 1
HDL
30
Concentration (mg/dl)
25
20
15
*
10
*
5
0 1
Triglyseride
120
*
Concentration (mg/dl)
100
*
80
60
40
20
0 1
Total protein
120
Concentration (mg/dl)
100
80
60
40
20
0
1
Atherogenic Index
10
*
9 **
8
6 *
5
0 1
normolipidemic rats (Hamilton et al. 1977). Maybe there are bioactive compounds such as
Another study showed depression of the in vivo (-)-HCA in the G. atroviridis fruit extract, but
lipogenic rates in a dose-dependent manner in could not show any significant effects as they
the liver, adipose tissue and small intestine and are still in mixture in the crude extracts. There
caused significant reductions in body-weight could be other compounds that inhibit or
gain, food consumption and total body lipid counter-effect the HCA’s activity in G.
(Sullivan et al. 1974a; 1974b). Administration atroviridis. We cannot assume that G.
of flavonoids from G. cambogia significantly atroviridis extracts do not contain the same
lowered lipid levels in normocholesterolemic bioactive compounds that lower cholesterol
and hypercholesterolemic rats (Koshy et al. level like previous studies. Maybe direct
2001). consumption of G. atroviridis extract should
not be encouraged for the purpose of lowering
All these studies encouraged exploration of the
cholesterol level in our body.
efficacy of (-)-HCA in the control of obesity
and hypertriglyceridemia (Jena et al. 2002).
Abstrak
Kelor (Moringa oleifera) termasuk famili Moringaceae, merupakan suatu genus tunggal dari
famili pohon semak belukar yang dibudidayakan diseluruh daerah tropis dan dimanfaatkan
untuk berbagai kepentingan. Tujuan penelitian ini adalah untuk mengetahui; kemampuan
koagulan biji kelor dalam menurunkan turbiditas limbah cair industri pencucian jeans pada
proses koagulasi/flokulasi, dosis optimum koagulan pada proses tersebut, pengaruh waktu
sedimentasi dan kedalaman kolum sedimentasi terhadap turbiditas tersisihkan pada proses
sedimentasi limbah cair industri pencucian jeans yang dikoagulasi/flokulasi dengan koagulan
biji kelor. Penggunaan koagulan biji kelor berpengaruh sangat nyata terhadap turbiditas
tersisihkan limbah cair dengan pH optimum koagulasi 3 (tiga) dan turbiditas tersisihkan
83,08%. Turbiditas limbah cair industri pencucian jenas juga dipengaruhi oleh dosis
koagulan biji kelor. Dosis otimum koagulan adalah 120 mg/250 mL atau 480 mg/L dengan
turbiditas tersisihkan 92,21%. Untuk ketiga kedalaman titik uji (30 cm, 90 cm dan 150 cm)
dan waktu sedimentasi 150 menit dijumpai bahwa peningkatan waktu sedimentasi dari sampel
yang dikoagulasi/flokulasi dengan biji kelor akan meningkatkan turbiditas tersisihkan.
Keadaan sebaliknya berlaku pada kedalaman kolum, dimana peningkatan kedalaman kolum
akan menurunkan turbiditas tersisihkan untuk waktu sedimentasi yang sama.
Kata kunci: biji kelor, limbah cair pencucian jeans, pH.
Tabel 2. Hasil Percobaan Pengaruh pH Koagulasi terhadap Turbiditas Limbah Cair Industri Pencucian
Jeans dengan Menggunakan Koagulan Biji Kelor dan Hasil Uji Jarak Duncan (UJD) Turbiditas
Tersisihkan dalam Bagan huruf.
Keterangan:
1. UJD= Ujia Jarak Duncan
2. Angka-angka yang diikuti oleh huruf yang tidak sama berarti berbeda nyata pada taraf 5%
(huruf kecil) dan berbeda sangat nyata pada taraf 1% (huruf besar).
dari semua prosesnya ditunjukkan pada Tabel hasil dari 1 (satu) kali ulangan percobaan.
1.
Bersadarkan hal diatas, terlihat bahwa pH
2. Percobaan optimum koagulasi untuk koagulan biji kelor
Untuk membuat koagulan biji kelor, buah kelor terjadi pada pH 3.
yang sudah matang (berwarna coklat) dan
Hasil percobaan pengaruh dosis koagulan
kering secara alamiah di pohonnya diambil lalu
terhadap turbiditas limbah cair industri
bijinya dikeluarkan dari dalam buah. Biji
pencucian jeans disajikan dalam Gambar 2.
dengan cangkangnya yang bersih kemudian
diblender hingga menjadi bubuk dan diayak Selanjutnya bersadarkan hasul Uji Jarak
dengan ayakan tepung, lalu dikeringkan dalam Duncan sebagaimana disajikan pada Tabel 3
oven pemanas pada suhu 120oC selama 30 terlihat bahwa dosis koagulan 120 mg/250 mL
menit untuk menghomogenkan kadar airnya. memberikan kualitas terbaik dibandingkan
Tepung biji kelor tersebut kemudian dicampur dengan dosis lainnya.
aquadest (5 gram tepung biji kelor dalam 100 Keasaman (pH) optimum koagulasi dan dosis
ml aquadest). Larutan ini selanjutnya optimum koagulan ini kemudian digunakan
digunakan sebagai koagulan. untuk melihat pengaruh waktu sedimentasi
Dengan menggunakan sampel limbah cair terhadap turbiditas tersisihkan limbah cair.
sebanyak 30 liter, diamati variable pH, dosis Untuk koagulan tawas (sebagai pembanding),
kogulan dan turbiditas pada proses pH optimum adalah 6 dan dosis koagulan
koagulasi/flokulasi serta variabel waktu dan optimumnya adalah 60 mg/250 mL.
turbiditas pada proses sedimentasi. Dengan menggunakan kolom sedimentasi
3. Hasil dan Pembahasan dengan ukuran panjang 220 cm dan diameter
Hasil percobaan pengaruh pH koagulasi penampang 5 inci, dipelajari profil
terhadap turbiditas limbah cair industri pengendapan limbah yang telah
pencucian jeans pada proses koagulasi/flokulasi dikoagulasi/diflokulasi pada pH dan dosis
untuk menentukan pH koagulasi optimum yang koagulan optimum.
diperoleh disajikan pada Tabel 2 dan Gambar Gambar 3 merupakan grafik profil
1. Dalam hal ini, untuk koagulan biji kelor, pengendapan limbah cair industri pencucian
yang disajikan merupakan hasil rata-rata dari 3 jeans yang dikoagulasi/ diflokulasi dengan
(tiga) kali ulangan percobaan sedangkan untuk koagulan biji kelor.
koagulan tawas, yang disajikan merupakan
100
90
80
Turbiditas Tersisihkan (%)
70
60
50
40
30
20
Kelor= 30 mg/250 mL
10
0
0 1 2 3 4 5 6 7 8 9 10 11
pH
Gambar 1. Hubungan Persen Turbiditas Tersisihkan dengan pH Koagulasi pada Proses
Koagulasi/Flokulasi
100
90 92.21 90.87
86.3 88.29
85.01 83.74
80 82.23
79.16
74.59
70
Turbiditas (FTU)
60
50
40
34.19
30
20
10
0
0 30 60 90 120 150 180 210 240 270
Dosis Koagulan (mg/ 250 mL)
Gambar 2. Hubungan Persen Turbiditas Tersisihkan dengan Dosis Koagulan
Kelor pada Proses Koagulasi/Flokulasi, pH koagulasi=3
Tabel 3. hasil Percobaan Pengaruh Dosis Koagulan terhadap Turbiditas Limbah Cair Industri
Pencucian Jeans dengan Menggunakan Koagulan Biji Kelor dan hasil Uji arak Duncan (UJD)
Turbiditas Tersisihkan dalam Bagan Huruf
Dosis Turbiditas
Hasil UJD dalam Bagan
No Koagulan Akhir (FTU) Tersisihkan (%) Huruf
(mg/mL)
1 0 307,33 34,19 fF
2 30 83,00 82,23 cdBCD
3 60 70,00 85,01 bcdABC
4 90 64,00 86,30 abcABC
5 120 36,39 92,21 aA
6 150 42,64 90,87 abAB
7 180 54,69 88,29 abcABC
8 210 75,93 83,74 cdABC
9 240 97,33 79,16 deCD
10 270 118,67 74,59 eE
Pencucian/Pelusuhan Pakaian Jadi Jeans. Proyek Muyibi A.S., Evison L.M., (1995). Moringa
Pengembangan Sumber Daya, Energi dan oleifera sedds for softening Hardwater. Wat Res.
Pengendalian Pencemaran Industri. Bandung. 29(4), 1099-1105.
Chandra A. (1998). Penentuan Dosis Optimum Sutherland J.P., Folkard G.K., Mtawali M.A.,
Koagulan Ferro Sulfat-Kapur, Flokulan Chemifloc Grant W.D., (1994). Moringa oleifera as a Nattural
dan Besfloc serta Biofloculan Moringa Oleifera coagulant. 20th WEDC Conference, Affordable
dalam Pengolahan Limbah Cair Pabrik Tekstil. Water Supply and Sanitation, Colombo, Srilangka,
Tesis Magister. Jurusan Teknik Kimia Universitas 122-127.
Parahyangan. Bandung.
Abstrak
Dalam penelitian ini digunakan isolate bakteri termofil SW2, dari Pusat Pengolahan Kompos,
sebagai sumber enzim α-amilase ekstraseluler. Isolasi enzim dilakukan setelah bakteri
tersebut diaktifkan dan dikultur dalam medium yang mengandung pati kentang pada suhu
60oC, pH 7,5 selama 39 jam. Enzim α-amilase ekstraseluler yang diperoleh memiliki aktivitas
optimum pada suhu 70oC,dan pH 6,0. Enzim ini merupakan α-amilase logam.karena aktivitas
katalitiknya dapat ditingkatkan oleh ion logam, seperti Na+, K+, Mn+ dan Ca2+ serta
diinhibisi sangat kuat oleh Zn2+, Fe2+ dan EDTA . Aktivitas enzim ini juga diturunkan oleh
adanya senyawa SDS dan urea. Sedangkan efek penyimpanan selama 4 bulan pada suhu
kamar dapat menurunkan aktivitas enzim hingga mencapai + 50%. Berat molekul enzim
kasar ditentukan dengan metode elektroforesis SDS-poliakrilamid dan diperoleh sekitar 180
kDa.
Kata kunci : α-Amilase, karakterisasi, SW2, , termofil
864
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Siswati Setiasih, Budiasih Wahyuntari, Trismilah, dan Dewi Apriliani
Aspergillus dan Rhizopus (Shaw., 1995; Dyah., ekstraseluler dipisahkan dari selnya dengan
1995) cara disentrifus pada kecepatan 4000 rpm, 4oC
selama 30 menit. Filtrat enzim yang didapat
Penelitian ini merupakan lanjutan dari
kemudian dipekatkan 10 kali dengan
penelitian sebelumnya, yang bertujuan
ultrafiltrasi menggunakan membran pemisah
memproduksi enzim α-amilase ekstraseluler.
berukuran 30 kilodalton (Kda).
Sebagai sumber enzim digunakan bakteri
termofil Bacillus SW2 yang diisolasi dari Pusat 2.4. Penentuan aktivitas enzim
Pengolahan Kompos, BSD-Tangerang. Enzim Penentuan aktivitas ini berdasarkan pada
hasil isolasi tersebut selanjutnya akan penguraian substrat oleh enzim. Aktivitas α-
digunakan dalam industri tekstil. Alasan utama amilase ditentukan dengan metode kolorimetri
dari pemanfaatan mikroorganisme adalah untuk Fuwa (Taji., 1988; Wiseman., 1979). Satu unit
menghemat biaya impor enzim tersebut. Sel aktivitas enzim didefinisikan sebagai jumlah
mikroorganisme merupakan sumber penghasil enzim yang menyebabkan penurunan warna
enzim yang sangat potensial karena untuk sebesar 50% pada kondisi di atas.
peningkatan produksi enzim dapat dilakukan
2.5. Penentuan kadar protein
dengan lebih mudah, misalnya dengan cara
Kadar protein ditentukan dengan metode
pengaturan kondisi lingkungan
Bradford), dan sebagai standar protein
pertumbuhannya. Fokus pekerjaan dari
digunakan larutan bovine serum albumin
penelitian ini adalah pada uji karakterisasi
((Kruger., 1994; Bradford., 1976)
enzim kasar hasil pemekatan melalui
ultrafiltrasi. Uji aktivitas enzim dilakukan 2.6. Pengaruh temperatur dan pH
terhadap berbagai pengaruh lingkungan Kondisi optimum bagi aktivitas enzim α-
seperti: suhu, pH, aktivator serta inhibitor amilase ditentukan dengan cara memvariasikan
enzim. Untuk penentuan berat molekul protein temperatur (yaitu : 20, 30, 40, 50, 60, 70, 80,
enzim digunakan SDS-PAGE. 90, dan 100oC) dan memvariasikan pH pada
temperatur optimumnya ( yaitu : pH 4,0; 5,0;
2. Percobaan
6,0 menggunakan buffer sitrat 20 mM; pH 6,0;
2.1. Mikroorganisme
7,0; 8,0 menggunakan buffer fosfat 20 mM;
Mikroorganisme yang digunakan dalam
dan pH 9,0; 10,0 menggunakan buffer glisin–
penelitian ini adalah isolat bakteri termofil
SW2 bersifat gram positif berbentuk batang, NaOH). Stabilitas penyimpanan α-amilase
koloni bulat tidak beraturan berwarna krem, ditentukan dengan cara menyimpan filtrat
tebal dan tidak tembus pandang. Bakteri enzim pada suhu kamar (30oC) dan suhu dingin
tersebut diisolasi dari pusat pengolahan kompos (4oC). Kemudian secara berkala dilakukan
BSD, Tangerang, dan biakannya dipelihara pengujian aktivitas enzimnya, selama 4 bulan
serta diperbanyak pada medium agar. penyimpanan yang diukur pada temperatur dan
pH optimum enzim.
2.2. Media
Komposisi media agar yang digunakan adalah 2.7. Pengaruh berbagai ion logam dan agen-
maizena 2%, agar teknis 1,65%, gum gellan agen pendenaturasi
“Gelrite” 0,35%, ekstrak ragi 0,5%, bacto Filtrat yang mengandung enzim diikubasi
pepton 0,5%, K2HPO4 0,05%, MgSO47H2O dengan berbagai senyawa ion logam (KCl,
0,05%, CaCl22H2O 0,1%. Komposisi media LiCl, FeCl36H2O, NaCl, CaCl22H2O,
fermentasi terdiri atas, pati kentang 1%, ekstrak MgCl26H2O, NiCl26H2O, ZnCl2, MnCl24H2O)
ragi 0,5%, bacto pepton 0,5%, K2HPO4 0,05%, masing-masing pada konsentrasi 1 mM, 5 mM,
MgSO47H2O 0,05%, CaCl22H2O 0,1% dan 10 mM selama 30 menit. Sedangkan
pengaruh agen-agen pendenaturasi protein
2.3. Fermentasi dilakukan dengan cara menginkubasi filtrat
Inokulum yang telah disiapkan dimasukkan enzim dengan senyawa SDS (konsentrasi 0,4%,
secara aseptik ke dalam media fermentasi (90% 1,0% dan 1,5%), EDTA dan urea (konsentrasi 1
volume produksi), lalu diinkubasi selama 39 mM, 5 mM dan 10 mM) selama 30 menit.
jam pada suhu 60oC di dalam shaker incubator Aktivitas α-amilase diukur pada temperatur
yang berkecepatan 150 rpm. Cairan fermentasi dan pH optimum yang diperoleh pada
(broth) yang mengandung α-amilase percobaan sebelumnya..
Supernatan
1900 1,116 2120,4 0,027 51,775 40,954 41
(sentrifus)
Supernatan
200 4,636 927,2 0,093 18,69 49,609 50
(ultrafiltrasi)
Filtrat
1700 0 0 0,0078 13,175 0 0
(ultrafiltrasi)
120
100
Aktivitas relatif (%)
80
60
40
20
0
20 30 40 50 60 70 80 90 100
Temp ( OC)
120
100
Aktivitas relatif (%)
80
60
40
20
0
4 5 6 7 8 9 10
pH
2.8. Penentuan bobot molekul enzim kasar Coomassie Brilliant Blue R-250 (Shaw., 1995;
Enzim hasil isolasi ditentukan bobot Boyer., 1993)
molekulnya secara elektroforesis
3. Hasil dan pembahasan
menggunakan gel poliakrilamid sodium
3.1. Produksi Enzim
dodosil sulfat 7,5% (SDS/PAGE) Zimogram
Berdasarkan hasil penelitian sebelumnya,
dengan standar marker High Molecular Weight
kondisi optimum proses fermentasi dilakukan
(HMW-SDS)(Amershem Pharmacia Biotech,
pada suhu 60oC, pH awal 7,5 selama 39 jam di
Uppsala, sweden) Gel hasil elektroforesis
dalam shaker incubator yang berkecepatan
diinkubasi dalam larutan amilum dan pita-pita
150 rpm (Widyasti., 2002). Cairan fermentasi
ptrotein yang terpisah diwarnai dengan
yang diperoleh dipisahkan dari selnya dengan
cara sentrifugasi pada kecepatan 4000 rpm, 4oC menyatakan bahwa α-amilase termofilik
selama 30 menit, kemudian dipekatkan 10 kali memiliki aktivitas antara 60-80oC dan
dengan ultrafiltrasi. Pemekatan dengan kehilangan aktivitasnya pada temperatur di
ultrafiltrasi berdasarkan pada kemampuan bawah 40oC (Vielle., 2001). Sedangkan enzim
membran dengan tekanan hidrostatik tinggi α-amilase ekstraseluler dari isolat bakteri
untuk menahan komponen yang mempunyai termofil SW2 menjadi tidak aktif pada 100oC.
ukuran partikel yang relatif besar serta
melewatkan pelarut dan zat terlarut dengan Penentuan pH optimum enzim α-amilase
ukuran partikel yang lebih kecil, sehingga ekstraseluler dari isolat bakteri termofil SW2
didapatkan filtrat enzim yang lebih murni ini dilakukan pada suhu 60oC. Gambar 2
(Copeland., 1994). Pemekatan juga bertujuan menunjukkan bahwa aktivitas enzim tertinggi
agar enzim lebih stabil selama masa diperoleh pada pH 6. Aktivitas enzim relatif
penyimpanan. Hasil penentuan aktivitas enzim masih tinggi baik pada pH 5 maupun pada pH
α-amilase ekstraseluler yang terdapat dalam antara 7 – 9 akan tetapi pada pH di bawah 5
supernatan dapat dilihat pada Tabel 1. dan di atas pH 9 aktivitas enzim menurun
drastis.
Pemekatan enzim dengan ultrafiltrasi
menyebabkan tingkat kemurnian naik sebesar 3.3. Pengaruh berbagai ion logam dan
50 kali dibandingkan broth, kenaikan ini senyawa pendenaturasi
disebabkan karena molekul air dan juga protein Untuk mengetahui pengaruh beberapa ion
lain yang ukurannya lebih kecil dari 30 kDa logam terhadap aktivitas enzim, maka dalam
dapat terlewatkan sehingga memberikan percobaan ini digunakan beberapa senyawa
kenaikan aktivitas spesifik . garam klorida, yaitu: KCl, FeCl36H2O, NaCl,
CaCl2.2H2O, MgCl2.6H2O, NiCl2.6H2O, ZnCl2,
3.2. Karakterisasi MnCl2.4H2O. Senyawa garam klorida
Temperatur optimum bagi aktivitas α-amilase digunakan karena aktivasi α−amilase menurun
yang diperoleh dari hasil percobaan yaitu sesuai urutan Cl- > Br- > I- (Bush., 1989).
70oC. Di bawah temperatur optimum (60oC) Penambahan ion K+ pada konsentarasi 1 mM
dan di atas temperatur optimum (90oC), enzim menurunkan aktivitas enzim sebesar ±4%,
masih memiliki aktivitas sebesar ±66%. ada sedangkan pada konsentrasi 5 mM dan 10 mM
80oC enzim masih memiliki aktivitas sebesar ion K+ meningkatkan aktivitas enzim masing-
±77% dibandingkan aktivitas pada temperatur masing sebesar ±2% dan ±4%. Ion Na+
optimumnya (Gambar 1). Hasil penelitian lain menaikkan aktivitas enzim pada konsentrasi 1
120
100
aktivitas relatif (%)
80
60
40
20
0
None Na+ Mn2+ Ni2+ Fe3+ Urea
senyawa
1 mM 5 mM 10 mM
Gambar. 3 Pengaruh ion logam, senyawa pengkelat dan pendenaturasi protein terhadap aktivitas α-amilase
ekstraseluler SW2
105
100
90
85
80
SDS
Gambar. 4 Pengaruh berbagai konsentrasi deterjen anionik (sulfonil dedosil sulfat) terhdap aktivitas α-
amilase ekstraseluler SW2
mM dan 5 mM masing-masing sebesar ±6% Dari data tersebut, α-amilase hasil isolasi dapat
dan ±2%, sedangkan pada konsentrasi 10 mM digolongkan sebagai α-amilase logam.
ion Na+ menurunkan aktifitas enzim sebesar
±2%. Pada konsentrasi 1 mM dan 5 mM ion Untuk mengetahui adanya pengaruh detergen
Ca2+ menaikkan aktivitas enzim masing-masing anionik, maka dalam percobaan digunakan
sebesar ±2% dan ±3%, sedangkan pada SDS dengan konsentrasi sebesar 0,4%, 1,0%
konsentrasi 10 mM ion Ca2+ menurunkan dan 1,5%. Dari data hasil percobaan (Gambar
aktivitas enzim sebesar ±7%. Ion Mn2+ 4) terlihat aktivitas enzim menurun sejalan
menaikkan aktivitas enzim sebesar ±5% pada dengan bertambahnya konsentrasi SDS.
konsentrasi 1 mM, selanjutnya kenaikan Urea sebagai agen pendenaturasi protein juga
konsentrasi ion Mn2+ menyebabkan aktivitas mempengaruhi aktivitas enzim. Pada Gambar 3
enzim menurun yaitu sebesar ±1% pada 5 mM konsentrasi urea 1 mM aktivitas enzim naik
dan ±12% pada 10 mM. Ion Mg2+ menurunkan sampai ±6%. Selanjutnya aktivitas enzim
aktivitas enzim, dan penurunannya sejalan menurun sejalan dengan bertambahnya
dengan bertambahnya konsentrasi ion Mg2+, konsentrasi urea. Pada konsentrasi urea 5 mM
pada konsentrasi 1 mM, 5 mM dan 10 mM, dan 10 mM aktivitas enzim menurun masing-
aktivitas enzim menurun masing-masing masing sebesar ±1% dan ±20%.
sebesar ±8%, ±10% dan ±20%. Ion Zn2+ dan
Fe3+ menyebabkan enzim sama sekali tidak 3.4. Gel Elektroforesis
Dari hasil elektroforesis (Gambar 5) diperoleh
aktif baik pada konsentrasi 1 mM, 5 mM
satu pita protein yang menunjukkan aktivitas
maupun 10 mM. Begitu pula dengan ion Ni2+
pada konsentrasi 5 mM dan 10 mM, pada katalitik enzim terhadap substrat pati.
Terdapat beberapa hasil penelitian yang
konsentrasi ion Ni2+ 1 mM aktivitas enzim
turun sampai dengan ±24%. Berdasarkan data melaporkan bahwa isolasi α -amilase dari
tersebut (Gambar 3) maka terdapat empat sumber mikroorganisme termofilik akan
macam ion logam yang dapat meningkatkan menghasilkan dua bentuk enzim α-amilase.
aktivitas α-amilase hasil isolasi yaitu K+, Na+, .
Menurut Long-Liu Lin et al ( 1998) apabila
Ca2+ dan Mn2+ serta tiga macam ion logam sumber karbon yang digunakan pada fermentasi
yang dapat menghilangkan aktivitas α-amilase berasal dari pati terlarut akan teridentifikasi dua
hasil isolasi yaitu Ni2+, Zn2+ dan Fe3+. pita amilase dengan berat molekul sekitar 150
dan 42 kDa. Akan tetapi apabila sumber
Pada Gambar 3 adanya penambahan EDTA
(sebagai pengkelat logam) pada berbagai karbon berasal dari pati mentah hanya satu pita
amilase dengan berat molekul sekitar 150 kDa
konsentrasi menunjukkan bahwa aktivitas
yang dapat teridentifikasi, karena protein
enzim α-amilase ini hampir seluruhnya hilang.
dengan berat molekul 42 kDa kemungkinan
diabsorbsi oleh sumber karbon yang tidak larut
dalam air. Percobaan ini menggunakan pati penelitian ini kepada Pusat Pengkajian dan
mentah yang berasal dari kentang sehingga Penerapan Teknologi (PPPT), Serpong.
hanya amilase dengan berat molekul yang besar
6. Daftar Pustaka
dapat teridentifikasi. Dengan menggunakan Boyer, R.F. 1993. Modern experimental
standar berat molekul diperkirakan pita protein biochemistry. 2nd edition. Benjamin/ Cumming
yang memiliki aktivitas mengkatalisis pati Publishing. London.
tersebut memiliki berat molekul sekitar 180
Bradford, M.N. (1976). A rapid and sensitive
kDa.
method for quntation of microgram quantities of
protein utilizing the principle of protein dye binding.
Anal. Biochem., 72, 248-254
Bush, D.S., L. Sticher, Huystee, R. van, D. Wagner,
220 & R.L. Jones. 1989. The Calcium requirement for
170 stability and enzymatic activity of two isoforms of
barley aleurone α-amilase. J. Biol. Chem. 246 (32):
19392-19398.
116
Copeland, R.A. 1994. Methods for protein analysis:
76
a practical guide to laboratory protocols. Chapman
and Hall. New York.
53
Dyah, P.M. 1995. Studi tentang enzim amilase
penghidrolisis pati mentah ubi kayu dari
Streptomyces sp. no. 4. Prosiding Seminar
Bioteknologi Biomassa BPPT I. Jakarta.
(a) (b)
Jei-Fu Shaw, Fu-Pang Lin, Su-Chiu Chen & Hsing-
1 2 3 4
Chen Chen. 1995. Purification and properties of an
extracellular α−amilase from Thermus sp. Botanical
Bulletin of Academia Sinica. 36: 195-200.
Gambar. 5. a.) Hasil uji elektroforesis (SDS-PAGE) Kruger, N.J. 1994. The Bradford method for protein
enzim kasar α-amilase ekstraseluler SW2 (1 dan 2 quantitation. Di dalam J.M. Walker, (ed. ). Methods
= native enzim;3 dan 4 = enzim yang in molecular biology, vol 32: Basic protein and
terdenaturasi); b) penanda berat molekul protein peptide protocols. Humana Press. New Jersey.
Long-Liu Lin, Charng-Cherng Chyau, & Wen-Hwei
4. Kesimpulan
Hsu. 1998. Production and properties of raw-starch-
Karekterisasi terhadap enzim kasar α-amilase degrading amylase from the thermophilic and
hasil isolasi dari bakteri termofil SW2 telah alkaliphilic Bacillus sp. TS-23. Biotechnol. Appl.
berhasil dilakukan. Diketahui bahwa enzim ini Biochem. 28: 61-68.
merupakan enzim ekstraseluler dengan
Taji, N. 1988. Industrial utilization of amilase. Di
temperatur dan tingkat keasaman optimum
dalam The Amylase Research Society of Japan, (ed.
berturut-turut pada 70oC dan pH 6,0. Sebagai ). Handbook of amylase and related enzymes: Their
tambahan, penelitian ini berhasil sources, isolation methods, properties and
mengidentifikasi pengaruh ion-ion logam dan applications. 1st edition. Pergamon Press. New
senyawa-senyawa pendenaturasi terhadap Jersey.
aktivitas katalitiknya. Karakter penting lainnya
Trismilah, Sumaryanto, Esti, W. 2000. Enzim α-
seperti kestabilan aktivitas menunjukkan bahwa
amilase dari B. stearothermophilus DSM22
aktivitas enzim dapat dipertahankan pada menggunakan kulit buah pisang nangka sebagai
temperature yang relative rendah selama proses substrat. Prosiding Seminar Nasional Kimia.
penyimpanannya (hasil tidak dicantumkan Surabaya.
dalam makalah ini).
Vielle, C., G.J. Zeikus. 2001. Hyperthermophilic
5. Ucapan terima kasih enzymes: Sources, uses and molecular mechanism
Penelitian ini dibiayai atas dana hibah Badan for thermostability. Microbiology and Molecular
Pengkajian dan Penerapan Teknologi (BPPT) biology Reviews. 65 (1): 1-43.
Kementrian Ristek Republik Indonesia. Peneliti Widyasti, E. 2002. Isolasi dan optimasi suhu dan pH
sangat berterimakasih atas fasilitas yang pertumbuhan bakteri termofil penghasil α−amilase
diberikan untuk melaksanakan sebahagian dari
termostabil. Seminar Masalah Khusus Jurusan Wiseman, A., (ed. ). 1979. Topics in enzymes and
Biologi FMIPA IPB. Bogor. fermentation biotechnology. Ellis Horwood
Limited. New York.
Kandungan Senyawa Kimia dari Tanaman Garcinia Spp Yang Tumbuh di Indonesia
Soleh Kosela
Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Indonesia, Depok, Indonesia
Abstract
Senyawa kimia yang diisolasi dari tanaman Garcenia mempunyai variasi tertentu, yaitu dari
kerangka xanton, flavonoid, triterpenoid dan quinon. Dari buah Garcenia dulcis berhasil
diisolasi senyawa dioksimorelin, asam morellat dan morellin, sedang daun Garcenia dulcis
berhasil diisolasi senyawa dulxanton E, F, G dan H. Ekstrak kulit batang Garcinia picrorrhiza
mengandung senyawa garcinopikrophenon, triterpenoid asam (24 E)-3β-hidroksi -7,24-
euphadien-26-oat, asam lanosta-7,24-dien 3-oxo-27 oat, asam 3β-hidroksi-7,24-euphadien-26
oat dan garcinopicrobenzophenonon pada kulit batang Garcenia porecta ditemukan
porxanthon dan triterpenoid. Beberapa senyawa xanthon dan benzofenon diisolasi dari daun
Garcenia rigida dan Garcenia benthani Piere yang akan kami bahas. Semua tanaman
Garcenia ini diambil di daerah Bogor dan Kalimantan. Aktivitas biologi ditentukan di
Universitas Indonesia dan The National University of Singapore. Penentuan Struktur Molekul
menggunakan NMR, Infra Red, Ultraviolet, Mass spektrometer dan X-Ray diffraksi.
Quantitative Analysis of Trace pp-DDE in Cod Liver Oil by Isotope Dilution Mass
Spectrometry during APMP.QM-P4 Pilot Study and Uncertainty Evaluations
Abstract
The organochlorine pesticide p,p′-DDE (p,p’-dichlorodiphenyl)dichloroethylene) is a
breakdown product of the well-known persistent pesticide p,p′-DDT, which has been banned
in many countries due to health concerns. p,p′-DDE is a typical example of an organochlorine
pesticide of environmental importance, and is an analyte that many countries around the
world routinely test for.
The paper deals with the Quantitative Analysis of Trace pp-DDE in Cod Liver Oil by Isotope
Dilution Mass Spectrometry and Uncertainty Evaluations was carried out during APMP.QM-
P4 Pilot Study of organized by APMP ( Asia Pasific Metrology Program) in 2004 and
coordinated by National Analytical Reference Laboratory , National Measurement Institute,
Australia.
This intercomparison study was attending by 12 countries including Indonesia represented
by Research Institute for Chemistry –Indonesian Institute of Sciences (Laboratory No.4).
The result obtained for pp-DDE in Cod Liver Oil was 146,75 ng/g with expanded
uncertainty 8,4%. The median obtain from this laboratory intercomparison study was 160,35
ng/g. The results of the study are also reported here.
Key words; p,p’-DDE, IDMS, uncertainty, GCMS.
make a measurement result traceable to the SI In this report, we provide result of the
unit, it is also necessary to evaluate the quantitative analysis of the cod liver oil sample
uncertainty of every step in the measurement and description of the procedures2 for the
procedure and combine them to meet the evaluation of the uncertainty of the result of the
principles of the internationally agreed guide, IDMS measurement. This report also describes
[“Guide to the Expression of Uncertainty in details on experimental conditions used to
Measurement” provided by International increase the accuracy of the IDMS
Organization for Standardization (ISO) in measurement and the result during APMP.QM-
1993]. The guide establishes general rules for P4 Pilot Study .
evaluating and expressing uncertainty in the
2. Experimental
broad spectrum of measurement and is
The IDMS measurement consist of spiking a
accepted in all field of measurement. However,
known amount of isotope-enriched p,p’-DDE
it is very difficult to estimate and combine 13
C12 to a known amount of cod liver oil, clean-
uncertainties for every step involved in
up of the sample to separate oil matrix, and
chemical measurements following the ISO
GC/MS measurement of the extract. The
guide due to the complexity of the procedures.
measured isotope ratio of spike cod liver oil
Recently, Eurachem provided a document,
sample was calibrated by bracket method using
[“Quantifying Uncertainty in Analytical
two calibration known amounts of p,p’-DDE
Measurement”, Eurachem, 1995], describing
and p,p’-DDE 13C12.
how the concepts in the ISO guide can be
applied in chemical measurements. Though the Methodology
document has been a useful guideline for Materials :
analytical chemists, it is still important to Two bottles of sample of cod liver oil from
provide a practical guidance on estimating NARL, Australia.
uncertainty for each of widely used chemical p,p’-DDE 13
C12 spike solution from NARL,
measurement method to make the ISO guide Australia.
properly applicable.
12
C p,p’- -DDE standard (99,6 %) was supplied
A few chemical measurement methods are from APMP – QM – P1, LGC 110, vial no. 23
recognized as primary methods that make the and 13
C p,p’--DDE standard solution was
measurement results traceable to the SI units supplied from APMP – QM – P1, LGC 110,
directly without significant empirical correction vial no. 13 ( 2001).
factors. Isotope Dilution Mass Spectrometry
(IDMS) has been considered as strong Petroleum benzene (boiling point 40 – 60 0C) is
candidate of a primary method for the analysis from E.Merck.
of trace organic compound in complex matrix AL2O3 basis (Art. 1076) is from E.Merck.
(Kim, 1999).
Instrument :
As IDMS method overcomes difficulty of Balance AT 200 Mettler Toledo max = 205
correcting recovery yield in sample preparation gram, d = 0,1 mgram.
and separation, it has been widely accepted as a
reliable analysis method for highly accurate Gas Chromatography ( Trace GCQ 2000),
determination in clinical chemistry, toxicology, Mass Spectrometer (Finnigan MAT).
food and drug analysis, and environment EI mode; Ion measure ; m/z = 318 for 12Cp,p’-
analysis. To test feasibility of IDMS as a DDE and m/z = 330 for 13Cp,p’-DDE
primary method for the analysis of trace
organic compounds and the international
uniformity of the measurement, Research Instrument condition :
Institute for Chemistry –Indonesian Institute of GC Instrument
Sciences (LIPI) participated in
intercomparison programs with several national Column DB5MS ; 30 m long ; 0,25 mm i.d ;
metrology institute in the intercomparison of 0,25 µm film thickness.
environmental analysis, (p,p’- Temperature of injector 250 0C
dichlorodiphenyl)dichloroethylene (pp’-DDE)
in cod liver oil.
Table 1.
Result of analysis of p,p-DDE mix standard carried out by RCC laboratory.
No Weight of Weight Final Conc.of Conc.of Ratio of Conc Height
12
C of 13C Weight 12
C in the 13
C in the mix of Ratio of 12C/13C
12
(gram) (gram) (gram) mix standards C/Concen.of + RSD
13
standards (µgram/ C
(µgram/ gram)
gram)
1 0,0967 0,3434 0,4401 0,81 6,66 0,12 0,12 + 0,0%
2 0,3463 0,4025 0,7488 1,711 4,585 0,37 0,37 + 8,1 %
Table 1a.
Analysis result of p,p’-DDE in sample Cod Lever Oil Vial No.53
No Sample Weight Weight Weight Height Concen.of Mean of Conc.of 12C
code of of of 13C ratio 12
C found in found in the cod liver
sample sample taken into of 12C/13C the cod liver oil
(gram) taken into the found from oil (ngram/gram)
the aluminacol GCMS (µgram/
aluminacol umn gram)
umn (gram)
(gram)
1. I 0,3097 0,3097 0,0195 0,20 0,1478 132,8
0,21 0,1178
2. II 0,3071 0,3071 0,0185 0,29 0,1967 156,9
0,22 0,1171
3. III 0,3010 0,3010 0,0177 0,26 0,1726 141,3
0,21 0,1100
4. IV 0,3007 0,3007 0,0191 0,24 0,1747 152,6
0,23 0,1305
5. V 0,3074 0,3074 0,0189 0,25 0,1759 156,8
0,25 0,1376
Mean 148,08
Table 1b.
Analysis result of p,p’-DDE in sample Cod Lever Oil vial No.3
No Sample Weight Weight Weight Height Concen.of Mean of Conc.of 12C
code of of of 13C ratio 12
C found in found in the cod liver
sample sample taken into of 12C/13C the cod liver oil
(gram) taken into the column oil (ngram/gram)
the column (gram) (µgram/
(gram) gram)
1. B 0,3063 0,3063 0,0179 0,22 0,1479 134,00
0,23 0,1201
2. C 0,3070 0,3070 0,0171 0,28 0,1757 150,15
0,25 0,1246
3. D 0,3028 0,3028 0,0181 0,24 0,1645 138,15
0,21 0,1118
4. E 0,3052 0,3052 0,0177 0,23 0,1532 152,6
0,29 0,1511
5. V 0,3074 0,3074 0,0184 0,25 0,1713 152,65
0,25 0,1340
Mean 145,42
Table 2. Results of analysis p,p′-DDE in the cod liver oil from 12 laboratories
(Mackay, 2005)
Lab. Reported result Reported result Reported mean Standard Expanded
No. bottle bottle 2 (ng/g) result Uncertainty (ng/g) Uncertainty (ng/g)
1 (ng/g) (ng/g)
1 157.7 156.4 157.0 2.1 4.5
2 167 171 169 14.4 28.8
3 159.7 159.8 159.7 3.6 7.1
4 148.08 145.42 146.75 6.15 12.30
5 163.3 162.7 163.0 1.7 3.3
6 162.2 161.2 161.7 0.8 1.7
7 104.75 104.95 104.85 0.23 0.46
8 1066 1053 1060 113 226
9 131 121 126 10.3 20.7
10 160 161 161 Not reported 15
11 162.08 258.68 210.38 0.167225847 0.3344516
12 154.7 149.6 152.2 7.67 15.34
1060
ng/g
200
↑
Conc (ng/g)
150
100
L a b o ra to ry
Lab Lab Lab Lab Lab Lab Lab Lab Lab Lab Lab Lab
7 9 4 12 1 3 10 6 5 2 11 8
from median value and has large uncertainty gram for clean up and almost laboratories using
(see Table 2) although RCC-LIPI using IDMS GPC or flourisil column method for clean up
as a primary method of analysis. The closer (Mackay, 2005).
value of analysis to median value are
In general the results of RCC-LIPI are better
Laboratory no. 1,2, 3, 5, 6, 10, and 12. The
than laboratory no.7, 9 , 11 and 8. More
bed accuracy result of RCC –LIPI laboratory it
laboratories are now employing techniques
may cause by not large enough sample
such as isotope dilution mass spectrometry
introduce to alumina clean up column and
(IDMS) to improve the accuracy of their
may cause by the clean up procedure using
methods as done by RCC-LIPI, although some
alumina is not suitable for cleaning pesticide
GC-ECD results show excellent comparability
from high fat content of the samples or wrong
(Thailand) (Mackay, 2005) and this highlights
value of calibration standard. All laboratories
the importance of the other factors in analysis
except RCC-LIPI were using more than 1,0
such as effective sample clean-up and effective Report, 7 February 2005 , National
standard preparation and calibration. Analytical Reference Laboratory, National
Measurement Institute, Australia (Co-
4. Acknowledgement ordinating Laboratory)
The authors wish to thank Miss Ratih and Resti
2. Kim , B. et al. , Quantitative Analysis of
for their assistance in the operating GC and
Trace p,p’-DDE in Corn Oil by IDMS:
GCMS; Mrs Hasri from Pesticide Laboratory, Uncertainty Evaluation Bull. Korean
Agriculture Department, Pasar Minggu, Jakarta Chem.Soc., 1999, Vol.20, no.8.
for her assistance in preparing alumina for
samples clean up and Mr.Harry Budiman for 3. Baumann R.A. et al., Analytical Method
for Pesticide Residues in Food Stuffs, Sixth
his assistance in the calculating uncertainty
Edition, 1996. General Inspectorate for
budget. Health Protection, Ministry of Public Health,
5. References Welfare and Sport, the Netherland
1. Mackay, L.G., APMP.QM-P4 Pilot Study –
Determination of p,p′-DDE in Fish Oil, Draft
Siti Aisyah,* Yana M. Syah,* Sjamsul A. Achmad,* Euis H.Hakim,* Lukman Makmur,* Lia D.
Juliawaty,* Laily B. Din,** Jalifah Latif,** Ikram M. Said.**
*
Kelompok Penelitian Kimia Organik Bahan Alam, Departemen Kimia, Institut Teknologi Bandung, Jalan
Ganeca 10, Bandung 40132, Indonesia
**
School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti
Kebangsaan Malaysia, 43600 UKM Bangi, Selangor D.E. Malaysia
Abstrak
Suatu trimer resveratrol (+)-α-viniferin (1) telah berhasil diisolasi untuk pertama kalinya
dari ekstrak aseton kulit batang Shorea platyclados. Struktur senyawa ini telah ditetapkan
berdasarkan data spektroskopi UV, IR, 1H NMR, 13C NMR, serta melalui perbandingan
terhadap data senyawa sama yang telah dilaporkan.
Kata kunci : (+)-α-viniferin, Dipterocarpaceae, Shorea platyclados
gel Merck 60 GF254, kromatografi radial 232oC (terurai) dan putaran optik +30o.
(kromatotron) menggunakan Si gel Merck 60 Spektrum UV senyawa 1 memperlihatkan
PF254, dan analisis kromatografi lapis tipis serapan maksimum pada panjang gelombang
(KLT) pada pelat aluminium berlapis Si gel 203, 229 dan 285 yang mengindikasikan
Merck Kieselgel 60 GF254 0,25 mm. Semua adanya kromofor fenolik yang tidak
pelarut yang digunakan adalah yang berkualitas terkonjugasi. Adanya kromofor ini juga
teknis yang didestilasi. Larutan 1,5% Ce(SO4)2 diperkuat dengan adanya pergeseran
dalam 2N H2SO4 digunakan sebagai pereaksi bathokromik (pergeseran pada panjang
penampak noda. gelombang yang lebih besar) ketika dilakukan
penambahan reagen geser NaOH. Spektrum IR
Bahan Tumbuhan. Kulit batang Shorea
senyawa ini menunjukan adanya pita serapan
platyclados Sloot. ex. Foxw. diperoleh dari
untuk gugus hidroksil pada bilangan
kebun percobaan Darmaga, Bogor, Jawa Barat
gelombang 3401cm-1, C=C aromatis pada
yang dikumpulkan pada bulan maret 2003.
1615, 1515, 1441 cm-1, oksi aril pada 1244 cm-
Spesimen tumbuhan ini diidentifikasi oleh staf 1
, serta para disubtitusi benzen pada 831 cm-1.
Herbarium Bogoriense, Bogor.
Data UV dan IR diatas memberi petunjuk
Ekstraksi dan Isolasi. Serbuk kulit batang bahwa senyawa 1 adalah senyawa turunan
Shorea platyclados sebanyak 2,7 kg diekstraksi fenol. Spektrum 13C NMR senyawa 1
dengan menggunakan aseton sebanyak 3 kali menunjukkan sederet sinyal yang
berturut-turut menghasilkan 120 gram ekstrak mengindikasikan adanya 6 karbon alifatik (δC
aseton. Selanjutnya ekstrak yang diperoleh 45,7-95,0), 18 karbon metin aromatik (δC 96,0-
dipartisi dengan dietil eter sehingga didapat 128,1), 9 karbon kuarterner (δC 105,6-140,5 )
ekstrak aseton-eter sebanyak 60 gram. dan 9 karbon oksi aril (δC 157,3-161,7).
Sebagian (40 gram) dari ekstrak aseton-eter Sementara itu spektrum 1H NMR senyawa ini
selanjutnya difraksinasi dengan kromatografi menunjukkan sekumpulan sinyal yang dapat
vakum cair menggunakan eluen n-heksan-etil ditandai sebagai berikut; (i) tiga pasang proton
asetat dengan kepolaran yang terus metin aromatik berkopling-orto dari unit 4-
ditingkatkan menghasilkan lima fraksi utama hidroksifenil (δH 6,75-7,26), (ii) tiga pasang
yaitu fraksi A, B, C, D dan E. Fraksi C proton metin aromatik berkopling-meta dari
selanjutnya dipisahkan lebih lanjut dengan unit 2,3-disubtitusi-5-hidroksifenil (δH 6,10-
kromatografi vakum cair dengan menggunakan 6,63), (iii) tiga pasang proton metin alifatik dari
eluen n-heksan-etil asetat dengan kepolaran unit 2,3-dihidrobenzofuran (δH 3,99-6,02). Dari
yang terus ditingkatkan dan diikuti dengan analisis spektrum 13C dan 1H NMR tersebut,
pemurnian dengan menggunakan kromatografi maka dapat disarankan bahwa senyawa 1
radial menggunakan eluen kloroform-metanol. adalah α-viniferin. Dukungan selanjutnya
Dari gabungan fraksi 11-16 diperoleh senyawa diperoleh dari perbandingan data 13C dan 1H
(+)-α-viniferin (1) (150 mg). NMR (Tabel 1), data fisik dan spektroskopi
OH
(+)-α-viniferin (1), diperoleh berupa serbuk
warna kuning, t.l.230-232oC (terurai); [α]D20 OH
6. Daftar Pustaka Ito, T., Tanaka, T., Ido, Y., Nakaya, K., Iinuma, M.,
Aminah N.S., Achmad, S.A., Aimi N., Ghisalberti, Riswan, S., (2000). Chem. Pharm. Bull., 48: 12
E.L., Hakim E.H., Kitajima M., Syah Y.M., 1959-1963
Takayama H., (2004). The Indonesian Society of Kitanaka, S., Ikezawa, T., Yadukawa, K.,
Natural Product Chemistry, 4:1 27-34 Yamanouchi, S., Takido, M., Sung, H.K., and Kim,
I Nyoman Adi W., Achmad, S.A., Aimi, N., Hakim, I.H., (1990), Chem Pharm Bull., 38(2), 432-435
E.H., Lia D.J., Syah, Y.M., M.I.C., (2003). The Tukiran; Achmad, S.A., Hakim, E.H., Lia D. J.,
Indonesian Society of Natural Product Chemistry, Syah, Y.M., Kokki S., (2003)The Indonesian
3:1 39-44 Society of Natural Product Chemistry, 3:1 24-31
Ito, T., Tanaka, T., Ido, Y., Nakaya, K., Iinuma, M.,
Riswan, S., (2000). Chem. Pharm. Bull., 48: 7 1001-
1005
Abstrak
Termodinamika merupakan ilmu yang merambah semua bentuk sistem di alam. Saat ini
termodinamika berkembang bukan hanya di ranah keadaan setimbang, tetapi juga di daerah
tak setimbang yang melibatkan proses-proses tak reversibel. Untuk itu akan dibahas bentuk
termodinamika di tiga ranah keadaan, yaitu: keadaan setimbang, keadaan dekat setimbang
dan keadaan jauh dari setimbang, yang masing-masing memiliki ciri dan perilaku tersendiri.
Sejalan dengan itu berkembang pula pendekatan molekular pada keadaan setimbang, dekat
setimbang dan jauh dari setimbang. Bila ranah setimbang telah sepenuhnya difahami, maka
ranah dekat setimbang, yang secara nyata menggambarkan proses-proses yang berlangsung
di alam, mulai difahami pada tataran fenomenologi maupun molekular. Sebaliknya, keadaan
jauh dari setimbang masih merupakan tantangan besar, meskipun saat ini tampak
perkembangan yang menarik. Berbeda dengan keadaan dekat setimbang yang dapat
dikembalikan ke keadaan setimbang, sistem pada keadaan jauh dari setimbang tidak selalu
dapat dikembalikan ke keadaan setimbang. Sistem semacam itu dxapat secara spontan
berubah menghasilkan struktur baru yang belum ada sebelumny dan tidak diramal
sebelumnya, melalui proses yang dikenal sebagai self organization. Melalui konsep ini, yang
dipelajari pada sistem-sistem terbuka, termodinamika mulai merambah berbagai sistem,
antara lain: sistem biologi, sistem informasi dan sistem sosial. Akan dibahas apa yang harus
dilakukan pada sistem perkuliahan kimia agar dapat mengantisipasi perkembangan ini di
masa depan.
Abstrak
Kacang panjang (Vigna sesquipedalis) mengandung lipid yang tersusun oleh 57% asam
lemak esensial, linoleat (L, C18:2, ω6) dan linolenat (Ln, C18:3, ω3), sekaligus mengandung
enzim pengoksidasinya, lipoksigenase. Isolat kasar lipoksigenase hasil ekstraksi dengan bufer
borat 2,0 M pH 9,0; dipurifikasi berturut-turut dengan cara fraksionasi menggunakan
(NH4)2SO4, dialisis dan dilanjutkan dengan kromatografi penukar anion DEAE Selulosa.
Penentuan aktivitas spesifik menggunakan substrat linoleat menunjukkan terbentuknya
peningkatan aktivitas yaitu mulai dari 0,226 U/mg (ekstraksi), 0,418 U/ml (fraksionasi
dengan 60-90% NH4SO4), 0,523 U/mg (dialisis) sampai 350,6 U/mg (kromatografi DEAE
Selulosa) atau dengan pemurnian sebesar 1550,59 kali. Kondisi optimum reaksi diperoleh
pada pH = 9,0, dan 300C. Berdasarkan substrat alamiah dan kondisi optimumnya, maka
Lipoksigenase yang diperoleh termasuk tipe I (L-1), atau lipoksigenase alkali, dengan
penomoran E.C. 1.13.11.12.
Kata kunci : isolasi, lipoksigenase, purifikasi dan karakterisasi, tipe I, Vigna sesquipedalis.
mikroorganisme. Lipoksigenase pada manusia saring Whatman No. 1. Filtrat yang diperoleh
berguna pada oksidasi asam arasidonat (An, dimasukkan ke dalam botol reagen untuk
C20:4 ω6) membentuk asam 5-hidroksi- disimpan dalam lemari pendingin sampai saat
6,8,11,14 eikosapentatetraenoat, suatu senyawa digunakan. Pada saat digunakan, reagen ini
antara pembentukan leukotrien A4, C, D dan E perlu diencerkan terlebih dahulu sebanyak 5
yang merupakan komponen penting pada sel kali dengan aquadest.
darah putih. Leukotrien merupakan konstituen Peralatan yang digunakan antara lain :
mediator reaksi imflamasi dan hipersensitivitas, spektrofotometer UV/Vis Hitachi, Refrigerated
(Chen et.al, 1994; Dwyer et.al, 2004; Ross, Centrifuge Shimadzu, blender, membrane
1999). Pada tanaman, enzim ini diperlukan dialysis/selofan (43 x 27) cm kapasitas 175
untuk pertumbuhan dan produksi senyawa ml/ft, kolom kromatografi penukar anion (33 x
antibakteri, (DKFZ, 2003). Lipoksigenase 1,7) cm, fraction collection, lemari pendingin,
banyak terdapat pada biji kacang-kacangan blender, pH meter, neraca analisis, pengaduk
seperti kacang kedelai, kacang panjang, dan magnetik dan peralan gelas serta perlatan
kacang tanah. pendukung lain.
Ada dua jenis lipoksigenase kacang kedelai Cara kerja
yaitu lipoksigenase tipe I (L-1) dan Isolasi Lipoksigenase
lipoksigenase tipe II (L-2). L-1 merupakan Sebanyak 150 gram biji kacang panjang
lipoksigenase alkali, memiliki aktivitas pada ditambah dengan 600 ml buffer borat 2,0 M pH
pH 9,0, bersifat stabil dan aktivitasnya tidak 9,0; kemudian diblender selama satu menit
berkurang selama pemurnian, dengan Mr dengan keadaan dingin. Homogenat yang
sebesar 102000. L-2 dikenal sebagai diperoleh disaring dengan kain katun, filtrate
lipoksigenase netral karena bekerja pada pH selanjutnya disentrifugasi dengan refrigerated
6,5. Lipoksigenase tidak aktif umumnya dalam centrifuge pada 4o C dengan kecepatan 6000
bentuk kadaan fero (LOX-Fe2+), (Boyington, rpm selama 30 menit. Supernatan yang
1993). diperoleh merupakan ekstraks enzim kasar
Penelitian ini bertujuan untuk mengisolasi yang selanjutnya difraksionasi bertingkat
lipoksigenase yang terdapat pada kacang dengan penambahan garam (NH4)2SO4.
panjang, penentuan kondisi optimum reaksi Penentuan Aktifitas Lipoksigenase Ekstraks
katalisisnya dan sekaligus tipe enzimnya. kasar
2. Percobaan Sampel substrat dibuat dengan mencampurkan
Bahan dan Peralatan. 0,95 ml buffer borat 0,2 M pH 9,0 dengan 2,0
Biji kacang panjang diambil dari kacang ml larutan linoleat 0,2 M dan 0,05 ml larutan
panjang segar yang baru dipetik, diperoleh dari enzim kasar. Sebagai blanko digunakan
perkebunan kacang panjang di kampung campuran 1,0 ml buffer borat dan 2,0 ml
Pekopen, desa Lambang Jaya, Tambun, Bekasi. larutan linoleat 0,2 M. Selanjutnya sampel dan
blanko diinkubasi pada 30o C selama 30 menit.
Bahan kimia yang digunakan antara lain asam
Reaksi dihentikan dengan merendam tabung
linoleat, coomassie brilliant blue G 250, Bovine
reaksi sampel dan blanko dalam air mendidih
Serum Albumin (BSA), dan DEAE selulosa,
selama 3 menit.
(NH4)4SO4 dan buffer borat. Larutan stok
linoleat dibuat dengan cara menambahkan Aktivitas enzim ditentukan berdasarkan
etanol 95 % pada 0,05 ml asam linoleat, diaduk pembentukan ikatan rangkap terkonjugasi asam
sampai terbentuk emulsi, setelah itu ditambah linoleat. Pengukuran dilakukan dengan
dengan aquadest sampai volume 50,0 ml. Pada spektrofotometer UV pada λ 234 nm. Aktivitas
saat penggunaan, larutan stok diencerkan 6 kali spesifik dihitung berdasarkan rumus :
dengan buffer borat 0,2 M pH 9,0. Reagen
Bradford dibuat dengan cara melarutkan 100
A234 nm
mg Coomassie Briliant Blue G 250 dalam 50 Aktivitas Spesifik = ⎯⎯⎯⎯⎯⎯⎯⎯⎯⎯⎯⎯
ml etanol 95 %. Larutan ini kemudian 30 x 0,001 x mg protein total
dicampurkan dengan 100 ml asam fosfat 85 %
dan diencerkan sampai 1,0 l dengan aquadest, Satu unit aktivitas dinyatakan sebagai kenaikan
selanjutnya disaring menggunakan kertas 0,001 absorbansi per menit pada 25o C diukur
pada panjang gelombang 234 nm, dengan 0,2 M pH 9,0. Proses dialisis dilakukan pada
volume sampel 3,0 ml, (William et.al, 2000). suhu dingin menggunakan ice salt bath, selama
24 jam dengan penggantian larutan buffer
Penentuan Kadar Protein Enzim Kasar.
sebanyak 8 kali.
Penentuan protein dilakukan berdasarkan
metode Bradford. Sejumlah 100 µl larutan Kromatografi Penukar Anion DEAE-
enzim kasar ditambah dengan 5,0 ml reagen Selulosa
Bradford dan dihcampurkan dengan Kolom DEAE-Selulosa yang digunakan
menggunakan vortex mixer. Setelah diinkubasai mempunyai panjang 33 cm, diameter 1,7 cm
selama 15 menit, sampel diukur absorbansinya dengan volume 27,22 cm3. Kolom yang telah
pada λ 595. Sebagai blanko, larutan enzim diregenerasi dengan larutan NaCl 1,4 M
kasar diganti dengan aquadest, sedangkan sebanyak 10 kali volume kolom untuk
larutan standar digunakan BSA dengan kadar menghilangkan sisa protein yang tertinggal
0,2 mg/l sampai 1,0 mg/l. Kadar protein enzim dalam kolom. Kolom kemudian dikondisikan
kasar ditentukan dengan cara dengan pelarut NaCl 0,02 M sebanyak 10 kali
mengekstrapolasikannya terhadap kurva volume. Selanjutnya sejumlah 1,5 ml sampel
standar. dituangkan secara perlahan ke kolom melalui
dinding tabung menggunakan pipet dan
Fraksionasi dengan Garam Amonium Sulfat dibiarkan semalam agar protein sampel
Ekstraks enzim kasar, selanjutnya difraksionasi berinteraksi dengan gugus amino dari resin
dengan penambahan garam (NH4)2SO4 pada yang bermuatan positif. Sampel kemudian
variasi kejenuhan 0-30 % (b/v); 30-60 % (b/v) dielusi menggunakan eluen NaCl 0,02 M; 0,1
dan 60-90 % (b/v). Pembuatan tingkat M; 0,2 M; 0,3 M; 0,4 M dan 0,5 M dengan laju
kejenuhan S2 % sebanyak 1 liter dari larutan S1 alir 58 cpm. Tiap fraksi. dengan volume 2,5 ml
% berdasarkan rumus g = 533(S2-S1)/100-0,3S2. ditampung dengan bantuan pengumpul fraksi
Penambahan garan dilakukan sedikit demi (fraction collector). Total fraksi yang diperoleh
sedikit pada suhu 0-5o C sambil diaduk dengan sebanyak 48 fraksi.
pengaduk magnetik selama 2 jam. Larutan
selanjutnya dibiarkan mengendap semalaman. Kandungan protein tiap fraksi ditentukan
Endapan selanjutnya dipisahkan melalui berdasarkan ekstrapolasi dengan standard BSA
sentrifugasi pada putaran 7500 rpm dengan 0,001-0,7 mg/ml yang diukur serapannya pada
suhu 4o C selama 70 menit. Endapan yang λ 280 nm. Selanjutnya fraksi dengan kadar
diperoleh kemudian disuspensikan dalam protein tertinggi diukur aktivitas spesifiknya.
buffer borat 0,2 M pH 9,0. Penentuan kondisi optimal reaksi.
Selanjutnya setiap fraksi enzim yang diperoleh pH optimum, ditentukan berdasarkan prosedur
ditentukan aktivitas dan kadar proteinnya 2.2.2, dengan variasi pH 5, 6, 7, 8, 9, 10
menggunakan prosedur yang sama seperi pada menggunakan buffer borat 0,2 M.
enzim kasar. Suhu optimum ditentukan berdasarkan variasi
Dialisis suhu inkubasi pada 10, 20, 30, 40 dan 50o C
Dialisis dilakukan dengan menggunakan menggunakan kondisi pH optimum yang
membran selofan yang sudah dibersihkan dari diperoleh sebelumnya.
pengotor gliserin dan senyawa sulfur. Pengotor 3. Hasil dan Pembahasan
gliserin dibersihkan dengan cara mencuci Isolasi dan Fraksionasi
menggunakan aliran air selama 4 jam. Isolasi lipoksigenase dilakukan secara ekstraksi
Sedangkan pengotor sulfur dihilangkan dengan menghasilkan supernatan ekstraks enzim kasar
cara memasukkan selofan ke dalam larutan 0,3 sebanyak 367,13 mg protein dalam 445 ml
% Na2S pada suhu 80o C selama 1 menit, volume dengan aktivitas spesifik 0,0226 U/mg.
kemudian dicuci dengan air panas 60o C selama
2 menit dan pengasaman dengan 0,2 % (v/v) Fraksionasi enzim kasar dilakukan melalui
H2SO4. Selanjutnya dicuci dengan air panas proses salting out dengan garam (NH4)4SO4.
untuk menghilangkan asamnya. Anion sulfat merupakan anion divalent yang
efektif untuk mengendapkan protein. Garam ini
Suspensi enzim dimasukkan ke dalam kantung mempunyai kelarutan yang baik pada suhu
selofan, lantas dicelupkan dalam buffer borat rendah dan bersifat endotermik sehingga
0.30
0,40
0.25 0,02
0,30 0,50
Serapan optik pada 234 nm
0.20 0,10
0.15 0,20
0.10
0.05
0.00
0 10 20 30 40 50
(0.05)
(0.10)
Fraksi (@ 2,5 ml)
Gambar 1. Kromatogram DEAE selulosa protein isolat lipoksigenase dengan eluen NaCl
dengan protein enzim dilepas melalui kurva seperti pada Gambar 2. Terlihat bahwa
penukaran anion dengan cara menambahkan aktivitas lipoksidase muncul pada puncak
berbagai variasi konsentrasi NaCl sebagai pertama ke-dua dan ke-tiga. Puncak ke-1
eluen. Profil elusi protein ditampilkan pada mengandung 0,2125 mg protein dengan
Gambar 1. aktivitas spesifik 22,433 U/mg. Puncak ke-2
mengandung 0,0425 mg protein dengan
Peningkatan konsentrasi eluen NaCl
aktivitas spesifik 350,588 U/mg. Sedangkan
menyebabkan penukaran anion semakin efektif
puncak ke-3 mengandung 0,325 mg protein
yang ditunjukkan dengan peningkatan serapan
dengan aktivitas spesifik 40,408 U/mg.
protein pada fraksi hasil elusi dengan
konsentrasi NaCl antara 0,2 – 0,4 M NaCl. Puncak ke-2 menunjukkan bahwa walaupun
Peningkatan konsentrasi NaCl lebih lanjut protein yang dikandungnya paling sedikit tetapi
menjadi 0,5 M tidak meningkatkan serapan memberikan aktivitas spesifik paling tinggi.
protein lagi, hal ini menunjukkan bahwa Hal ini menunjukkan bahwa kemurnian enzim
protein dalam sampel sudah terelusi semua. pada fraksi ini paling tinggi. Sedangkan puncak
ke-empat dengan kandungan protein paling
Tiap fraksi hasil kromatografi penukar anion
banyak ternyata tidak mengandung
selanjutnya diukur aktivitasnya menghasilkan
0.5
0,20 0,30
Puncak 2
Serapan optik pada 234 nm
0.4
0,10 0,40
0.3 0,02 0,50
Puncak 3
0.2 Puncak 1
0.1
0
0 10 20 30 40 50
-0.1
Fraksi (@ 2,5 ml)
0.45
0.43
Serapan optik pada 234 nm
0.42 0.44
0.41 0.43
0.40
0.42
0.39
0.41
0.38
0.37 0.4
0.36 0.39
0.35 0.38
4 5 6 7 8 9 10 11 0 10 20 30 40 50 60
pH Suhu (oC)
Gambar 3. Hubungan antara aktivitas enzimatis dengan variasi pH (a) dan variasi suhu (b). Kondisi
optimum reaksi oksidasi asam linoleat yang dikatalisis oleh lipokigenase hasil isolasi diperoleh pada pH
9,0 dan suhu 30o C..
Abstrak
Jamur Lingzhi (Ganoderma lucidum) kaya akan senyawa aktif organik seperti polisakarida,
asam amino, protein, triterpen, alkaloid dan lain-lain. Salah satu kandungan Lingzhi yang
memberikan manfaat untuk kesehatan adalah Ganoderma polisakarida (GPS), yang
merupakan senyawa prebiotik. Dalam penelitian ini dilakukan studi pendahuluan analisis
kandungan GPS pada jamur Lingzhi. GPS adalah heteropolisakarida yang terdiri atas
maltosa, galaktosa dan monosakarida lain dalam jumlah sedikit, ditambah asam-asam amino
yang terkonyugasi seperti asam aspartat dan asam glutamat. Hasil analisis dengan tes Molish
positif, analisis spektroskopi inframerah dapat dideteksi adanya gugus fungsi O-H, CHO dan
C-H. Analisis kromatografi lapis tipis dan kromatografi cair kinerja tinggi dapat terdeteksi
adanya glukosa, galaktosa dan manosa. Hasil analisis gravimetri memberikan kadar fraksi
polisakarida dalam sampel jamur Lingzhi yaitu 0,66 % dan analisis Follin Wu memberikan
kandungan gula pereduksi dalam fraksi polisakarida sebesar 24,62%.
Kata kunci: GPS, jamur Lingzhi, prebiotik
asam aspartat dan asam glutamat, untuk itu 2.2.3. Analisis Kromatografi Lapis Tipis
dalam penelitian ini dilakukan studi (KLT)
pendahuluan analisis kandungan GPS. Sampel fraksi GPS yang telah dihidrolisis
dengan HCl 6N pada suhu 60oC selama
30menit, kemudian dikeringkan dalam oven
suhu 60oC. Padatan kering dan standar
beberapa monosakarida dilarutkan dalam
aquadest kemudian dibuat spot pada lempeng
silika yang telah diimpregnasi dengan larutan
natrium asetat 0,02M. Pemisahan dilakukan
dalam bak pengembang dengan fasa gerak
campuran n-propanol dan aquades (85:15)
hingga terjadi pemisahan.
2.2.4. Analisis Kromatografi Cair Kinerja
Tinggi (KCKT)
Sampel yang telah dihidrolisis, dilarutkan
dalam aquades kemudian diinjeksikan ke dalam
Gambar 1. Jamur Lingzhi
alat KCKT. Pemisahan dilakukan dengan fase
2 Percobaan gerak methanol-air (60-40) menggunakan
2.1. Persiapan sampel ( Mamoru et al. 1997) kolom amina fase terikat pada suhu 30oC,
Jamur Lingzhi kering 250 g setelah kecepatan alir fase gerak diatur pada
dibersihkan, diekstrak dalam air panas( 95- 1mL/menit dengan detektor ultraviolet pada
100oC) selama 30 jam. Filtrat disaring dan panjang gelombang 254nm.
dipekatkan dengan rotary evaporator. Aliquot 2.3. Analisis Kuantitatif Ganoderma
kemudian diendapkan dengan etanol kemudian Polisakarida (GPS)
disentrifugasi dengan kecepatan 8500 rpm 2.3.1. Analisis Gravimetri
selama 20 menit. Endapan dipisahkan Fraksi GPS yang sudah dikeringkan ditimbang
kemudian dilarutkan kembali dalam air dan dibandingkan dengan berat kering sampel
(100mL), kemudian didialisis. Hasil dialisis awal untuk menentukan kadarnya.
diendapkan kembali dengan etanol, kemudian
disentrifugasi kembali. Endapan hasil 2.3.2. Analisis Kandungan Gula Pereduksi
sentrifugasi dipisahkan, dikeringkan pada suhu Metode Folin Wu
40oC, hasilnya merupakan sampel yang diduga Larutan sampel adalah sampel fraksi GPS yang
mengandung senyawa Ganoderma Polisakarida sudah dihidrolisis dengan HCl 6N dan
(GPS) dipanaskan pada suhu 60oC selam 30 menit,
dipipet sebanyak 0,4mL ke dalam tabung Folin
2.2. Analisis Kulitatif Ganoderma Wu yang sudah berisi 4mL Na2CO30,25 N dan
Polisakarida (GPS) ditambahkan 5,6mL aquadest.
2.2.1. Tes Molish
Ke dalam 2mL larutan sampel fraksi GPS yang Larutan standar glukosa dengan konsentrasi
telah dihidrolisis sebelumnya oleh HCl 6N, 20ppm, 40ppm, 75ppm, dan 100ppm juga
ditambahkan 2 tetes larutan Molish dan 1mL diperlakukan seperti sampel. Semua tabung
asam sulfat pekat melalui dinding tabung. Folin Wu dipanaskan dalam air mendidih
selama 8 menit. Kemudian ditambahkan 2mL
2.2.2. Analisis Spektroskopi Inframerah (IR) larutan asam fosfomolibdat, kemudian larutan
Sampel yang telah dihaluskan bersama KBr ditepatkan sampai 25mL. Dikocok sampai
dengan perbandingan 1:100, dimasukkan dalam homogen dan diukur dengan spektrofotometer
sel sampel. Setelah alat spektrofotometer visible pada panjang gelombang maksimum ;
dikalibrasi, dilakukan analisis hingga diperoleh dibuat kurva kalibrasi standar dan dapat
spectrum sampel, dan dibandingkan dengan ditentukan kandungan gula pereduksi dalam
spektra gugus fungsi standar dari reference. fraksi GPS.
3. Hasil dan Pembahasan
Analisis kualitatif dan kuantitatif dilakukan
dengan melakukan pendekatan-pendekatan
Gambar 2 : Hasil pemisahan monosakarida penyusun GPS dengan Kromatografi Lapis Tipis (KLT) pada
lempeng silica yang diimpregnasi oleh natrium asetat 0,02 M dan menggunakan fase gerak n-propanol :
aquadest (85:15)
Tabel 1. Data Rf dan kesimpulan dugaan hasil pemisahan monosakarida penyusun GPS dengan KLT pada
lempeng silica, diimpregnasi natrium asetat 0,02 M , fase gerak n-propanol : aquades (85:15)
sehingga kita dapat menduga bahwa fraksi inframerah, diperoleh puncak-puncak spectrum
polisakarida yang kita peroleh adalah yang menunjukkan gugus-gugus fungsi GPS.
Ganoderma Polisakarida (GPS) yang dikenal
Gugus O-H pada bilangan gelombang antara
memiliki khasiat bagi kesehatan, dan diduga
3460 – 3470 cm-1, gugus aldehid pada bilangan
berfungsi sebagai senyawa prebiotik.
gelombang sekitar 1636 cm-1 dan gugus C-H
Hasil tes Molish memperlihatkan hasil yang pada bilangan gelombang anta1400 – 1405 cm-
1
positif dengan terbentuknya warna ungu, hal ini .
menunjukkan bahwa fraksi polisakarida dalam
Hasil pemisahan dengan kromatografi cair
jamur Lingzhi termasuk dalam kelompok
kinerja tinggi, nilai Retention time 3,57 ; 4,71
senyawa polisakarida.
dan 5,57 menit, berturut-turut adalah glukosa,
Analisis kromatografi lapis tipis, dilakukan galaktosa dan maltosa. Dengan demikian dapat
untuk mengetahui jenis monosakarida diperkirakan bahwa fraksi polisakarida dari
penyusun dalam fraksi polisakarida. Hasil jamur Lingzhi mengandung / tersusun di
analisis didapat nilai Rf yang dibandingkan antaranya adalah glukosa , galaktosa dan
dengan standar. Didapatkan beberapa spot maltosa.
dan dapat disimpulkan Rf = 0,43, Rf = 0, Dari analisis kuantitatif secara gravimetrik
25 dan Rf = 0,16 berturut-turut sebagai didapatkan bahwa jamur Lingzhi mengandung
glukosa, galaktosa dan maltosa. 0,66% (w/w) fraksi polisakarida.
Penentuan kadar gula pereduksi dalam fraksi
Analisis spektrum infra merah juga polisakarida dengan metode Folin Wu , diukur
memperkuat dugaan bahwa fraksi yang kita menggunakan spektrofotometer visible pada
peroleh adalah polisakarida. Hasil hidrolisis panjang gelombang (λ) 790 nm.
polisakarida yang dianalisis spectrum
Setelah dibuat kurva standar, didapat kadar Ito Hitoshi,1998, What is Reishe?, Network Global
gula pereduksi sampel adalah 24,62 % Publishing: http://www.canited.com/, 24 Agustus
2001, 10.57 WIB
4. Kesimpulan
Senyawa hasil ekstraksi jamur Lingzhi yang Mizuno Takashi, Wang Guanying, Zhang Jie,
Kawagishi Hirokazu, Nishitoba Tsuyoshi, Li
kemudian diendapkan etanol, merupakan
Jingxuan, 1999, Reishi, Ganoderma Lucidum and
Ganoderma Polisakasida (GPS). Dari hasil data Ganoderma Tsuage : Bioactive Substances and
analisis kualitatif dan kuantitatif, hasil Medical Effects, http://www.mikei.com/reishi1997-
hidrolisis GPS merupakan senyawa-senyawa 6.htm, Japan : Japan’s MIKEI corp., 24 Agustus
monosakarida yang merupakan hidrolisis dari 2001, 11.20 WIB
oligosakarida.yang diduga sebagai senyawa
Sugiura Mamoru, Ito Hioshi, 1997, Study of the
prebiotik. Main Chemical Component of Ganoderma lucidum,
5. Ucapan terima kasih http://www.reishi.com/ganolucd.html, 24Agustus
Ucapan terima kasih kepada PT. Botani 2001, jam 17.30 WIB
Tropical Lestari, yang telah membantu Vita Green Health Products Co.,Ltd., “Five
memberikan sampel jamur Lingzhi untuk Coloured” Lingzhi ( Ganoderma lucidum ), Clinical
penelitian ini. Aspect,
http://www.vitagreen.com/html/lingzhi.htm, 24
6. Daftar Pustaka Agustus 2001, 17.00 WIB.
Alexander Renee R., Griffiths joan M., 1993, Basic
Biochemical Method, 2nd edition, Wiley-Liss Inc.,
New York
Abstrak
Telah dilakukan usaha untuk mensintesis suatu senyawa 1,3-dihidroksi-2-(4-piridil)-4,5-
dimetil imidazolina sebagai prekusor senyawa organik radikal 2-(4-piridil)-4,5-dimetil
imidazolina-1-oksil-3-oksida. Senyawa ini merupakan turunan dari 2-(4-piridil)-4,4,5,5-
tetrametilimidazolina-1-oksil-3-oksida (RadDPyTIm) yang telah berhasil disintesis dan telah
dikembangkan sebagai ligan nitronil nitroksida. Tujuan penelitian ini adalah mensintesis 1,3-
dihidroksi-2-(4-piridil)-4,5-dimetil imidazolina, yakni mengurangi gugus metil imidazol
dalam RadDPyTIm. Langkah-langkah sintesis yang dilakukan adalah: (1) reaksi kopling
oksidatif nitroetana menjadi 2,3-dinitrobutana, (2) reduksi 2,3-dinitrobutana (hasil langkah 1)
membentuk 2,3-dihidroksilaminobutana, dan (3) reaksi 2,3-dihidroksilaminobutana (hasil
langkah 2) dengan 4-piridinkarboksaldehida membentuk 1,3-dihidroksi-2-(4-piridil)-4,5-
dimetil imidazolina. Karakterisasi zat hasil penelitian dilakukan berdasar titik lebur dan
kelarutan dan diidentifikasi melalui spektroskopi ultraviolet, inframerah, dan 1H-NMR. Hasil
penelitian telah diperoleh beberapa senyawa, yakni: (1) 2,3-dinitrobutana (suatu zat padat
kristal berwarna kuning coklat), (2) 2,3-dihidroksilaminobutana (tidak diidentifikasi), dan (3)
1,3-dihidroksi-2-(4-piridil)- imidazolina.
Kata-kata kunci: 2,3-dihidroksilaminobutana, 2,3-dihidroksi-2-(4-piridil)-4,5-dimetil
imidazolina
O-
2
N
N
N
O .
dengan 4 gugus metil
1
3
Oleh sebab itu, penelitian untuk meningkatkan (Rad DPyDIm). Penelitian ini bertujuan untuk
Tc dari strategi ini masih perlu untuk terus memperoleh senyawa baru DPyDIm sebagai
dikembangkan. Ligan RadDPyTIm tersebut prekursor senyawa RadDPyDIm. Senyawa
dikenal sebagai senyawa radikal radikal tersebut akan digunakan sebagai ligan
nitronilnitroksida dengan struktur umum seperti paramagnetik dalam sintesis material magnetik
pada 4. baru berbasis senyawa kompleks. Senyawa
DPyIm diperoleh melalui sintesis dengan bahan
O- dasar nitrometana dan 4-piridil-
N karboksaldehida.
R 2. Metode Penelitian
Penelitian ini bersifat eksperimental yang
O dilakukan di laboratorium. Semua data
dikumpulkan dan diperoleh dari hasil
(4) pengamatan di laboratorium. Sasaran penelitian
adalah diperolehnya 1,3-dihidroksi-2-(4-
RadDPyTIm diperoleh dengan menggunakan piridil)-4,5-dimetilimidazolina sebagai
piridin-4-karboksaldehida sebagai -R. Senyawa prekursor ligan radikal yakni 2-(4-piridil)-4,5-
ini bersifat paramagnetik dan dapat membentuk dimetilimidazolina-1-oksil-3-oksida dengan
senyawa kompleks dengan ion-ion logam [2-4]. tahapannya meliputi: (1) sintesis 2,3-
Kajian struktur RadDPyTIm menunjukkan dinitrobutana, (2) sintesis 2,3-
inteaksi antar molekul yang lemah (J = 3,2 ± dihidroksiaminobutana, dan (3) sintesis,
0,08 cm-1, zJ ‘= -0,32 cm-1 untuk M = Mn(II), pemurnian, karakterisasi, dan identifikasi 1,3-
[3]). Interaksi antar molekul yang lemah dihidroksi-2-(4-piridil)-4,5-dimetilimidazolina.
tersebut diduga karena adanya efek sterik yang Karakterisasi senyawa hasil sintesis dilakukan
besar dari dua radikal yang berseberangan. dengan penentuan titik leleh dan uji kelarutan.
Untuk mensintesis 1 bahan dasar yang Identifikasi struktur senyawa hasil sintesis
digunakan 2-nitropropana, maka sintesis 3 akan dengan metode spektroskopi ultraviolet (UV),
dapat diperoleh dari 1,2-dinitroetana. Secara inframerah (IR), dan resonansi magnetik inti
teori 1,2-dinitroetana ini dapat disintesis proton (1H-NMR).
melalui reaksi kopling nitrometana di bawah Bahan dan alat
tahapan brominasi dalam suasana basa dalam Bahan-bahan yang digunakan dalam penelitian
pelarut etanol-air. 1,2-Dinitroetana kemudian ini antara lain nitroetana, 4-
dikonversi menjadi 1,2-bis- piridinkarboksaldehida, natriumhidroksida,
(hidroksilamino)etana untuk dikondensasikan brom, seng, ammonium klorida, etanol,
lanjut dengan aldehida. Pada tahap ini aquades, metanol, dietil eter, diklorometana,
diperlukan katalis seng dan biasanya aseton, metil klorida, aluminium foil, pipa
berlangsung pada temperatur < 10oC. Senyawa kapiler, dimetilsulfoksida (DMSO),
yang diperoleh kemudian dioksidasi oleh dimetilsulfoksida terdeuterasi (d6). Derajat
natriumperiodat untuk memperoleh senyawa kualitas bahan adalah for synthesis, pro-
radikal. analysis, atau yang sejenisnya. Semua bahan
Perolehan senyawa baru radikal RadDPyIm langsung digunakan tanpa perlakuan khusus.
dapat digunakan untuk membuat senyawa Alat-alat yang digunakan dalam penelitian ini
kompleks yang berpotensi sebagai material adalah tabung reaksi, beaker glass, erlenmeyer,
magnetik dengan sifat-sifat magnetik lebih seperangkat alat refluks, labu leher tiga,
unggul. Sintesis senyawa tersebut sangat desikator, pipet volume, gelas ukur, rovavapor,
penting untuk mengetahui pengaruh sterik ligan corong Buchner, termometer, ultrasonic
radikal terhadap interaksi magnetik cleaner, thermos air, magnetic stirrer, spatula,
intermolekuler dalam material magnetik Melting Point Apparatus: SIBATA Mel-270,
senyawa kompleks. Aspek penelitian yang spektro-fotometer UV: SHIMADZU UV-1610,
dilakukan adalah sintesis 1,3-dihidroksil-2-(4- spektrofotometer IR: Jasco FT/IR-5300 dan
piridil)-4,5-dimetilimidazolina (DPyDIm) spektrofotometer 1
H-NMR: HITACHI
sebagai prekursor senyawa radikal 2-(4- FT/NMR-R-1900.
piridil)-4,5-dimetilimidazolina-1-oksil-3-oksida
NO2 NO2
NO2
H Br+ - Br- Br
_
+ -OH
H H
Nitroetana (I)
NO2
_
H
NO2 NO2
Mekanisme reaksi yang terjadi diduga sebagai kuning jernih. Endapan yang didapat di cuci
berikut: (a) Pertama, serangan basa OH- pada dengan air lalu dikeringkan dalam desikator.
hidrogen (asam) dari nitroetana membentuk ion Endapan ini selanjutnya disebut senyawa III.
karban (-CH(CH3)NO2), (b) Kedua, serangan
Pemurnian Senyawa Hasil Sintesis DPyDIm
ion karban terhadap brom menghasilkan
(III)
bromonitroetana (CH3CHBrNO2), dan (c)
Langkah awal yang dilakukan adalah pemilihan
Ketiga, serangan ion karban (-CH(CH3)NO2)
pelarut untuk rekristalisasi sebagai metode
hasil lain langkah (a) terhadap
pemurnian yang dilakukan. Pemilihan pelarut
(CH3CHBrNO2) menghasilkan (II) seperti
dilakukan dengan cara melarutkan 0,001 g
diikhtisarkan pada Gambar 2.
senyawa hasil sintesis dalam 5 mL pelarut
Sintesis 1,3-Dihidroksi-2-(4-piridin)-4,5- metanol, metanol-air (1:1), etanol, etanol-air (
dimetilimidazolina (DPyDIm) 1:1), aseton, metil klorida pada keadaan dingin.
Sintesis dan karakterisasi 1,3-dihidroksi-2-(4- Dari pelarutan ini senyawa tidak larut pada
piridin)-imidazolina (DPyDIm) dilakukan semua pelarut dalam keadaan dingin.
dengan dua tahap utama, yakni (1) konversi Selanjutnya, melarutkan senyawa tersebut pada
2,3-dinitrobutana menjadi 2,3- keadaan panas dalam penangas air dan
dihidroksilaminobutana melalui reaksi reduksi mencatat suhu kelarutan senyawa. Senyawa
dengan seng/amoniumklorida (suasana asam) hasil sintesis yang dapat larut dalam pelarut
dan pelarut etanol-air (1+1), (2) reaksi tertentu pada keadaan panas kemudian
pembentukan cincin imidazolina melalui reaksi didinginkan secara perlahan. Pendinginan
2,3-dihidroksilaminobtana (hasil tahap 1) secara perlahan dilakukan dengan cara
dengan 4-piridilkarboksaldehida. 2,3- memasukkan larutan dalam tabung reaksi dan
Dihidroksilaminobutana hasil konversi secara menutup rapat tabung reaksi serta memberi
reduksi 2,3-dinitrobutana tidak dipisahkan lubang sebesar ukuran jarum. Pendinginan
terlebih dahulu dari prosesnya (meta-sintesis), secara perlahan dilakukan selama ± 3 hari.
akan tetapi langsung direaksikan dengan 4- Dengan pendinginan secara perlahan ternyata,
piridilkarboksaldehida. Perlakuan percobaan hanya pelarut etanol-air (1:1) yang
sintesis DPyDIm tersebut diuraikan sebagai menghasilkan endapan sehingga dapat
berikut. disimpulkan bahwa etanol-air (1:1) adalah
Tahap (1): Sintesis 2,3-dihidroksilaminobutana pelarut yang cocok untuk rekristalisasi (Tabel
dilakukan dengan mere-aksikan 0,125 mol 2).
ammonium klorida dengan 0,07 mol 2,3- Rekristalisasi Senyawa Hasil Sintesis
dinitrobutana dengan katalis 0,125 mol serbuk DPyDIm (III)
seng dalam suatu labu leher tiga. Reaksi Rekristalisasi III dilakukan dengan melarutkan
dilakukan di atas pengaduk magnetik pada suhu 4 g zat ini dalam etanol-air (1+1) dalam
di bawah 10 oC. Penambahan seng dilakukan keadaan panas (30-600C) di atas penangas air
selama 5-6 jam. Setelah seng habis pengadukan sampai semuanya larut. Volume larutan dijaga
dilanjutkan selama satu jam pada suhu kamar. tetap 100 mL untuk menghindari terjadinya
Kemudian campuran yang diperoleh disaring kristalisasi prematur pada saat penyaringan
(dengan filter maser no.4). Endapan dicuci dalam keadaan panas. Senyawa III larut
dengan etanol 2 × 25 mL. Hasil yang diperoleh sempurna pada 50oC, selanjutnya larutan
berupa filtrat tidak berwarna dan endapan disaring dalam keadaan panas. Filtrat
berwarna abu-abu. Filtrat inilah yang ditampung dalam tabung reaksi dan ditutup
digunakan untuk reaksi selanjutnya, yakni rapat menggunakan aluminium foil dengan
sintesis DPyDIm. Tahap (2): Sintesis DPyDIm memberi satu lubang sebesar ukuran jarum.
dilakukan dengan reaksi kopling reduktif Kemudian filtrat tersebut dimasukkan dalam
senyawa hasil reaksi pada tahap (1) yakni 2,3- termos yang berisi air panas (50oC) ditutup
dihidroksilaminobutana (filtrat tak berwarna) rapat sampai tidak ada uap yang keluar.
dengan 4-piridilkarboksaldehida. Reaksi Pendinginan perlahan dilakukan selama 3 hari.
tersebut dilakukan dengan melakukan Endapan yang terbentuk pada proses ini
pengadukan pada suhu kamar selama 2 jam. disaring. Diperoleh endapan (kuning pucat)
Dari reaksi tersebut diperoleh endapan sebanyak 0,5 g dan lebih bersih dibandingkan
berwarna kuning-oranye dan filtrat berwarna sebelum rekristalisasi. Demikian juga, hasil
daerah gugus fungsi 909-650 cm-1 terdapat Berdasarkan perbandingan tersebut maka dapat
serapan =C-H keluar bidang yang khas untuk diketahui bahwa luas daerah di bawah kurva
senyawa heteroaromatik. Dua serapan pada pada geseran kimia 8,70 ppm dan 7,78 ppm
690,58 cm-1 dan 775,45 cm-1 merupakan adalah 4 proton. Jadi terdapat kesesuaian data
serapan khas untuk piridin. Fakta lain yang pada spektrum UV, IR dan 1H-NMR
menunjukkan keberadaan senyawa ini dapat keberadaan 4-piridil dalam senyawa hasil.
dilihat dari munculnya pasangan serapan pada
Kerumitan spektrum 1H-NMR senyawa “1,3-
1614,56 cm-1 dan 1421,67 cm-1 yang
dihidroksi-2-(4-piridil)-4,5-dimetilimidazolina”
merupakan uluran C=C aromatik, sedangkan
hasil sintesis tampak pada daerah geseran kimia
tekuk C=NH aromatik muncul pada 1552,84
3-4 ppm dimana muncul satu puncak singlet
cm-1. Muncul pita serapan melebar pada
dengan intensitas sangat tinggi. Keberadaan
3383,45 cm-1 diduga sebagai pita serapan ulur
puncak tersebut dimungkinkan adalah
OH yang khas untuk ikatan hidrogen
keberadaan air dari pelarut DMSO
intermolekuler. Fakta lain yang menunjukkan
terdeteurisasi (d6) dan atau dari senyawa hasil
adanya gugus fungsi ini adalah munculnya pita
sintesis. Keberadaan air dalam pelarut DMSO
serapan yang tajam pada 1385,01 cm-1 yang
kerap kali muncul sebagai puncak singlet pada
merupakan getaran tekuk OH dalam bidang.
geseran kimia sekitar 3,30 ppm. Luas daerah di
Munculnya pita serapan kuat dan tajam pada
bawah puncak menunjukkan nilai sebesar 17
1552,84 cm-1 diduga sebagai ulur tak simetrik
proton. Luas daerah di bawah puncak pada
N-O. Pita dengan intensitas sedang pada
geseran kimia tersebut dimungkinkan adalah
2922,42 cm-1 diduga sebagai pita ulur C-H tak
hasil akumulasi dari puncak-puncak lain yang
simetrik gugus metil. Keberadaan gugus ini
ada pada daerah geseran kimia 3-4 ppm.
dipastikan dengan munculnya pita serapan
Akumulasi yang paling mungkin terjadi adalah
tajam pada 1385,01 cm-1 yang merupakan pita
akumulasi proton air dalam pelarut DMSO-
serapan untuk getaran tekuk C-H gugus metil.
terdeuterasi, dan atau dari senyawa itu sendiri
Spektrum 1H-NMR senyawa III (”DPyDIm”) serta proton gugus metil. Pelarut DMSO
hasil sintesis tampak pada Gambar 5. dimungkinkan memberikan sumbangan 6
Berdasarkan spektrum 1H-NMR senyawa III proton (dua dari gugus metil), 4 proton dari air
tersebut, muncul 5 puncak pada daerah geseran (yang ada dalam pelarut DMSO), 6 proton dari
kimia 0-10 ppm. Munculnya 4 puncak tersebut dua gugus metil dari senyawa dan satu proton
menunjukkan bahwa terdapat 4 jenis dari gugus metin (CH) yang tidak muncul
lingkungan proton yang tidak ekivalen. dalam spektrum 1H-NMR senyawa hasil
Geseran kimia δΗ muncul pada 8,70 ppm dan sintesis. Menurut teori proton metil muncul
7,78 ppm. Geseran kimia tersebut adalah khas pada geseran kimia 2,50 ppm dalam pelarut
untuk senyawa piridin. Kedua puncak tersebut DMSO terdeuterasi. Namun demikian
menggambarkan terdapat dua jenis proton 4- keberadaan gugus metil dalam “1,3-dihidroksi-
piridil. Selain itu juga terjadi pembelahan 2-(4-piridil)-4,5-dimetilimidazolina” hasil
puncak singlet menjadi puncak doblet akibat sintesis dapat dikuatkan dari spektrum IR
adanya kopling dengan inti tetangga. Tetapan senyawa tersebut.
kopling (Jab) dari kedua puncak doblet adalah
Pada δΗ 2,50 ppm muncul puncak mirip singlet
0,063 ppm (δΗ 8,70 ppm) dan 0,006 ppm (δΗ yang diduga sebagai puncak dari proton metin
7,78 ppm). Berdasarkan hasil analisis spektrum (CH). Menurut teori seharusnya proton C-H
1
H-NMR tersebut menunjukkan bahwa piridin (metin) muncul pada daerah geseran kimia 2,88
termonosubstitusi sehingga menyebabkan ppm sebagai puncak kuartet. Perbedaan puncak
perubahan hubungan geometrik piridin dari yang muncul dimungkinkan karena kecilnya
kondisi semula. interaksi (kopel) yang terjadi. Luas daerah di
Selanjutnya apabila dikaji lebih lanjut, geseran bawah puncak menunjukkan 3 proton
kimia C-H pada 8,70 ppm dan 7,78 ppm (seharusnya menunjukkan 2 proton). Walaupun
memberikan luas daerah di bawah puncak terdapat perbedaan jenis puncak dan luas
sebesar 0,27. Jika luas di bawah puncak ini daerah integrasi, namun nilai geseran kimia
dibandingkan dengan luas daerah di bawah pada daerah tersebut adalah masuk dalam
puncak yang lain maka diperoleh perbandingan rentang daerah geseran kimia untuk senyawa
0,27 : 0,99 : 0,19: 0,02 atau 4: 17: 3: 0,3. alifatik tersubstitusi (2–7,5 ppm). Namun
spektrum IR nya menunjukkan adanya metin medan atas (geseran diamagnetik) dari posisi
alifatik mengikat metil. Puncak yang sangat aslinya jika ada dalam larutan yang sangat
lemah muncul pada geseran kimia 1,3 ppm encer. Menurut teori geseran kimia proton
diduga merupakan proton hidroksil. Geseran hidroksil ada pada daerah 0,5-5,5 ppm.
kimia proton hidroksi tergantung pada pelarut
Berdasarkan analisis spektra UV, IR, dan 1H-
dan konsentrasi. Proton hidroksil akan
NMR maka senyawa III hasil sintesis secara
mengalami perubahan geseran kimia ke arah
bertahap dengan material awalnya nitroetana
OH
NHOH N
+ OHC N N
NHOH N
4-Piridilkarboksaldehida
OH
II III
Abstract
Lanthanum (III) ion selective electrode base ionophore 1,10-Diaza-4,7,13,16-
tetraoxacyclooctadecane-N,N’-diaceticacid was researched. Electrode was prepare with
inner solution system by the membrane composition contain active ionophore, anionicside
KTCPB, plasticizer NPOE and support matrix PVC. A good response (slope 19,93) is
produced and electrode can response with detection limit 3,92.10-6 M. The electrode can
measure lanthanum ion with a few interfering alkali, earth alkali and transition elements.
Keywords: Lanthanum ion-selective-electrode, PVC membrane, 1,10-Diaza-4,7,13,16-
tetraoxacyclooctadecane-N,N’-diaceticacid
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
902
th
Proceeding
Fax : +62 (22) 2504154, Homepage of The 6 ITB-UKM Joint Seminar
: http://www.chem.itb.ac.id/jschem, E-mail :on Chemistry
jschem@chem.itb.ac.id
Suyanta , Susanto I.R , Buchari , Indra Noviandri
are produce the same result. Application in using neutral bis (thiaalkylxanthato)alkanes,
potentiometry titration with ESI-La as working Anal Chem, 68, 366-378.
electrode is do it. The result of titration can see 6. Zolotov Xu A., (1997), Macrocyclic
in figure 5. Compound an Analytical Chemistry, John
Willey and Sons Inc, New York.
5. Conclusion
This work describe the study of potentiometry 7. Chang CA., Ochaya Ven O., (1986), Inorg
ion La-ISE with ionophore lariat diaza 18 Chem, 25, 355-358.
crown 6 in membrane electrode. This ISE is 8. Fabre B., Simonet J: Coordination
useful for measurement lanthanum ion with e Chemistry Reviews, 1998, 178-180, 1211-
few interfering alkali, earth alkali and 1250.
transition element. 9. Bakker E., Bulhman P., Pretch E., (1997),
6. References Carrier based ion selective electrodes and bulk
1. Houk, R.S., Fassel, F.A., Flesch, G.D., Svec optodes, ionophores for potentiometric and
H.J., (1980), Inductively coupled argon plasma optical sensors, Chem Rev, 3083-3132.
as an ion source for mas spectrometric 10. Gadzeppo VP., Christian GD., (1984),
determination of trace element, Analytical Determination of selectivity coefficients of ion
Chemistry, 52, 2283-2289. selective electrodes by a matched-potential-
2. Anonim, (1988), Analytical methode for method, Anal Chim Acta, 64, 279.
Atomic Absorption Spectrophotometer, AA100, 11. Umezawa Y., Umezawa K., Sato H., (1995),
New York: Perkin Elmer. Selectivity coefficients for ion selective
3. Masuda A., Nomura N., Tanaka T., (1973), electrode: recommended methods for reporting
Geochim Cosmochim Acta, 37, 239-245. KAB value, Pure Appl Chem, 67, 507.
4. Morf WE., Simon W., (1978), Ion Selective 12. Shamsipur M., Yousefi M., Ganzali M.R.,
Electrode in Analytical Chemistry, Freiser H (2000)., PVC Based 1,3,5-trithiane sensor for
Ed, Plenum, New York. cerium (III) Ions, Anal Chem , 72, 2391-1394.
5. Choudhury DA., Obata T. and Kamato S.,
(1996) Samarium (III) selective electrodes
Lampiran
Electrode of Ag/AgCl
Inner solution
Membrane
Voltmeter
Working Reference
electrode Electrode
KCl solution
Inner solution Raksa
Kalomel + KCl
Ag, AgCl
Glaswool
Membrane
KCl solid
140
120
100
E (mvolt)
80
60
40
20
0
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14
pH of solution
240
220
200
E (mVolt)
180 Ionophor 1
160 Ionophor 2
140
120
100
-9 -8 -7 -6 -5 -4 -3 -2 -1 0
- Log Concentration (M)
250
200 Na+
K+
Ca2+
emf (mvolt)
150
Mg2+
Zn2+
100
Pb2+
La3+
50 Cu2+
0
-7 -6 -5 -4 -3 -2 -1
Concentration (-log M)
Na+ 7,10.10-4
K+ 5,36.10-3
Ca2+ 2,94.10-4
Mg2+ 8,85.10-4
Zn2+ 3,24.10-4
Pb2+ 4,46.10-3
Cu2+ 1,99.10-2
*) Condition reference solution 1.10-7 M LaCl3, primary ion (A) 10-6 – 10-1 M La3+ and interfering ion
(B) 10-2 M Mn+
Isolasi dan Penentuan Struktur Senyawa dari Fraksi Aseton Talus Lichen Ramalina
Javanica Nyl
Suyanto1), Suwarso, W.P.2), Kosela, S.2), Suwito, H.1), Winiati, S.3), Dai4), Krohn, K.4)
1) Universitas Airlangga, Surabaya
2) Universitas Indonesia, Jakarta
3) Universitas Negeri Jakarta
4) Institute of Organic Chemistry, University of Paderborn, Germany
Abstrak
Penelitian ini bertujuan untuk mengisolasi dan menentukan struktur beberapa senyawa pada
ekstrak aseton talus lichen Ramalina Javanica Nyl. Isolasi dilakukan dengan kromatografi
kolom secara gradien pelarut n-heksana-EtOAc, kemudian diikuti dengan kromatografi lapis
tipis (KLT) preparatif secara berulang dengan eluen yang sama (17:1), sehingga diperoleh
senyawa murni. Struktur ditentukan secara spektroskopi UV, IR dan NMR dan diperoleh
senyawa derivat gliserol (1) dan derivat glikol (2).
Kata kunci: lichen, Ramalina Javanica Nyl, derivat gliserol, derivat glikol
908
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Suyanto, Suwarso, W.P., Kosela, S., Suwito, H., Winiati, S., Dai, Krohn, K
255, 268. IR (KBr, ν cm-1): 2922, 1736, 1647, adanya pita stretching C-O-C pada 1087 cm-1.
1151, 1087. Adapun puncak pada δ 3.52 dan 50.87 ppm
1 menunjukkan adanya gugus metoksi (-OMe).
H-NMR dan 13C-NMR tertera pada Tabel 1.
Puncak pada δ 31.57 dan 4.15 ppm
Senyawa (2) kristal merah muda titik leleh 128- menunjukkan gugus metilen yang terikat pada
130oC. Spektrum UV(λmaksnm, EtOAc): 262, atom oksigen dari gugus fungsi ester.
269. IR (KBr, ν cm-1): 2918, 2851, 2361, 1734, Sedangkan puncak pada δ 2.19 dan 60.36 ppm
1647, 1464, 1072. Data 1H-NMR dan 13C-NMR menunjukkan adanya gugus metilen yang
tertera pada Tabel 2. terikat karbonil (C=O), demikian juga δ 1.59
dan 22.63 ppm adalah gugus metilen alkana.
Pembahasan
Puncak pada 0.90 dan 21.00 ppm adalah gugus
Senyawa (1): Puncak pada δ 4.15 (q, 2H)
metil alkana. Dari pembahasan tersebut dapat
menunjukkan adanya gugus metilen yang
diduga bahwa senyawa (1) mempunyai
terikat pada atom karbon dan atom oksigen dari
struktur:
gugus fungsi ester. Adanya gugus metilen ini
diperkuat oleh adanya puncak pada δ 53.38 1' 1''
1
ppm, sedangkan gugus fungsi ester ditunjukkan CH 2 -O-CO-CH3
oleh pita pada spectrum IR 1736 dan 1647 cm-
1
. Adanya gugus ester didukung oleh data dari 2'
2
13
C-NMR pada δ 171.10 ppm yaitu atom CH -O-CH3
karbon kuarterner. Puncak pada δ 2.06 ppm (s, 3' 3'' 3''' 3''''
3H) adalah proton dari gugus metil yang 3
mengikat karbonil (C=O). Hal ini diperkuat
CH -O-CO-CH
2 -CH
2 -CH
3
2
oleh pita serapan IR pada 2922 dan 1151 cm-
1 (1)
serta puncak pada δ 30.9 ppm. Gugus metin
yang mengikat atom oksigesn muncul pada δ Senyawa (2):
3.69 dan 76.7 ppm. Hal ini juga diperkuat oleh Data H1-NMR dan C13-NMR tertera pada
Tabel 1. Pergeseran kimia proton dan karbon senyawa (1)
No at C δC (ppm) δH (ppm) Jumlah proton
1 53.38 4.15 2H
1’ 171.10 - -
1’’ 30.90 2.06 3H
2 76.70 3.69 1H
2’ 50.87 3.52 3H
3 31.57 4.15 2H
3’ 171.10 - -
3’’ 60.36 2.19 2H
3’’’ 22.63 1.59 2H
3’’’’ 18.40 0.90 3H
Tabel 2. 4. Kesimpulan
Puncak pada δ 4.15 (kwartet) dan δ 60.37 ppm Ekstrak fraksi aseton lichen Ramalina Javanica
menunjukkan adanya proton dari gugus metilen Nyl. Mengandung senyawa turunan gliserol
yang terikat atom O. sedangkan δ 2.19 dan δ yaitu 3-butanoil-2-metil-1-etanoil gliserol (1)
31.92 ppm menunjukkan adanya gugus metilen dan turunan glikol yaitu 2-heksanoil-1-metil
yang terikat pada CO ester. Hal ini diperkuat glikol (2)
oleh spectrum IR pada 1734 cm-1. Puncak pada 5. Ucapan Terima Kasih
δ 2.06 (triplet) dan δ 29.65 ppm menunjukkan Prof. K. Krohn dan Dr. Dai dari Institute of
adanya proton dari gugus metilen alkana. Organic Chemistry, University of Paderborn,
Demikian juga δ 1.64 dan 29.35 ppm, δ 1.31 Germany yang telah membantu pengukuran
dan δ 22.68 ppm adalah gugus metilen alkana. NMR.
Sedangkan δ 0.91 dan δ 21.02 ppm
Daftar Pustaka
menunjukkan adanya gugus metil alkana. Alvin, K.L. and Kershow, K.A., (1963), The
Adanya gugus metil dan metilen alkana ini Observer’s Book Of Lichen, Frederich Warnet Co
diperkuat oleh spectrum IR pada 2918 cm- Ltd, London.
1
.Puncak pada δ 29.69 ppm (dari DEPT)
Matsyech, S.,(1999), Sumber Daya Alam Sebagai
menunjukkan adanya atom karbon dari gugus Bahan Sintesis Senyawa Aktif Untuk Bahan Dasar
metilen yang terikat atom O. Hal ini diperkuat Industri Obat, Prosiding, Seminar Kimia Bahan
juga oleh adanya stretching C-O-C pada Alam, Jakarta.
bilangan gelombang 1072 cm-1. Puncak pada δ
Suwarso, W.P.; Gani, R.L., Krohn, K., John, M.,
3.51 (singlet) dan δ 50.87 ppm menunjukkan (1999), Eur.J.Org.Chem. 1719-1791.
adanya gugus metoksi (OCH3). Adanya gugus
ini diperkuat oleh bilangan gelombang yang William, D.H. and Flaming, I., (1995) Spectroscopic
muncul pada 2851 cm-1. Puncak yang paling Methods In Organic Chemistry, 5th Ed. Mc Graw
Hill Book Company London, Tokyo, Toronto.
downfield pada δ 171.10 ppm adalah puncak
dari atom karbon kuarterner (=C=O) adanya Winiati, S., (1999), Isolasi Dan Elusidasi Struktur
gugus ini diperkuat oleh bilangan gelombang Serta Penentuan Aktivitas Biologi Senyawa Kimia
pada 1734 cm-1. Dari pembahasan tersebut Dalam Fraksi Heksana Dan Aseton Dari Talus
dapat diduga bahwa senyawa (2) mempunyai Ramalina Javanica Nyl, Msi, Thesis, Program
Magister Ilmu Kimia Universitas Indonesia
struktur sebagai berikut:
1'
1
CH - O - CH 3
2
2 2' 2'' 2''' 2'''' 2''''' 2''''''
CH -O - CO - CH - CH - CH -CH - CH 3
2 2 2 2 2
Takashi Kamiyama
Abstract
The neutron powder diffraction is recognized as a powerful technique to clarify the
relationship between the crystal structures and the properties of functional materials. Its
application fields has been expanding in materials science. In the field, not only the limited
epoch-making experiments, but also a large number of ordinary experiments with diversity
and interdisciplinary approach would result in prominent scientific results. Brand-new
powder diffractometers (NPD’s), which appear or will soon appear in Europe, Australia, US
and Asian facilities, will be expected to exceed the present limit of application, and stimulate
the existing 60 NPD’s in the world. I will talk about the present materials science using
neutron powder diffraction. I will also talk about new Japanese NPD’s project, and then the
prospect of NPD’s impact.
th
Proceeding
Departement of Chemistry ITB, Jl.of The 6 10,ITB-UKM
Ganesha JointPhone
Bandung 40132, Seminar
: +62on Chemistry
(22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Tati Herlina, Agustono, Abdul Muis, Unang Supratman, Anas Subarnas, Supriyatna Sutardjo,
Syafruddin, dan Hideo Hayashi
Abstrak
Dalam penelitian berkelanjutan kami dalam pencarian senyawa antimalaria baru dari
tumbuhan Indonesia diperoleh hasil bahwa ekstrak metanol daun Erythrina variegata
menunjukkan aktivitas antimalaria yang signifikan terhadap pertumbuhan Plasmodium
falciparum secara in vitro. Ekstrak metanol dipisahkan komponen-komponennya dengan
kombinasi kolom kromatografi pada silika gel diperoleh suatu senyawa antimalaria. Struktur
kimia senyawa aktif ditetapkan berdasarkan data-data spektroskopi dan perbandingan data
dari senyawa yang berhubungan dari penelitian sebelumnya, dan diidentifikasikan sebagai
turunan triterpenoid pentasiklik, 3β -11α-28-trihidroksi-olean-12-en. Aktivitas antimalaria
senyawa 3β-11α-28-trihidroksi-olean-12-en memperlihatkan nilai IC50 0,243 µg/mL
terhadap pertumbuhan P. falciparum secara in vitro.
Kata kunci : Antimalaria, Erythrina variegata, Leguminosae, triterpeniod pentasiklik
30 29
19 20 21
12
18
HO 11 13 22
25 26
H
17 OH
1 9 14 28
2 16
10 8
H 15
5 27
4 7
HO 3
H 6
24 23
40,06; 2H), C-2 (δC 28,67; 2H), C-3 (δC 80,13; sebelumnya (Mathias, et al., 2000; Debella, et
H), C-4 (δC 43,22), C-5 (δC 56,37; H), dan C-24 al., 2000; Barreiros, et al., 2002; Okada, et al.,
(δC 16,28; 3H). Spektrum 1H NMR juga 2003; dan Tanaka, et al., 2003) struktur planar
memperlihatkan adanya penjodohan geminal dari senyawa aktif ditetapkan sebagai triterpen
pada geseran kimia kimia δH 1,92 triplet doblet pentasiksik 3β,11α, 28-trihidroksiolean-12-en.
( J = 13,6; 4,3; 1H-1) dengan proton pada δH Aktivitas biologis senyawa 3β-11α-28-
1,16 dobel doblet (J = 13,6; 4,3; 1H-1) yang trihidroksi-olean-12-en memperlihatkan nilai
mengalami penjodohan visinal dengan proton IC50 0,243 µg/mL terhadap pertumbuhan P.
pada geseran kimia δH 1,76 dobel doblet ( J = falciparum secara in vitro.
13,6; 6,8 Hz; 1H-2) dan proton pada geseran
kimia δH 1,45 triplet doblet ( J = 12,8; 3,3 Hz; 5. Ucapan Terima Kasih
Penulis mengucapkan terima kasih kepada :
1H-6) yang mengalami penjodohan visinal
dengan proton pada geseran kimia δH 1,48 1. Direktorat Jenderal Pendidikan Tinggi atas
dobel doblet (J = 8,4; 3,3 Hz; 1H-7), yang dana yang diberikan melalui Hibah Penelitian
merupakan karakteristik dari proton yang Tim Pascasarjana (Hibah Pasca) Tahun
berada pada cincin A dan B senyawa Anggaran 2004.
13
triterpenoid. Spektrum C-NMR
2. Dr. Tomoyuki Fujita dan Dr. Kohki
memperlihatkan adanya 30 signal yang terdiri
Akiyama pada Laboratory of Natural Products
dari 28 atom karbon sp3 dan 2 atom karbon sp2.
Chemistry, Division of Applied Biological
Dari ke-30 signal tersebut, terdapat 7 atom
Chemistry, Graduate School of Agriculture and
karbon metilen, 10 atom karbon etilen, 6 atom
Life Sciences, Osaka Prefecture University,
karbon metin dan 7 atom karbon kuartener.
Osaka, Japan atas pengukuran spektra NMR.
Tujuh atom karbon kuartener pada senyawa
merupakan karakteristik untuk kelompok 3. PT. Biofarma (Persero) Bandung, dan
senyawa triterpenoid dengan kerangka struktur Lembaga Eijkman, Jakarta atas pengujian
pentasiklik (Nakanisi, et al., 1974). Diantara aktivitas biologis.
ke-30 signal tersebut terdapat tiga atom karbon
6. Daftar Pustaka
teroksigenasi pada geseran kimia δC 80,13 (C-
Atamini, F. Tiga senyawa baru cassanefurano
3), 75,56 (C-11) dan 64,61 (C-28) dan satu
diterpen hasil isolasi dari daging biji Bogore
pasang atom karbon rangkap dua pada geseran
(Caesalpinia erista L.), asal Sulawesi Selatan
kimia δC 122,44 (C-12) dan 144,85 (C-13) yang
sebagai bahan dasar obat antimalaria, Sci. &
khas untuk atom karbon-12 (13) senyawa
Tech. 2001, 2, 1, 12-24.
triterpen pentasiklik golongan olean.
Berdasarkan data-data spektra di atas dan data- Barreiror, M.L.; David, J.M.; Pereira, P.A.;
data yang telah diperoleh pada penelitian Maria L.S. and david J.P. Fatty acid esters of
triterpenes from Erythroxylum passerium, J. Okada, Y.; Ayako, M. and Toru, O. A new
Braz. Chem. Soc. 2002, 13, 5, 387-399. triterpenoid isolated from Lagerstronemia
speciosa (L.) Pers. Chem. Pharm. Bull. 2003,
Bhattacharjer, A.K.; Karle, J.M. Chem. Res.
51, 4, 452-454.
Toxicol. 1999, 12, 422-428.
Sato, M.; Tanaka, H.; Fujiwara, S.; Hirata, M.;
Cole, A.R.H. and Thornton, D.W. Infrared
Yamaguchi, R.; Etoh, H.; Tokuda, C.
spectra of natural products, Part III: the
Antibacterial property of isoflavonoids isolated
identification and location of ethylenic double
from Erythrina variegata against cariogenic
bonds in pentacyclic triterpenoids, J. Chem.
oral Bacteria, Phytomedicine, 2003,10, 5, 427-
Soc. 1957, 57, 1, 1332-1338.
433.
Chawla, A.S.; Krishnan, T.R.; Jackson, A.H.;
Saxena, S.; Neerja, P.D.C. and Bhakuni, R.S.
Scalabrin, D.A. and Stuttgart, W.G. Alkaloidal
Antimalarial Agents from Natural Sources,
constituents of Erythrina variegata bark,
Current Science, 2003, 85, 9, 1314-1329.
Planta medica, 1988, 54, 6, 526-528.
Shulman, S.T.; John, P.D. and Herbert, M.S.
Debella, A.; Haslinger, E.; Martin, G.S.; Bucar,
Dasar Biologi dan Klinis Penyakit Infeksi,
F., Abebe, D. And Kunert, O. Triterpenoid
1992, Penterjemah, Soeprapto S.; Gadjah Mada
saponins and sapogenin lactones from Albizia
University Press, Yogyakarta, Indonesia.
gummifera, Phytochemistry, 2000, 53, 885-892.
Snow, R.W.; Craig, M.H.; Dechman, U. and
DepKes, Parameter Standar Umum Ekstrak
Lesueur, D. Parasitol. Today,1999, 15, 99,.
Tumbuhan Obat, Jakarta, 2000, 10-11.
Tanaka, H.; Etoh, H.; Shimizu, H.; Makita, T.
Heyne, K. Tumbuhan Berguna Indonesia, Jilid
and Tateishi Y. Two new isoflavonoids from
II, 1987, Balai Kehutanan Indonesia.
Erythrina variegata, Planta Med.; 2000, 66, 6,
Kitagawa, I.; Mahmud, T.; Simanjuntak, P.; 578-579.
Hori, K.; Uji, T. and Shibuya, H. Dehatrine, an
Tanaka, H.; Hirata, M.; Etoh, H.; Shimizu, H.;
antimalarial bisbenzylisoquinoline alkaloid
Sako, M.; Murata, J.; Murata, H.; Darnaedi, D.
from the the Indonesian medicinal plant
and Fukai, T. Eryvarins F and G, two 3-
Belischmiedia madang, isolated as a mixture of
phenoxychromones from the roots of Erythrina
two rotational isomers. Chem. Pharm. Bull.
variegata, Phytochemistry, 2003, 62, 8, 1243-
1993, 41, 997–999.
1246.
Mathias, L.; Ivo, J.C.; Vieira, R.B. and Edson,
Trigg, P.I. and Kondrachine A.V. The Current
R.F. A New pentacyclic triterpene iIsolated
Global Malaria Situation, In Irwin W. Sherman,
from Myroxylon balsamum (syn. Myroxylon
Malaria Parasite Biologi, Phatogenesis and
peruiferum), J. Braz. Chem. Soc. 2000, 11, 2,
Protection, ASM Press, Washington, DC, 1998,
195-198.
11-22.
Mursito, B. Ramuan Tradisional untuk
Wernsdorfer, W.H. Epidemology of drug
Penyakit Malaria, Cetakan Pertama, Penebar
resistence in malaria, Acta. Trop.; 1994, 56,
Swadaya, Jakarta, 2002.
143-156.
Nakanisi, K.; Toshiro, G.; Ito, S.; Natori, S. and
Shigeo, N. Natural Product Chemistry, 1974, 1.
Abstrak
Telah dilakukan isolasi suatu senyawa limonoid, aphanamixin dari ekstrak n-heksana kulit
batang tumbuhan Aphanamixis polystachya (WALL) R. N. Parker (MELIACEAE). Identifikasi
struktur dilakukan berdasarkan data spektroskopi (UV, IR, 1H-NMR, dan 13C-NMR) serta
membandingkannya dengan data literatur untuk senyawa yang bersangkutan.
Kata kunci : Aphanamixis polystachya, Limonoid, Meliaceae
Rf-nya digabung dan selanjutnya dipisahkan gugus alkohol alifatik (-C-OH) pada daerah
melalui kromatografi kolom gravitasi dan tekan 1248,2 cm-1.
secara berulangkali hingga menghasilkan suatu
Berdasarkan data literatur spektrum 13C-NMR
fraksi yang menunjukkan satu spot. Terhadap
untuk sejumlah senyawa limonoid yang telah
fraksi ini, setelah diuapkan selanjutnya
berhasil diisolasi dari sejumlah tumbuhan
direkristalisasi dan diperoleh suatu kristal putih
Meliaceae, sebagaimana yang telah dilaporkan
sebanyak 76 mg. Terjadinya perubahan warna
(Mulholland et al,. 1999) dan dengan tetap
jingga dengan penambahan pereaksi
mempertimbangkan pengetahuan
Liebermann-Buchard terhadap sedikit kristal
kemotaksonomi dari tumbuhan tersebut, maka
ini, menunjukkan adanya suatu senyawa
dapat diketahui bahwa spektrum 13C-NMR
terpenoid (limonoid).
senyawa isolat banyak memperlihatkan
Data spektrum UV senyawa isolat dengan sejumlah sinyal yang tidak berbeda jauh
pelarut n-heksana menunjukkan adanya serapan (mendekati) dengan kerangka dasar suatu
pada daerah 290 nm. Daerah serapan demikian limonoid, aphanamixin yang diisolasi dari
menunjukkan adanya kromofor ikatan rangkap tumbuhan yang sama.
terkonjugasi pada senyawa isolat tersebut, yaitu
Kemiripan data 13C-NMR senyawa isolat ini
unit struktur dari furano. Penambahan pereaksi
juga didukung dengan pemunculan sejumlah
NaOH tidak mengalami pergeseran yang
sinyal pada spektrum 1H-NMR yang juga
signifikan berarti tidak ada kromofor -OH
dimiliki pada spektrum 1H-NMR dari
fenolik yang bersifat asam.
aphanamixin (Chatterjee et al.,1970). Selain itu
Data spektrum IR senyawa ini menunjukkan sinyal dari spektrum 1H-NMR senyawa isolat
adanya gugus karbonil lakton (COO-) di daerah juga memberikan 1 gugus AcO- singlet pada δ
1704,4 dan 1736,2 cm-1, gugus -OH pada 2,70 (3H) dan gugus –OH singlet pada δ 3,18
daerah 3435 cm-1, vibrasi ulur –CH di daerah (1H). Sayangnya, data spektrum lengkap 1H-
2950,4 dan 2878,4 cm-1 [dapat sebagai gugus dan 13C-NMR dari aphanamixin tidak
metil (CH3), metilen (-CH2-), ataupun metin (- dilaporkan.
CH-)], ikatan rangkap karbon-karbon (-C=C-)
Berikut adalah data spektrum 1H- dan 13
C-
pada daerah 1653,1 – 1460,6 cm-1, dan adanya
Tabel : Data Spektrum 1H- dan 13C-NMR (δ ppm, CDCl3) Senyawa Isolat
1 13 1 13
No. H-NMR C-NMR No. H-NMR C-NMR
C senyawa isolat senyawa isolat C senyawa isolat senyawa isolat
1 0,84 12,8 10 - 38,5
2 0,97 12,9 11 - 40,5
3 1,01 18,9 12 - 45,4
4 1,27 23,3 13 - 46,6
5 1,30 23,8 14 - 53,8
6 1,31 26,2 15 - 78,4
7 1,32 27,4 16 - 118,1
8 2,07 28,5 17 - 145,8
9 3,18 36,6
O
O
23
OH 21
22
18 20
12
11 17
13
1 19 16
14
9 8
2 15
10
3 30
4 7
5
OAc 6
28 29
Aphanamixin
NMR senyawa isolat, sebagaimana dapat kepada staf Herbarium Bogoriense, LIPI,
dilihat pada tabel 1. Bogor, yang telah membantu mengidentifikasi
spesimen tumbuhan tersebut.
Dari spektrum pada sejumlah data tersebut
diatas dapat disimpulkan bahwa senyawa hasil 6. Daftar Pustaka
isolasi adalah aphanamixin, yang struktur Barneji B., Nigam S.K., (1984). Wood Constituent
lengkapnya dapat disajikan berikut. of Meliaceae : a review. Fitoterapia. LV. 3-36.
Biswas K., Chattophadhyay I., Banerjee R.K.,
4. Kesimpulan Bandyophadayay U., (2002). Biological Activities
and Medicinal Properties of Neem (Azadirachta
Studi fitokimia terhadap tumbuhan A.
indica). Current Science. 82 (11). 1336-1345.
polystachya telah dilakukan dan dari penelitian
ini telah berhasil ditemukan suatu senyawa Castellanos L., Correa R.S.D., Martinez E.,
limonoid, aphanamixin. Jenis senyawa Calderon J.S., (2002). Oleanane Triterpenoids from
limonoid ini merupakan komponen utama yang Cedrela montana (Meliaceae). Z. Naturforsch. 57c.
575-578.
terdapat di hampir kebanyakan tumbuhan
Meliaceae dan implikasinya akan banyak Chatterjee A., Kundu A.B., Chakrabortty T.,
ditemukan senyawa jenis limonoid lainnya dari Chandrasekharan S., (1970). The Stucture and
spesies tersebut serta dua spesies Meliaceae Stereochemistry of Aphanamixin and
berikutnya, seperti Khaya senegalensis, Aglaia Aphanamixinin. Tetrahedron Vol. 26, pp. 1859-
1867.
odorata, dan Sandoricum ketjapi, yang kini
sedang dalam proses penelitian kelompok Connolly J.D., Okorie D.A., de Wit, D.L., Taylor,
kami. D.A.H., (1976). Struktur of Dregeanin and
Rohitukin. Chem.Comm., 909.
5. Ucapan terima kasih
Terima kasih disampaikan kepada staf Kebun Mulholland D.A. dan Naidoo N., (1999). Limonoids
Percobaan Carita Banten, Jawa Barat yang from Aphanamixis polystachya. Phytochemistry. 51.
927 – 930.
telah menyediakan bahan tumbuhan yang
dibutuhkan. Terima kasih disampaikan pula
Kopolimerisasi Cangkok Asam Akrilat Pada Serat Rayon Dengan Teknik Pra-
irradiasi Peroksida
1) Puslitbang Isotop dan Radiasi, BATAN, Jalan Cinere Pasar Jum’at, Jakarta Selatan 12070, Indonesia
e-mail: titapus2000@yahoo.com
2) Departemen Kimia, FMIPA, Universitas Indonesia, Depok 16424, Indonesia
Abstrak
Kopolimerisasi cangkok atau grafting adalah suatu metoda yang banyak dilakukan untuk
memodifikasi suatu polimer sehingga memiliki sifat baru yang berbeda dari polimer asalnya.
Teknik grafting yang diinduksi oleh radiasi ada dua macam yaitu simultan (polimer dan
monomer diiradiasi secara bersamaan dalam keadaan vakum) dan pra-irradiasi (polimer
diiradiasi terlebih dahulu dalam keadaan vakum atau dalam media udara, kemudian
direaksikan dengan monomer dalam keadaan vakum atau dalam atmosfer nitrogen). Pada
penelitian ini digunakan teknik pra-irradiasi peroksida (polimer diiradiasi dalam media
udara) karena prosesnya sederhana. Serat rayon digrafting dengan menggunakan monomer
asam akrilat yang telah dilarutkan dalam H2O : methanol (90:10) dengan berbagai
konsentrasi. Irradiasi dilakukan dengan menggunakan irradiator sinar gamma (Co-60) dalam
media udara dengan variasi total dosis dan laju dosis. Grafting dilakukan dalam atmosfer N2.
Deaerasi awal terhadap pelarut air dapat menurunkan kadar oksigen terlarut sampai dengan
27% dan menaikkan persentase grafting sebanyak 24% – 68%, serta meningkatkan
kebolehjadian grafting yang dihasilkan. Persentase grafting meningkat dengan meningkatnya
laju dosis serta meningkatnya total dosis sampai batas tertentu. Penambahan volume atau
peningkatan rasio monomer AAc terhadap rayon tidak menyebabkan proses berjalan lebih
efisien walaupun persentase grafting meningkat. Temperatur dan waktu optimal proses
grafting adalah 45oC dan 45 menit.
Kata kunci: Asam akrilat; Kopolimerisasi cangkok; Pra-Irradiasi peroksida; Rayon
500 40
35
400
30
Grafting (%)
Effisiensi (%)
300 25
20
200
15
Tanpa deaerasi
100 10 AAc 30%
Deaerasi
0 5 AAc 40%
0 5 10 15 20 0
0 10 20 30
Dosis Serap (kGy)
Vol u m e l aru tan AAc (m l )
Gambar 1. Pengaruh deaerasi H2O dalam sistem
Gam bar 2. Pe n garu h vol u m e l aru tan AAc
pelarut terhadap persen grafting te rh adap e fi si e n si grafti n g
iradiasi awal peroksida, dalam percobaannya ia yang mengakibatkan semakin besar pula persen
menyimpulkan bahwa pada saat radiasi dalam grafting yang dihasilkan.
media udara, selain radikal bebas yang ada
Selain besarnya persen grafting, sifat fisik
dalam fasa amorfos (berubah menjadi
substrat polimerpun harus diperhatikan. Dosis
peroksida) dan radikal yang terjebak dalam fasa
radiasi yang tinggi dapat memicu terjadinya
kristalin, terbentuk pula radikal yang terjebak
degradasi pada serat rayon, hal ini dibuktikan
pada interfase diantara daerah kristal dan
pada dosis radiasi 12 kGy sifat fisik serat rayon
amorfos. Radikal yang terakhir ini memegang
menurun yang ditandai dengan merapuhnya
peran yang penting pada saat proses grafting
serat. Dosis optimal adalah 10 kGy dengan laju
(Jianqin, 1999). Karena rayon memiliki
dosis 4 kGy/j, hasil ini yang digunakan untuk
kristalinitas yang tinggi maka semakin kecil
proses selanjutnya.
laju dosis yang digunakan kemungkinan
semakin banyak radikal yang terjebak dalam Pengaruh konsentrasi dan volume larutan
fasa kristalin semakin besar, hal ini ditunjukkan monomer
pula pada gambar 2. dimana kadar Gambar 2. menunjukkan penggunaan larutan
pencangkokan yang dihasilkan pada laju dosis AAc 40 % menghasilkan persen grafting yang
2 kGy/j dan 4 kGy/j tidak memperlihatkan lebih besar daripada larutan AAc 30%.
perbedaan yang nyata dibandingkan dengan Efisiensi grafting pada konsentrasi 30% tidak
laju dosis 10 kGy/j. Pada laju dosis yang tinggi menunjukkan perbedaan yang nyata dengan
(10 kGy/j) kemungkinan terbentuknya radikal 40%. Meningkatnya konsentrasi monomer
bebas yang terjebak dalam fasa kristalin kecil, menyebabkan meningkatnya difusi monomer
sehingga radikal bebas yang berubah menjadi ke dalam matriks polimer sehingga probabilitas
peroksi dan radikal yang terjebak didalam tumbukan antara molekul monomer dan radikal
interfase amorfos-kristalin semakin banyak polimer semakin banyak sehingga persen
sebagai Penukar Ion . Thesis Magister, Jurusan Rekso G.T., Ichsan E.A. (1998). Radiation Graft
Kimia, Universitas Indonesia. Copolymer of Acrylamide onto Polypropylene
Fibers for Metal Uptake . Radiation Technology for
Chapiro A. (1962). Radiation Chemistry of
Conservation of The Environment. IAEA-
Polymeric Systems, John Wiley&Sons, New York.
TECDOC-1023 . 585-594.
Jianqin Liu, Maolin Zhai, Hongfei Ha, (1999). Pre-
irradiation Grafting of Temperature Sensitive Soebianto Y., Yoshii F., Makuuchi K., Ishigaki I.,
Hydrogel on Cotton Cellulose Fabric, Radiation (1987). Radiation Grafting of Hydrophilic
Physics and Chemistry 55. 55-59. Monomers onto Poly(4-Methylpentene-1), I . Die
Angewandte Makromolekulare Chemie 149. 87-99.
Pemetaan air masin dengan teknik geokimia air tanah di sekitar kolam ternakan
udang harimau, Kerpan Kedah
Umar Hamzah
Program Geologi
Pusat Pengajian Sains Sekitaran & Sumber Alam
Fakulti Sains & Teknologi
Universiti Kebangsaan Malaysia
43600 Bangi, Selangor, Malaysia
e-mail: aiman9@yahoo.com
Abstrak
Analisis air yang diekstrak dari tanah telah dilakukan terhadap 85 sampel tanah yang
dipungut secara grid di kawasan ternakan udang harimau di Kerpan. Sampel tanah diauger
pada kedalaman 2m bermula dari garis pantai sehingga 20 km kearah daratan. Dengan
analisis geokimia air telah diperolehi kepekatan beberapa anion dan kation seperti Kalium,
Naterium, Kalsium, klorida, sulfat dan bikarbonat disamping jumlah pepejal terlarut. Hasil
analisis kepekatan pepejal terlarut menunjukkan sempadan air masin adalah di sekitar 1 km
dari tepi laut manakala mengikut analisis kepekatan klorida, sempadan tersebut terletak
dalam lingkungan 4-6 km. Bentuk sempadan zon air masin pada peta kepekatan klorida dan
Kalsium menunjukkan kemasinan tersebut dipengaruhi terutamanya oleh faktor infiltrasi
daripada kolam ternakan udang dan terusan yang bersambung daripada laut ke dalam
kawasan kajian.
926
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Umar Hamzah
positioning system). Sampel tanah diambil sekitar 650 mg/l. Berdasarkan Davies dan
menggunakan auger tangan dari kedalaman DeWiast (1966) juga, kepekatan Kalsium
1.5-2.0 m. Sampel tersebut seterusnya dalam air laut ialah 400 mg/l. Oleh kerana
dikeringkan di makmal selama beberapa hari unsur Kalsium boleh juga disumbangkan
pada suhu bilik. Setelah kering, sampel tanah daripada sisa-sisa cangkang hidupan laut yang
tersebut dihancurkan dengan lesung tangan dan berada dalam lempung lautan kuno yang
pengetuk yang dibuat daripada plastik. Tanah dianggarkan menganjur dari 6-8 kilometer dari
yang telah dihancurkan diayak dengan pantai ke pendalaman, taburan lengkung
pengayak bersaiz 355 µm. Serbuk hasil ayakan Kalsium tidak boleh digunakan untuk
dicampur dengan air suling sehingga tepu dan menentukan kadar intrusi dan larut lesap air
diisi ke dalam botol kedap udara selama 24 laut moden. Taburan Magnesium tidak
jam. Untuk mengekstrak air daripada tanah, menunjukkan sebarang tren dan purata nilai
kuantiti sampel serbuk yang diperlukan ialah maksimum hanya disekitar 200 mg/l. Nilai ini
300 gram untuk dicampurkan dengan air suling adalah agak jauh berbanding dengan jumlah
sebelum diekstrak. Air yang diekstrak kandungan Magnesium dalam air laut iaitu
kemudiannya dianalisis dengan bantuan disekitar 1272 mg/l. Rajah 4 menunjukkan peta
peralatan makmal menurut prosedur taburan kepekatan unsur-unsur Kalium,
konvensional. Jumlah pepejal terlarut Naterium, Kalsium dan Magnesium di kawasan
ditentukan dengan alat konduktiviti/TDS kajian yang menunjukkan tren tipikal pengaruh
manakala alat Spectrophotometer UV-100-01 air laut dan lempung samudera. Kepekatan
digunakan untuk menganalisis kepekatan bertambah besar di kawasan yang berhampiran
klorida dan sulfat. Alat Spektrometer serapan dengan pantai.
atom (AAS) pula digunakan untuk menghitung Laporan yang diberikan dalam WHO (1971)
kepekatan Kalsium dan Magnesium manakala menyatakan bahawa kandungan Klorida boleh
alat Fotometer Nyalaan Api (FP) digunakan wujud dalam tanah oleh proses luluhawa batu
untuk menganalisis Kalium dan Naterium. dasar, resapan bahan evaporit, infiltrasi air laut,
Penentuan Bikarbonat dibuat melalui teknik penyejatan air laut, pembuangan air daripada
penitratan. sektor perindustrian dan kebocoran salur
3. Hasil dan pembahasan pembuangan. Berdasarkan nilai Klorida juga
Rajah 3 menunjukkan taburan unsur-unsur air boleh dikelaskan kepada air tawar, air payau
Kalsium, Kalium, Magnesium dan Naterium di dan air masin dimana air tawar mengandungi
sepanjang garis rintisan daripada tepi laut Klorida kurang dari 250 mg/l manakala air
hingga ke bahagian pendalaman. Kecuali unsur masin menunjukkan nilai Klorida melebihi
Magnesium, taburan unsur-unsur lain 1000 mg/l. Cerapan yang dilakukan
menunjukkan trend pertambahan kepekatan ke menunjukkan sampel-sampel yang diperolehi
arah laut dan pengurangan kepekatan ke arah dalam jarak 3 kilometer ke arah pantai
pendalaman. Lengkung taburan Kalium dan menunjukkan nilai kepekatan Klorida melebihi
Naterium menunjukkan trend yang hampir 1000 mg/l. iaitu termasuk dalam kategori zon
sama iaitu peningkatan kepekatan secara air masin (Rajah 5). Sampel yang diambil dari
mendadak pada kedudukan lokasi kurang lokaliti yang lebih jauh dari 3 kilometer
daripada 2 km dari pantai. Pada jarak ini termasuk dalam kategori payau dan tawar.
kepekatan Naterium dan Kalium masing- Sumber kemasinan dianggarkan daripada
masing dalam lingkungan 1000-3000 mg/l dan intrusi dan sejatan air laut yang berhampiran.
100-600 mg/l. Berdasarkan Davies dan Oleh kerana kontur kepekatan klorida yang
DeWiast (1966), nilai Naterium dan Kalium air bernilai 1000 mg/L tidak berbentuk selari
laut ialah disekitar 10560 mg/l dan 380 mg/l. dengan pantai tetapi berbentuk memanjang
Oleh itu dapat disimpulkan bahawa kawasan kearah daratan, ada kemungkinan faktor
yang berjarak kurang daripada 2 km daripada kemasinan disumbangkan oleh kolam ternakan
pantai besar kemungkinan telah mengalami udang yang menggunakan air laut. Air laut
penerobosan atau infiltrasi air laut. Manakala akan meresap di sekitar kolam tersebut dan
lengkung taburan Kalsium menunjukkan masuk ke dalam lempung serta menambahkan
peningkatan kepekatan dari pantai sehingga 6 kemasinan lempung tersebut. Fenomena ini
kilometer ke daratan dengan nilai maksimum di tidak kelihatan pada peta taburan anion yang
lain. Lengkung sulfat pula menunjukkan pola
yang berlawanan berbanding dengan Klorida daripada kolam ternakan udang yang
dimana pertambahan kepekatan dicerap di mengepam air laut sebagai media ternakan.
kawasan yang jauh daripada pantai. Kepekatan Kontur pertambahan kepekatan Kalsium di
di kawasan berhampiran pantai hanya disekitar sekitar kolam membuktikan faktor resapan air
1000-2000 mg/l dan meningkat menjadi lebih laut ke kawasan sekitar kolam. Tren kontur
besar dari 10000 mg/l pada jarak 8 kilometer yang sama diperhatikan pada taburan klorida
dari pantai. Pertambahan kepekatan sulfat di untuk menunjukkan wujudnya resapan air laut
kawasan pendalaman mungkin dipengaruhi menerusi kolam ternakan udang. Kepekatan
oleh aktiviti pembajaan dalam pertanian. klorida bertambah di sekeliling kolam ternakan
Lengkung taburan Bikarbonat tidak udang. Faktor resapan air laut menerusi kolam
menunjukkan sebarang tren dan berkepekatan ternakan tidak dapat dilihat berdasarkan peta
dalam julat diantara 0-400 mg/l. Kepekatan taburan jumlah pepejal terlarut, bikarbonat dan
Bikarbonat besar kemungkinan disumbangkan sulfat.
oleh batu dasar di kawasan kajian yang terdiri
5. Ucapan terima kasih
daripada batu kapur. Rajah 6 menunjukkan peta
Setinggi penghargaan diberikan kepada UKM
taburan Klorida, Sulfat dan Bikarbonat di
yang telah menyediakan gran penyelidikan
kawasan kajian dimana zon air masin, payau
untuk pelajar prasiswazah Yong Cheng Yeu
dan tawar dapat dikategorikan dengan baik
yang membolehkan beliau mengumpul dan
berdasarkan peta Klorida. Peta Bikarbonat
memproses sampel di lapangan dan makmal.
tidak menunjukkan sebarang tren manakala
peta taburan Sulfat juga tidak boleh digunakan 6. Daftar Pustaka
untuk pengezonan kemasinan air tanah. Samsudin A.R., Hamzah U., Rafek A.G., Haryono.
J., (1997). Salinity mapping of coastal groundwater
Pentafsiran yang dibuat mengenai cerapan aquifers using hydrogeochemical and geophysical
kepekatan pepejal terlarut dalam sampel air methods: A case study of North Kelantan.
tanah di kawasan kajian dibuat berdasarkan Proceedings of International Symposium on
pengelasan Davies dan DeWiast (1966) dan Integrated Coastal & marine Resource Management.
Philbert (1982). Air masin mengandungi Malang, Indonesia. Page 154-160.
kepekatan pepejal terlarut yang berjulat 10000- Davies, S.N. and DeWiast, R.J.M., (1966).
100000 mg/l manakala air tawar mengandungi Hydrogeology. John Wiley & Sons, Inc., New York,
kepekatan pepejal terlarut kurang daripada hal. 463
1000 mg/l. Cerapan analisis menunjukkan Hamzah U., Samsudin A.R., Mohamad I.C., (2002).
kebanyakan rintisan menunjukkan nilai Salinity mapping of coaastal groundwater aquifer by
kepekatan yang amat tinggi berhampiran surface geoelectrical methods: Case studies at Kuala
dengan pantai dan berkurang ke arah daratan. Selangor and Nenasi, Pahang. Proceedings of
Julat nilai kepekatan pepejal terlarut mencapai Malaysian Science & Technology Congress,
43350 mg/l dalam lingkungan 1 kilometer dari Symposium A, Johor Bharu. Page 232-243.
pantai. Zon air tawar pula terletak pada jarak 16 Mustafa M., (2002). Kajian keberintangan
kilometer daripada pantai. Rajah 6 geoelektrik dan geokimia di kawasan Kerpan,
menunjukkan taburan zon air masin Sanglang, Kedah, Disertasi sarjana muda,
berdasarkan kepekatan pepejal terlarut dimana Departemen Geologi, Universiti Kebangsaan
zon air masin terletak pada jarak 1 kilometer Malaysia.
dari pantai dan air tawar terletak pada jarak 16 Sapari N., Awang M. N., (1996). Alluvial aquifer: A
kilometer dari pantai. threatened water resource. Prosiding Seminar
4. Kesimpulan Geologi dan Sekitaran: Impak dan Pengauditan, hal.
Hasil kajian menunjukkan taburan unsur-unsur 85-104
Kalium, Naterium dan Kalsium mempunyai Philbert, F.J., (1982). Major ions. Dlm Jon,
perkaitan yang rapat dengan air laut dimana C.S.N(Ed). Chemical analysis of inorganic
kepekatan unsur-unsur tersebut yang teresap constituents of water. Page 69-128. United States of
dalam sampel lempung menunjukkan tren America:CRC Press, Inc.
peningkatan kepekatan ke arah laut. Kepekatan Soed S.B., (2002). Kajian geologi dan
unsur Kalsium yang disukat dalam sampel keberintangan duga dalam geoelektrik di kawasan
lempung pula boleh disimpulkan sebagai Kerpan-Ayer Hitam, Jerlun, Kedah. Disertasi
indikator kepada wujudnya resapan air laut
sarjana muda, Departemen Geologi, Universiti Yeu, Y. C., (2003). Pemetaan zon air masin, air
Kebangsaan Malaysia. payau dan air tawar serta pengelasan air tanah
dengan kaedah analisis kimia air di kawasan
WHO.,( 1971). International standards for drinking
Kerpan, Kedah Darul Aman.Disertasi sarjana muda,
water. Ed. Ke-3. Geneva: WHO
Departemen Geologi, Universiti Kebangsaan
Malaysia.
LAMPIRAN
Tha iland
Perlis
6° Kangar 6°
25’ 25’
Kawa san
Selat kajia n
Melaka
Kedah
0 8 16 km Alor Setar
6° 6°
05’ 05’
100° 00’ 100° 15’ 100° 30’
Perlis U
X
X X
X
X X
X
06° X X 06°
X 20’
20’ X
X X
X
X X
X X
X X
X X
X X X
X X X
X X X
X X X
X X X
X X X
X X X X
X X
X X X X
X
X X X X
X X
X
X X X X
06° X X 06°
X X
15’ X X 15’
X X
X X
X X
X X X
X
X X
X
X
Kedah
Selat Melaka
Petunjuk:
2+
Graf Kepekatan Ca bagi Stesen-stesen Pensampelan. Graf Kepekatan K+ Bagi Stesen-stesen Pensampelan.
800 600
700
500
600
400
A
Kepekatan (mg/l)
500 A
Kepekatan (mg/l)
B B
C C
400 D 300 D
E E
F F
300 G G
200
200
100
100
0 0
0 2 4 6 8 10 12 14 16 18 20 0 2 4 6 8 10 12 14 16 18 20
Jarak dari pantai (km)
Jarak dari pantai (km)
(Ca) (K)
2500
2000
2000
A
Kepekatan (mg/l)
B
A
Kepekatan (mg/l)
1500 C
B
1500 D
C
E
D
F
E
G
1000 F 1000
G
500
500
0
0 0 2 4 6 8 10 12 14 16 18 20
0 2 4 6 8 10 12 14 16 18 20 Jarak dari pantai (km)
Jarak dari pantai (km)
(Na)
(Mg)
Rajah 3: Taburan unsur-unsur Ca, K, Na dan Mg di sepanjang garis rentasan
6.38 6.38
6.36 6.36
6.34 6.34
2500.00
400.00
6.32 6.32
2000.00
300.00
6.30 6.30
1500.00
6.24 6.24
50.00 200.00
6.22 6.22
-50.00 0.00
100.20 100.22 100.24 100.26 100.28 100.30 100.32 100.34 100.36 100.38 100.40 100.20 100.22 100.24 100.26 100.28 100.30 100.32 100.34 100.36 100.38 100.40
(K) ( Ca )
6.38
6.38
6.36
6.36
6.34
6.34
400.00 2000.00
6.32
6.32
6.30 1600.00
6.30
100.00
6.28 1200.00
6.28
6.22 6.22
-50.00 -1000.00
100.20 100.22 100.24 100.26 100.28 100.30 100.32 100.34 100.36 100.38 100.40 100.20 100.22 100.24 100.26 100.28 100.30 100.32 100.34 100.36 100.38 100.40
( Na ) ( Mg )
Graf Kepekatan TDS Bagi Stesen-stesen Pensampelan Graf Kepekatan Cl- Bagi Stesen-stesen Pensampelan
15 3000
14
2750
13
2500
12
11 2250
10 2000
A A
Kepekatan (mg/l)
Kepekatan (g/l)
9 B B
1750
8 C C
D 1500 D
7 E E
6 F 1250
F
G
5 1000 G
4
750
3
500
2
1 250
0 0
0 2 4 6 8 10 12 14 16 18 20 0 2 4 6 8 10 12 14 16 18 20
Jarak dari pantai (km) Jarak dari pantai (km)
Graf Kepekatan SO42- Bagi Stesen-stesen Pensampelan Graf Kepekatan HCO32- Bagi Stesen-stesen Pensampelan
30000 600
25000 500
20000 400
A A
Kepekatan (mg/l)
Kepekatan (mg/l)
B B
C C
15000 D 300 D
E E
F F
G G
10000 200
5000 100
0 0
0 2 4 6 8 10 12 14 16 18 20 0 2 4 6 8 10 12 14 16 18 20
Jarak dari pantai (km) Jarak dari pantai (km)
Rajah 5: Graf taburan klorida, sulfat, pepejal terlarut dan karbonat di kawasan kajian
6.38 6.38
6.36 6.36
6.34 6.34
6.32 6.32
10000.00
1000.00
6.30 6.30
6.28 3000.00
6.28
6.26
6.26 250.00
1000.00
6.24
6.24
6.22
6.22
-2000.00
-250.00 100.20 100.22 100.24 100.26 100.28 100.30 100.32 100.34 100.36 100.38 100.40
100.20 100.22 100.24 100.26 100.28 100.30 100.32 100.34 100.36 100.38 100.40
( Cl ) ( TDS )
6.38 6.38
6.36 6.36
6.34 6.34
20000.00 400.00
6.32
6.32
6.30
15000.00 6.30
300.00
6.28
6.28
10000.00
200.00
6.26
6.26
6.24 5000.00
6.24 100.00
6.22
-10000.00 6.22
100.20 100.22 100.24 100.26 100.28 100.30 100.32 100.34 100.36 100.38 100.40
-50.00
( SO4 ) 100.20 100.22 100.24 100.26 100.28 100.30 100.32 100.34 100.36 100.38 100.40
( HCO3 )
Abstract
Titanium has many important practical applications. In this work our focus is on its
application in the battery industry where it is used almost universally as the anodic substrate
for the deposition of electrolytic manganese dioxide. The corrosion of titanium and the effect
of Mn2+ ions (0.001-1.0 M) in different concentration sulfuric acid solutions (0.001-1.0 M) at
temperatures ranging from ambient to 98°C have been studied using potentiodynamic
polarization techniques. Titanium showed voltage regions of active corrosion and passive
behaviour in different acid concentrations at different temperatures. It was also found that the
active corrosion of titanium to form titanium dioxide occurs at low potential (–0.8 to -0.4 V vs
SCE) and is strongly dependent on the sulfuric acid concentration and temperature.
Passivation occurs at potentials more positive than the active corrosion range, before oxide
breakdown at potentials above ~2 V depending on the electrolyte concentration. The
corrosion current of titanium increases with an increase in acid concentration and
temperature for acid concentrations of 0.1 M and higher. Increasing acid concentration is
also found to shift the breakdown potential of titanium dioxide layer toward more positive
values, but increasing temperature does not affect this value. The presence of Mn2+ ions were
found to decrease the corrosion current density at all temperatures. MnO2 is deposited on
titanium at lower potentials compared to oxygen evolution, and the deposition current density
of MnO2 correlates with Mn2+ concentrations.
Keywords : Corrosion, deposition, titanium
occurs. An investigation on titanium increased. The reason for this was the
dissolution (Caprani et al., 1982) has studied formation of a high resistance manganese
the interactions between oxygen reduction and compound layer on the cathode surface.
titanium dissolution in aerated hydrochloric
Suppressing the passivation of the Ti anode
acid. The presence of dissolved O2 inhibits the
during electrolytic production of EMD is the
anodic dissolution of Ti, predominantly in the
primary concern in EMD manufacturing,
active region. The reduction rate of O2 is
because the cell voltage would rise steeply until
partially limited by its diffusion to the electrode
the passage current was stopped (Mriyaaki et
surface and potential. Mixed kinetics for this
al., 1998). Another feasible means to prevent
reduction reaction was observed in the active
this failure was to adjust the MnSO4-H2SO4
region and a pure diffusional one in the near
composition, but there is no information on a
passivity region.
clear, safe region of electrolyte composition for
The best conditions for the Ti anode for EMD preventing Ti passivation. A sufficient supply
production were found to be at a relatively low of MnSO4 component to the electrolyte mixture
current density and the best method for is essential to maintain the Ti anode sound and
preventing Ti corrosion during EMD deposition non-passivated. The present work is aimed at
is by coating of the electrode surface with β- investigating the corrosion behavior of titanium
MnO2 (Kalinovskii et al., 1988). In relations to substrate during electrodeposition of
electrolyte composition and maximum current manganese dioxide in different sulphuric acid
density in sulfate solutions during EMD concentrations and temperature. The corrosion
deposition, the maximum deposition current behavior during deposition will be compared to
density was found to be approximately 115 to the background of titanium in sulphuric acid
A/m2 at the highest molar ratio of 0.9 (Fisher et without Mn(II) ions. The effect of Mn(II) ions
al., 1985). Another study on titanium anode for concentrations on the corrosion behavior and
EMD production in neutral solutions found that the deposition of manganese dioxide will also
the potential of the titanium anode during be investigated.
electrodeposition of the manganese dioxide in 2. Experimental
neutral solutions is less than that in acidic Potentiodynamic measurement were carried out
solutions (Tsagareli et al., 2000). Under such in an electrochemical cell consisted of 1 cm2
conditions no oxygen evolution was observed, titanium working electrode, platinum sheet
hence there are favorable conditions for the counter electrode and standard calomel
titanium electrode to work without passivation. electrode. A multi channel Perkin Elmer
Passivation of the titanium surface did not potentiostat was used to run the measurement.
actually take place in the neutral solution, Titanium working electrode was mechanically
however the voltage during electrolysis polished with abrasive paper, washed with
2
1
CH 16
11
1. Condenser
10 2. Stirring motor
3. Thermocouple
4. Working Electrode
5. Stirring Rod
7
6. Counter Electrode
3 7. Standard Electrode
4 6 8. Heating Mantle
5 9. Them controller
10. Integrator
8 11. Monotor
9
double de-ionized water and scanned in temperature (20, 40, 60, 80 and 98oC). The
negative direction at 100 mA for 5 minutes. It effect of Mn(IV) ions concentrations was
was then rinsed with water, acetone and water studied in 1M H2SO4 solutions with the
then dried at room temperature before placed in identical procedures.
the test cell. The scan was started from OCV
3. Results and Discusion
for 10 minute followed by negative
Figures 1-4 show the polarization curves of
potentiodynamic scan (-10mV/s) down to -0.8
manganese deposition on titanium in different
V and potentiostatic steps in positive direction.
sulphuric acid concentrations and temperatures.
250 potentiostatic steps were applied, where
The electrolyte consisted of H2SO4 prepared
each step was 25mV with 60 seconds static
with identical procedures as those run for
time. The steady state current in each
titanium background to be able for the
potentiostatic steps was then extracted to
polarization curves to be compared, and 0.02M
construct overall voltammogram. The effect of
Mn(II) was added. It has been observed that
acid concentration (0.001-1M) on the corrosion
the background curves of titanium in sulphuric
of titanium was studied as a function of
10
6 20 oC
Current Density [mA/cm 2]
4
40 oC
2
0 60 oC
-2
-4
80 oC
-6
98 oC
-8
-10
-1 -0.5 0 0.5 1 1.5 2 2.5 3 3.5 4
Fig 1. MnO2 deposition on titanium in 0.001M H2SO4 at different temperatures Mn(II) = 0.02M
10
6
20 oC
Current Density [mA/cm2]
4
40 oC
2
0 60 oC
-2
80 oC
-4
98 oC
-6
-8
-10
-1 -0.5 0 0.5 1 1.5 2 2.5 3 3.5 4
Fig 2. MnO2 deposition on Titanium in 0.01M H2SO4 at different Temperatures. Mn(II) = 0.02M
10
8 20 oC
6
40 oC
Current Density [mA/cm ]
2
0
60 oC
-2
-4
80 oC
-6
-8
98 oC
-10
-1 -0.5 0 0.5 1 1.5 2 2.5 3 3.5 4
Fig 3. MnO2 deposition on Titanium in 0.1M H2SO4 at different Temperatures. Mn(II) = 0.02M
10
8
20 oC
6
40 oC
Current Density [mA/cm ]
4
2
0
60 oC
-2
-4
80 oC
-6
-8
98 oC
-10
-1 -0.5 0 0.5 1 1.5 2 2.5 3 3.5 4
acid concentration higher tan 0.1M titanium concentration has no effect on titanium active-
undergoes surface activation and passivation at passive behaviour. Manganese dioxide
low potential between -0.8 to -0.45 volts (sce). deposition in this low acid concentration at
room temperature began at 1 volt (sce) and
It can be seen from fig 1 that there were no
increased to 1 mA/cm2 before it was constant at
increase in current density at the active-passive
that value at 1.5 volts.
potential region of titanium between -0.8-0.45
volts (sce) as it was observed in the background The second increase in current density was
curve of titanium. Mn(II) ions in low acid observed at about 2 volts before it decrease and
10
]
2
8
6
20
5
40
4
60
3
80
98
2
98
80
1
C]
60
T [o
0 40
-3 20
-2
-1
0
Log Acid Co
ncentration
finally constant. Identical pattern were MnOOH formed in the chemical step is then
observed in 40oC where there were two oxidized to form MnO2 at higher potential.
increases in current density at the same
The same shape of curves was found in 0.01M
potentials and two regions of constant current
sulphuric acids at all temperatures (fig 3) as it
were observed. Two increases and one regions
was found in 0.001M indicating that the same
of constant current density were observed at
reactions occurred at this concentration. There
60oC and only one increase at 80 and
was no active-passive peak current density
98oC.These two regions of increase and
observed in 0.01M at potential range -0.8 to -
constant current density suggests that there
0.45 volts of all temperatures. Two increases of
were two mechanisms or two species involved
current density were observed at 40, 60 and
in the process of manganese dioxide deposition
80oC while the corresponding constant current
as it was suggested by a number of workers
density regions were lower than those found in
(Jerkewics et al., 2004 and Rodrigues et al.,
0.001M acids. It suggests that increase in the
1988).
acid concentration have reduced the rate of
In a study on the electrochemical behaviour of MnO2 deposition that is probably due to the
manganese dioxide on gold electrode, Rogulski increase in passive layer formed on the surface
et al.(2003) found two positive peaks of of titanium substrate although no passivation
manganese species oxidation in 0.5M H2SO4 current density seen at low potential region.
and Mn(II) concentration lower than 0.1M Further decrease in deposition current density
with scan rate 2.5 mV/s. He stated that was found with increasing acid concentration
oxidation of Mn(II) to MnO2 involves multi of up to 1 M (fig 3-4) and the second oxidation
steps reaction as proposed earlier by peak current density disappeared.
Chartwright that the reactions involve slow
Fig 6 and 7 show the peak corrosion current
diffusion of Mn2+ from bulk solution to the
density of titanium in H2SO4 alone as
electrode surface followed by fast formation of
background and in H2SO4 containing Mn(II)
Mn3+ leading to the formation of the insulating
ions at constant concentration of 0.02M
MnOOH layer on the surface of electrode. He
respectively. In H2SO4 (fig 6) the corrosion
consider that the rate determining step is the
current density of Ti started to occur in 0.1M at
diffusion of Mn2+ from bulk to the surface and
60oC and it increased with the increase of
the two reactions leading to the formation of
temperature. It further increased as the acid
insulating layer is a single fast step. The
10
9
]
2
8
Current Density [mA/cm
20
7
6
40
5 60
4
80
3
2 98 98
80
1
60
0 T [oC]
40
-3
-2 20
-1
0
Log Acid Concentration
10
9
]
2
20
Current Density [mA/cm
7 40
6
60
5
4 80
3
98
98
2
80
1 60
T [oC]
0 40
-3 20
-2
-1
0
Log Acid Concentration
10
6
0 Mn
]
2
Current Density [mA/cm
4
0.001 Mn
2 0.005 Mn
0 0.01 Mn
-2 0.02 Mn
-4 0.08 Mn
-6
0.1 Mn
-8
-10
-1 - 0.5 0 0.5 1 1.5 2 2.5 3 3.5
10
0 Mn
6
]
2
0.001 Mn
Current Density [mA/cm
2 0.005 Mn
0 0.01 Mn
-2
0.02 Mn
-4
0.08 Mn
-6
0.1 Mn
-8
-10
-1 - 0.5 0 0.5 1 1.5 2 2.5 3 3.5
reduced the corrosion current of titanium at all almost all temperatures except at 40oC where
temperature and acid concentration. the Mn(ii) concentrations were 0.1, 0.08 and
0.02 M. The highest corrosion current at all
To investigate the effect of Mn(II) ions
temperatures was found in the acid containing
concentration in the acid, different
no Mn(II) ions and it decreased as the Mn(II)
concentrations of Mn(II) in 1M H2SO4 was
ions added to the acid, where the biggest
taken to run identical tests on titanium. Fig 8-
decrease were found at the highest temperature
11 show voltammogram of titanium in the acid
of 98oC. This suggests that the increase in
containing different Mn(II) ions concentrations.
temperature enhances the surface coverage of
Corrosion can be seen clearly occurring at
10
6
0 Mn
2
]
0.001 Mn
Current Density [mA/cm
4
0.005 Mn
2
0.010 Mn
0
0.020 Mn
-2
0.08 Mn
-4
0.1 Mn
-6
-8
- 10
-1 - 0.5 0 0.5 1 1.5 2 2.5 3 3.5
o
Effect of Mn(II) Concentrations in 1M H2SO4 at 98 C
10
6
0 Mn
Current Density [mA/cm ]
2
0.001
2
Mn
0 0.005
-2
Mn
0.01 Mn
-4
-6
-8
-10
-1 -0.5 0 0.5 1 1.5 2 2.5 3 3.5
Mn(II) adsorption that causes significant 60 and 98oC the corrosion current density
decrease in the corrosion current. gradually increased after the first decrease on
the initial addition of Mn(II) ions in the acid.
Fig 12 summarises the corrosion current
density of titanium in 1M H2SO4 at different The deposition current density increased with
Mn(II) ion concentrations and temperatures. Mn(II) concentrations and temperature, as seen
The decrease in corrosion current density in fig 13, indicating that the corrosion of
continue as the Mn(II) ion concentration was titanium at low anodic potential does not
increased up to 0.1M only at 40 and 80oC. At
7
Corrosion Current Density [mA/cm2]
5 98 oC
4 80oC
3 60 oC
2 40 oC
-1
- 4.5 -4 - 3.5 -3 - 2.5 -2 - 1.5 -1 - 0.5 0
Fig 12. Corrosion Current Density of titanium in 1M H2SO4 + Mn(II) [log Mn –4 reffers to 0M Mn(II)]
10
8
2
]
Current Density [mA/cm
7
98 oC
6
80 oC
5
4
60 oC
3 40 oC
2
0
- 3.5 -3 - 2.5 -2 - 1.5 -1 -0.5 0
prevent MnO2 from depositing onto the surface At constant concentration of Mn(II) ions in the
of titanium. acid electrolyte, the increase in H2SO4
concentration decreases deposition current of
4. Conclusion
MnO2. The present of Mn(II) ions in the acid
Titanium shows active-passive behaviour in
reduces the corrosion of titanium at high
high concentrations of H2SO4 containing
temperature and the increase of Mn(II) ions do
Mn(II) ions. Corrosion current increases with
not reduce MnO2 deposition on Titanium.
increasing temperature and acid concentration.
Abstract
It has been performed semi-synthesis of vanillin 3 from eugenol 1a and/or 1b as main
components of clove oil, by using microwave technique on the household commercial
available microwave oven. As first step for this reaction, to the eugenol 1a and/or 1b were
reacted with KOH-solution 10% and heated in the microwave oven for 1, 2 and 3 minutes,
respectively, on heating level I as well as for 1 and 2 minutes respectively, on the heating
level II. The yield of isomerized products were following: 22.38% trans-isoeugenol 2a and
2.82% cis-eugenol 2b (total conversion: 25.20%) on the heating level I for 1 minute; 23.27%
trans-eugenol and 2.90% cis-isoeugenol (total conversion: 26.17%) on the heating level I for
2 minutes; 29.64% trans-isoeugenol and 3.78% cis-eugenol (total conversion: 33.42%) on the
heating level I for 3 minutes; 0.19% trans-isoeugenol and 90.89% cis-isoeugenol (total
conversion: 91,08%) on heating level II for 1 minute as well as 0.02% trans-isoeugenol and
94.97% cis-isoeugenol (total conversion: 94,99%) on the heating level II for 2 minutes.
Without any further purification or separation, to the isomerized products were oxidized with
3 mL (0.026 mol) nitrobenzene and heated in the microwave oven on the heating level II for 2
minutes. The yields of vanillin 3 from this oxidation reaction were 6.75% (heating level I for 1
min.); 13.60% (heating level I for 2 mins.); 69.22% (heating level I for 3 mins.); 82.09%
(heating level II for 1 min.) as well as 86.10% (heating level II for 2 mins.), respectively.
Spectral data of semi-synthesized vanillin as well as its melting point are closing together with
related data of natural occurring vanillin.
Key words: Eugenol, isoeugenol, , microwave, microwave oven, nitrobenzene, vanillin
dielectric constants, such acetone (ε = 20.6 D) final temperature will be much higher in
and ethanol (ε = 24.6 D), are heated at the same ethanol than in acetone (Lidström et al., 2001).
radiation power and same period of time, the In order to compare the abilities of different
OH OH OH
OCH3 OCH3 OCH3
strong base, KOH Nitrobenzene
190 o-220 oC, 8 hours 100 oC, 5 hours
CHO
1 2 3 , 3.6%
Scheme 1
OH OH OH OH
OCH3 OCH3 KOH-solution, PTC, OCH3 OCH3
60oC, 8 hours
and +
1b 2b, by product
1a 2a, major product
KMnO4-solution, 40oC
2a + 2b ⎯⎯⎯⎯⎯⎯⎯⎯→ 3 in 16.9% (total yield of 22.9% from starting material, eugenol 1)
PTC: 18-crown ether-6, 2 hours
Scheme 2
OH OH OH
OCH3 OCH3 OCH3
KOH-solution, Nitrobenzene
microwave microwave
CHO
1 2 3
Scheme 3
anhydrous, filtered off, and the isomerization organic phase was evaporized in vaccuo. The
products was ready to be measured on GC to raw vanillin crystal should be recrystalized in a
analyze its composition as well as on IR- mixture of warm ethanol-water (2 : 1). The
spectrophotometer. colorless pure vanillin crystal was ready to be
determined its yield, melting point as well as its
b. Oxidation of Isomerization Products
IR-spectrum
with Nitrobenzene to Vanillin 3
Without any purification and separation, the 3. Results And Discussion
isomerization products was mixture with 3.0 In the first step in this work, it has been tried to
mL Nitrobenzene (26.5 mmol), than stirred and determine the temperature in the microwave
the reaction mixture was heated in the oven room on heating by heating level I for 1, 2
microwave oven on heating level II for 2 and 3 minutes, respectively, as well as by
minutes. After reaction mixture cooled down, heating level II for 1 and 2 minutes. The results
than aqueous phase was separated from its of temperature measurement on the inner room
organic phase. The aqueous phase was than of microwave oven are appeared on table 1.
neutralized with HCl 1.0 M, and the collected
Table 1. The results of temperature measurement on the inner room of microwave oven
Heating time Temperature on heating level (OC)
(minute) I II
1 57 124
2 83 165
3 105 -
R CH CH CH 3
allyl- or/and benzyl protons III
Scheme 4
Table 2. Results on isomerization of eugenol to isoeugenol (counted from peak areas of gas
chromatogram)
Wijaya (1992) and Priyono Suwarso et al. compared with energy system of eugenol
(2002) stated, that the reaction mechanism of (scheme4).
isomerization of eugenol with strong
The results of heating influence by microwave
base 1 to trans- and/or cis-isoeugenol is
assisted organic synthesis on isomerization
[1,3] prototropic rearrangement reaction.
reaction of eugenol 1 to trans- and/or cis-
Eugenol was considered as allyl- or/and benzyl
isoeugenol 2a , 2b could be shown in the table
system, therefore eugenol has Hα-acid or active 2.
proton of allyl- or/and benzyl system. If strong
base (:B) was added to eugenol, than this active From those results of isomerization products,
proton (Hα-acid) could be abstracted by strong there are two modes of isomerization product to
base to form HB, but in another side, from be attractive discussed, because on heating
eugenol I could perform unstable carbanion level I trans-isoeugenol 2a as major product,
system IIa and followed by resonance structure whereas on heating level II cis-isoeugenol 2b
to perform most stable carbanion system IIb. as major product. Eugenol 1 could be viewed
There are two reasons, why could be performed has two molecular structures, “trans-eugenol”
most stable carbanion IIb. The first explanation 1a and “cis-eugenol” 1b. As normal rule in the
is formation non terminal double bond IIb that organic chemistry from viewing of its steric
stabilized by more hyperconjugations than hindrance said, that trans-isomer is most
terminal double bond on carbanion system IIa. thermodynamic stable in low temperature,
The second explanation is formation of longer whereas cis-isomer is most thermodynamic
conjugation system of double bonds from stable in high temperature, consecquently
aromatic system with outer double bond system trans-isomer (trans-eugenol 1a) could be
of side chain, that caused decreasing of the transformed into cis-isomer (cis-eugenol 1b) by
energy content of the hole system (isoeugenol) giving of thermal- or photochemical energy. By
heating on microwave oven at heating level I
for 1, 2, and 3 minutes (see table 1), it could be for the reaction product in this work. The yield
considered that the resulted temperature on vanillin could be shown in the Table 3
belonged to the “low” criteria, so that the trans-
If the yields of vanillin 3 from this method
isomer (trans-eugenol 1a) could be proposed as
were compared with the results of formerly
most stable structures. Therefore the major
work (Soemadhiharga et al., 1973; Wijaya,
product of isomerization reaction was trans-
1992; Priyono Suwarso et al., 2002), so could
isoeugenol 2a and cis-isoeugenol 2b as
be said that by using the microwave assisted
minor/by product. In opposite, by heating on
organic synthesis (MAOS) method, especially
microwave oven at heating level II for 1 and 2
the reaction time could be significantly
minutes (see table 1), it could be considered
shortened. From the table 3. could be seen, that
that the rised temperature belonged to the
on heating level I with heating time 3 minutes
“high” criteria, so that the cis-isomer (cis-
as well as on heating level II with heating time
eugenol 1b) could be proposed as most stable
1 and 2 minutes, the percentages of total
structure. Also cis-isomer (cis-isoeugenol 2b)
conversion from eugenol 1 into isoeugenol 2 as
was major product in this isomerization
well as the yield to the vanillin 3 in the
reaction (scheme 5).
following reaction were very satisfaction.
The next reaction was oxidation reaction to
The mechanism reaction of the oxidation of
oxidaze trans- and/or cis- isoeugenol 2a, 2b
isoeugenol 2 into vanillin 3 could be described
with nitrobenzene as oxidator on heating at
as shown in scheme 6.
microwave oven into vanillin 3 as main target
OH OH OH OH
"cis"-eugenol 1b cis-isoeugenol 2b
"trans"-eugenol 1a trans-isoeugenol 2a
OH OH
OCH3 OCH3
heating level I
+
reaction time:
1, 2 and 3 mins.
OH OH
OCH3 OCH3 2b, by product
and/or microwave 2a, major product
KOH-solution most stable isomer
OH OH
1b OCH3 OCH3
1a most stable isomer heating level II
+
most stable isomer on heating level II reaction time:
on heating level I 1 and 2 mins.
OH OH OH
OCH3 OCH3 OCH3
nitrobenzene,
+ + N N +
microwave,
heating level II, 4, azobenzene
reaction time 2 mins.
CHO H3 CCHO
2b 3 5, acetaldehyde
2a
Scheme 6
Lidström, P., Tinerney, J., Wathey, B., Westman, J., Soemadhiharga, D., Somaatmadja, D., Ali (1973),
(2001), Tetrahedron, 57, 9225 Laporan Penelitian: Vanili dari Eugenol Minyak
Daun Cengkeh, Balai Penelitian Kimia Bogor, p.
Mingos, D.M.P., (1994), Res. Chem. Intermed., 20,
157
85
Wijaja, H., (1992), Karya Utama Sarjana Kimia,
Priyono Suwarso, W., Sukri, T., Wijaja, H., (2002),
Jurusan Kimia-Fakultas Matematika dan Ilmu
Makara Seri Sains, 6(1), 36-44
Pengetahuan Alam, Universitas Indonesia.
Pusat Pengajian Sains Kimia & Teknologi Makanan, Fakulti Sains & Teknologi,
Universiti Kebangsaan Malaysia (UKM), 43600 Bangi, Selangor, Malaysia.
03-89293870; Fax: 03-89213232; E-mail: wawm@pkrisc.cc.ukm.my
Abstrak
Kajian dijalankan untuk menganalisis kompaun pirazin terbentuk semasa pemprosesan gula
kabung menggunakan kaedah ruang tutupan pengekstrakan mikro fasa pepejal (RT-PMFP)
gas kromatografi spektrometri jisim (GK-SJ). Sampel sebanyak 1 ml diambil setiap setengah
jam sepanjang pemasakan air nira selama 4 jam untuk penentuan kompaun pirazin. Kompaun
meruap dalam ruang tutupan vial 12 ml diekstrak dengan 2cm fiber divinilbenzene-karboxen-
polidimetilsiloxane (DVB-CAR-PDMS) pada suhu pengekstrakan 50oC selama 10 minit.
Pembentukkan komponen meruap pirazin (nitrogen heterosiklik) mencatat peratusan tertinggi
pada masa pemasakan 4 jam bagi kesemua 21 analit pirazin yang dikenalpasti dengan jumlah
luas puncak relatif (LPR) merangkumi 87.88% berbanding dengan 7 analit komponen meruap
kumpulan oksigen-heterosiklik (9.92% LPR). Hampir separuh daripada LPR komponen
meruap gula kabung disumbang oleh dua analit pirazin iaitu 2,5-dimetil pirazin (30.39%) dan
2-etil-5-metil pirazin (19.48%). Antara komponen meruap, 2-etil-3,5-dimetil pirazin,
benzeneacetaldehid dan 2-metil butanal dikenalpasti dalam gula kabung pernah dilaporkan
sebagai komponen aroma impak dalam pemprosesan makanan terma. Penggunaan kombinasi
kaedah RT-PMFP dengan GK-SJ terbukti berjaya mengekstrak kompaun meruap pirazin
(kumpulan nitrogen heterosiklik) dan furan (kumpulan oksigen heterosiklik) yakni komapun
meruap yang bertanggunjawab terhadap profil aroma gula kabung secara analitikal semasa
pemprosesan gula kabung.
Kata Kunci: Air nira (Arenga pinnata), kompaun meruap Maillard, ruang tutupan
pengekstrakan mikro fasa pepejal (RT-PMFP), gas kromatografi spektrometri jisim
yang mempunyai intensiti tertinggi kepekatan yang tertinggi. Bukan setakat begitu
(kebarangkalian > 80%) untuk membezakan sahaja, kedua-dua analit ini juga menunjukkan
kompaun meruap daripada jiran terdekat. kesamaan dari segi kedudukan kumpulan
Penilaian separa kuantitatif terhadap kepekatan metilan iaitu pada kedudukan ke-2 dan ke-5
kompaun meruap adalah berdasarkan kepada struktur molekul pirazin. Fenomena ini
perbandingan luas puncak kompaun analit menyetujui mekanisme yang dicadangkan oleh
kepada luas puncak kompaun piawai dalaman, Chi (1999) yang menyatakan bahawa dalam
tridecane. persekitaran media tanpa gula penurun, 2,5-
dimetil pirazin boleh dihasilkan melalui proses
3. Hasil dan Perbincangan
pendekarbonilan diikuti pendehidratan asid
Pengenalpastian Kompaun Meruap
amino iaitu merupakan jalan tindak balas utama
Maillard
berbanding dengan 2,6-dimetil pirazin yang
Kromatogram yang diperolehi daripada cairan
terhasil melalui proses pendekarbonilan diikuti
gula kabung dipanas pada masa yang berlainan
pendeaminaan. Bagi kumpulan O-heterosiklik,
(30, 60, 90, 120, 150, 180, 210 dan 240 min)
kompaun meruap kelas furan kelihatan
menunjukkan profil yang amat kompleks
dominan berbanding dengan kompaun kelas
(Jadual 1). Secara keseluruhan, sebanyak 26
furanone dengan 2-furfural, 2-furan metanol
kompaun dikenalpasti pada masa pemasakan
dan 5-metil furfural mencatat kepekatan yang
ke-210 dan 240 minit bagi setiap cairan gula
tertinggi (Jadual 1) pada masa pemasakan ke-
kabung terproses. Kompaun meruap ini terdiri
210 dan 240 minit. Pembentukkan kompaun
daripada 2 kelas kumpulan yang utama yakni
meruap kumpulan O-heterosiklik pada masa ini
nitrogen dan oksigen heterosiklik. Kumpulan
dijangka mempunyai kaitan dengan
nitrogen heterosiklik terdiri daripada 19 analit
persekitaran media tindak balas dalam cairan
kompaun meruap kelas pirazin manakala
gula kabung. Menurut Kroh (1994), suhu tinggi
oksigen heterosiklik pula terdiri daripada 5
berserta nilai pH media yang berasid akan
analit kelas furan dan 2 analit kelas furanone,
menggalakkan proses pengkaramelan dan
Kehadiran kompaun meruap kumpulan N- dan
akibatnya produk hasil daripada
O-heterosiklik iaitu produk akhir Maillard
pendegradasian kompaun 2,5-dimetil-4-
dalam cairan gula kabung terproses menyokong
hidroksi-3(2H) furanone (HMF) akan
bukti bahawa tindak balas Maillard sedang
terbentuk. Pernyataan ini disokong oleh
berlaku semasa pemprosesan gula kabung.
pengenalpastian 2 kompaun hasil degradasi
Jadual 1 menunjukkan kewujudan dan HMF iaitu 2-furfural dan 5-metil furfural dalam
kehilangan beberapa kompaun meruap semasa kajian ini.
pemprosesan gula kabung yang mana dijangka
Sungguhpun corak kinetik proses pemanasan
mempunyai kaitan dengan proses transformasi
air nira menunjukkan variasi yang amat ketara
dinamik dalam tindak balas Maillard.
tetapi secara dasarnya 2 kumpulan kompuan
Memandangkan hanya produk Maillard N- dan
meruap dapat dibezakan. Dalam kumpulan
O-heterosiklik kompaun yang dikaji dalam
pertama, hampi semua kompaun meruap dapat
eksperimen ini, maka tidak hairanlah sekiranya
dikenalpasti pada masa pemasakan ke-120 dan
kesemua 26 analit kompaun meruap meningkat
mencapai kepekatan maksimum pada masa ke-
mengikut pertambahan masa pemasakan
240 minit iaitu masa akhir pembentukan gula
kecuali analit 5- etil-2,3-dimetil pirazin sahaja
kabung. Kompaun meruap kelas alkil pirazin
mengalami penurunan kepekatan selepasa masa
seperti 2-metil pirazin dan 2,5-dimetil pirazin
pemasakan ke-180 min. Kehilangan kompaun
tergolong dalam kumpulan ini. Manakala,
meruap ini kemungkinan disebabkan oleh sifat
kumpulan kedua pula merangkumi analit
keisomeran analit ini yang tidak stabil
seperti 2-furfural, 2-furan metanol dan 5-metil
berbanding dengan 2 analit yang lain iaitu 3-
furfural yang mana mula terbentuk pada masa
etil-2,5-dimetil pirazin dan 2-etil-3,5-dimetil
pemasakan ke-210 minit dan mencapai
pirazin yang menunjukkan pertambahan
maksimum pada 240 min pemasakan.
kepekatan secara mendadak. Antara kompaun
Memandangkan kedua-dua kumpulan ini
meruap pirazin yang dikenalpasti, hanya 2,5-
menunjukkan keadaan yang hampir optimum
dimetil pirazin dan 2-etil-5-metil pirazin sahaja
pada masa pemasakan ke-240 min, maka 1
yang hadir dalam kesemua lapan siri
kumpulan sampel air nira (B2) yang berlainan
pemanasan air nira dengan mencatat kandungan
dimasak pada masa ini dikumpul bagi tujuan terbakar kacang dan makanan terproses terma.
perbandingan. Pernyataan tersebut mencapai persamaan dalam
kajian ini dengan penemuan nilai ambang
Perbandingan Sumbangan Kompaun Meruap
perisa kompaun meruap 2-etil-5-metil pirazin
Cairan Gula Kabung Terproses
dan 2-etil-3,5-dimetil pirazin yang jauh lebih
Dalam kajian kompaun meruap sesuatu produk, rendah berbanding dengan pirazin yang
kedua-dua data kandungan kepekatan (bpb) dan berantai sisi kumpulan metil (Jadual 2). Selain
nilai ambang perisa (bpb) amatlah penting itu, faktor kedudukan kumpulan metil pada
untuk tujuan perbandingan kadar sumbangan cecincin pirazin juga mempengaruhi nilai
secara relatif. Bagi memudahkan tafsiran hasil ambang perisa kompaun meruap dengan
kajian, nilai ambang perisa dalam larutan air penggantian kumpulan metil pada kedudukan
bagi kebanyakkan kompaun disenaraikan 2,3 mengakibatkan peningkatan nilai ambang
dalam Jadual 1 yang pernah dilaporkan oleh perisa berbanding dengan penggantian pada
Buttery et al. (1997) digunakan. Nilai ambang kedudukan 2,5 atau 2,6 (Fors & Olofsson,
perisa (bpb) bagi beberapa kompaun meruap 1985). Sekali lagi, pernyataan ini jelas terbukti
disenaraikan dalam Jadual 2 bersama-sama kesahihannya dengan pengenalpastian nilai
dengan data kepekatan dan log10 nisbah ambang perisa bagi 2,5-dimetil pirazin (1700
kepekatan kepada nilai ambang perisa bagi bpb) dan 2,6-dimetil pirazin (1500 bpb) yang
cairan gula kabung terproses. lebih rendah berbanding dengan 2,3-dimetil
Berdasarkan kepada Jadual 2, jelas kelihatan pirazin (2500 bpb) (Jadual 2). Tambahan lagi,
terdapat perbezaan yang ketara bagi kepekatan peningkatan nombor gantian kumpulan metil
kompaun meruap yang dihasilkan oleh produk atau etil yang bersiri homolog sama pada rantai
cairan gula kabung terproses B1 dan B2. sisi cecincin pirazin akan mengurangkan nilai
Antara 26 analit kompaun yang dikaji, hanya ambang perisa alkil pirazin. Maka, tidak
terdapat 2 analit kompaun meruap yang mana hairanlah sekiranya terdapat perbezaan nilai
berlaku di atas kepekatan nilai ambang perisa ambang perisa yang ketara antara kompaun
air di dalam kedua-dua cairan gula kabung induk pirazin (180000 bpb) dengan 2,3-, 2,5-
terproses B1 dan B2. Kompaun yang dan 2,6-dimetil pirazin (<2500 bpb) (Jadual 2).
dimaksudkan ini ialah 2-etil-5-metil pirazin dan Bagi kompaun meruap kumpulan O-
2-etil-3,5-dimetil pirazin masing-masing heterosiklik, tidak kelihatan terdapat perbezaan
dengan nilai ambang perisa 100 bpb dan 0.04 kandungan kepekatan yang ketara bagi cairan
bpb pernah dilaporkan sebagai kompaun aroma gula kabung terproses B1 dan B2. Berdasarkan
impak dalam makanan terproses terma dan kepada Jadual 2, didapati kompaun meruap
tergolong dalam kategori alkil pirazin. Secara kelas furan mendominasi aroma dalam
amnya, kumpulan alkil pirazin ini kumpulan O-heterosiklik dengan analit 2-furan
menyumbang kepada aroma terbakar, kacang metanol iaitu produk hasil penurunan 2-furfural
hangus dan perisa serupa ubi (Fors, 1983). mencatat nilai ambang perisa dan kandungan
Namun begitu, nilai ambang perisa bagi kepekatan yang tertinggi. Sementara itu,
kesemua mono dan dimetil pirazin secara kompaun meruap 2-furfural dan 5-metil
relatifnya adalah tinggi (> 1 bpj) dalam kajian furfural, produk hasil degradasi HMF dengan
ini dan kebarangkalian pirazin jenis ini nilai ambang perisa (< 1bpj) mencatat nisbah
berperanan dalam penyumbangan aroma kepekatan 4:1 pada kedua-dua cairan gula
makanan terma adalah minor. kabung terproses B1 dan B2. Penemuan nilai
Sungguhpun begitu, penggantian satu atau nisbah kepekatan ini selaras dengan teori
lebih kumpulan metil dengan kumpulan etil Schrodter (1992) yang menyatakan bahawa
pada sisi rantai pirazin boleh menyebabkan dalam proses pendegradasian HMF, iaitu
penurunan yang ketara terhadap nilai ambang produk yang tidak stabil dalam keadaan berasid
perisa (Guadagni et al. 1972) dan pernah dan suhu tinggi akan membebaskan 80%
dilaporkan terdapat beberapa analit pirazin produk furfural dan 20% kombinasi produk 5-
gantian rantai sisi dengan kumpulan etil metil furfural dan 2,5-furandialdehid.
mencatat nilai ambang perisa yang cukup Kegagalan penemuan 2,5-furandialdehid dalam
rendah sehingga menjadi kompaun meruap kajian ini kemungkinan disebabkan oleh
yang penting dalam penyumbangan aroma kesediaan kandungan agen penurunan yang
tinggi dalam keadaan persekitaran sampel B1 sumber atom nitrogen dalam persekitaran
dan B2 mengakibatkan proses penurunan media tindak balas. Peningkatan kepekatan
menjadi dominan dan kecenderungan kumpulan amino dan ammonia seterusnya akan
menghasilkan 5-metil furfural. Pengenalpastian memangkinkan proses fragmentasi gula dan
kandungan kepekatan HMF yang rendah (< 7 menghasilkan banyak fragment kecil yang aktif
bpb) pada cairan gula kabung B1 dan B2 dan iaitu sumber dikarbonil untuk terlibat dalam
peningkatan yang mendadak kandungan tindak balas seterusnya. Kereaktifan
kepekatan 2-furfural (¬200 bpb) dan 5-metil fragmentasi gula dan kesediaan sumber atom
furfural (> 39 bpb) dijangka dapat menjadi nitrogen dalam persekitaran sesuatu media
penunjuk kepada kualiti perisa produk gula tindak balas amat penting dalam penghasilan
kabung yang terbentuk selain daripada kompaun meruap kumpulan N- dan O-
kompaun meruap kumpulan N-heterosiklik. heterosiklik terutama melalui tindak balas
Maillard. Daripada Rajah 1, didapati corak
Dari segi kualitatif, kelas pirazin mencatat
penghasilan kompaun meruap kelas pirazin
kadar sumbangan yang tertinggi secara relatif
adalah hampir sama bagi air nira B1 dan air
dengan 90.0% LPR pada B1 dan 70.0% LPR
nira B2 iaitu meningkat dengan pertambahan
pada B2 diikuti dengan kelas furan deirvatif
masa pemanasan. Perbezaan yang ketara bagi
yang hanya mendapat sekitar 10.0% LPR (B1)
kedua-dua sampel air nira semasa pemanasan
dan 30.0% LPR (B2). Perbezaan ini turut
ialah dari segi kuantiti kompaun meruap pirazin
disertai dengan bilangan analit yang berlainan
yang terbentuk terutama sekali bagi analit 2,5-
pada kedua-dua produk dengan masing-masing
dimetil pirazin dan 2-etil-5-metil pirazin. Selain
mencatat 26 analit (B1) dan 16 analit (B2).
itu, peningkatan mendadak kesemua kompaun
Fenomena ini menyokong teori Kroh (1994)
meruap kelas pirazin hanya berlaku pada masa
yang menyifatkan bahawa penghasilan
ke-150 minit pemanasan jelas menyokong
bahagian relatif sesuatu kompaun meruap
bahawa berlakunya proses pembekalan sumber
dipengaruhi oleh faktor suhu dan keadaan
atom nitrogen daripada kumpulan amino dan
persekitaran samada berasid atau berbes
ammonia serta sumber dikarbonil akibat
terutama sekali dalam tindak balas Maillard.
fragmentasi gula pada peringkat permulaan
Perubahan Profil Kompaun Meruap masa pemanasan air nira. Dengan itu,
Maillard Semasa Pemanasan Air Nira dipercayai kekonsistenan nilai pH yang tinggi
Berdasarkan kepada Jadual 2, didapati terdapat pada tempoh pemanasan ini (< 150 min) dalam
10 analit kompaun meruap Maillard yang media tindak balas amat penting dalam
melebihi 1 % LPR pada kedua-dua cairan gula penentuan kuantiti kompaun meruap Maillard
kabung terproses B1 dan B2. Kompaun meruap yang terbentuk terutama kelas pirazin.
ini merangkumi 7 kompaun meruap kelas
Rajah 2 menunjukkan corak perubahan profil
pirazin dan 3 kompaun meruap kelas furan
kompaun meruap kelas furan yang jelas
dengan sesetengah kompaun tersebut melebihi
kelihatan berbeza dengan kompaun meruap
kepekatan 1 bpj dan di atas kepekatan nilai
kelas pirazin. Sungguhpun kompaun meruap
ambang perisa air (log10 K/AP > 0) akan
kelas furan meningkat mengikut pertambahan
dianalisis dengan lebih terperinci untuk melihat
masa pemanasan tetapi ia hanya mula berlaku
corak profil penghasilan kompaun semasa
pada minit ke-210. Namun begitu, dari segi
pemprosesan gula kabung (240 min).
kuantiti didapati kandungan kepekatan 2-
Perubahan profil kompaun meruap kelas
furfural dan 5-metil furfural bagi kedua-dua
pirazin dan furan semasa pemanasan air nira
cairan gula kabung terproses B1 dan B2 adalah
masing–masing ditunjukkan dalam Rajah 1 dan
hampir sama kecuali analit 2-furan metanol.
Rajah 2.
Memandangkan 2-furan methanol adalah
Suhu tinggi dan kebesan yang lemah produk hasil penurunan 2-furfural maka
merupakan keadaan pemprosesan yang kuantiti kepekatan analit ini yang tinggi pada
bersesuaian untuk tindak balas Maillard (Ellis, sampel B1 kemungkinan disebabkan oleh
1959). Nilai pH yang tinggi dapat kelebihan sumber gula penurun berbanding
mengurangkan kadar pemprotonan atom dengan B2. Perbezaan sifat kelakuan kedua-dua
nitrogen dalam kumpulan amino atau ammonia kelas kompaun meruap ini jelas menunjukkan
dan meningkatkan kepekatan kedua-dua kekompleksan system yang terlibat dalam
tindak balas Maillard. Menurut Shibamoto dan Chi, K. S. 1999. Pyrazine formation from serine and
Bernhard (1976), faktor pemprosesan seperti threonine. J. Agric Food Chem. 47: 4332-4335.
suhu dan masa tindak balas adalah parameter Ellis, G. P. 1959. The Maillard reaction. In
penting dalam penentuan jenis dan kuantiti advances in carbohydrates chemistry; Wolfrom, M.
produk Maillard yang terbentuk dalam tindak L., Ed.; Academic Press: New York, pp63-134.
balas Maillard. Memandangkan faktor masa Fors, S. M. 1983. Sensory properties of volatile
pemanasan ditetapkan dalam kajian corak profil Maillard reaction products and related compounds.
kompaun meruap melalui 8 siri pemanasan, In The Maillard reaction in Food and Nutrition;
maka dipercayai bahawa perbezaan jenis dan Waller, G. R. Feather, M. S., Eds.; American
kuantiti kompaun meruap pirazin ini adalah Chemical Society: Washington, DC, pp 185-286.
berpunca daripada faktor suhu pemanasan dan Fors, S. M. & Olofsson, B. K. 1985. Alkyl
ciri-ciri fizik-kimia air nira terutama kandungan pyrazines, volatiles formed in the Maillard reaction .
dan jenis asid amino dan gula penurun serta I. Determination of odor detection thresholds and
nilai pH media. odor intensity functions by dynamic olfactometry.
Chemical Senses. 10: 287-296.
4. Kesimpulan
Daripada ujikaji yang dijalankan, kompaun Guadagni, D. D., Buttery, R. G. & Turnbaugh, J. G.
meruap 2-etil-5-metil pirazin dan 2-etil-3,5- 1972. Odour threshold and similarity ratings of
dimetil pirazin merupakan analit yang dominan some potato chip components. J. Sci. Food Agric.
dan dijangka bertanggungjawab terhadap 23: 1435-1444.
aroma gula kabung. Faktor suhu pemprosesan Kroh, L. W. 1994. Caramelisation in food and
dan sifat semulajadi sumber reaktan dalam air beverages. Food Chemistry. 51: 37-379.
nira yakni kandungan dan jenis asid amino dan Panyakul, V. 2001. Palm sugar: the ingenous
gula penurun serta nilai pH media merupakan sweetness. ILEIA Newsletter. 13(2): 19.
parameter yang berperanan dalam penentuan
kuantiti dan jenis pembentukkan kompaun Pawliszyn, J. 2000. Theory of solid phase
microextraction. Journal of Chromatographic
meruap Maillard terutama kumpulan N- dan O-
Science. 38: 270-278.
heterosiklik kompaun. Dengan erti kata lain,
pemanasan air nira secara tradisional Pawliszyn, J. 1997. Solid-phase microextraction.
menghasilkan kualiti aroma gula kabung yang Theory and Practice; Wiley-VCH Inc.; New York.
tidak konsisten. Pollien, P., Ott, A., Montigon, F., Baumgartner, M.,
Munoz-Box, R. & Chaintreau, A. 1997. Hypenated
5. Penghargaan
headspace gas chromatography-sniffing technique:
Penyelidik ingin mengucapkan setinggi-tinggi Screening of impact odorants and quantitative
penghargaan kepada kementerian Sains, aromagram comparisons. J. Agric. Food Chem. 45:
Teknologi dan Innovasi atas bantuan kewangan 2630-2637.
melalui geran IRPA 03-02-02-0071 EA261.
Ribuan terima kasih juga ingin disampaikan Schrodter, R. 1992. Modelluntersuchungen zur
Strukturaufklarung von Modell-melanoidinen
kepada En. Rahmat, pegawai penyelidik dari
mittels Hochfrequenzpyrolyse. Dissertation,
Lembaga koko Malaysia atas tunjuk ajar dan Technische Universitat Berlin.
bantuan khidmat analisis gas kromatografi
spektrometri jisim. Yang, X. P. & Peppard, T. 1994. Solid-phase
microextraction for flavour analysis. J. Agric. Food
6. Rujukan Chem. 42: 1925-1930.
Ames, J. M., Guy, R. C. E. & Kipping, G. J. 2001.
Effect of pH, temperature and moisture on the Shibamoto, T. & Bernhard, R. A. 1977.
formation of volatile compounds in glycine/glucose Investigation of pyrazines formation pathways in
model systems. J. Agric. Food Chem. 49: 4315- sugar-ammonia model systems. J. Agric. Food
4323. Chem. 25: 609-615.
Buttery, R. G., Ling, L. C. & Stern, D. J. 1997. Vernin, G & Parkanyi, C. 1982. Occurrence and
Studies on popcorn aroma and flavor volatiles. J. formation of heterocyclic compounds. In The
Agric Food Chem. 45: 837-843. Chemistry of heterocyclic flavouring and arma
compounds; Vernin, G., Ed.; Ellis Horwood: New
York, pp 192-198.
LAMPIRAN
Jadual 1 Kompaun meruap Maillard yang utama dikenalpasti dalam cairan gula kabung (B1) pada 8 masa
proses pemanasan yang berlainana. (N=3)
N-heterosiklik (Pirazin) 5 90 375 1945 2108 3322 4541 5615
Pirazin 672 0 0 0 0 10 20 35 44
2-metil pirazin 823 0 0 32 77 83 228 437 609
2,5-dimetil pirazin 912 0 66 236 1075 1003 1400 1681 1942
2,3-dimetil pirazin 919 0 0 40 190 192 299 366 417
2,6-dimetil pirazin 936 0 0 0 25 13 26 28 32
2-etil-6-metil pirazin 992 0 0 0 73 47 63 159 317
2-etil-5-metil pirazin 1001 5 24 64 439 578 866 1033 1245
1016
2-ethenil-6-metil pirazin 0 0 0 21 17 19 22 34
3-etil-2,5-dimetil pirazin 1082 0 0 3 16 35 155 352 436
2-etil-3,5-dimetil pirazin 1088 0 0 0 9 21 26 116 157
5-etil-2,3-dimetil pirazin 1089 0 0 0 9 33 45 0 0
2,5-dietil pirazin 1091 0 0 0 11 21 31 33 42
Dimetil-2-vinil pirazin 1098 0 0 0 0 41 97 152 119
5-metil-6,7-dihidro-(5H)-siklopenta 1147
pirazin 0 0 0 0 0 0 3 17
3,5-dietil-2-metil pirazin 1162 0 0 0 0 5 23 73 104
1171
2,3-dietil-5-metil pirazin 0 0 0 0 4 6 10 19
2-metil-5-(-1-propenil)- pirazin 1197 0 0 0 0 4 12 15 28
2,5-dimetil-3-cis-propenil pirazin 1233 0 0 0 0 0 3 5 13
1240
2-isopropenil-3,6-dimetil pirazin 0 0 0 0 0 3 7 13
3-furfuril-2,5-dimetil pirazin 1413 0 0 0 0 0 0 7 10
O-heterosiklik (Furan Derivatif) 0 0 0 0 9 23 513 634
2-metil furan 598 0 0 0 0 8.6 20 38 30
2-metil tetrahidro furanone 806 0 0 0 0 0 3 19 27
2-furfural 835 0 0 0 0 0 0 178 193
2-furan metanol 860 0 0 0 0 0 0 221 322
5-metil furfural 964 0 0 0 0 0 0 50 55
2,5-dimetil-4-hidroksi-3(2H)furanone 1060 0 0 0 0 0 0 7 7
3-fenil furan 1224 0 0 0 0 0 0 4 17
a
kepekatan kompaun meruap dinyatakan dalam unit bahagian per billion (bpb).
b
Kovat indeks berdasarkan kepada siri alkane (C6-C22)
Jadual 2 Nilai ambang perisa, kepekatan dan luas puncak relatif kompaun meruap Maillard yang
dikenalpasti dalam cairan gula kabung B1 dan B2 pada masa pemanasan ke-240 min. (N=3)
KIb Ambang Kepekatanb (bpb) Log10 k/APc % LPRd
Perisab (bpb) B1 B2 B1 B2 B1 B2
N-heterosiklik (Pirazin) 5615 1119 89.8 70.7
Pirazin 672 180000 44 25 -3.6 -3.9 0.7 1.6
2-metil pirazin 823 60000 609 290 -2.0 -2.3 9.8 18.3
2,5-dimetil pirazin 912 1700 1942 417 0.1 -0.6 31.1 26.3
2,3-dimetil pirazin 919 2500 417 91 -0.8 -1.4 6.7 5.8
2,6-dimetil pirazin 936 1500 32 0 -1.7 - 0.5 0
2-etil-6-metil pirazin 992 317 88 5.1 5.6
2-etil-5-metil pirazin 1001 100 1245 126 1.1 0.1 19.9 8.0
1016
2-ethenil-6-metil pirazin 34 16 0.5 1.0
3-etil-2,5-dimetil pirazin 1082 436 33 7.0 2.1
2-etil-3,5-dimetil pirazin 1088 0.04 157 16 3.6 2.6 2.5 1.0
2,5-dietil pirazin 1091 42 0 0.7 0
Dimetil-2-vinil pirazin 1098 119 12 1.9 0.8
5-metil-6,7-dihidro-(5H)-siklopenta 1147
pirazin 17 0 0.3 0
3,5-dietil-2-metil pirazin 1162 104 7 1.7 0.4
1171
2,3-dietil-5-metil pirazin 19 0 0.3 0
2-metil-5-(-1-propenil)- pirazin 1197 28 0 0.5 0
2,5-dimetil-3-cis-propenil pirazin 1233 13 0 0.2 0
1240
2-isopropenil-3,6-dimetil pirazin 13 0 0.2 0
3-furfuril-2,5-dimetil pirazin 1413 10 0 0.2 0
O-heterosiklik (Furan Derivatif) 634 464 10.2 29.3
2-metil furan 598 30 0 0.4 0
2-metil tetrahidro furanone 806 27 12 0.4 0.7
2-furfural 835 300 193 201 -0.2 -0.2 3.1 12.7
2-furan metanol 860 1900 322 202 -0.8 -1.0 5.1 12.8
5-metil furfural 964 500 55 39 -1.0 -1.1 0.9 2.5
2,5-dimetil-4-hidroksi-3(2H)furanone 1060 60 7 0 -0.9 - 0.1 0
3-fenil furan 1224 17 10 0.2 0.6
a
Kovat indeks berdasarkan kepada siri alkane (C6-C22)
b
kepekatan kompaun meruap dinyatakan dalam unit bahagian per billion (bpb).
c
Nilai ambang perisa kompaun dalam larutan air dinyatakan sebagai bahagian kompaun per billion (109)
bahagian air
d
LRP: Luas puncak relatif kompaun meruap
2000 450
2-etil-3,5-dimetil pirazin
1000 2-etil-3,5-dimetil pirazin
200
800
150
600
100
400
200 50
0 0
30 60 90 120 150 180 210 240 30 60 90 120 150 180 210 240
Masa(min) Masa (min)
Rajah 1 Perubahan profil beberapa kompaun meruap kelas pirazin (LPR > 1%) yang terhasil semasa pemasakan
air nira (Arenga pinnata) B1 dan B2 pada selang masa yang berlainan.
350 350
Kepekatan, bahagian per billion (bpb)
2-furfural 2-furfural
Kepekatan, bahagian per billion (bpb)
300
B1 B2
300
2-furan
metanol 2-furan
250 250 metanol
5-metil
furfural 5-metil
200 200
furfural
150 150
100 100
50 50
0 0
30 60 90 120 150 180 210 240 30 60 90 120 150 180 210 240
Masa (min) Masa (min)
Rajah 2 Perubahan profil beberapa kompaun meruap kelas furan (LPR > 1%) yang terhasil semasa pemasakan air
nira nira (Arenga pinnata) B1 dan B2 pada selang masa yang berlainan.
Off-line Liquid-Liquid Extraction and Solid Phase Extraction and Online Pre-
Concentration Micellar Electrokinetic Chromatography for Analysis of
Organophosphorus Pesticides
Abstract
Micellar electrokinetic chromatography (MEKC) has grown tremendously in its application
since its inception in 1984 by Terabe et al. MEKC with on-column UV detection is the
common mode of detection for analytes but this suffer from several drawbacks such as its high
limit of detection (LOD) as limited by the optical path length of the column diameter. In an
attempt to decrease the LOD, several off-line and on-line methods have been developed for
the detection of pesticides. In the current study, solid phase extraction (SPE) and liquid-
liquid extraction (LLE) as an off-line extraction method was combined with an on-line
micellar electrokinetic chromatography for the separation and detection of three hydrophobic
organophosphorus pesticides (OPPS) at the ppb levels. The three OPPs studied viz.
quinalphos, diazinon and profenofos are commonly used in the agriculture sector in Malaysia.
The LOD of these three OPPs at sub-ppm levels were primarily achieved using sweeping, an
online concentration MEKC method obtained from an earlier MEKC separation. LLE with n-
hexane offered good reproducible recoveries of the OPPs from spiked lake water with LOD in
fractional ppb level while SPE with dichloromethane as eluting solvent also offered LOD at
the sub ppb level but with lower recoveries of the three OPPs (38-83%) compared to LLE (71-
111%). LLE also gave lower RSD values (8-14%).
Keywords: Micellar electrokinetic chromatography, sweeping, solid phase extraction, liquid-
liquid extraction, organophosphorus pesticides
962
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Wan Aini Wan Ibrahim, S. M. Monjurul Alam, A. B. Sulaiman
cartridge. Prior to passing the spiked water 5 mL) were combined in a glass vial. Organic
samples, the cartridge was activated with 2 mL solvents were evaporated to dryness by a gentle
DCM followed by 2 mL distilled water, and flow of nitrogen and reconstituted into the
immediately spiked water samples were slowly buffer matrices (1 mL) for the run in sweeping-
poured (ca. 3 to 5 mL per min) at a suction of MEKC.
<−0.3 bars. After loading the sample, the 3. Results and Discussions
cartridge was dried by passing air for at least 30 Figure 2 shows the electropherogram that was
min. The retained OPPs were eluted from the obtained in an earlier study by sweeping-
solid phase material with 2 × 3 mL DCM (at MEKC, where three OPPs were separated by
<−0.5 bars). Afterwards, the solvent was an optimized buffer consisting of 10 mM SDS,
evaporated to dryness using a gentle flow of 10 mM 1:1 v/v phosphate-borate buffer and
nitrogen and the residue was reconstituted into 10% v/v methanol-acetonitrile. In this
0.5 mL buffer matrix (defined in sweeping- sweeping, the presence of certain amount of
MEKC). The concentration of each OPPs organic solvents in sample matrices was found
became 0.5 ppm. The reconstituted sample for necessary to increase the solubility of
the run in sweeping-MEKC was filtered hydrophobic OPPs, especially for profenofos.
through a 0.45 µm filter disc to remove the A range of concentration (0.2 to 1.2 ppm) of
visible particles that supposedly was each OPP in several mixtures was used to
incorporated from the solid phase material of prepare a calibration curves for calculating the
the cartridges upon the suction condition LOD. The obtained LOD values in sub ppm
(<−0.5 bars). This level of suction was found levels
necessary to receive all retained OPPs from the
solid phase materials. (Table 1) could be considered as high and
unsuitable for determining the maximum
2.4 Liquid-Liquid Extraction (LLE) permissible limits (ca. in fractional ppb level)
Two common organic solvents, chloroform and of pesticides in water samples even though, the
n-hexane were used in this LLE procedure. sensitivity enhancement in this sweeping-
Separation funnels (300 mL) with Teflon MEKC over normal MEKC (results not shown
stopcocks and stoppers were used. Spiked here) were about 30 to 50 folds higher (see
water sample (250 mL) at 1 ppb of each OPP Table 1). Sensitivity enhancement factors in
was poured into the separation funnel and 2 mL terms of peak areas (SEFarea) or in terms of
of organic solvent (chloroform or n-hexane) peak heights (SEFheight) (presented in Table 1)
was added to it. The mixture was shaken were calculated respectively by the ratio of the
vigorously for 15 min and then allowed to peak areas or peak heights obtained from
stand for 30 min. The funnel was vented to sweeping-MEKC and normal MEKC and
reduce the pressure inside. Following this corrected by the dilution factors (see the
operation, the organic and aqueous layers were footnote of Table 1).
separated. When chloroform was used, the
aqueous layer resides over the organic phase, Other online concentration i.e. stacking [9] did
therefore organic portion was easily drained not render better results compared to sweeping-
into a glass vial and the second aliquot of MEKC because these OPPs are non-polar and
chloroform or n-hexane (2 mL) was added for quite hydrophobic. To further improve the
the next cycle. However, in the case of n- detection sensitivity; it is assumed that
hexane, the organic portion resides over the application of offline sample pre-concentration
aqueous phase, therefore the aqueous layer was technique e.g. SPE and LLE with common
drained into a cleaned beaker and the organic solid phase cartridges and common laboratory
extract was transferred into a glass vial. After organic solvents may improve the sensitivity of
that, water samples were again poured into the detection by multiplying the pre-concentration
separation funnel and 2 mL of another aliquot effect of online sweeping-MEKC methods.
of chloroform or n-hexane was added for 3.1 Two step enrichment by SPE and
second cycle of extraction. In total 5 sweeping-MEKC
extractions were done for one batch of 250 mL LC 18 is a common cartridge used in most of
spiked water (for extraction by both chloroform the analytical laboratory to extract the nonpolar
and n-hexane) and the total organic portion (2 × organic compounds from water, either by
3
1
EOF
Figure 2 Sweeping-MEKC for the separations of hydrophobic OPPs. Conditions: separation buffer
contained 10 mM 1:1 phosphate-borate buffer (pH 9.3), 10 mM SDS and 10 % v/v 1:1 methanol-
acetonitrile; sample prepared in 10 mM 1:1 phosphate-borate buffer (pH 9.3) and 10 % v/v 1:1 methanol-
acetonitrile; applied potential 25 kV; electrokinetic sample injection for 100 s at 15 kV; total capillary
length 82 cm and effective length 42 cm. Peaks: EOF (electroosmotic flow); 1, diazinon (0.8 ppm); 2,
quinalphos (0.4 ppm); 3, profenofos (0.4 ppm)
Table 1 LODs and Sensitivity Enhancement Factors (SEFarea and SEFheight) in sweeping-MEKC over
normal MEKC of three hydrophobic OPPs
LOD by peak area LOD by peak height a b
OPPs SEFarea SEFheight
Diazinon 0.15 ppm 0.18 ppm 33 47
Quinalphos 0.11 ppm 0.21 ppm 33 42
Profenofos 0.13 ppm 0.21 ppm 27 30
NB. SEFarea = (peak area obtained with sweeping-MEKC/peak area obtained with normal NM-MEKC) ×
dilution factor
SEFheight = (peak height obtained with sweeping-MEKC/peak height obtained with normal NM-
MEKC) × dilution factor
spiking or naturally occurring, into small The possible sources of unidentified peaks in
amount of suitable organic solvents. DCM is Figure 3 are the impurities inherited from
one of the organic solvents that has been extracting solvent, or the results of partial
preferred for extraction of nonpolar compounds decomposition of OPPs on solid surface, or it
with LC 18 cartridges in undergraduate could be the remnants of solid phase materials
research project in our laboratory. The that were dislodged by higher suction pressure.
demonstrated SPE procedure was applied to However, these impurity peaks did not interfere
separate these three OPPs by sweeping-MEKC. with the peak of interest. It is assumed that this
Figure 3 shows the electropherogram that was routine-use of LC 18 cartridge may not be
obtained by the two steps enrichment process suitable for these OPPs when DCM is used or
of SPE and subsequent sweeping-MEKC. The vice versa, and suitable SPE method could be
recoveries and the calculated LOD are obtained when other cartridges and different
presented in Table 2. The recoveries were extracting solvents would be optimized in
found to be very poor and the reproducibility of combinational manner, for which substantial
recoveries was unsatisfactory as it was time is required to optimize both parameters.
enormously high. The LOD, after a 500-fold
3.2 Two steps enrichment by LLE and
enrichment from SPE, is still high for
sweeping-MEKC
quinalphos and profenofos, if it was calculated
The LLE procedure from the Experimental
in terms of peak heights.
section was applied to separate these OPPs by
EOF 1
3
Figure 3 SPE by C18 and DCM in sweeping-MEKC for the separation of hydrophobic OPPs. Other
conditions, sample preparation and injection are similar to Figure 1. Peaks: EOF, 1 diazinon, 2
quinalphos, 3 profenofos, each 0.5 ppm. Sample enrichment from SPE: 500 fold (250 mL of 1 ppb were
finally reconstituted in 0.5 mL buffer matrix)
Table 2 Recoveries and LOD of SPE in sweeping-MEKC for the separation of hydrophobic OPPs (n = 3)
OPPs Recoveries %, peak Recoveries %, peak
area basis (RSD) LOD, by peak area height basis (RSD) LOD, by peak
height
Diazinon 83 (16) 0.32 ppb 80 (8) 0.45 ppb
Quinalphos 42 (16) 0.48 ppb 30 (18) 1.8 ppb
Profenofos 38 (41) 0.55 ppb 25 (43) 1.1 ppb
Figure 4 LLE by chloroform in sweeping-MEKC for the separation of hydrophobic OPPs. Conditions:
separation buffer, sample preparation, sample injection is similar to Figure 2; total capillary length 72 cm
and effective length 37 cm. Peaks: 1 diazinon, 2 quinalphos, 3 profenofos, each 0.25 ppm. Sample
enrichment from LLE: 250 fold (250 mL of 1 ppb were finally reconstituted in 1.0 mL buffer matrix)
Table 3 Recoveries and LOD of LLE by chloroform in sweeping-MEKC for the separation of
hydrophobic OPPs ( n = 3)
OPPs Recoveries %, LOD, by peak Recoveries %, LOD, by peak
peak area basis area peak height basis height
(RSD) (RSD)
Diazionon 55 (18) 0.60 ppb 77 (8) 0.90 ppb
Quinalphos 48 (23) 0.70 ppb 56 (19) 2.0 ppb
Profenofos ---- ---- ----- ----
1
3
Figure 5 LLE by n-hexane in sweeping-MEKC for the separation of hydrophobic OPPs. Conditions:
separation buffer, sample preparation, sample injection is similar to Figure 4. Peaks: 1 diazinon, 2
quinalphos, 3 profenofos, each 0.25 ppm. Sample enrichment from LLE: 250 fold (250 mL of 1 ppb were
finally reconstituted in 1.0 mL buffer matrix)
Table 4 Recoveries and reproducibility of LLE (by n-hexane) in sweeping-MEKC for the separation of
hydrophobic OPPs (n = 3)
impurities of the extracting solvents as in total Figure 5 shows the electropherogram of LLE
10 mL organic solvents were used for five with n-hexane and sweeping-MEKC
cycle extraction and were evaporated separation. The recoveries and the calculated
thereafter. A few broad hump-like peaks with LOD are presented in Table 4. LLE with n-
shorter migration (between 5 to 10 min) are hexane has offered better reproducible
probably due to the dissolved trace materials in recoveries compared to the other two
water that were concentrated by the extracting counterparts. The lowest recoveries was 71%
solvents. The LOD on the basis of peak height, profenofos on the basis of peak height but it
including 250-fold enrichment is still high for was 92% on peak area basis, that implied its
quinalphos poor peak efficiency compared to direct run of
Table 4 Recoveries and reproducibility of LLE (by n-hexane) in sweeping-MEKC for the separation of
hydrophobic OPPs (n = 3)
IB
1
3
Ag3
Figure 6 Blank and aged standard runs in sweeping-MEKC for the separation of hydrophobic OPPs. A,
run of three aged OPPs; B, sample matrices run without OPPs; Conditions: separation buffer, sample
preparation, sample injection is similar to Figure 2. Peaks: 1 diazinon, 2 quinalphos, 3 profenofos each
0.25 ppm, IB Impurities associated with buffer, Ag3 peak is from aged profenofos (ca. 3 months)
standard. The LOD obtained was in fractional 2). The same deionized water source was used
ppb level. However, most of the unidentified but was collected in different time period. And
peaks were found attributable to the impurities similarly, acetonitrile used in Figure 5 was
inherited in extracting solvent, therefore, the from a different batch but the brand was same.
purity of extracting solvent are crucial. Similar Secondly, because of aging of stock standards,
to chloroform but to a lesser extent, n-hexane profenofos gave a pair of peak (Figure 6,
also has concentrated some hydrophilic Figure 2), where the first one is considered to
impurities with shorter migration times. be the equivalent to the peak of profenofos in
However in LLE, the system was shaken Figure 1. The comparatively faster migration of
arbitrarily for 15 min considering that each OPP in Figure 6 is due to the shorter
equilibrium has been achieved and sometimes capillary length used in this study (Figure 4 –
emulsions was formed; therefore it was stand 6).
for a longer time.
4. Conclusions
At the end, sweeping-MEKC of OPPs In conclusion, LLE with common laboratory
standards and blank water samples without organic solvent n-hexane was found to be the
spiking any OPPs were also made (Figure 6). quicker way to improve the detection
The single peak in blank sample is either sensitivity but in this regard solvent of highest
impurity from water or from acetonitrile, as the purity level should be used, therefore the
other components were same as before (Figure chance of concentrating the impurities in
certain zones would be minimized. The LOD electrokinetic chromatography. J. Chromatogr. A.,
attainable with offline SPE (using DCM) and 793, 331-340.
offline LLE (using n-hexane) was in the range [5] Quirino, J. P., Inoue, N. and Terabe, S. (2000).
of 0.45 – 1.0 ppb and 0.62 – 1.01 ppb Reversed migration micellar electrokinetic
respectively with recoveries ranging from 38 – chromatography with off-line and on-line
83% and 71 – 112% respectively. concentration analysis of phenylurea herbicides. J.
Chromatogr. A., 892, 187-194.
5. Acknowledgment
The authors gratefully acknowledged the [6] Farran, A. and Ruiz, S. (2004). Application of
financial support provided by Ministry of solid-phase extraction and micellar electrokinetic
capillary chromatography to the study of hydrolytic
Science, Technology & Innovation (MOSTI),
and photolytic degradation of phenoxy acid and
Malaysia through IRPA grant (project no: 08- phenylurea herbicides. J. Chromatogr. A., 1024,
02-06-0060). 267-274.
6. References [7] W. Ibrahim, W. Aini., Alam, S. M. M. and
[1] Susse, H. and Muller, H. (1995). Application of Sulaiman, A. 2003. Separation of organophosphorus
micellar electrokinetic capillary chromatography to pesticides using micellar electrokinetic
the analysis of pesticides. Fresenius J. Anal. Chem., chromatography. Jurnal Teknologi, 38 (C) Jun., 51-
352, 470-473. 60.
[2] Susse, H. and Muller, H. (1996). Pesticide [8] Quirino, J. P. and Terabe, S. (1999). Sweeping
analysis by micellar electrokinetic capillary of analyte zones in electrokinetic chromatography.
chromatography. J. Chromatogr. A., 730, 337-343. Anal. Chem., 71, 1638-1644.
[3] Farran, A., Ruiz, S., Serra, C. and Aguilar, M. [9] Quirino, J. P., Kim, J. B. and Terabe, S. (2002).
(1996). Comparative study of high-performance Sweeping: concentration mechanism and
liquid chromatography and micellar electrokinetic applications to high-sensitive analysis in capillary
capillary chromatography applied to the analysis of electrophoresis. J. Chromatogr. A., 965, 357-373.
different mixtures of pesticides. J. Chromatogr. A.,
737, 109-116. [10] Kim, J. B. and Terabe, S. (2003). On-line
sample preconcentration in micellar electrokinetic
[4] He, Y. and Lee, H. K. (1998). Orthogonal array chromatography. J. Pharm. Biomed. Anal., 30,
design experiments for optimizing the separation of 1625-1643
various pesticides by cyclodextrin-modified micellar
Abstract
Monazite (La,Ce,Nd)PO4 is an ubiquitous mineral in any heavy mineral assemblage found in
almost all heavy mineral samples from placer mining through-out Peninsular Malaysia. In
the Peninsular, two monazite varieties, yellow and green, are found. The yellow variety is
common, observed as fine brownish-yellow rolled, elongated grains, found all over the
country, while the green variety, observed as flattened grains, is rare and observed only in
significant amount in samples from Semiling in Kedah. Monazite grains from this and other
localities were studied under the microscope and microanalysed using a Phillips XL30
Scanning Electron Microscope equipped with an X-ray element analyser. Analytical results
show that in most samples, Ce is the dominant REE and that they are monazite-Ce. Of the
yellow and green monazite, the brownish yellow monazite has higher La (0.00 – 20.13 %) and
Ce (28.07%-38.13%) contents, while the green variety contains lower La ( max. value
13.32%), lower Ce ( max. 29.24%), and higher number of accessory elements. Of the
accessory elements, Ca and U is present in the green monazite but is not found in the yellow
monazite and the green colour of some monazite may probably be caused by the presence of
these elements. Geologically, the common yellow monazite is associated with hydrothermal,
lower temperature-pressure tin-bearing formational environment whereas the green monazite
is found in significant amount only in Semilng where it is associated with a higher
temperature-pressure pegmatitic Sn-Nb-Ta environment.
Key words: alluvial monazite, colour difference, grains shapes, Peninsular Malaysia, SEM
microanalysis,
970
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Wan Fuad Wan Hassan
= 100um
Figure 1.a
Figure 1. b
Figure 1. c
yellow and green grains are shown in Figures 2 detected are Fe, U, C, Ca, Ag, Al, Si, Th, Sm,
and 3. Gd, Pt, Rb and Cs. The accessory elements are
present in some of the samples only. Most
The dominant element present in monazite is
notable among them are U, Th and Ca. Despite
oxygen, O with content ranging from 10.44%
the fact that Pb, Th and U content were being
to 32.6 % followed by phosphorus with a
fully utilized in age dating of rock using
range of 2.77% to 15.59 %. Three dominant
monazite (Grove & Harrison 1999,
rare earth element present are Ce (15.81% -
Timmermann 2000), the three elements are not
38.13%), Nd ( 5.89% - 13.50%) and La (0.00%
always present in the Malaysian monazite. As
– 20.42%). A number of accessory elements
shown by the results, Th is not a common
Table 2.Chemical composition of yellow monazite from Semiling and Sungai Satak
element in monazite as only 1 in 8 sample indicating that all the analyzed monazite grains
contains Th with a content of 18.37 %. are monazite-Ce.
Uranium is also not common ( 3 in 8)
Comparing the green from yellow monazite in
containing 1.46 – 7.95 % U and it is detected
term its chemical composition, a significant
only in the green monazite. Traces of Ca, C,
difference would be the presence of Ca, which
Ag and Fe were also detected. Ca is present
is present in 2- 3 % in all green monazite but
about 2-3 % in green monazite but not detected
not detected in the yellow variety. The presence
in the yellow variety. In all samples analysed,
of Ca may probably be the cause of the colour
the dominant rare metal element is Ce,
difference. Interaction of Ca with other
Semiling G 3
Bakri G 1
Sungai Satak y
Semiling y 4
Figure 3. Compositional spectrograms of yellow monazite grains from Sungai Satah and Semiling
elements present perhaps alters the colour from the green variety as yellow monazite shows no
brownish yellow to green. presence of Ca and U.
5. Conclusion 6. Acknowledgement
From the present study, the following The present writer wishes to thank the Fakulti
conclusions are derived: Sains dan Teknologi Universiti Kebangsaan
Malaysia for the permission and financial
a) Malaysian monazite, like occurrences in
support rendered to attend this conference.
other parts of the world, are monazite-Ce.
Monazite-La and monazite Nd were not 7. References
encountered. Berry, L.G., B. Mason & R.V. Dietrich, 1951.
Mineralogi: konsep, pemerihalan dan penentuan.
b) The REE composition of the monazite is not Dewan Bahasa dan Pustaka, Kuala Lumpur.
strongly connected to the crystal shape of the
grains as the monazite-Ce observed in the Ford, W.E., 1951. Dana’s textbook of mineralogy,
John Wiley and Sons.New York.
samples can assume shapes of elongated rolled
grains as well as the flattened shape. Grove, M., & T.M. Harrison, Monazite Th-Pb age
depth profiling. Geology, 27(6), 1999, pp 487-490
c) The colour difference of the monazite may
probably be due to the presence of Ca and U in http://webmineral.com/java/Monazite
Timmermann, H., R.R. Parrish, S.R. Noble & R. Wan Fuad Wan Hassan 1989. Some characteristics
Kryza., 2000. New U-Pb monazite and zircon data of the heavy detrital minerals from Peninsular
from the Sudetes Mountain in SW Poland: evidence Malaysia. Geol. Soc. Malaysia, Bull 24, 1989; pp 1-
for a single cycle Variscan. Jour. Geol. Soc., 157(2), 12.
2000, pp 265-268.
Abstract
Laboratory batch experiments were carried out to study the competitive sorption behaviour of
heavy metals (Pb, Cu, Ni and Zn) in five types of Malaysian soils, differing in their
physicochemical properties; weathered metasediment from Air Hitam, Puchong (AHQ), river
alluvium soils from Sg. Sedu (SSC), lateritic soils from Sg. Sedu (SSL) and Taman Beringin
(TBL), and graphitic schist from Ampang Pechah (APS). The tests were carried out in two
systems, i.e. single element solution and mixed solution of pure heavy metal nitrate salts. Soil
AHQ possesses high sorption capacity compared to others in both systems. The sorption
capacity of these soils, in both systems, for all the heavy metals can be ranked as follow:
AHQ>SSC>SSL>TBL>APS. Pb has a better affinity for sorption in all soils compared to
other heavy metals. Heavy metals were highly adsorbed in single solution compared to the
mixed solution. This is due to the less competition for sorption sites in single system as
compared to in the mixed system; i.e. competition among the heavy metals for sorption sites
on the soil solid constituents in the mixed system.
Keywords: Competitive sorption, heavy metals, landfill, batch equilibrium test, soil
976
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Wan Zuhairi Wan Yaacob and Abdul Rahim Samsudin
P E R A K P A H A N G
N
Ampang Pechah Landfill
Kundang Landfill
STRAITS OF
MALACCA
Pandamaran Landfill
LEGEND
Ampar Tenang Sg. Kembong Landfill
Landfill Landfill
(Sampling location)
Sg. Sedu Landfill
N E G E R I
S E M B I L A N
0 25 km 50 km
standard method reported by USEPA (1992). and 400 mg/l). Nitrate salts were chosen
The same procedure was also reported by Yong because of their poor ability to complex
et al (1992), Yong (2001) and Wan Zuhairi metallic cations.
(2000, 2003a, 2003b). According to Jessberger
3. Results and Discussions
et al (1997), batch tests provide a quick method
Adsorption isotherms in single system (single
of estimating the sorption capacity of soils. In
element)
BET, 4g of soil was mixed with 40 ml of
The adsorption of Pb in a single system for
known concentration of tested solution, i.e.
different samples is presented in Figure 2. The
HMs. After 24 hours of agitation, soil and
results show that the amount of Pb adsorbed
solution (supernatant) were then separated by
from single Pb(NO3)2 solution increased with
centrifuging. The solution was then analysed
the equilibrium concentration of Pb in the
using AAS to determine the concentration of
solution. Soil AHQ adsorbed more Pb
HMs left in the solution. The concentration of
compared to other soils, with the maximum
HMs adsorbed by soils was then calculated
concentration of 2.1 mg/g; i.e. which is about
using an equation below:
43% of the initial concentration of Pb (Co=484
(C o − C )V mg/L). Soil AHQ adsorbed 87% of the total Pb
q= at the early stage of the test using lower
M
concentration of Pb (Co=46mg/L). This
Where, indicates that at lower concentration, soil AHQ
has extra free sorption sites and capable of
q = the amount of contaminant removed from
receiving all Pb, i.e. the input Pb was below the
solution (mg/g)
adsorption capacity of this soil, which is very
Co = the concentration of contaminant in the much depending on their cation exchange
solution before mixing with soil (mg/L) capacity, surface area, and other
C = the equilibrium concentration of physicochemical properties. While at higher
contaminant left in the solution after the concentration, free sorption sites are only
experiment (mg/L) capable to accommodate some of the Pb ions
and some are left free in the solution after
V = volume of solution in the centrifuge tubes equilibrium (i.e. all the available sorption sites
(40 ml) are now saturated with Pb). Therefore, the
M = mass of soil in the tubes (4g) sorption of HMs is highly active at lower
concentration compared to at the higher
The test was carried out in two systems; (i) concentration. According to Mohamed et al
single element solution of Pb, Cu, Ni and Zn; (1992) at low concentration, clay particles tend
and (ii) mixed solution containing all four disperse due to the full development of the
elements (multi-cation condition). All diffuse double layer, therefore clay particle
solutions in both systems were prepared using surfaces in contact with the solution at the
nitrate salt with different concentrations maximum. Meanwhile, the addition of HMs at
ranging from 50-400 mg/L (50, 100, 200, 300 higher concentration further enhanced the
2.5
1.5
0.5
Pb Zn Cu Ni
2
AHQ soil samples (mg/g)
1.5
0.5
0
0 100 200 300 400 500
Equilibrium concentration (mg/L)
Figure 3. The affinity for sorption of heavy metals in single system (an example for AHQ soil).
1 .2
Amount of Pb adsorbed by soil samples from
AHQ
SSC
1 APS
TBL
SSL
mixed solution (mg/g)
0 .8
0 .6
0 .4
0 .2
0
0 100 200 300 400 500
E q u il ib r iu m c o n c e n t r a t io n ( m g / L )
competition for exchange sites (Veeresh, et al varies, where Pb is highly sorbed compared to
2003; Polcaro et al 2003). The sorption Zn, Cu and Ni. The affinity of heavy metals to
capacity for Pb in a single solution can be be sorbed by all soil samples can be ranked as
ranked as follow; AHQ>SSC>SSL>TBL>APS. Pb> Zn ≈Cu >Ni.
The affinity of heavy metals for sorption also
2.5
(mg/g)
(mg/g)
0.4
1
0.3 Zn-single
Pb-single Zn-mixed
0.5 0.2
Pb-mixed
0.1
0
0 100 200 300 400 0
Equilibrium concentration C, mg/L 0 100 200 300 400 500 600
Equilibrium concentration, mg/L
0.45
Amount of Cu adsorbed from single
0.7
0.4
0.6 (b) 0.35
(d)
0.5 0.3
(mg/g)
0.4 0.25
(mg/g)
0.2
0.3
0.15
0.2 0.1 Ni-single
Cu-single
0.1 0.05 Ni-mixed
Cu-mixed
0
0
0 100 200 300 400 500
0 100 200 300 400 500
Equilibrium concentration, mg/L
Equilibrium concentration, mg/L
cation exchange sites caused by the high levels metals by soils. Isotherms and fractional factorial
of cation present in the mixed solution. The experiments. Environ Pollut. 101:275-284.
cations (Pb, Cu, Ni and Zn) in the multi-ion Frost, R.R. and Griffin, R.A., 1977. Effect of pH on
solution competed with each other for the Adsorption of Cooper, Zinc and Cadmium from
available cation exchange site. Landfill Leachate by Clay Minerals. Journal of
Environmental Science and Health. A12 (4&5), pp.
This phenomenon can also be observed in other 139-156.
HMs as depicted in Figures 6b, 6c and 6d. The
difference of HMs sorption in both solutions Jessberger, H.L., Onnich, K., Finsterwalder, K., and
would give information of the behaviour of Beyer, S. 1997. Experimental and numerical studies
of contaminant transport through mineral liners and
HMs in the real leachate (i.e. field condition).
resulting improvements in liner materials. In.
We can expect that the sorption of HMs in the Advanced Landfill Liner System. Ed. August, H.,
landfill leachate would be much lower due to Holzlohner, U., and Meggyes, T. Thomas Telford:
the competitiveness for sorption sites between London
various pollutants in leachate.
Mohamed, A.M.O, Yong, R.N., Tan, B.K., Farkas,
4. Conclusions A., and Curtis, L.W. (1992). Geo- Environmental
The study has revealed that the sorption Assessment of a Micaceous Soil for its Potential
behaviour of heavy metals in single system is Use as an Engineered Clay Barrier. Geotechnical
difference compared to in the mixed solution. Testing Journal, ASTM, 17 (3): 291-304.
The amount of HMs sorbed in a single system Polcaro, A.M., Mascia, M., Palmas, S., Vacca, A.,
is higher than the amount sorbed in the mixed and Tola, G. 2003. Competitive sorption of heavy
system due to the competition between HMs metals ions by soils. Environmental Engineering
for sorption sites at the surfaces of soil Science. 20 (6):607-616.
components. The study suggests that Usepa (1992). Batch-Type Procedures for
competition exists between solutes at Estimating Soil Adsorption of Chemicals,
equilibrium with the solid phase, especially for EPA/530/SW-87/006-F. Washington, D.C. : US
high solute concentrations (i.e. higher Environmental Protection Agency.
competition among HMs at higher Wan Zuhairi W.Y. 2000. An investigation of
concentration). Soils have different capacity for natural attenuation characteristic of natural clay
sorption. The study also revealed that soil soils from South Wales and their potential use as
AHQ has a better capacity for sorption engineered clay liner. Thesis Doctor of philosophy
compared to other soils. The sorption capacity (Ph.D.). Cardiff University (unpublished)
for these soils in both systems can be ranked as; Wan Zuhairi, W.Y. 2001. Soils Suitability for
AHQ>SSC>SSL>TBL>APS. HMs have Landfill Liner Material Based on Their Physico-
different affinity for sorption. Pb has higher Chemical Properties: A Case Study from South
affinity for sorption compared to others. The Wales, United Kingdom. Majalah Geologi
sorption affinity of HMs differ in both systems Indonesia (MGI – Special Edition ISSN 0216-1061),
as shown by this study and can be ranked as Vol. 16: 115-122.
follow: Pb> Zn ≈Cu >Ni (single system) and Wan Zuhairi W.Y. 2003a. Sorption capacity on
Pb>Cu>Ni>Zn (mixed system). lead, copper and zinc by clay soils from South
Wales, United Kingdom. Journal of Environmental
5. Acknowledgements
Geology, 45(2): 236 - 242.
This study is part of the project funded by
IRPA No. 08-02-02-0008-EA178 and UKM’s Wan Zuhairi, W.Y. 2003b. Heavy Metal Sorption
Short Grant S/27/2000. Special thanks to Mr. Capabilities of some Soil Samples from Active
Yaacob Othman for his technical help with Landfill Sites in Selangor. Geological Society of
AAS. Malaysia, Bulletin 46, pp 295-297.
Wan Zuhairi, W.Y., Abdul Rahim Samsudin, Mohd
6. References Ramziemran & Chan Yik Loon. 2004. Natural
Elliot, H.A., Liberati, M.R., and Huang, C.P. 1986.
Sorption Capability of Heavy Metals: Granitic
Competitive adsorption of heavy metals by soils.
Residual Soil from Broga and Marine Clay from Sg.
Soil Sci Soc Am J. 46:1153-1158.
Besar Selangor. Geological Society of Malaysia,
Echeverria, J.C., MOrera, M.T., Mazkiaran, C. and Bulletin 48, pp. 13-16.
Garrido, J.J.1998. Competitive sorption of heavy
Veeresh, H., Tripathy, S., Chaudhuri, D., Hart, B.R.
and Powell, M.A. 2003. Competitive adsorption
behaviour of selected heavy metals in three soil Yong, R.N., Mohamed, A.M.O & Warkentin, B.P.
types of India amended with fly ash and sewage 1992. Principles of Contaminant Transport in Soils.
sludge. Environmental Geology. 44:363-370. Elsevier, New York.
Yong, R. N. 2001. Contaminated soils, pollutant
fate and mitigation. CRC press, New York.
Wan Zuraida Wan Mohd. Zain1), Sjamsul A. Achmad2), , Euis H. Hakim2), Jalifah Latip1),
Nik Idris Nik Yusof 3) and Yana M. Syah2)
1)
School of Chemistry and Food Technology, Faculty of Science and Technology, National University of
Malaysia, 43600 Bangi, Selangor, Malaysia
2)
Department of Chemistry, Institut Teknologi Bandung, Jalan Ganesha 10, Bandung 40132, Indonesia.
3)
MBH Manufacturing & Marketing Sdn. Bhd. Lot 18, Jalan Modal 23/2, Kawasan Miel, Fasa 8, 4000 Shah
Alam, Selangor.
Abstract
Four oligostilbenes, i.e. (-)-ε-viniferin (1), laevifonol (2), (-)-hopeaphenol (3), vaticanol B (4),
one stilbene glucoside resveratrol-13-O-glucopyranoside (5), and one gallic acid derivative
bergenin (6), were isolated from the acetone and MeOH extracts of the tree barks of V.
odorata. The structures of compounds 1-6 were established on the basis of their spectral data,
including UV, IR and NMR spectra, in comparison with the previously reported data and by
the result of X-ray chrystallogaphy analysis for compound 6. The presence of these
metabolites in V. odorata suggested a close chemotaxonomic relationship between this plant
with V. umbonata and V. rassak.
Keywords: Vatica umbonata, Dipterocarpaceae, oligostilbenes, chemotaxonomy.
with acetone and MeOH at room temperature to hopeaphenol (3), vaticanol B (4), resveratrol-
give acetone (27 g) and MeOH (11 g) extracts, 13-O-glucopyranoside (6), and bergenin (5),
respectively. A part of the MeOH extract (20 g) respectively. Compound 5 was also confirmed
was fractionated using liquid vacuum by analysis of X-ray chrystallograpy.
chromatography technique (silica gel 150 g)
3. Results and discussion
eluted with (each 150 ml) n-hexane-EtOAc of
Four oligostilbenes, i.e. (-)-ε-viniferin (1)
increasing polarity to give five major fractions
(Oshima et al., 1995), laevifonol (2) (Hirano et
A-E. Fraction B (2.2 g) was purified with flash
al.. 2003), (-)-hopeaphenol (3) (Cogon et al.,
and radial chromatography (silica gel) eluted
1972), vaticanol B (4) (Tanaka et al., 2000),
with n-hexane-EtOAc and CHCl3-MeOH,
one stilbene glucoside resveratrol-13-O-
respectively, afforded ε-viniferin (315 mg) (1),
glucopyranoside (5), and one gallic acid
and vaticanol B (100 mg) (4). Purification of
derivative bergenin (6), were isolated from the
fraction E using the same method gave
acetone and MeOH extracts of the tree barks of
hopeaphenol (60 mg) (3) and laevifonol (40
V. odorata. The isolation of these compounds
mg) (2). Also, using the same methodology,
was carried out with several chromatographic
fractination and purification of the acetone
methods (vacuum liquid, flash, and radial
extract gave bergenin (12 mg) (6) and
chromatography) on silica gel eluted with
resveratrol-13-O-glucopyranoside (25 mg) (5).
various solvent systems. The structures of
The structure of compounds 1-6 was elucidated compounds 1-6 were established on the basis of
based on spectroscopic data, including UV, IR, their spectral data, including UV, IR and NMR
and NMR spectra (data not shown here), as spectra, in comparison with the previously
well as by comparison with the those reported reported data and by the result of X-ray
data, to be ε-viniferin (1), laevifonol (2), chrystallogaphy analysis for compound 6.
HO
H O OH
H
HO O OH
H OH
H OH HO
HO H O
HO O HO O OH
OH
OH
OH O H
OH O
O
1 5 OH
OH
3
HO
H O OH HO O H H O OH
OH
HO OH HO
H H H
H H H
H O
HO OH HO
H H H H
OH HO OH
H
OH
OH HO OH
HO
12d OH
OH
3
4
O
HO
O
H
OH
H3CO
H
OH O
OH
6 OH
The Effect of Palm Oil Vitamin E Supplementation on DNA Damage and Certain
Immune Parameters in the Ageing Population
Wan Zurinah Wan Ngah1), Noor Aini Abdul Hamid1), Azian Abdul Latiff2), Zaiton Zakaria3),
Musalmah Mazlan1), Johari Ibahim1), Chin Siok Fong1), Aminuddin Abdul Karim3)
Abstract
The free radical theory of ageing has been widely accepted where ageing occurs as a result of
oxidative stress leading to detrimental accumulation of damage to cellular components.
Antioxidants have therefore been suggested to be protective. The objective of this study is to
evaluate the effects of 6 months Tri E (vitamin E extracted from palm oil containing 60%
tocotrienols and 40% tocopherols) supplementation on certain immune parameters and DNA
damage in the healthy adult. A single blind, placebo controlled trial was conducted in healthy
subjects age 35-70 years old with fasting blood collected at 0, 3 and 6 months of
supplementation where subjects received either Tri E capsule (160mg/d) or placebo. After
obtaining informed consent, fasting blood samples (18 ml) were taken from 24 healthy
individuals who passed the screening test. No significant differences in lymphocyte
percentage, CD4+, CD8+, B cell, natural killer cells and CD4/CD8 ratio was observed
between the two groups. Endogenous antioxidant defense measured by the determination of
erythrocyte super oxide dismutase (SOD) was found to increase while glutathione peroxidase
(GPx) was unchanged with supplementation. HDL increased after 6 months (p<0.05)
supplementation while alanine transaminase (ALT) although within normal range was
decreased after 3 and 6 months (p<0.05). A significant increase in the number of undamaged
DNA (p<0.05) and decrease in mildly damaged DNA (p<0.05) as measured by comet assay
were observed after 6 months of supplementation. In conclusion, the results suggest that
vitamin E supplementation did not alter the lymphocyte subset parameters and had no effect
on immune response. However, it is interesting to note that vitamin E supplementation maybe
beneficial by causing increases in HDL, SOD levels while decreasing ALT enzyme activity
and levels of DNA damage.
Key words: Ageing, Correlation, Free Radical, Immune Response, Oxidative Stress.
the ageing rate and subsequent disease risk and supplementation and the second group receive
pathogenesis. placebo. In this report, a total of 10 subjects for
group 1 and 14 subjects for group 2 have been
In addition, ageing has been reported to relate
recruited. Ethical approval was obtained from
to increasing oxidative stress levels. Oxidative
the Research and Ethics Committee of the
stress is characterized by the imbalance
Medical Faculty, UKM. Informed consent was
between oxidant production and antioxidant
obtained from the subjects. Fasting blood
defense in cells where oxidant production is
(18ml) was taken from each subject who fulfills
higher than antioxidants (Halliwell, 1991). This
the inclusion criteria. Their medical history and
imbalance will result in an increase in the aging
background details were taken and they were
process (Sohal & Allen, 1985). Oxidative status
required to answer a food frequency
is determined by measuring antioxidant
questionnaire and to undergo a full physical
enzymes SOD, CAT, GPx, and natural
examination.
antioxidants such as α-tocopherol, ascorbic
acid, β-carotene and α-lipoic acid. Human Monoclonal antibodies were used to
studies are limited due to the high cost involved determined subpopulations of lymphocyte
and logistic problems but needs to be done. including T cells, cells positive to CD3 surface
There is also limited information on these antigen; T cytotoxic/suppressor, cells positive
antioxidant enzymes in the literature. for CD 8 surface antigen: and B cells, cells
positive for CD19 cell surface antigen. 2 ml
A strong positive correlation has been venous bloods were collected in EDTA tubes
identified between maximum life span and and thoroughly mixed. 20 µl of monoclonal
concentrations of antioxidants such as antibody conjugate (Becton Dickinson) was
tocopherol in plasma. As free radical reactions placed at the bottom of tubes as follows CD4,
have been indicated as the cause of ageing and CD8, CD19 and CD16+56 and 50 µl of whole
many age-related degenerative diseases, blood were added, vortexed gently and were
nutritional supplementation especially with incubated for 15 minutes in the dark at 4oC.
antioxidants are promoted for health benefits RBCs were lysed using 0.5 ml FACS lysing
and increasing longevity. As such, interest has solution and incubated 10 minute at room
focused on the potential health benefits of temperature in the dark. Data were acquired
vitamin E from palm oil that has been reported using FACSCAN flow cytometer (Becton
to contain a high percentage of tocotrienols as
Dickinson) and simulSET® programme.
well as tocopherols.
Comet assay was performed as described by
Generally, reports on the relationship between
Singh et al. (1988) with slight modifications.
age and the accumulation of products of
Fully frosted microscope slides were precoated
oxidative damage to proteins, lipids and nucleic
with a layer of 0.6% normal melting point
acids are limited. It is also suggested that an
agarose at about 50°C. They were covered with
imbalance between the pro oxidant, antioxidant
cover slips to flatten out the molten agarose
and recovery, substitution or impaired
layer and chilled to enhance gelling of the
biological protein will influence the ageing
agarose. The following operations were
process. The objectives of this study are to
performed under dim light to prevent further
determine the effects of six months vitamin E
DNA damage. Blood samples were suspended
(Tri-E) supplementation on immune response,
in 0.6% low melting points agarose in PBS, pH
enzymes SOD and GPx and DNA damage as
7.4. After removing the cover slips from the
measured by the comet assay.
slides, the cell suspensions were pipetted onto
2. Materials and Methods the first agarose layer at about 37°C and cover
A single blind, placebo controlled study was slips were applied once again. The LMP
carried out where inclusion criteria are subjects agarose was allowed to solidify on an ice-cold
do not smoke or drink alcohol, or on any flat tray. After removal of the cover slips, the
medication or take vitamin supplements, free slides were immersed into ice-cold lysing
from any chronic diseases and are not pregnant. solutions (2.5 M NaCl, 100 mM EDTA, 10 mM
Subjects were divided into two groups where Tris at pH 10, 1% Triton X-100, 1% sodium N-
one group received Tri E capsule (160mg/day) lauroyl sarcocinate, 10% DMSO) at 4°C for 1
hour to remove cellular protein. Slides were Data obtained were analyzed using Statistical
then placed horizontally in an electrophoresis Package for Social Sciences (SPSS) 11.5
tank containing 0.3 M NaOH and 1mM EDTA version.
at 4°C for 20 minutes to allow the alkaline
3. Results and Discussion
unwinding. Electrophoresis was performed at
A total of 24 subjects have so far completed the
25 V and 300 mA for 20 minutes. The slides
6 month supplementation and their profile are
were then washed three times for 5 minutes
shown in Table 1. Subjects are all female and
each with a neutralizing solution (0.4M Tris,
Malay.
pH 7.5) before staining with 20 µl/ml of
Ethidium Bromide. Cover slips were placed on The results of the comet assay showed that
the top and the slides were placed in a supplementation with Tri-E significantly
humidified container to prevent drying of the increased the amount of undamaged DNA
gel and they were analyzed as soon as possible while reducing the amount of damaged DNA
or within 24 hours. after 6 months (Figure 1). However, analysis of
the results obtained showed that the amount of
Visual analyses of DNA damage were carried
damaged DNA did not significantly increase
out in accordance with the protocols of
with increasing age probably due the small
Kobayashi et al. (1995). Slides were examined
number of subjects studied so far. Antioxidant
at 200x magnification using a fluorescence
status reflects the balance between antioxidant
microscope. 500 randomly selected non-
defenses and free radicals within the body
overlapping cells on each slide were analyzed,
(Heaton et al., 2002). The association of
assigning a score on an arbitrary scale of 0-4
oxidative stress with DNA damage has been
ranging from 0 of no DNA damage to 4 of
demonstrated in animal studies. As such,
extensive DNA damage based on perceived
maintaining a balanced antioxidant status and
comet tail length migration and relative
reducing levels of oxidative stress have been
proportion of DNA in the comet tail. The five
suggested as a method to reduce damage to
classes of DNA damage were further
DNA.
categorized into 3 grades as normal (score 0:
undamaged, no migration), mild damage (score A study by Duthie et al. (1996) demonstrated a
1 & 2: limited migration) and extensive damage protective effect of antioxidant
(score 3 & 4: DNA pieces migrate freely into supplementation towards oxidative DNA
the tail). damage in human lymphocytes. It has also been
reported that supplementation with a
SOD activity in erythrocyte was determined
combination of Vitamin A, C and E resulted in
according to the method of Beyer and
a significant decrease in the levels of all
Fridovich (1987). This method is based on the
modified DNA bases caused by oxidative stress
inhibitory effect of SOD on nitro blue
(Jaruga et al., 2002).
tetrazolium (NBT) reduction by O2- generated
by the action of xanthenes oxidase on Reports on the antioxidant enzyme activities in
xanthenes. The reduction of NBT was humans have so far showed variable results.
measured at 550 nm. One SOD unit was Our results showed that SOD activity increased
defined as the enzyme activity required to significant (p < 0.05) (Figure 2) after 6 months
inhibit the rate of NBT reduction by 50 % in 1 supplementation while GPx activity was
min. unaffected (Figure 3). SOD is reported to be the
first line enzymatic antioxidant defense which
GPx activity was determined according to
catalyses the dismutation of highly reactive
Paglia and Valentine (1967). GPx catalyzes the
superoxide anion into H2O2 that is converted to
oxidation of GSH by tert-hydroperoxide. In the
H2O by GPx and CAT (Cheng et al., 2001).
presence of glutathione reductase and NADPH,
Antioxidant enzymes function with vitamin E
GSSG is immediately converted to GSH with a
to defend the cell against free radical attack
concomitant oxidation of NADPH to NADP+.
which increased in aging.
The decrease in absorbance at 340 nm was
measured. One GPx unit was defined as the Table 2: Lipid profile between placebo group
enzyme activity necessary to convert 1 µmol and vitamin E group at 0, 3 and 6 months
NADPH to NADP+ in 1 minute. supplementation.
Our results showed that 6 months of vitamin E Consequences of Minor Changes in Condition,
supplementation caused HDL to increase Analytical Biochemistry., 161: 559 – 316.
compared to the placebo group. Since our Cheng T.Y., Zhu Z., Masuda S., Orcos N.C., (2001).
subjects are healthy individuals, the total Effects of Multinutrient Supplementation on
cholesterol levels are within the normal range Antioxidant Defense Systems in Healthy Human
and supplementation did not alter the level of Being, Jour. Nutr. Biochem., 12: 388 -395.
total cholesterol although there were tendency Duthie S.J., Ma A.G., Ross M.A., Collins A.R.,
for the LDL levels to decrease. A study in (1996). Antioxidant Supplementation Decreases
hypercholesterolemic subjects have shown that Oxidative DNA Damage in Human Lymphocytes,
dietary supplementation of 200 mg/day Cancer Res., 56: 1291-1295.
tocotrienol rich fraction (TRF) caused a
Halliwell B., (1991). Reactive Oxygen Species in
significant reduction of total cholesterol and Living Systems; Source, Biochemistry and Role in
LDL and increased HDL slightly (Qureshi et Human Disease, Am.J.Med., 91(3C): 14-22.
al., 1991). It is suggested that vitamin E
reduced the HMG CoA activity that regulates Heaton P.R., Ransley R., Charlton C.J., Mann S.J.,
Stevenson J., Smith, B.H.E., Rawlings, J.M., Harper
the synthesis of cholesterol.
E.J., (2002). Application of Single-cell Gel
The results of the liver function tests showed Electrophoresis (comet) Assay for Assessing Levels
that while all other parameters remained of DNA Damage in Canine and Feline Leukocytes.
unchanged the alanine transminase enzyme Waltham International Symposium: Pet Nutrition
(ALT) was significantly reduced. ALT is an Coming of Age.
indicator of liver cell turnover and a reduction Jaruga P., Jaruga B., Gackowski D., Olczak A.,
in this enzyme is indicative of Halota W., Pawlowska M., Olinski R., (2002).
hepatoprotection. Supplementation with Antioxidant Vitamins
Prevents Oxidative Modification of DNA in
Result showed no significant different (p < Lymphocytes of HIV-infected Patients, Free Radical
0.05) in both groups. Biology & Medicine., 32: 414-420.
No significant difference was observed in the Junqueira B.C., Barros B.M., Chan S.S., Rodrigues
lymphocyte percentage, CD4+, CD8+, B cell, L., Giavarotti L., Abud R.L., Deucher, G.P., (2004).
natural killer cells and CD4/CD8 ratio between Aging and Oxidative Stress., Molecular Aspects of
the vitamin E supplemented and placebo Medicine., 25: 5-16.
groups (Table 4). Meydani et al. (1989) Kobayashi H., Sugiyama C., Morikawa Y., Hayashi
reported that vitamin E supplementation M., Sofuni T., (1995). A Comparison between
increased lymphocyte proliferation response to Manual Microscopic Analysis and Computerized
Con A, delayed type hypersensitivity and Image Analysis in the Single Cell Gel
decreased PGE2 production. Electrophoresis Assay, MMS Commun., 3(2): 103-
115.
4. Conclusion
Meydani S. N., Meydani M., Barklund P. M., Liu
In conclusion, the result suggests that vitamin E
S., Miller R. A., Cannon J. G., Rocklin R.,
supplementation maybe beneficial by causing Blumberg J. B., (1989). Effect of Vitamin E
increases in HDL and SOD levels while ALT Supplementation on Immune Responsiveness of the
enzyme activity is decreased and levels of Aged, Ann. NY. Acad. Sci., 570: 283 – 290.
DNA damage. However, the lymphocyte subset
Paglia D.E & Valentine W.N., (1967). Studies on
parameters were not affected by vitamin E
the Quantitative and Qualitative Characterizations
supplementation. of the Erythrocyte Glutathione Peroxidase, Journal
5. Acknowledgement of Laboratory & Clinical Medicine, 70 (1): 158 –
The research was funded by the Malaysian 169.
government through the IRPA 06-02-02- Qureshi A.A., Qurhesi N., Wrigth J. J. K. et al.,
0016/PR0008/09-01 grant and Universiti (1991). Lowering of Serum Cholesterol in
Kebangsaan Malaysia. Hypercholesterolemia Human by Tocotrienol, Jour.
Am. Clin. Nutr., 53: 1021S-1026S.
6. References
Beyer W.F. & Fridovich I., (1987). Assaying for Singh N.P., McCoy M.T., Tice R.R., Schneider
Super Oxide Dismutase Activity: Some Large E.L., (1988). A Simple Technique for Quantitation
of Low Levels of DNA Damage in Individual Cells, Differentiation and Ageing: A Unified Theory,
Exp. Cell Biol., 175: 184-191. Basic Life Science, 35: 75-104.
Sohal R.S. & Allen R.G., (1985). Relationship
between Metabolism Rate, Free Radicals,
LAMPIRAN
Group Age n
30-39 2
Placebo 40-49 10
50-59 2
>60 -
30-39 1
Vitamin E 40-49 6
Supplementation 50-59 3
>60 -
Total 24
Table 2: Lipid profile between placebo group and vitamin E group at 0, 3 and 6 months supplementation.
Parameters Placebo Vitamin E
0 month 3 months 6 months 0 month 3 months 6 months
Total
5.24±0.59 4.88±0.86 5.29±0.45 5.59±0.59 5.62±0.74 5.60±0.72
Cholesterol
Triglyceride
0.98±0.53 1.14±0.30 0.99±0.34 1.08±0.50 1.09±0.61 1.3±0.48
LDL
3.44±0.43 3.06±0.29 3.21±0.34 3.7±0.63 3.68±0.75 3.5±0.83
HDL
1.48±0.27 1.32±0.37 1.64±0.38 1.39±0.22 1.43±0.28 1.51±0.28 *
* There is significant increased (p < 0.05) in HDL level and HDL/Total cholesterol ratio after 6 months
supplementation compared to 0 month.
Table 3: Liver function test between placebo group and vitamin E group at 0, 3 and 6 months
supplementation. * There is significant difference (p < 0.05) in ALT levels after 3 and 6 months
supplementation compared to 0 month.
Parameters Placebo Vitamin E
0 month 3 months 6 months 0 month 3 months 6 months
Protein 80.69±3.25 77.91±5.11 78.09±4.06 77.13±5.78 80.13±4.81 78.21±3.60
Albumin 40.07±3.42 39.9±3.65 39.5±1.27 39.53±2.47 41.06±2.25 40.07±3.32
Bilirubin 12.62±6.82 11.29±7.06 11.81±10.19 11.47±3.77 12.06±4.28 10.93±3.79
ALP 59.9±10.95 64±13.07 62±17.83 61.47±8.17 66.07±16.23 62.13±14.4
ALT 19.31±12.28 19.64±9.06 23.55±8.44 26.6±7.98 17.73±6.54* 18.57±6.33*
Calcium 2.41±0.10 2.39±0.12 2.44±0.17 2.42±0.06 2.40±0.10 2.42±0.12
Amount of cells
500 50
480 40
460 Placebo 30 Placebo
440 Vitamin E 20 Vitamin E
420 10
400 0
0 3rd 6th 0 3rd 6th
Duration (months) Duration (months)
(a) (b)
Figure 1: (a) Effect of Vitamin E supplementation on undamaged DNA level. (b) Effect of Vitamin E supplementation
on mildly damaged DNA level. Results are means ± SEM. Values statistically different from 0 month (t-test, 95%
confidence level) are indicated with an asterisk
0 month
4
SOD activitiy in RBC (U/mg Hb)
3 months
3.5 6 months
3 *
2.5
2
1.5
1
0.5
0
Placebo Group Vitamin E
Figure 2: SOD activity between placebo group and vitamin E group at 0, 3 and 6 months supplementation.
* There is significant increase (p < 0.05) in SOD activity after 6 months supplementation compared to 0 month. Figure
2 shows significant increase (p<0.05) for SOD activity in the vitamin E supplementation group after six months of
supplementation given to them
14 0 month
GPx Activitiy in RBC (U/mg Hb)
3 months
12 6 months
10
0
Placebo Vitamin E
Group
Figure 3: GPx activity between placebo group and vitamin E group at 0, 3 and 6 months supplementation
Abstract
The usage of fertilizer for vegetable plants is very large and covers wide regions at the
present. In the fact however, NPK multi fertilizer still not yet efficient and generate
environmental pollution. The aims of this research are prepare the formula of efficient NPK
multi fertilizers for vegetable plants (potato = Solanum tuberosum and tomato = Lycopersion
lycopersicum) with minimum levels of pollution. This research was conducted at a greenhouse
and laboratory scale with 13 combinations of NPK in multi fertilizers during growing plant
period to their elements migration: adsorbed into the plants, deposited in the soil and lost to
environment. The experiments were carried out into three times replications. The contain of
nitrogen, phosphor, and potassium were analyzed by using the integrated Kjeldahl-Nessler
method, the Olsen method and the flame photometry method, respectively.
The results revealed that all of the multi fertilizer formulas into tomato and potato plants were
not efficient due to the percentage of nutrients (N, P, and K) were adsorbed by plants were
low, whereas the percentage of nutrients lost to environment are higher. Distribution of
nitrogen (adsorbed by the plant, deposited in the soil, and lost to environment), in tomato and
potato plants for each fertilizer formula was not different significantly at 95% confidence
level. Distibution of phosphor in tomato plant for each fertilizer formula was not different
significantly, whereas the distribution in potato plants was different significantly. The highest
adsorbed phosphor in potato plants showed in the sample 1 with NPK formula are 8:6:6.
Whereas the lowest phosphor lost to environment showed in the sample 13 with NPK formula
8:8:4. Distribution of potassium in tomato plants for each fertilizer formula was not different
significantly, whereas the distribution in potato plants was different significantly. The most
adsorbed potassium in the potato plant with NPK formula 8:6:4, while the least potassium
migration to environment was sample 8 that had NPK’s formula 10:8:2.
Key words: NPK fertilizer, Vegetable plants, Migration
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem,
Proceeding E-mail : jschem@chem.itb.ac.id
of The 6th ITB-UKM Joint Seminar on Chemistry 991
Wawang Suratno, Intan Asri, Dini Faradila
endangers is eutrofication of waters body. as cabbage, chili etc. Therefore, the inefficient
fertilizer and minimalization the environmental
The farmers tend to give fertilizer with the
pollution in the area of the vegetable plants
excessive concentration, on the chance of the
centre conducted this research.
fertilizer will be more absorbed by the plants so
that their production will be more gratify. Even The research objectives are to find formula of
though in reality, giving excessive fertilizer efficient NPK multi fertilizers for potato
will influence the plants. On the other hand, (Solanum tuberosum) and tomato (Lycopersion
inefficient fertilizer means damaging the lycopersicum) based on their elements
economic agriculture system, because expense migration i.e. adsorbed into plant, deposited in
released by farmer bigger than fertilizer value soil and lost to environment. The NPK multi
exploited by plant. fertilizer be expected have low level pollution
to environment. This research is also try to find
There are some ways of fertilizer inefficient in
NPK multi fertilizer that has low level of
agriculture farm. The nitrogen fertilizer in soil
environmental pollution. This preliminary
change to ammonium or nitrate ions, that is
research carried out in laboratory and
easy brought by water. Even the alterable
greenhouse scale and can be developed to field
denitrification process nitrate becomes to N2O
research.
and N2 gases, able to go out into the air
(Suratno, 1997). Phosphor fertilizer is generally 2. Experimental
in polyphosphate form, which in soil can be Materials used in this research are soil from
condensed and precipitated, for example as farm of agriculture Lembang, tomato seed
calcium phosphate. While the potassium (Lycopersion lycopersicum) varietas martha,
fertilizer which generally salt of potassium potato seed (Solanum tuberosum) and the NPK
chloride and potassium oxide are very easy multi fertilizer formulating from the ZA
dissolve in water, so that earn the castaway (zwavelzuure amoniak = amonium sulphate),
through the surface or ground water (Sutejo, the SP 36 (super phosphate of 36% P2O5) and
1999). the KCl fertilizers. Chemicals to analyzed are
the N, P, K contents used by common
Lembang and Bandung South (Ciwidey and
procedure which effected by ascorbic acid,
Pangalengan) areas are representing the centre
concentrated sulphuric acid, 25% of
area of vegetable plantation. The dominant
hydrochloride acid, mixture of selen and 30%
vegetable plants in that area are tomato and
of sodium hydroxide, Nessler solution, Olsen
potato plants, and other vegetable plants such
pereaction, ammonium standard, phosphate
Table 1. The Formula of NPK multi fertilizer for tomato and potato plants.
No Formula of N:P:K* Formula of N:P:K*
Tomato Plant Potato Plant
1 3 : 2 : 2.5 8:6:6
2 3 : 2.5 : 2 8:7:5
3 3 : 3.5 : 1 8:9:3
4 3 : 4 : 0.5 8 : 10 : 2
5 2 : 3 : 2.5 6:8:6
6 2.5 : 3 : 2 7:8:5
7 3.5 : 3 : 1 9:8:3
8 4 : 3 : 0.5 10 : 8 : 2
9 2 : 4 : 1.5 6 : 10 : 4
10 2.5 : 3.5 : 1.5 7:9:4
11 3.5 : 2.5 : 1.5 9:7:4
12 4 : 2 : 1.5 10 : 6 : 4
13** 3 : 3 : 1.5 8:8:4
N 3:0:0 8:0:0
P 0:3:0 0:8:0
K 0 : 0 : 1.5 0:0:4
Note: *Nitrogen from ZA fertilizer; phosphor as P2O5 from SP36 fertilizer and potassium as
K2O from KCl fertilizer. Unit is in gram.
**Standard formula based on result of the research by Hall of Vegetable Plant
Research,Lembang, West Java and ordinary practiced by vegetable farmer.
80% 80%
57.52
62.5361.5863.7760.3262.4262.1364.4760.0663.1759.6663.0859.8561.48
60% Lossed (%) 60%
87.31 Lossed (%)
93.31 91.6894.5888.9391.7992.3594.97 88.4 93.4690.53 93.5788.7390.99 Adsorbed (%)
Adsorbed (%)
Deposited (%)
40% 40% Deposited (%)
80% 80%
74.26 71.83
60% 78.73 79.11 60% 78.88 78.55
87.4591.94 87.2288.45 85.68 86.24 90.4 Lossed (%) 85.8888.44 83.62 87.0986.11 84.42 86.72
92.65 90.8388.76 90.43 90.20 Lossed (%)
96.6992.61 96.01
Adsorbed (%) Adsorbed (%)
40% Deposited (%) 40% Deposited (%)
0.01
0.00
0.01 0 0.04 0.05
20% 20%
0.05 0.01 0.40 0.04 0.01 28.16 0.02
0.4 0.04 0.04 0.06 25.73 0.06 0.06 21.40
0.04 21.26 20.89 0.06 0.02 0.04 21.08 0.04 0.04 15.57
12.15 8.02 12.7311.51 0.04 14.27 0.08 0.04 13.75 13.7211.52 16.34 12.8513.83 13.26
7.31 9.12 11.19 9.58 9.53 0.08 9.76
0% 3.23 7.36 0% 3.91
1 2 3 4 5 6 7 8 9 10 11 12 13 P 1 2 3 4 5 6 7 8 9 10 11 12 13 14
Number of fertilazer formula Number of fertilazer formula
0% 0%
1 2 3 4 5 6 7 8 9 10 11 12 13 K 1 2 3 4 5 6 7 8 9 10 11 12 13 K
Number of fertilazer formula Number of fertilazer formula
fertilizer formula. From data of experiment higher than absorbed by plant. Mean value of
result revealed that mean nitrogen persentage in lost nitrogen for the tomato and potato
soil to entire formula at tomato and potato plantations were 91.47% and 58.58%
plantations were 9.66% and 7.94% respectively. This nitrogen loss due to some
respectively. For the tomato plantation this factor, among others that is washes out. The
value was higher than absorbed nitrogen by properties of ZA fertilizer is dissolve easy in
plant, so that could be calculated less amount of water, so that is easy to clean by percolation or
the nitrogen fertilizer at next plantation season. sprinkler water. Besides, nitrogen in soil can
The value for the potato plantation was under release to air through the denitrification process
plant requirement of adsorbed nitrogen, so that in anaerobe soil layer. This process altered the
at next plantation season the potato plant still available nitrate for plant became the free
require the nitrogen fertilizer. nitrogen gas into the air.
Figure 1 show indicating that loosing of The sample 9 (formula NPK = 2:4:1.5) at
nitrogen fertilizer to environment was very tomato plantation was the least nitrogen lost to
environment equal to 88.40%, while at potato sample 6 (formula NPK=7:8:5), was equal to
plantation the sample 1 (formula NPK = 8:6:6) 25.73%.
equal to 55.07% was the least nitrogen loss.
Pursuant to this research data, could be
Presumably next research to come cared
knowable that the smallest of lost phosphor at
reduction of environment pollution coming
the tomato plantation was in sample 3 (formula
from vegetable plantation field, hence require
NPK= 3:3.5:1) equal to 78.73%, while at the
to be made multi fertilizer with nitrogen
potato plantation was 1n sample 13 (formula
percentage not equal to single fertilizer as
standard NPK= 8:8:4), equal to 71.83%. Mean
farmer standard and require to strive the NPK
percentage of the lost Phosphor was higher than
multi fertilizer formula, which have slow
deposited phosphor in soil and adsorbed by
release property with membrane coating.
plant. This is opposite to Marschner (1986),
3.2 Migration of phosphor of multi fertilizer which said generally phosphor fertilizer
in tomato and potato plantations difficult to clean by rainwater and irrigate or
Experiment results of tomato and potato sprinkler water so that phosphor loosing is
plantations showed that the distribution of expected relative small. This matter should be
phosphor migration i.e. deposited in soil, detailed investigated.
adsorbed in plant and lost to environment as
3.3 Migration of potassium of multi fertilizer
like in the Figure 2 or in Appendix Table 1 and
in tomato and potato plantations
in Appendix Table 2.
Experiment results of tomato and potato
Pursuant to the figure and the data, seen that plantations showed that the distribution of
phosphorus element adsorbed by tomato and potassium migration i.e. deposited in soil,
potato plantation were very small with mean adsorbed in plant and lost to environment as
percentage of each of 0.06%. Mostly phosphor like in the Figure 3 or in Appendix Table 1 and
loose to environment and some others in Appendix Table 2.
deposited in soil. Whether tomato plantation
This research data show that mean percentage
and also potato plantation, both showing
of adsorbed potassium in tomato plant was
sample 1 (formula NPK = 3:2:2.5 for tomato
6.24% and in potato plant was 5.15%. The
and formula NPK = 8:6:6 for potato) had the
highest percentage of adsorbed potassium at
highest percentage (0.40%) of adsorbed
tomato plantation was in sample 3 (formula
phosphorus, compared to [by] other sample. It
NPK= 3:3.5:1) equal to 16.73% and at potato
can say that these fertilizer formulas were the
plantation was also in sample 3 (formula NPK=
most efficient in the case of absorption of
8:9:3) equal to 13.86%. The fertilizer formulas
phosphate.
were most efficient to each for the plant of
Absorbed phosphorus by plant is in the form of tomato and of potato.
inorganic ion will quickly turn into the organic
Adsorbed potassium by plant root is in the form
phosphorus compound. This organic
of K+, which its function is to accelerate
phosphorus easy move between plant tissues.
forming of carbohydrate by photosynthesis,
This matter causing absorbed phosphor relative
strengthening plant protection to attack of
small when compared to adsorbed nitrogen by
disease pest and improve the seed. Lacking of
plant. Besides than that if the SP 36 fertilizer
potassium in a plant will cause plant stalk weak
mixed with the ZA fertilizer it can ossify so
so that easy plant fall down.
that difficult plant roots to adsorb.
The experiment data also show that at tomato
Result of calculation generally shows that the
plantation the mean percentage of deposited
mean percentage of deposited phosphor in soil
potassium in soil was equal to 45.39%, while at
was 11.60% for the tomato plantation and was
potato plantation was equal to 52.85%. These
15.48% for the potato plantation. This matter is
values were higher than deposited nitrogen and
computable for next plantation season phosphor
than deposited phosphor. This matter due to
fertilizer can be reduced because in soil is still
andosol soil type from Lembang which contain
enough available phosphor. The biggest of
high enough potassium concentration.
deposited phosphor at tomato plantation was on
sample 3 (formula NPK=3:3.5:1) was equal to Available potassium in soil is changeable in
21.26%, while at potato plantation was on colloidal soil with other element. Therefore
potassium in soil would be more easy adsorbed Pursuant to Figure 3 showed that at tomato
by plant roots but also easier lose effect of plantation the mean percentage of lost
wash. potassium to environment much close the mean
Statistical Analysis
In the effort to developed Indonesia agriculture, Marschner, H. 1986. Mineral Nutrition of Higher
where in this case especially to all vegetable Plants. London: Academic Press Harcourt Brace
farmer, needed a productivity test to the Jovanovich.
formula of the efficient NPK multi fertilizer Rosmarkam, A., Yuwono N.W., 2002. Ilmu
which proposed to its result can be Kesuburan Tanah. Yogyakarta: Penerbit Kanisius.
implemented. Rubatzky, V.E., Yamaguchi M., 1998. Sayuran
5. Acknowledgment Dunia. Edisi ke dua. Penerjemah Ir. Catur Herison,
Writers say many thank and appreciate to QUE MSc. Bandung: Penerbit ITB
Project of Chemistry Department, Faculty of Soelarso, R.B., 1997. Budi Daya Kentang Bebas
Mathematics and Natural Sciences, Padjadjaran Penyakit. Yogyakarta: Penerbit Kanisius.
University which is on year 2004 have defrayed
this research as project grant. Suratno, W., 1997. Fluks Nitrous Oksida
(N2O) di Tanah Sawah: Pengaruh Teknik
6. References Irigasi, Pupuk Urea dan Varietas Padi.
Anonymous.2003. Soil Layers.
http://www.enchantedlearning.com/geology/label/
Desertasi, Program Pascasarjana IPB.
soillayers Bogor.
Bloomfield, C., Coulter J.K., 1973. Genesis and Suratno, W., Murdiyarso, D., Suratno, F.G., Anas,
Management of Acid Sulphate Soils. Harpenden: I., Saeni, M.S., and Rambe, A. 1998. Nitrous Oxide
Rothhamstead Experimental Station. Flux from Irrigated Rice Fields in West Java.
Environmental Pollution 102, S1 (1998) 159-166.
Brady, N.C., and Weil R.R., 1996. The nature and
the properties of soil. Prentice Hall. Sutejo, M.M., Kartasapoetra A.G., 1991. Pengantar
Ilmu Tanah. Cetakan ke dua. Jakarta: PT Rineka
Epstein, E., 1972. Mineral Nutrition of Plants: Cipta.
Principles and Perspectives. New York: John
Wiley and Sons. Sutejo, M.M., 2002. Pupuk dan Cara Pemupukan.
Cetakan ke tujuh. Jakarta: PT Rineka Cipta.
Fitzpatrick, E. A., 1994. An Introduction to Soil
Science. Second edition. Singapore: Longman Thompson, L.M., Troeh F.R., 1978. Soil and Soil
Singapore Pub. Pte. Ltd. Fertility. New York: McGraw-Hill Book. Co.
Gardner, F. P., Pearce R.B., Mitchell R.L., 1985. Tisdale, S.L., Nelson W.L., Beaton J.D., 1985. Soil
Physiology of Crop Plants. Iowa: Iowa State Fertility and Fertilizer. New York: MacMillan Pub.
University Press. Co.
APENDIX TABEL 2
POTATO PLANTATION
Nitrogen
No. Formula % Deposited in soil % adsorbed by plant % lossed to environment
NPK
1 2 3 Mean 1 2 3 Mean 1 2 3 Mean
sampel Fertilizer
1 8:6:6 15.25 5.10 13.98 11.44 29.57 30.08 33.47 31.04 55.18 64.82 52.56 57.52
2 8:7:5 3.58 2.89 15.93 7.47 23.45 27.78 38.79 30.01 72.97 69.33 45.28 62.53
3 8:9:3 6.91 4.50 11.33 7.58 38.40 28.58 25.54 30.84 54.69 66.92 63.13 61.58
4 8:10:2 5.02 7.99 4.97 5.99 34.78 32.20 23.74 30.24 60.20 59.81 71.29 63.77
5 6:8:6 6.77 7.39 18.77 10.98 29.79 34.22 22.10 28.70 63.44 58.39 59.13 60.32
6 7:8:5 6.33 6.43 8.83 7.20 37.21 28.45 25.49 30.38 56.46 65.12 65.69 62.42
7 9:8:3 5.57 4.97 10.34 6.96 28.43 25.76 38.54 30.91 66.00 69.27 51.13 62.13
8 10:8:2 9.25 5.52 -1.46 4.44 30.25 33.66 29.37 31.09 60.50 60.82 72.08 64.47
9 6:10:4 6.84 5.90 18.00 10.25 28.68 30.51 29.88 29.69 64.48 63.59 52.12 60.06
10 7:9:4 6.69 4.05 7.30 6.01 40.12 28.47 23.87 30.82 53.19 67.48 68.83 63.17
11 9:7:4 4.41 3.44 19.81 9.22 23.55 26.98 42.84 31.12 72.04 69.58 37.36 59.66
12 10:6:4 5.73 3.01 11.54 6.76 29.92 32.74 27.83 30.16 64.35 64.25 60.64 63.08
13 8:8:4 8.43 5.29 14.81 9.51 33.88 29.44 28.60 30.64 57.69 65.27 56.59 59.85
N 8:0:0 5.31 4.27 12.58 7.39 35.04 28.58 29.79 31.14 59.65 67.15 57.63 61.48
Phosphor
No. Formula % Deposited in soil % adsorbed by plant % lossed to environment
NPK
Fertilizer 1 2 3 Mean 1 2 3 Mean 1 2 3 Mean
sampel
1 8:6:6 17.46 10.58 13.12 13.72 0.61 0.21 0.39 0.40 81.93 89.21 86.49 85.88
2 8:7:5 16.54 8.33 9.70 11.52 0.04 0.04 0.04 0.04 83.42 91.63 90.26 88.44
3 8:9:3 18.22 22.26 22.75 21.08 0.06 0.02 0.04 0.04 81.72 77.72 77.21 78.88
4 8:10:2 13.27 18.53 17.23 16.34 0.09 0.01 0.02 0.04 86.64 81.46 82.75 83.62
5 6:8:6 10.04 8.04 10.52 9.53 0.08 0.02 0.02 0.04 89.88 91.94 89.46 90.43
6 7:8:5 18.75 26.37 32.08 25.73 0.01 0.01 0.01 0.01 81.24 73.62 67.91 74.26
7 9:8:3 15.92 9.50 13.14 12.85 0.09 0.06 0.03 0.06 83.99 90.44 86.83 87.09
8 10:8:2 13.48 11.08 16.94 13.83 0.08 0.04 0.06 0.06 86.44 88.88 83.01 86.11
9 6:10:4 19.56 26.41 18.22 21.40 0.04 0.07 0.04 0.05 80.40 73.52 81.74 78.55
10 7:9:4 6.47 4.12 1.15 3.91 0.11 0.07 0.06 0.08 93.42 95.81 98.79 96.01
11 9:7:4 8.88 10.47 9.94 9.76 0.03 0.04 0.05 0.04 91.09 89.49 90.01 90.20
12 10:6:4 13.35 17.86 15.49 15.57 0.02 0.01 0.01 0.01 86.64 82.13 84.50 84.42
13 8:8:4 26.67 29.14 28.66 28.16 0.01 0.02 0.00 0.01 73.32 70.84 71.34 71.83
P 8:0:0 14.73 19.28 5.77 13.26 0.04 0.01 0.01 0.02 85.23 80.71 94.22 86.72
Kalium
No. Formula % Deposited in soil % adsorbed by plant % lossed to environment
NPK
Fertilizer 1 2 3 Mean 1 2 3 Mean 1 2 3 Mean
sampel
1 8:6:6 44.38 39.95 90.11 58.15 12.76 4.80 4.54 7.37 42.86 55.25 5.35 34.49
2 8:7:5 48.48 60.43 45.91 51.61 6.31 5.36 6.80 6.16 45.21 34.21 47.28 42.24
3 8:9:3 52.74 45.62 30.56 42.97 11.66 7.35 22.58 13.86 35.60 47.03 46.86 43.16
4 8:10:2 66.77 40.76 61.67 56.40 8.56 6.59 3.80 6.32 24.67 52.65 34.53 37.28
5 6:8:6 30.84 35.48 15.58 27.30 6.11 5.48 6.65 6.08 63.05 59.04 77.77 66.62
6 7:8:5 60.71 33.94 75.10 56.58 8.92 4.62 14.81 9.45 30.37 61.44 10.10 33.97
7 9:8:3 38.22 32.22 40.13 36.86 4.54 3.54 1.49 3.19 57.24 64.24 58.38 59.95
8 10:8:2 75.72 79.36 77.40 77.49 8.48 9.58 2.04 6.70 15.81 11.06 20.56 15.81
9 6:10:4 48.90 55.09 50.27 51.42 9.73 5.55 3.75 6.34 41.37 39.37 45.98 42.24
10 7:9:4 60.05 38.80 57.16 52.00 11.27 5.64 5.80 7.57 28.68 55.56 37.03 40.43
11 9:7:4 41.15 52.18 36.03 43.12 7.75 7.84 5.72 7.10 51.10 39.99 58.25 49.78
12 10:6:4 48.85 59.33 63.97 57.38 9.97 9.80 3.59 7.79 41.18 30.87 32.45 34.83
13 8:8:4 55.86 60.28 40.37 52.17 11.88 6.77 12.28 10.31 32.26 32.95 47.35 37.52
K 0:8:0 70.80 60.06 98.58 76.48 6.27 5.68 3.51 5.15 22.93 34.26 -2.10 18.36
Abstract
Eight known oligostilbenoids, (-)-ε-viniferin (1), (+)-balanocarpol (2), shoreaphenol (3),
pauciflorol B (4), (+)-isohopeaphenol (5), (-)-hopeaphenol (6), (-)-α-viniterin (7), and
diptoindonesin A (8), and a resveratrol C-glucoside, resveratrol-12C-glucopyranoside (9),
have been isolated from two Shorea plants, S. javanica and S. ovalis. The structure of these
compounds was identified based spectroscopic data, including UV, IR, and NMR spectra. The
cytotoxic
O properties
OH of compounds
H O 1-9 were
OH evaluated against
O murine
OH leukemia P-388
O cells,OH OH
HO
and resulted that compounds
HO
4 and 6 were theHOmost active. HO
H H H
Keywords:
H Shorea javanica , S. ovalis, Dipterocarpaceae, oligostilbenoids, cytotoxic
H H
HO
properties against P-388 HO
cells. H
OH
HO
O
HO H
H OH
H H
OH OH OH OH
1. Introduction Shorea javanica and S. ovalis. OH
Dipterocarpaceae OH plants have been known to be
OH OH OH
2. Experimental
a source
(−)−ε-Viniferinof
(1) oligostilbenoid compounds
(-)-Balanocarpol (2) Shorephenol (3) Pauciflorol B (4)
General experimental procedures
(Sotheeswaran and Pasupathy, 1993; Cichewicz
UV spectra were measured with a Varian Conc.
and Kouzi, 2002; Hakim, 2002; ). They
OH HO 100 instrument. OH IRHOspectra Owere determined
HO
include H stilbene
O
dimers, trimers, O H
tetramers,
OH
H O
HO with a Perkin Elmer FTIR Spectrum
H
OH One
hexamers, heptamers and octamers with
H H
spectrometer using KBr pellets. H and 13C
H H 1
various molecular frameworks resulting from
NMR spectra Hwere recorded either with Bruker
different
HO
oxidative
H
condensation
H OH
of the HO H
1
OH
13
H H AX500 operating
H at 500 H H) and 125 ( C)
(
resveratrol OH monomer. Some HO of these OH HO
MHz or with a JEOL AS400 operating at 400
compounds show interesting biological
OH HO (1H) and 100 (OH 13
C) HO
MHz using residual and
activities, such as antibacterial, antiviral, and
deuterated solvent peaks
(-)-Hopeaphenol as reference standards.
(6)
cytotoxic effects. In previous
(+)-Isohopeaphenol (5) reports, we have
High resolution mass spectrum was obtained
described the isolation and structure elucidation
with VG Autospec mass spectrometer (EI
of three new oligostilbenoids,OH diptoindonesinOHA
mode). Vacuum liquid (VLC) and column
and cis- and trans-diptoindonesin B from
chromatography were carried out using Merck
species of O Dipterocarpaceae growing
HO in OH
OH
silica gel 60 GF 254 and silica gel G60 35-70
Indonesia (Aminah H et al., 2002; Syah etH al.,H O
mesh. For TLC analysis, precoated silica
OH
OH gel
OH
2003).
HO
In the course of our research effort onO
HO plates
O (Merck HO Kieselgel 60 GF254, 0.25 mm)
OH
the cytotoxicH constituents
O from the Indonesian OH
HO were used.
OH OH
plants (Suhartati
O etH al., 2001;HOSyah et al., 2001; OH
Resveratrol 12-C-glukoside (9)
2004), we now report the isolation andOH Plant materials
cytotoxic properties OH
of the
OH
oligostilbenoids 1-8 Samples
Diptoindonesin A (9) of the root woods of S. javanica were
and a resveratrol
(−)−α-Viniferin (7)C-glucoside 9 isolated from collected in August 2000 from the Village of
1000
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Yana M. Syah, Sjamsul A. Achmad, Laily bin Din, Emilio L. Ghisalberti,
Euis H. Hakim, Lia D. Juliawaty, Jalifah Latip and Ikram M. Said
Pahmungan, Pesisir Tengah Krui, West (1H, d, J = 6,4 Hz), 4,35 (1H, d, J = 6,4 Hz);
13
Lampung, while the tree barks of S. ovalis were C NMR (MeOH-d4) δ ppm: 162,7 (C-11b),
collected in May 2003 from the Experimental 160,0 (C-13a), 160,0 (C-11a), 159,7 (C-13b),
Botanical Garden of Haurbentes, Jasinga, 158,5 (C-4b), 158,4 (C-4a), 147,4 (C-9a), 136,9
Bogor. The identity of both plants was (C-9b), 133,9 (C-1a), 131,1 (C-1b), 130,3 (C-
determined by the staff of Herbarium 8b), 128,7 (C-2b/6b), 128,2 (C-2a/6a), 123,7
Bogoriense, Bogor, Indonesia. The plant (C-7b), 120,0 (C-10b), 116,3 (C-3b/5b), 116,2
specimens were deposited at the Herbarium (C-3a/5a), 107,5 (C-14a), 107,5 (C-10a), 104,4
Bandungense, Institut Teknologi Bandung, (C-14b), 102,2 (C-12a), 96,9 (C-12b), 94,8 (C-
Indonesia. 7a), 58,3 (C-8a).
Extraction and isolation (+)-Balanocarpol (2), obtained as a dark-
The dried powder of the root woods of S. yellowish solid, [α]D = + 49,0 (c 0,1, MeOH);
javanica (1 kg) was macerated with MeOH (3 x 1
H NMR (MeOH-d4) δ ppm: 7,45 (1H, d, J =
24 hours). The MeOH extract was evaporated 8,6 Hz), 7,03 (1H, d, J = 8,6 Hz), 7,03 (1H, d, J
in vacuo to yield a gummy solid (85 g). A part = 2,1 Hz), 6,81 (1H, d, J = 8,5 Hz), 6,58 (1H, d,
of the extract (20 g) was fractionated using J = 2,1 Hz), 6,52 (1H, d, J = 2,4 Hz), 6,34 (1H,
liquid vacuum chromatography technique d, J = 8,5 Hz), 6,32 (1H, d, J = 2,4 Hz), 5,48
(silica gel 150 g) eluted with (each 150 ml) n- (1H, brs), 5,29 (1H, brs).
hexane-EtOAc of increasing polarity (1:1 2x,
2:3 4x, 3:7 4x, 1:4 2x), EtOAc (2x), and Shoreaphenol (3), obtained as a bright
EtOAc-MeOH (9:1 2x) to give five major yellowish solid; UV (MeOH) λmaks nm: 203,
fractions A-E. Fractiob B (1.2 g) was purified 224 (sh), 251 (sh), 293, 398; UV
with radial chromatography (silica gel) eluted (MeOH+NaOH) λmaks nm: 207, 247 (sh), 443;
with 15-17% MeOH in n-hexane-diisopropil IR (KBr) νmaks cm-1: 3393, 1611, 1512, 1435,
eter (1:1) afforded ε-viniferin (20 mg) (1), and 1335, 1244, 1173, 1172, 1008, 836; 1H NMR
three fractions B2-B4 (each 55, 50, and 900 (MeOH-d4) δ ppm: 7,63 (1H, d, J = 8,7 Hz),
mg). Purification of fractions B2 and B3 using 7,22 (1H, d, J = 2,1 Hz), 6,96 (1H, d, J = 2,1
the same method gave shoreaphenol (10 mg) Hz), 6,87 (1H, d, J = 8,7 Hz), 6,73 (1H, d, J =
(3) and (+)-balanokarpol (30 mg) (2). A part of 8.7 Hz), 6,58 (1H, d, J = 2,5 Hz), 6,43 (1H, d, J
(1 g) of fraction D (3 g) was purified, also with = 8,7 Hz), 6,39 (1H, d, J = 2,5 Hz), 6,01 (1H,
radial chromatography eluted 17.5-20 % brs); 13C NMR (MeOH-d4) δ ppm: 199,2 (C-
MeOH in diisopropil eter-n-heksana (1:1), to 8b), 160,1 (C-4a), 159,0 (C-11a), 157,9 (C-
give pauciflorol B (115 mg) (4), and (+)- 13a), 156,5 (C-4b), 156,5 (C-13b), 155,4 (C-
isohopeafenol (80 mg) (5). Using the same 11b), 154,5 (C-7a), 135,6 (C-9b), 131,2 (C-
methodology, purification of fraction E yielded 2a/6a), 131,0 (C-1b), 128,7 (C-2b/6b), 123,4
(-)-hopeaphenol (5 mg) (6). Also, using the (C-10b), 123,2 (C-1a), 116,7 (C-3a/6a), 116,2
same methodology, from the MeOH extract of (C-8a), 115,6 (C-3b/5b), 114,4 (C-10a), 112,1
the tree barks of S. ovalis afforded α-viniterin (C-14b), 109,0 (C-14a), 103,0 (C-12b), 102,9
(100 mg) (7), resveratrol-12C-glucopyranoside (C-12a), 56,5 (C-7b).
(10 mg) (9), and diptoindonesin A (15 mg) (8). Pauciflorol B (4), obtained as a dark-yellowish
(-)-ε-Viniferin (1), obtained as a dark- solid, [α]D = - 36,0 (c 0,1, MeOH); UV
yellowish solid, [α]D = -29,0 (c 0,1, MeOH); (MeOH) λmaks nm: 205, 229 (sh), 282; UV
UV (MeOH) λmaks nm: 203, 225 (sh), 321; UV (MeOH+NaOH) λmaks nm: 207, 250 (sh), 287;
(MeOH+NaOH) λmaks nm: 208, 246 (sh), 243; IR (KBr) νmaks cm-1: 3392, 1613, 1514, 1454,
IR (KBr) νmaks cm-1: 3338, 1605, 1513, 1448, 1338, 1243, 1174, 1159, 1008, 833; 1H NMR
1337, 1242, 1171, 1122, 1002, 833; 1H NMR (acetone-d6) δ ppm: see Table 1; 13C NMR
(MeOH-d4) δ ppm: 7,14 (1H, d, J = 8,5 Hz), (acetone-d4) δ ppm: see Table 1; HMQC dan
7,03 (1H, d, J = 8,5 Hz), 6,82 (1H, d, J = 16,5 HMBC: see Table 1.
Hz), 6,76 (1H, d, J = 8,5 Hz), 6,65 (1H, d, J = (+)-Isohopeaphenol (5), obtained as a dark-
8,5 Hz), 6,63 (1H, d, J = 2,0 Hz), 6,57 (1H, d, J yellowish solid, [α]D = + 190 (c 0,1, MeOH);
= 16,5 Hz), 6,25 (1H, d, J = 2,0 Hz), 6,18 (1H,
UV (MeOH) λmaks nm: 203, 229 (sh), 284; UV
t, J = 2,1 Hz), 6,16 (2H, d, J = 2,1 Hz), 5,36
(MeOH+NaOH) λmaks nm: 207, 249 (sh), 289; (-)-Hopeaphenol (6), obtained as a dark-
IR (KBr) νmaks cm-1: 3401, 1614, 1510, 1452, yellowish solid, [α]D = - 401 (c 0,1, MeOH);
1358, 1241, 1172, 1153, 1134, 1085, 1006, UV (MeOH) λmaks nm: 203, 226 (sh), 284; UV
834; 1H NMR (acetone-d6) δ ppm: 8,71 (1H, (MeOH+NaOH) λmaks nm: 208, 249 (sh), 287;
brs), 8,18 (1H, brs), 8,01 (1H, brs), 7,82 (1H, IR (KBr) νmaks cm-1: 3399, 1613, 1513, 1447,
brs), 7,75 (1H, brs), 7,54 (1H, d, J = 8,7 Hz), 1335, 1240, 1172, 1004, 833; 1H NMR
7,00 (1H, d, J = 8,7 Hz), 6,40 (1H, d, J = 8,7 (acetone-d6) δ ppm: 8,61 (1H, brs), 8,58 (1H,
Hz), 6,39 (1H, brs) 6,34 (1H, d, J = 8,7 Hz), brs), 8,31 (1H, brs), 8,10 (1H, brs), 7,53 (1H,
6,31 (1H, d, J = 2,0 Hz), 5,85 (1H, d, J = 2,1 brs), 7,16 (1H, d, J = 8,7 Hz), 6,93 (1H, d, J =
Hz), 5,66 (1H, d, J = 10,0 Hz), 5,53 (1H, d, J = 8,7 Hz), 6,81 (1H, d, J = 8,7 Hz), 6,58 (1H, d, J
2,1 Hz), 5,45 (1H, d, J = 10,0 Hz), 5,17 (1H, = 8,7 Hz), 6,56 (1H, d, J = 2,1 Hz), 6,32 (1H,
brs), 3,46 (1H, brs); 13C NMR (acetone-d4) δ brs), 5,83 (1H, brs), 5,78 (1H, d, J = 12,1 Hz),
ppm: 160,5 (C-11b/11c), 158,6 (C-4a/4d), 5,75 (1H, d, J = 2,1 Hz), 5,19 (1H, d, J = 2,1
158,5 (C-11a/11d), 158,2 (C-13b/13c), 156,8 Hz), 4,25 (1H, d, J = 12,1 Hz), 3,96 (1H, brs).
(C-13a/13d), 155,2 (C-4b/4c), 141,7 (C-9b/9c),
140,8 (C-9a/9d), 137,5 (C-1b/1c), 133,8 (C- (+)-α-Viniferin (7), obtained as a dark-
1a/1d), 130,8 (C-2a/6a/2d/6d), 129,9 (C- yellowish solid, [α]D = -22,0 (c 0,1, MeOH);
2b/6b/2c/6c), 118,3 (C-10a/10d), 117,0 (C- UV (MeOH) λmaks nm: 203, 228 (sh), 285; UV
10b/10c), 116,6 (C-3a/5a/3d/5d), 114,7 (C- (MeOH+NaOH) λmaks nm: 207, 248 (sh), 294;
3b/5b/3c/5c), 109,7 (C-14b/14c), 107,1 (C- IR (KBr) νmaks cm-1: 3380, 2920, 1614, 1515,
14a/14d), 102,5 (C-12a/12d), 95,2 (C-12b/12c), 1435, 1361, 1232, 1170, 1113, 997, 832. The
93,6 (C-7a/7d), 53,8 (C-8a/8d), 52,8 (C-8b/8c), IR spectrum of compound 7 was identical with
43,6 (C-7b/7c). those standard (+)-α-viniferin.
Resveratrol 12C-glucopyranoside (8), obtained (1H, s), 4,93 (1H, d, J = 9,5 Hz), 3,70-3,45
as a white solid, UV (MeOH) λmaks nm: 205, (5H, m).
309; UV (MeOH+NaOH) λmaks nm: 207, 341; Diptoindonesin A (9), obtained as a yellowish
IR (KBr) νmaks cm-1: 3401, 2925, 1620, 1607, solid; UV (MeOH) λmaks nm: 203, 225 (sh),
1512, 1444, 1383, 1238, 1031, 1013, 835; 1H 321; UV (MeOH+NaOH) λmaks nm: 208, 246
NMR (acetone-d6) δ ppm: 7,41 (2H, d, J = 8,4 (sh), 243; IR (KBr) νmaks cm-1: 3369, 2927,
Hz), 7,02 6,85 (1H, d, J = 16,1 Hz), 6,85 (1H, 1606, 1514, 1432, 1365, 1243, 1172, 1103,
d, J = 16,1 Hz), 6,82 (2H, d, J = 8,4 Hz), 6,54
1079, 1010, 835; 1H NMR (acetone-d6) δ ppm:
8,71 (1H, s), 8,67 (1H, s), 8,41 (2H, s), 8,09 al., 1990), resveratrol-12C-glucopyranoside (8)
(1H, s), 7,20 (2H, d, J = 8,4 Hz), 7,16 (2H, d, J (Ito et al., 2000), and diptoindonesin A (9)
= 8,6 Hz), 6,91 (1H, d, J = 16,5 Hz), 6,81 (2H, (Aminah et al., 2002). The structure of these
d, J = 8,4 Hz), 6,72 (2H, d, J = 8,8 Hz), 6,69 compounds was determined based on the
(1H, s), 6,69 (1H, d, J = 16,5 Hz), 6,27 (2H, d, analysis of spectroscopic data, including UV,
J = 2,2 Hz), 6,21 (1H, t, J = 2,2 Hz), 5,43 (1H, IR, and NMR spectra.
d, J = 5,8 Hz), 4,44 (1H, d, J = 5,8 Hz), 4,79
The cytotoxic properties of compounds 1-9
(1H, d, J = 9,7 Hz), 3,90-3,75 (3H, m), 3,65-
(Table 2) were determined against murine
3,40 (2H, m).
leukemia P-388 cells according to the method
Cytotoxic assay described previously (Alley et al., 1988).
The cytotoxicity assay was conducted Compounds 1-7 showed significant activity
according to the method described by Alley et against P-388 cell lines, with hopeaphenol (6)
al. (1988). P-388 cells were seeded into 96 well and pauciflorol (4) being the most potent, while
plates at an initial cell density of approximately compounds 8 and 9 were inactive. Inspection of
3 x 104 cells cm-3. After 24 hours incubation for cytotoxicities of compounds 1-9 it appears that
cell attachment and growth, varying the degree of cytotoxic properties does not
concentrations of samples were added. The relate to the molecular size of oligostilbenoids.
compounds added were first dissolved in However, comparing the cytotoxic properties
DMSO at the required concentration. of compounds 8 and 9, glucosylation of the
Subsequent six desirable concentrations was oligostilbenoids abolishes cytotoxicities. Thus,
prepared using PBS (phosphoric buffer polarity of the molecule gives significant
solution, pH = 7.30-7.65). Control wells contribution to the cytotoxic properties of
received only DMSO. The assay was oligostilbenoids against P-388 cells.
terminated after 48 hours incubation period by
To our knowledge this is the first report of
adding MTT reagent and the incubation was
cytotoxic effects of the oligostilbenoids against
continued for another 4 hours, in which the
P-388 cells. Several studies on the cytotoxic
MTT-stop solution containing SDS was added
properties of oligostilbenoids against a number
and another 24 incubation was conducted.
of human tumor cell lines have been described
Optical density was read by using micro plate
previously (Seo et al., 1999; Ito et al., 2003).
reader at 550 nm. IC50 value is taken from the
These studies resulted that two
plotted graph of percentage live cells compared
tetramerstilbenoids, i.e. vatdiospyroidol (10)
to control (%), receiving only PBS and DMSO,
from Vatica diospyroides and vaticanol C (11)
versus tested concentration of compounds (µg
from V. rassak, were the most potent.
ml-1). The IC50 value is the concentration
Compound 11 was cytotoxic towards tumor
required for 50% growth inhibition. Each
cells KB, Col2 dan BC1, while compound 12
assays and analyses were run in triplicate and
was active against tumor cells SW480, DLD-1,
averaged.
COLO201, PC3, LNCaP, SH-SY5Y, HL60,
3. Results and discussion K562, and U937. Further studies on the
The dried powdered root woods of Shorea cytotoxic effect of compound 11 showed that
javanica were macerated in methanol to give a its cytotoxicity was due to the mechanism of
brown solid of methanol extract. Fractionation apoptosis, possibly by affecting mebrane
and purification of the extract using various proteins in the mitocondria.
chromatographic techniques yielded six
Pauciflorol (4), the most active oligostilbenoids
oligostilbenoids compounds, i.e. (-)-ε-viniferin against P-388 cells in this study, belongs to the
(1) (Oshima et al., 1996), (+)-balanocarpol (2) trimerstilbenoid class of compounds, members
(Tanaka et al., 2000), shoreaphenol (3) of which have been shown to exhibit
(Saraswathy et al., 1992), pauciflorol B (4) (Ito antiinflammatory (Kitanaka et al., 1990),
et al., 2003), (+)-isohopeaphenol (5) (Zgoda- antifungal (Bokei et al., 1988), antibacterial
Pols et al., 2002), and (-)-hopeaphenol (6) (Ito (Gunawardena et al., 1986; Sultanbawa et al.,
et al., 2000). Using the same methodology, 1987), ecdysteroid antagonist (Satyajit et al.,
from the MeOH extract of the tree barks of S. 1999), DNA topoisomerase II inhibitory
ovalis afforded (-)-α-viniterin (7) (Kinakata et (Nozaki et al., 1997), and rat liver 5α-reductase
Ito T., Akao Y., Yi H., Oguchi K., Matsumoto K., Cordell G.A., Pezzuto J.M., Kinghorn A.D., (1999).
Tanaka T., Iinuma M., Nozawa, Y., (2003). Resveratrol tetramers from Vatica dyosporoides, J
Antitumor effect of resveratrol oligomers against Org. Chem. 64, 6976-.
human cancer cell lines and the molecular
Suhartati T., Achmad S.A., Aimi N., Hakim E.H.,
mechanism of apoptosis induced by vaticanol C,
Kitajima M., Takayama H. and Takeya K., (2001).
Carcinogenesis, 24, 1489-1497.
Artoindonesianin L, a new prenylated flavone with
Ito T., Tanaka T., Ido Y., Nakaya K-I, Iinuma M., cytotoxic activity from Artocarpus rotunda.
Sudarsono, R., (2000). Stilbenoids isolated from Fitoterapia, 72, 912-918.
stem bark of Shorea hemsleyana, Chem. Pharm.
Sultanbawa M.U.S., Surendrakumar S., Bladon P.,
Bull, 48, 1001-1005.
(1987). Distichol, an antibacterial polyphenol from
Ito T., Tanaka T., Nakaya K-I, Iinuma M., Iliya I., Shorea disticha, Phytochemistry, 26, 799-801.
Nakaya K-I., Ali Z., Takahashi Y., Sawa R.,
Syah Y.M., Achmad S.A., Ghisalberti E.L., Hakim
Shirataki Y., Murata J., Darnaedi D., (2003). New
E.H., Makmur L. and Mujahidin D., (2001).
resveratrol oligomers in the stem bark of Vatica
Artoindonesianins G-I, three new isoprenylated
pauciflora, Tetrahedron, 59, 5347-5363.
flavones from Artocarpus lanceifolius, Fitoterapia,
Kinakata S., Ikezawa T., Yasukawa K., Yamanouchi 72, 765-773.
S., Takido M., Sung H.-K., Kim I.-H., (1990). (+)-
Syah Y.M., Aminah N.S., Hakim E.H., Aimi N.,
α-Viniferin, an anti-inflammatory compound from
Kitajima M., Takayama H. and Achmad S.A.,
Caragana chamlagu root, Chem. Pharm. Bull., 38,
(2003). Two oligostilbenes, cis- and trans-
432-435.
diptoindonesin B, from Dryobalanops oblongifolia,
Nozaki H, Hayashi H, Hayashi K, Ohira S, Ikeda S, Phytochemistry, 63, 913-917.
Iinuma M, Tanaka T, Ohyama M, Tsutsui K,
Syah Y.M., Achmad S.A., Ghisalberti E.L., Hakim
Takaoka D, Yamada M., (1997). 39th Symposium on
E.H. and Mujahidin D., (2004). Two new cytotoxic
the chemistry of natural products, 571.
isoprenylated flavones, artoindonesianins U and
Oshima Y., Kamijou A., Ohizumi Y., Niwa M., Ito V,from the heartwood of Artocarpus champeden,
J., Hishamichi K., Takeshita M., (1996). Novel Fitoterapia,75, 134-140.
oligostilbenes from Vitis coignetiae, Tetrahedron,
Tanaka T., Ito T., Nakaya K., Iinuma M., Takahashi
49, 5801-5804.
Y., Naganawa H., Matsuura, N., Ubukata M.,
Saraswathy A.K., Purushothaman K.K., Patra A., (2000). Vaticanol D, a novel resveratrol hexamer
Dey A.K., Kundu A.B., (1992). Shoreaphenol, a isolated from Vatica rassak, Tetrahedron Lett., 41,
polyphenol from Shorea robusta Gaertn., Indian 7929-7932.
Drugs, 26, 574-575.
Zgoda-Pols J.R., Alan J.F., Lew B.K., John R.P.,
Satyajit D.S., Pensri W., Laurence D., (1999). (2002). Antimicrobial resveratrol tetramers from
Tetrahedron, 55, 513. stem bark of Vatica oblongifolia ssp. oblongifolia, J.
Nat. Prod., 65, 1554-1559.
Seo E.-K., Chai H., Constant H.L., Santisuk T.,
Reutrakul V., Beecher C.W.W., Farnsworth N.R.,
Abstract
Some of diorganotin(IV) derivatives of hydroxamic acids o-NO2C6H4COROH (R= methyl and
tolyl) were synthesised by refluxing diorganotin oxide and the respective free ligand using a
Dean and Stark water separator. The N-methyl o-nitrobenzohydroxamic acid and N-tolyl o-
nitrobenzohydroxamic acid were derived from the corresponding o-nitrobenzoyl chloride and
N-methyl- and N-tolylhydroxylamine in the presence of sodium hydrogen carbonate. The
isolated complexes are characterized by IR, 1H, 13C and 119Sn spectroscopic techniques in
combination with elemental analysis. The dimethyl and dibutyltin(IV) complexes afforded
single crystals suitable for X-ray diffraction studies. The crystal structures of dimethyl and
dibutyltin complexes 1, 2, 4 and 5 R2Sn[o-NO2C6H4CONR’O] 2 where R= methyl and n-butyl;
R’= methyl and tolyl, respectively showed that the geometry at the tin atom exist in a skew-
trapezoidal bipyramid with two bidentate hydroxamates and two organic subtituents defining
a C-Sn-C angle of 147.8(2)º, 147.0(3)º, 146.3(2)º and 145.8(2)º respectively. The coordination
mode occurs by deprotonation of the hydroxy group and subsequent (O,O) coordination of the
carbonyl oxygen. The free ligand and their complexes were screened against antimicrobial
and human promyolicytic leukemic cells (HL-60). The dibutyltin and diphenyltin complexes
were found to be more active than the dimethyltin complexes and the respective free ligands.
The antimicrobial test showed that these complexes were moderately active.
Keywords: Synthesis, Structure, Bioactivity, Organotin
R O R OH
C C
N N
H OH OH
(I) (II)
Scheme 1. Tautomeric structures of hydroxamic acid.
platin12. 2. Experimental
Material and Synthesis
Organotin(IV) hydroxamates formalize an
The reagents and solvents used were reagent
interesting class in bioorganometallic chemistry
grade and used as supplied. Dimethyl and
due to its ability to demonstrate anti-tumor
diphenyl oxides were prepared by alkaline
activity13-15. The biological activity of the
hydrolysis of dimethyl- and diphenyltin(IV)
R2SnL2 complexes was shown to largely
chlorides21. Dibutyltin oxide is a commercial
depend on the R group and di-n-butyltin
product. N-methyl- (I) and N-tolyl (II) o-
derivatives have higher activity than other
nitrobenzohydrxamic acids were obtained by
group derivatives11.
reaction of the appropriate o-nitrobenzoyl
In the last two decades, the synthesis, chloride and N-methyl- and N-
physicochemical properties and structure tolylhydroxylamine in the presence of sodium
determination of organotin hydroxamates have hydrogen carbonate22 as shown in Scheme 1.
been the subject of various studies16-18. As a
Dialkyl and diphenyltin(IV) bis(hydroxamates)
rule, the hydroxamic acid ligand is shown to be
complexes were similarly synthesised
bidentate as a result of carbonyl coordination to
according to the method reported23 with some
tin atom, thus causing significantly substantial
modification in the work-up procedure.
reduction in the infrared carbonyl stretching
Dimethyltin, dibutyltin and diphenyltin oxides
frequencies relative to that for the free
and N-methyl- and N-tolyl o-
hydroxylamines19, 20. However, only a few X-
nitrobenzohydroxamic acids were mixed, in a
ray structures determinations of organotin N-
stoichiometric 1:2 ratio in toluene and refluxed
substituted hydroxylamine derivatives are
for 4 h separately according to Scheme 2. The
available.
reaction mixture was cooled and filtered. The
This paper will entail a description of the filtrate was reduced under vacuum to a small
syntheses and characterization of volume and the orange crystalline solids of
diorganotin(IV) bishydroxamates of the general dimethyl- (1,4), dibutyl- (2,5) or yellow of
formula R2Sn[o-NO2C6H4CONR’O]2 (R= diphenyltin(IV) (3,6) bis(N-methyl- and N-tolyl
methyl, n-butyl and phenyl; R’= methyl and o-nitrobenzohydroxamates) respectively were
tolyl). Infrared, 1H and 13C spectroscopic precipitated by addition of petroleum ether (40
techniques including 119Sn were used in the - 60 oC). Single crystals suitable for X-ray
characterization of the compounds and the diffraction of dimethyl- and dibutyltin
structure of dimethyltin and di-n-butyltin bis(N- complexes were obtained upon slow
methyl- and N-tolyl o-nitrobenzohydroxamates) vaporization from chloroform and methanol
R2Sn[o-NO2C6H4CONR’O]2 (R= methyl and solution after addition of petroleum ether.
butyl; R= methyl and tolyl) were determined by
Elemental Analysis and Spectroscopic
X-ray crystallography. The free ligand and their
Technique
complexes were screened for cytotoxicity
Elemental C, H and N analysis were carried out
activity against human promyolicytic leukemic
on a Fison EA 1108 CHN-S analyser. Tin was
cells (HL-60) and antimicrobial properties.
determined gravimetrically, by igniting a
known quantity of each complex to SnO2.
Infrared spectra were recorded on a Perkin-
O O OH
NO2
NO2 R
R
R2SnO + R Reflux N O O C
Toluene/4hr Sn + H2O
C N O
C O N
R R
O OH NO2
R = Me, Bu and Ph; R'= methyl
Scheme 2. Reaction of N-methyl- and N-tolyl o-nitrobenzohydroxamic acids with diorganotin oxides
complexes. They were Methicillin resistant determined using the microtitration of 3-(4,5-
sthaphylococcus (MRSA), Bacillus subtilis dimethylthiazol-2-yl)-2,5-diphenyltetrazolium
wild type (B29), S. typhimurium, Pseudomonas bromide (MTT) assay (Sigma, USA) as
aeruginosa (60690), Candida albicans (C.A.), reported by Mosmann28. Controls that
Aspergillus ochraceous (398), Saccaromyces contained only cells were included for each
ceciricaee (20341) and Candida lypolytica sample.
(2075).
3. Results and Discussion
Antimicrobial activity of each sample was Elemental analysis and melting point data
qualitatively determined by a modified disc obtained were in good agreement with the
diffusion method27. Antimicrobial activity was values calculated for the proposed empirical
indicated by the presence of clear inhibition formula as shown in Table 1.
zones around the discs. Commercially available
The most relevant infrared data of the N-
streptomysin (Sigma, USA) was used as
methyl- and N-tolyl o-nitrobenzohydroxamic
antibacterial control.
acids and their diorganotin(IV) complexes are
Cytotoxic assay given in Table 2. By comparison with the data
The HL-60 (Human promyolicytic leukemia) reported for other organotin(IV) hydroxamates,
cells line was obtained from the National we suggest the following assignments for these
Cancer Institute, USA. The cells were cultured complexes. The infrared spectra of N-methyl-
in RPMI-1640 medium supplemented with and N-tolyl o-nitrobenzohydroxamic acids
10% fetal calf serum. Cytotoxicity was exhibit, a broad band at 3100 cm-1(N-methyl o-
C N Ph C N
Ph Ph
O O O O
Sn Sn Sn
O O O O
Ph Ph C Ph
N C N
n
Figure 2. Polymeric structure of diphenyltin(IV) complexes
nitrobenzohydroxamic acid) and 3126 cm-1 (N- Strong bands at 1445 cm-1 and 1422 cm-1, in the
tolyl o-nitrobenzohydroxamic acid), which, is spectra of the free ligands, may be attributed to
due to the OH group. These bands disappear in the C-N stretching frequencies. However, on
the spectra of the complexes suggesting the complex formation these bands are shifted to
deprotonation of the hydroxamates group on higher frequencies by 9-54 cm-1. The carbonyl
complex formation. The carbonyl (C=O) oxygen, which serves as a donor atom with
stretching vibration, located at 1630 cm-1 (N- electron withdrawal from the carbonyl group,
methyl o-nitrobenzohydroxamic acid) and 1637 will in turn increase the electron density on the
cm-1 (N-tolyl o-nitrobenzohydroxamic acid), is C-N group. Therefore, a lowering of the
lowered in all diorganotin(IV) complexes by carbonyl frequency and an increase of the C-N
19-107 cm-1 , indicating that the carbonyl group frequency are expected in the infrared spectra
is involved in complex formation. of the complexes1. The coordination through
Table 4. 13C NMR data for diorganotin(IV) complexes and the free ligands.
Cpd. (δ, ppm)
Product C=O Aromatic Aliphatic
I o-NO2C6H4CONCH3OH 161.9 124.9-134.4 N-CH3: 36.6
Table 5 Correlation between 2J(Sn-H) and 1J(Sn-C) coupling constants (Hz) and C-Sn-C angles (θ. º) including
119
Sn (δ, ppm) chemical shifts in diorganotin(IV) complexes 1, 2, 3, 4, 5 and 6.
1 13 119
No. Compound H C Sn
2 1
J(Sn-H) C-Sn-C J(Sn-C) C-Sn-C
1 Me2Sn[o-NO2C6H4CONCH3O]2 87.15 140.6a 784.87 145.6b -189.57
c
2 Bu2Sn[o-NO2C6H4CONCH3O]2 - - 741.82 146.7 -230.26
3 Ph2Sn[o-NO2C6H4CONCH3O]2 - - 937.85 168.5b 414.03
-206.86
-354.34
-414.90
4 Me2Sn[o-NO2C6H4CONC6H4-p-CH3O]2 84.22 136.9a 745.67 142.2b -176.16
5 n-Bu2Sn[o-NO2C6H4CONC6H4-pCH3O]2 - - 724.14 143.6c -218.26
6 Ph2Sn[o-NO2C6H4CONC6H4- p-CH3O]2 - - 891.72 163.9b -203.04
-348.69
a
θ =0.0161(| 2J |)2 – 1.32| 2J | + 133.4 29
b
| 1J | =9.99 θ – 746 30
c
θ =0.178| 2J | + 14.74 31
the carbonyl oxygen and the deprotonation of the case of N-tolyl o-nitrobenzo- hydroxamic
hydroxy group is further supported by the acid is due to the intramolecularly hydrogen
occurrence of new bands at 529 – 564 cm-1 in bonded hydroxy proton, the peak is not-visible
the spectra of the complexes which, may be in the spectrum of N-methyl o-
assigned to ν(Sn-O) 20. nitrobenzohydroxamic acid due to the rapid
exchange with the water molecule present in
The conclusion drawn from 1H NMR spectral
the solvent. However, this peak disappears in
studies, lends additional support to the manner
the 1H NMR spectra of the organotin
of bonding discussed above. The 1H NMR
complexes indicating, thereby, the
spectral data of the N-methyl- and N-tolyl o-
deprotonation on complexation with the
nitrobenzohydroxamic acids and their
organotin moiety. The resonance at 3.28 ppm in
diorganotin(IV) complexes have been recorded
the N-methyl o-nitrobenzohydroxamic acid has
and listed in Table 3. The signal at 9.07 ppm in
been assigned to the methyl protons attached to
the nitrogen atom, which remains unaltered on The carbonyl signals of N-methyl- and N-tolyl
complexation and thus clearly indicates the o-nitrobenzohydroxamic acids occur as a sharp
non-involvement of this group in the complex singlet at 161.9 and 162.0 ppm. On
formation. The resonance at 2.95 ppm has been complexation these signals shift slightly upfield
assigned to the methyl protons on the aromatic to 160.2, 160.0, 159.7-159.1, 161.8, 160.6 and
ring of the N-tolyl o-nitrobenzohydroxamic 161.7 ppm for complexes 1, 2, 3, 4, 5 and 6
acid. For the dimethyltin complexes of N- respectively. This shift indicates the low
methyl- and N-tolyl o-nitrobenzohydroxamic interaction between the carbonyl oxygen of the
acids (1,4) the methyl protons attached to the hydroxamates and the tin atom. The carbon
tin atom appear as a singlet at 0.92 ppm and signal bonded to nitrogen, which appears at
1.07 ppm respectively. The butyl protons in the 36.6 ppm in the free ligand of N-methyl o-
dibutyltin complexes of N-methyl- and N-tolyl nitrobenzohydroxamic acid shifts downfield, to
o-nitrobenzohydroxamic acids appear as a 39.5, 39.6 and 39.7 ppm for complexes 1, 2 and
multiplet and a triplet in the range 1.71 – 2.04 3 respectively. The downfield shift may be
ppm and at 0.91-1.14 ppm due to –(CH2)3 and attributed to steric effect on complex formation.
the terminal CH3 groups respectively. The The carbon signal attached to the tin atom in
complex pattern observed in the region 7.03 – dimethyltin complex appears at 7.4 ppm for
8.32 ppm in all complexes is due to the complex (1) and 7.2 ppm for complex (4). The
overlapping resonances of the aromatic ligand butyl carbon in the dibutyltin complex
and phenyl group protons bonded to tin atom in appeared at 14.0-26.9 ppm region. The carbon
the diphenyltin complexes of N-methyl- and N- signal in the aromatic region appeared at 124.1
tolyl o-nitrobenzohydroxamic acids. This – 145.5 ppm. The peak at 146.3 ppm is due to
observation supports the infrared data. In all the quaternary carbon to which the nitro group
complexes the signals for all types of protons is attached.
have been identified and the number of protons
The C-Sn-C angles may be calculated from
of various groups observed from the integration
NMR parameters and the geometry about the
curves is found to be equivalent to the total
tin atom may be postulated. The calculated C-
number of protons calculated from the expected
Sn-C angles are based on the reported
molecular formula. This interpretation, which is
relationships between 2J(Sn-H) and 1J(Sn-C)
based on 1H NMR results is further supported
coupling constants and the chemical shifts
by a 13C NMR and X-ray structural studies of
obtained from tin NMR recorded in CDCl3 are
four representative complexes 1, 2, 4 and 5.
shown in Table 5. The values of the 2J(Sn-H)
The 13C NMR chemical shifts of the N-methyl- and 1J(Sn-C) coupling constants fall in the
and N-tolyl o-nitrobenzohydroxamic acid and region for six-coordinated tin in the case of
their diorganotin(IV) complexes are listed in diorganotin derivatives29. Structures 1, 2, 4 and
Table 4. For each compound, the number of 5 in solution display a C-Sn-C angle close to
signals observed is in good agreement with the those found in solid state observed from X-ray
molecular formula except for N-methyl o- crystallography. The values might suggest that
nitrobenzohydroxamic acid. The spectra are in solution the dimethyl- and dibutyltin(IV)
generally consistent with the conclusion drawn derivatives is a skew-trapezoidal bipyramid and
from 1H NMR results. In the case of dimethyl- the basic structural features of the solid state
and dibutyltin(IV) complexes, the spectra phase remain in CDCl3. Similar results were
exhibited only one set of resonancess, reported for related compounds 17,18.
indicating the presence of only one structure in
The 119Sn resonances for the diorganotin(IV)
solution whereas in the case of diphenyltin(IV)
complexes appear as sharp signals and their
complexes the spectra exhibited two sets of
chemical shifts fall in the range for six-
resonances indicating the presence of dimeric
coordinated tin32. It is well known that an
or oligomeric or polymeric structures in
increase in the coordination of tin should give
solution as shown in Figure 2. The structures
rise to a high field shift of δ 119Sn 33. The δ
are most probably due to the intermolecular 119
Sn values are also dependent on the ligand
bridging of the ligands as proved by 119Sn
and show an upfield shift with increasing
NMR spectra, which exhibit more than one
distance between the two coordinating atoms 34.
signal.
Figure 5. Structure and atomic numbering scheme for Me2Sn-NO2C6H4CONC6H4- p-CH3O]2 (4)
Figure 6. Structure and atomic numbering scheme for n-Bu2Sn[o-NO2C6H4CONC6H4- p-CH3O]2 (5)
119
The values of δ 119Sn in addition depend on the Sn values appear at (414.03, -206.86, -
grouping attached to tin. For complexes 3 and 354.34 and -414.90) and (-203.04 and -348.69)
6, which have phenyl substituents on tin, δ respectively, but for the complexes 1, 4, 2 and
5 which have methyl and butyl substitutents on
Table 6.Bon d lengths [Å] and angles [°] for compounds 1, 2, 4 and 5.
Bond d(Å) Bond ω (deg) Bond ω (deg)
Compound (1)
Sn(1)-C(2) 2.097(3) C(11)-N(3)-C(2) 129.0(3)
Sn(1)-C(1) 2.098(3) C(2)-Sn(1)-C(1) 147.83(2) O(6)-N(3)-C(2) 112.7(3)
Sn(1)-O(2) 2.118(2) C(1)-Sn(1)-O(1) 83.96(1) O(1)-C(3)-N(1) 121.7(3)
Sn(1)-O(6) 2.123(2) O(2)-Sn(1)-O(1) 71.00(8) O(1)-C(3)-C(4) 119.8(3)
Sn(1)-O(5) 2.380(2) O(6)-Sn(1)-O(1) 140.93(8) N(1)-C(3)-C(4) 118.4(3)
Sn(1)-O(1) 2.383(2) O(5)-Sn(1)-O(1) 147.89(8) O(5)-C(11)-N(3) 121.9(3)
O(1)-C(3) 1.246(4) C(3)-O(1)-Sn(1) 111.08(2)
O(2)-N(1) 1.373(3) O(5)-C(11)-C(1) 119.3(3)
N(1)-O(2)-Sn(1) 116.98(2) N(3)-C(11)-C(1) 118.6(3)
O(5)-C(1) 1.252(4) C(11)-O(5)-Sn(1) 111.3(2)
O(6)-N(3) 1 .373(3) N(3)-O(6)-Sn(1) 117.70(2)
N(1)-C(3) 1.298(4) C(3)-N(1)-O(2) 118.9(3)
N(3)-C(1) 1.308(4) C(3)-N(1)-C(1) 128.6(3)
N(1)-C(3) 1.317(4) O(2)-N(1)-C(1) 112.3(3)
C(11)-N(3)-O(6) 118.2(3)
Compound (2)
Sn(1)-C(1) 2.100(7) C(1)-Sn(1)-O(2) 101.2(3) C(5)-Sn(1)-O(5) 85.47(2)
Sn(1)-O(2) 2.111(4) C(1)-Sn(1)-C(5) 147.0(3) O(6)-Sn(1)-O(5) 71.13(1)
Sn(1)-C(5) 2.112(6) O(2)-Sn(1)-C(5) 104.4(2) O(1)-Sn(1)-O(5) 143.85(1)
Sn(1)-O(6) 2.117(4) C(1)-Sn(1)-O(6) 105.8(2) C(9)-O(1)-Sn(1) 109.4(4)
Sn(1)-O(1) 2.384(4) O(2)-Sn(1)-O(6) 73.88(2) N(1)-O(2)-Sn(1) 115.5(3)
Sn(1)-O(5) 2.410(4) C(5)-Sn(1)-O(6) 101.1(2) C(17)-O(5)-Sn(1) 111.3(4)
O(1)-C(9) 1.260(7) C(1)-Sn(1)-O(1) 83.4(3) N(3)-O(6)-Sn(1) 117.3(3)
O(2)-N(1) 1.375(6) O(2)-Sn(1)-O(1) 71.21(1) C(9)-N(1)-O(2) 119.3(5)
O(5)-C(2) 1.243(6) C(5)-Sn(1)-O(1) 85.4(2) C(9)-N(1)-C(16) 128.2(5)
O(6)-N(3) 1.370(6) O(6)-Sn(1)-O(1) 145.01(1) O(2)-N(1)-C(16) 112.5(5)
N(1)-C(9) 1.296(7) C(1)-Sn(1)-O(5) 85.4(3) C(17)-N(3)-O(6) 119.6(4)
N(3)-C(2) 1.330(7) O(2)-Sn(1)-O(5) 144.87(2) C(17)-N(3)-C(2) 128.0(5)
Compound (4)
Sn(1)-C(1) 2.093(4) C(1)-Sn(1)-C(2) 146.29(2) O(2)-Sn(1)-O(1) 71.49(7)
Sn(1)-C(2) 2.094(4) C(1)-Sn(1)-O(2) 106.46(1) O(6)-Sn(1)-O(1) 144.60(8)
Sn(1)-O(2) 2.126(2) C(2)-Sn(1)-O(2) 100.53(1) O(5)-Sn(1)-O(1) 143.97(8)
Sn(1)-O(6) 2.141(2) C(1)-Sn(1)-O(6) 100.12(1) C(3)-O(1)-Sn(1) 110.80(2)
Sn(1)-O(5) 2.376(2) C(2)-Sn(1)-O(6) 106.63(1) N(1)-O(2)-Sn(1) 116.84(2)
Sn(1)-O(1) 2.395(2) O(2)-Sn(1)-O(6) 73.71(8) C(17)-O(5)-Sn(1) 110.86(2)
O(1)-C(3) 1.251(4) C(1)-Sn(1)-O(5) 85.68(1) C(3)-N(1)-O(2) 119.0(2)
O(2)-N(1) 1.380(3) C(3)-N(1)-C(1) 127.2(2)
O(3)-N(2) 1.214(4) C(2)-Sn(1)-O(5) 83.90(1) O(2)-N(1)-C(1) 113.4(2)
O(4)-N(2) 1.215(4) O(2)-Sn(1)-O(5) 144.44(8) C(17)-N(3)-O(6) 118.8(2)
O(5)-C(17) 1.248(4) O(6)-Sn(1)-O(5) 71.26(8) O(1)-C(3)-N(1) 121.8(3)
O(6)-N(3) 1.381(3) C(1)-Sn(1)-O(1) 83.74(1) N(1)-C(3)-C(4) 118.4(3)
C(2)-Sn(1)-O(1) 86.10(1)
Compound (5)
Sn(1)-C(1) 2.100(5) C(1)-Sn(1)-O(2) 103.68(2) C(5)-Sn(1)-O(5) 82.29(2)
Sn(1)-O(2) 2.102(2) C(1)-Sn(1)-O(6) 104.59(2) O(2)-Sn(1)-O(5) 145.20(9)
Sn(1)-O(6) 2.123(3) O(2)-Sn(1)-O(6) 75.60(9) O(1)-Sn(1)-O(5) 142.83(9)
Sn(1)-C(5) 2.130(5) C(1)-Sn(1)-C(5) 145.80(2) C(9)-O(1)-Sn(1) 110.2(2)
Sn(1)-O(1) 2.376(2) O(2)-Sn(1)-C(5) 105.24(2) N(1)-O(2)-Sn(1) 116.25(2)
Sn(1)-O(5) 2.467(2) O(6)-Sn(1)-C(5) 99.97(2) C(23)-O(5)-Sn(1) 109.6(2)
O(1)-C(9) 1.258(4) C(1)-Sn(1)-O(1) 84.34(2) N(3)-O(6)-Sn(1) 117.6(2)
O(2)-N(1) 1.375(3) O(2)-Sn(1)-O(1) 71.96(9) C(9)-N(1)-O(2) 119.5(3)
O(5)-C(2) 1.242(4) O(6)-Sn(1)-O(1) 147.55(1) C(23)-N(3)-O(6) 118.3(3)
O(6)-N(3) 1.389(4) C(5)-Sn(1)-O(1) 87.58(2) C(23)-N(3)-C(3) 128.0(3)
N(1)-C(9) 1.316(4) C(1)-Sn(1)-O(5) 84.34(2)
N(3)-C(2) 1.322(5) O(6)-Sn(1)-O(5) 69.62(9)
tin δ 119Sn values appear at -189.57, -176.16, - used35. These δ 119Sn values compare well with
230.26 and -218.26 respectively. These the six-coordinated tin compounds of the same
differences in the values are comparable with class17, 18 [values –198 and –182 for dimethyl, -
the differences found in starting material
222, -226 and –236 for dibutyl and –354 and – example, in the complex 1 the Sn-O bonds
361 for diphenyl]. were found to be at 2.118(2) and 2.383(2) Å
while in complex 2, 2.117(4) and 2.410(4) Å.
The molecular structures of Me2Sn[o-
The corresponding C-O bond lengths values are
NO2C6H4CONCH3O]2.H2O 1, n-Bu2Sn[o-
more characteristic of a double bond 19. The N-
NO2C6H4CONCH3O]2.½H2O 2, Me2Sn[o-
O bond lengths on the other hand are more
NO2C6H4CONp-CH3C6H4O]2.H2O 4 and n-
inclined towards a single bond 19. Hence, it may
Bu2Sn[o-NO2C6H4CONC6H4- p-CH3O]2 5 are
be deduced that the hydroxamate anion chelates
shown in Figures 3, 4, 5 and 6 respectively.
as a bidentate entity. The long Sn-O bonds are
Selected bond distances and angles are reported
considerably below the sum of the van der
in Table 6 for compounds 1, 2, 4 and 5. As
Waals radii for these atoms at 3.70 Å37. The C-
expected, the tin(IV) atoms in all complexes
O, C-N and N-O bond distances in the
investigated by X-ray crystallography were
coordinated hydroxamate ligands indicate the
found to be six-coordinated with two organic
expected electron delocalisation over the O-C-
groups (methyl or butyl) and two ligands. It is
N-O fragment. The Sn-C bond lengths 2.09 Å
clear that the hydroxamates behave as a
in compounds 1 and 4 are much shorter than
bidentate agent via two oxygen atoms. In all the
the Sn-C bond lengths in dimethyltin(IV)
structures examined by X-ray crystallography
dichloride 2.21 Å38. The geometry found about
the ONCO skeleton of each ligand is essentially
the tin atom in all structures studied here are
planar, the deviation of tin atoms from these
best described as a skew-trapezoidal bipyramid
planes being 0.022 Å and 0.012 Å for 1, -0.088
(STB).
Å and -0.005 Å for 2, 0.001 Å and -0.079 Å for
4 and 0.084 Å and 0.056 Å for 5 respectively The most important aspect of the structures is
which is substantially lies out of both planes. the non-participation of the nitro groups in the
The o-nitrophenyl group of each hydroxamate coordination to the central tin atom. As can be
group formed dihedral angles of 85.42˚ and seen from Figures 4, 5, 6 and 7 the nitro groups
88.06˚ in complex 1 and 82.60º and 88.89º in are directed away from the tin atom.
complex 2 with the chelating OCNO planes. Furthermore, the nitro groups do not make
The two o-nitrophenyl and p-methylphenyl close intermolecular contacts to tin in the
groups of each hydroxamate residue form crystal lattices. Coordination numbers greater
dihedral angles of 83.09º\78.24º and than six are known for diorganotin species39, 40,
63.34º\60.24º in complex 4 and 87.22º\84.83º and would seem that the presence of the bulky
and 66.54º\47.9º in complex 5 with chelating phenyl group bound to the nitro groups
OCNO planes. precludes close contacts with neighbouring tin
centre. The structures determination reported
The angles subtended by the alkyl groups to the
here combined with NMR evidence suggest
tin centre, C-Sn-C 147.83º, 147.0º, 146.29º and
that these compounds adopt monomeric
145.8º for 1, 2, 4 and 5 respectively. These
structures in the solid state.
values were found to be lie in the range of
122.6-156.9º which have been found in Screening for antimicrobial activity was done
diorganotin bischelate system wherein the on all the compounds. The results of the
organo substitution do not choose cis- or trans- antimicrobial screening are shown in Table 7.
geometries about the tin atom36. In the All compounds were inactive against C.
structures the two hydroxamates groups are lypolytica (2075), C. albicans (C.A) and
almost equivalent, forming one short covalent ochraceous (398) except compound (3), which
and one long coordinate tin to oxygen as shown showed moderate activity with inhibition zone
in Table 6. The structures (3), (4) and (6) of 10 mm against S. ceciricaee (20341).
contain one, half and one molecules of water Compound (II) was inactive against all
respectively which do not affect the geometry pathogenic microbials. All complexes showed
around the tin atom. clear inhibition zones of 7 mm and above
against Methicillin resistant sthaphylococcus
The coordination mode of hydroxamates was
(MRSA), P. aeruginosa (60690), S.
deduced from the bond lengths extended by the
typhimurium and Bacillus subtilis wild type
tin centre to the oxygen atoms, which were
found to be significantly different. For
I o-NO2C6H4CONCH3OH - 8 - - 8 - - -
1 Me2Sn[o-NO2C6H4CONCH3O]2 - 14 14 13 14 - - -
2 Bu2Sn[o-NO2C6H4CONCH3O]2 - 14 14 12 11 - - -
3 Ph2Sn[o-NO2C6H4CONCH3O] - 12 13 13 14 - - 10
II o-NO2C6H4CONC6H4- p-CH3OH - - - - - - - -
4 Me2Sn[o-NO2C6H4CONC6H4-p- - 14 14 14 13 - - -
CH3O]2
5 n-Bu2Sn[o-NO2C6H4CONC6H4-p- - 8 8 8 7 - - -
CH3O]2
6 Ph2Sn[o-NO2C6H4CONC6H4-p-CH3O]2 - - - - - - - -
Methicillin resistant sthaphylococcus (MRSA); Bacillus subtilis wild type (B29); S. typhimurium P. aeruginosa
(60690); C. albicans (C.A); A. ochraceous (398); S. ceciricaee (20341); C. lypolytica (2075); ‘ _/’, inactive.
a
Diameter of 15 mm and above considered active.
I o-NO2C6H4CONCH3OH -
1 Me2Sn[o-NO2C6H4CONCH3O]2 -
2 Bu2Sn[o-NO2C6H4CONCH3O]2 0.60
3 Ph2Sn[o-NO2C6H4CONCH3O] 2.00
II o-NO2C6H4CONC6H4- p-CH3OH -
4 Me2Sn[o-NO2C6H4CONC6H4-p-CH3O]2 23.0
5 n-Bu2Sn[o-NO2C6H4CONC6H4-p-CH3O]2 0.60
6 Ph2Sn[o-NO2C6H4CONC6H4-p-CH3O]2 1.50
_
‘ ’ Inactive
(B29) and considered to be moderately active complex 2 and 5 to 1.50 and 2.00 for
except complex 6 which was inactive. complexes 3 and 6. Complex 1 showed
inactivity whereas complex 4 showed weak
The ligands and their complexes were
activity.
evaluated for cytotoxic activity. The results of
the cytotoxicity screening against HL-60 are 4. Conclusion
shown in Table 8. The leukemic cell (HL-60) The complexes of diorganotin(IV) derivatives
were inactive to the ligands (I) and (II) but was of hydroxamic acids with the general formula
found to be sensitive towards the complexes R2Sn[o-NO2C6H4CONR'O]2 (R=methyl, butyl
except for complex 1, which was inactive. and phenyl; R’= CH3 and p-CH3C6H4), were
According to suggestion by Shier41 compounds successfully obtained by the azeotropic
with CD50 values of more than 10-25 µg/ml are removal of water generated in reactions
considered indicative of weak cytotoxic activity between diorganotin(IV) oxide and the relevant
while compounds with CD50 values less than 5 N-substituted o-methoxy- and o-
µg/ml are considered to be very active. nitrobenzohydroxamic acids in toluene as
Compounds with CD50, values from 5-10 µg/ml solvent using a Dean and Stark water separator.
are designate as moderately active. All Molecular sieve is also used to absorb the water
complexes showed very strong activity against molecules that are generated as a minor
HL-60 with CD50 values ranging from 0.60 for product. The isolated complexes are found to
be stable which suggests that the π-system of Taylor RJ, May I, Wallwork AL. Dennis IS, Hill N
electrons in the aromatic ring may have a role J, Galkin BY, Zilberman BY, Fedorov YSJ. Alloys
to play in stabilizing the tin(IV) oxidation state. and Comp. 1998, 534: 271.
The complexes are soluble in solvents such as Neilands JB. Science 1967; 156: 1443.
chloroform and DMSO. The spectroscopic
Maehr H. Pure Appl. Chem. 1971; 28: 603.
investigations of all compounds studied here
indicate that the tin atom is six-coordinated and Pereyre M, Quintard JP and Raham A. Tin in
is further supported by X-ray crystal structures Organic Synthesis, Butterworths, London, 1987;???.
of four representative compounds 1, 2, 4 and 5. Jousseaume B, Pereyre M, and Smith PJ, Chemistry
The dimethyltin(IV) and dibutyltin(IV) of Tin, 2nd ed, Blackie, London, 1998, Chap. 9, p.
complexes gave a distorted octahedron 290.
geometry best described as skew-trapezoidal Plunden SJ, Cusack PA, and Hill R. The Industrial
bipyramidal defined by C-Sn-C angles of Uses of Tin Chemical, The Royal Society of
147.83˚, 147.0˚, 146.29˚ and 145.8˚ Chemistry, London, 1985.
respectively. The free ligands and their
Evans CJ and Smith PJ, Chemistry of Tin, 2nd ed,
complexes were screened against antimicrobial Blackie, London, 1998, Chap. 2, p. 442.
and human promyolicytic leukemic cells (HL-
60). The dibutyltin and diphenyltin complexes Evans CJ, and Karpel S. J. Organomet. Chem. Libr.
were found to be more active than the 1985; 16: 83.
dimethyltin complexes. The, antimicrobial test Gielen M. Coord. Chem. Rev., 1996; 151: 41.
showed that these complexes were moderately
Gielen M; Lelieveld P; ve Dos D, Willem R. Metal
active while only one complex has found to be Based Anti-Tumour Drugs 1992; 2: 29.
moderately active against one type of fungi.
Choudhuri SK, Roy PS, Ghoah AK. Indian J.
5. Acknowledgements Chem. 1984; A23: 535.
We would like to thank the Malaysian
Government for funds (IRPA 09-02-02-0133). Choudhuri SK, Dutta SD, Chatterjee R, Chowdhury
JR. Chemotherapy 1991; 37: 122.
Mr Elhadi E. Saad is indebted to the General
Committee of Education and Scientific Chun-Ying W, Pin Y, Lian-Hong W, Li W. Chinese
Research Libya for financial support. Technical J. Chem. 2002; 20: 453.
assistance from members of the Faculty of Gielen M, Tin Based Antitumour Drug, edited by
Science and Technology, University Gielen M., NATO ASI Series, Ser. H: Cell Biology,
Kebangsaan Malaysia is gratefully 1989; Vol. 37.
acknowledged. Petrosyan VS, Yashina NS, Sizova TV, Leonova
Supplementary material TV, Aslanov LA, Yatsenko AV, Pellerito L. Appl.
Crystallographic data for the structural analyses Organomet. Chem. 1994; 8: 11.
of dimethyl-, dibutyltin(IV) bis(N-methyl o- Drovetskaia TV, Yashina NS, Leonova TV,
nitrobenzohydroxamates), dimethyl- and Lorberth J, Wocadlo S, Massa W, Pebler J. J.
dibutyltin(IV) bis(N-tolyl o- Organomet. Chem. 1996; 507: 201.
nitrobenzohydroxamates) 1, 2, 4 and 5 Harrison PG, King TJ, Richards JA. J. Chem. Soc.,
complexes have been deposited with the Dalton Trans. 1975; 9: 826.
Cambridge Crystallographic Data Center,
CCDC 224202, CCDC 224200, CCDC 224201 Das MK, Nath M, Zuckermann JJ. Inorg. Chim.
Acta 1983; 71: 49.
and CCDC 224203. Copies of this information
may be obtained free of charge from: The Gixasolo MA, Guli G, Rellerito I, Stocco GC. Appl.
Director, CCDC, 12 Union Road, Cambridge, Organomet. Chem. 1995; 9: 24.
CB2 1EZ, UK (fax: + 44-1223-336033; e-mail: Ulrich H, Sayigh AAR. J. Chem. Soc. 1963; 1098.
deposit@ ccdc.cam.ac.uk or www:
Harrison PG and Richards JA. J. Organomet. Chem.
http://www.ccdc.cam.ac.uk).
1980; 185: 9.
6. References Sheldrick GM. SHELXS-90. 1990. Program for the
Chatterjee B. Coord. Chem. Rev. 1978; 26: 281. Automatic Solution of Crystal Structure. Universty
Agrawal Y K. Rev. Anal. Chem. 1980; 5: 3. of Göttingen. Germany.
Sheldrick GM. SHELXL-97. 1997. Program for the Haward Jr. G. Crecely RW, Nelson WH. Inorg.
Refinement of Crystal Strucrures. Universty of Chem. 1985; 24: 2204.
Göttingen. Germamny .
Smith PJ, Tupeiauskas AP. Ann. Rep. NMR
Johnson CK. ORTEP-II. Report ORNL-5138, Oak, Spectrosc. 1978; 8: 291.
Ridge National Laboratory, Oak Ridge, Tennessee
Ng SW, Wei C, Kumar Das VG, Mak, TC. W. J.
1976.
Organomet. Chem. 1987; 334: 295.
Bauer AW, Kirby MDK, Sherris JC, Turck MD.
Bondi, A. J. Phys. Chem. 1964; 68: 441.
Am. J. Clin. Path. 1966; 45: 439.
Davies AG, Milledge HJ, and Puxley DC. J. Chem.
Mosmann T. J. Immunol. Meth. 1983; 65: 55.
Soc. A 1970; 2862.
Lockhart TP, Manders WF. Inorg. Chem. 1986; 25:
Lockhart TP. Organometallic 1988; 7: 1438.
892.
Lockhart TP, Davidson F. Organometallic 1987; 6:
Lockhart TP, Manders WF, Zuckerman JJ. J. Am.
2471.
Chem. Soc. 1985; 107: 4546.
Shier WT, Mammalian cell culture on $5 a day: a
Holecek J, Lycka A. Inorg. Chim. Acta. 1986; 118:
laboratory manual of low cost methods, los Banos,
L15.
University of the Philippines 1991; 64pp.
Otera J. J. Organomet. Chem. 1981; 221: 57.
Holecek J, Nadvorni, M, Handlir K, Lycka,A. J.
Organomet. Chem. 1983; 241: 177.
Abstrak
Flavonid adalah komponen fenolik dengan berat molekul rendah yang secara luas terdapat
pada tumbuhan, umumnya pada tumbuhan tingkat tinggi. Flavonoid bermanfaat bagi
kesehatan manusia. Flavonoid diketahui secara in vitro berpotensi sebagai antioksidan dan
pemecah aktivitas radikal bebas. Fakta-fakta yang berkembang flavonoid berperan
melindungi dari penyakit kardiovascular dan kanker. Beberapa flavonoid mempunyai sifat
sebagai antiviral, antibakterial, antifungal atau anti-alergenik. Pada umumnya untuk
mendapatkan senyawa flavonoid dari tumbuhan digunakan metoda ekstraksi dengan berbagai
jenis pelarut kimia, dalam penelitian ini ditujukan untuk menemukan metoda lain dalam
mengisolasi senyawa flavonoid dari daun jati Tectona grandis melalui proses fermentasi
dengan mikroorganisme Aspergillus niger. Hasil adaptasi Aspergillus niger pada media
100% daun jati Tectona grandis, umur inokulum yang dapat digunakan untuk proses
fermentasi dengan skala yang lebih besar adalah 48 jam dimana yield yang dihasilkan 2,05%
pada kondisi pH rata-rata 3,75. sedangkan yield flavonoid yang dihasilkan dengan cara
ekstraksi soxletasi 1,27%. .dengan peningkatan efisiensi sebesar 61,85% pada proses
fermentasi.
Kata kunci: Flavonoid, fermentasi Aspergillus niger.
1020
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Yanty Maryanty, Fida Madayanti, Akhmaloka
Kandungan kimia yang terdapat pada Jati emas intervalwaktu 12 jam. Pada setiap sampling
diantaranya: Tanin dan lendir (kandungan aktif tersebut dilakukan pengukuran berat kering dari
utama yang berhubungan dengan aktivitas jamur dan pH. Kemudian dibuat grafik antara
pelangsing tubuh/ “body slimming”), alkaloid, berat kering, yang telah dikoreksi terhadap
β- sitosterol, kaffein, friedelin - 3α- asetat, kontrol berupa medium yang tidak diinokulasi
friedelin - 3β- ol, terpens/sterol, karotenoid, dengan jamur pada kondisi yang sama dengan
flavonoid, resin, glukosa, asam lemak, asam asumsi hanya berat miselium yang terukur,
fenolik, zat-zat pahit dan karbohidrat dalam terhadap waktu. Dari aluran kurva pada
lendir (Rantee group, inc). Pada umumnya medium adaptasi diperoleh umur optimum
untuk mendapatkan senyawa flavonoid dari jamur (spora). Dari grafik juga dapat ditentukan
tumbuhan digunakan metoda ekstraksi dengan yield dan rendemen flavonoidnya.(Delita
berbagai jenis pelarut kimia, dalam penelitian Yuliani)
ini ditujukan untuk menemukan metoda lain 2.4 Ekstraksi dan Identifikasi Flavonoid dari
dalam mengisolasi senyawa flavonoid dari Daun Jati
daun jati Tectona grandis melalui proses Daun jati dicuci dan dikeringkan pada suhu
fermentasi yang merupakan salah satu bagian 35°C dalam oven dan dengan liquidizer diubah
bioteknologi yang menggunakan dalam bentuk bubuk. Bubuk daun jati
mikroorganisme sebagai pemeran utama dalam diekstraksi dengan menggunakan dietileter
suatu proses (srikandi fardiaz) dalam hal ini secara soxhletasi selama 4 jam untuk
mikroorganisme yang digunakan adalah menghilangkan kandungan lemaknya,
Aspergillus niger karena dapat menghasilkan kemudian daun di saring menggunakan kertas
berbagai enzim diantaranya hidrolase, α- saring whatman no.1 secara vakum. Bubuk
amilase, amilase, N-araginase, katalase, daun jati kering selanjutnya diekstraksi dua kali
selulase, enzim selulotik, glukose oksidase, dengan menggunkan pelarut methanol . ekstrak
glukoamilase, maltase dan protease, yang yang menggandung flavonoid disaring dengan
diharapkan dapat mengoptimalkan senyawa menggunakan kertas whatman no.1 secara
flavonoid yang dihasilkan. vakum dan diuapkan dengan menggunakan
2. Percobaan rotavapor. Ekstrak dikeringkan pada suhu 35-
2.1 Bahan Baku 40°C dengan udara panas.( Rita Spiteri)
Bahan baku penelitian adalah daun jati emas 3. Hasil Dan Pembahasan
yang diperoleh dari daerah Karawaci Pertumbuhan pada organisme uniseluler (ber
Tanggerang. Mikroorganisme yang digunakan sel tunggal)adalah petambahan jumlah sel yang
adalah Aspergillus niger, yang diperoleh dari berarti juga pertambahan jumlah
laboratorium Bioprosess Departemen Teknik mikroorganisme. dalam fermentasi biasanya
Kimia ITB. dilakukan pengukuran jumlah mikroorganisme
2.2 Penyiapan Sampel Basah untuk mengetahui kecepatan pertumbuhannya
Daun jati dicuci bersih dengan menggunakan dilakukan dengan beberapa cara seperti
air dan dibilas dengan aquades, dan pengukuran jumlah sel (perhitungan
dikeringkan dalam suhu ruang. Daun yang telah mikroskopik langsung, hitung cawan),
dikeringkan kemudian dibelnder dengan penggukuran massa sel (pengukuran berat
perbandingan daun dan aquades 1: 5 sampai kering, kekeruhan), pendugaan massa sel secara
terbentuk slurry daun jati. Slurry daun jati tidak langsung (pengukuran konsumsi nutrient,
dituangkan kedalam Erlenmeyer selanjutnya pengukuran komponen sel)( Srikandi Fardiaz).
media disterilisasi dengan menggunakan pada penelitian ini pengukuran pertumbuhan
autoklaf. (Delita Yuliani) Aspergillus niger dengan pengukuran berat
kering selnya. dari hasil percobaan terlihat
2.3 Pembuatan Kurva Pertumbuhan
terjadi penurunan jumlah mikroba pada awal
Kedalam medium adaptasi diinokulasi secara
fase adaptasinya Tabel 1) pada jam ke-0 sampai
aseptik sebanyak 10% (V/V) inokulum spora
jam ke-12 dan diikuti fase logaritmik hingga
dari jamur Aspergillus niger, kemudian
jam ke-36. dengan interval waktun pengukuran
inkubasi selama 72 jam pada suhu ruang 23-
12 jam fase statis tidak terlihat dalam grafik
27°C dengan pengocokan 180 rpm. Selama sehingga dari fase logaritmik langsung diikuti
inkubasi tersebut dilakukan sampling setiap
0,08
1,50 berat kering
jumlah ini lebih kecil jika dibandingkan dengan
yield
0,06 (g)
0,04
1,00 Yield
proses fermentasi sel bebas sehingga pada
0,02 0,50
proses fermentasi terjadi effisiensi sebesar 61,
0,00 0,00 85% dibandingkan dengan proses ekstraksi.
0 12 24 36 48 60 72
waktu (jam)
4. Daftar Pustaka
1. Fardiaz Srikandi, 1989. Fisiologi
Gambar 1 berat kering dan yield terhadap Fermentasi . Pusat Antar Universitas Pangan
waktu dan Gizi. IUC FN IPB.
2. Harborne J.B. 1987.Metode Fitokimia:
dengan fase menuju kematian pada jam ke-48 Penuntun Cara Modern Menganalisa
dan fase kematian pada jam ke-72. Tumbuhan. Edisi Kedua. Pebnerbit ITB.
Bandung
Flavonoid merupakan metabolit sekunder,
dimana komponen ini tidak diprosuksi pada 3. Miller Alan L, ND. 2004. Antioksidant
waktu pertumbuhan sel secara cepat (fase Flavonoids: Structure, Function and Clinical
logaritmik atau fase drophase) (Srikandi Usage.
Http:///www.thorne.com/altmedrev/fulltext/fla
Fardiaz), pada gambar 1 bahwa flavonoid
vonoids1-2.html, Diakses tanggal 2 Juni 2004.
diproduksi dengan hasil yang tertinggi pada
waktu adaptasi jam ke-48, dimana kondisi ini 4. Nijveldt J Robert. 2001. Flavonoids: A
dapat dipergunakan untuk produksi flavonoid Review of Probable Mechanism of Action And
pada skala yang lebih besar. Kebanyakan Potential Aplications. Am J Clin Nutr; 74:
418-25
mikroba dapat tumbuh pada kisaran pH 3-4 unit
pH atau kisaran 1000 – 10.000 konsentrasi ion 5. Rantree Group, Inc. (1996-
hidrogen. nilai pH untuk pertumbuhan mikroba 1997)..Mutamba – Guazuma ulmifolia [on-
mempunyai hubungan dengan suhu line]. Available WWW: http:///www.rain-
pertumbuhannya. jika Selama proses tree.com, Diakses tanggal 28 April 2004.
fermentasi kemungkinan terjadi perubahan 6. Spiteri Rita: Analysis of Rutin: A
senyawa kimia diantaranya polifenol dan gula. Flavonoid Found in Capparis Spinosa L.
Perub ahan ini dibantu oleh enzim yang dapat Available
menguraikan senyawa polifenol menjadi http://www.cis.um.edu.mt/~phcy/symp98/Rita
antosianin dan perubahan gula menjadi alkohol Spiteri.html. Diakses tanggal 10 September
2004
Abstract
Interfacial adsorptions of divalent and trivalent metal(II/III) complexes of 2-(5-bromo-2-
pyridylazo)-5-diethylaminophenol were investigated in toluene-water and heptane-water
systems by the high-speed stirring method combined with a photodiode-array
spectrophotometry, (metal ion = Co(II), Ni(II), Cu(II), Zn(II), Dy(III) and Gd(III)). The
observed all-metal complexes were completely adsorbed at the liquid-liquid interfaces, except
for Cu(II) complex dissolved in aqueous phase, and a large number of Ni(II) and Zn(II)
complexes would be extracted in the toluene. However, Ni(II) and Zn(II) complex at the
toluene-water interface were adsorbed higher than the ligand. The analysis of the interfacial
adsorption constants of ligand and complex were determined by the Langmuir adsorption
isotherm.
Key words: Complexation, interfacial adsorption, liquid-liquid interface, solvent extraction,
pyridylazo ligand.
the toluene-water and heptane-water interface The organic phase was continuously separated
by the HSS spectrophotometry. from the agitated mixture by means of a PTFE
phase separator and circulated through a flow
2. Experimental
cell with 10 mm optical path length installed in
2.1 Reagents
a Shimadzu photodiode-array detector SPD-M
Heptane and toluene (Nacalai Tesque Inc.,
6A at a flow rate of 15 ml min-1. Before the
G.R.) were purified by fractional distillation. 5-
addition of metal(II/III) solution, the interfacial
Br-PADAP (Dojindo lab., G.R.) was dissolved
adsorption behaviour of ligan was observed at
in heptane or toluene. The pH of aqueous phase
5000 rpm. When the stirring speed was
was controlled with acetate buffer or by the
decreased to 200 rpm, the absorbance increase
mixture of MES (Dojindo) and NaOH. The
of ligand in organic phase was observed.
ionic strength of the aqueous phase was
Afterward, 0.5 ml metal(II/III) stock solution
maintained at 0.1 M by (H+, Na+) ClO4-. Ni
was injected into the mixture at 5000 rpm, and
powder (>99.99% purity), Co metal (99.9 %),
the metal complexation was initiated. The
Cu metal (99.999%), Zn metal (>99.98%),
absorption spectra of the organic phase were
Dy2O3 and Gd2O3 and all the reagents were of
observed as a function of time.
analytical reagent grade. Water was purified by
using a Milli-Q system (Millipore) after The powders of Ni(II) and Zn(II) complexes
distillation and deionization. were synthesized by the technique of the
interfacial liquid-liquid reaction. They were
2.2 High-speed stirring measurement
dissolved in toluene to prepare the stock
The measurements of interfacial adsorption of
solutions, and used for the determination of the
ligand and metal complex, and the extraction
interfacial adsorption constants of metal
process of metal(II/III) with 5-Br-PADAP in
complexes in the toluene-water system by the
liquid-liquid systems were performed by the
HSS method.
high-speed stirring (HSS) spectrophotometry,
analogous to that reported previously (Onoe, 3. Results and Discussion
1998; Watarai, 1995). 49.5 ml of a buffered 3.1. Interfacial adsorption of ligan
aqueous phase without metal (II/III) containing Figure 1a shows the interfacial adsorption
0.1 M (H+, Na+)ClO4- and 50 ml of HL in measurement of ligan in the toluene-water
toluene or heptane were put into the glass stir system observed at the absorption maximum
cell, immersed in a thermostated water bath at wavelength, λmax = 462 nm. First, the rate of
25±0.1oC, and stirred at the rate of 5000 rpm. stirring is conducted under a high speed (5000
(a) (b)
1
200 rpm 452 nm
Cu(II) added 0.8 556 nm
1 200 rpm
HL
0.6
Absorbance
0 0
0 10 20 30 40 0 10 20 30 40 50 60
Time / min Time / min
(a) (b)
Fig. 1. Typical absorbance changes of Cu(II) complexation in toluene-water sytem (a), and Co(II)
complexation in heptane-water system (b) versa extraction time were observed at 200 rpm and 5000
rpm by the high-speed stirring method; (a) [HL] = 2.0x10-5 M, [Cu(II)] = 2.0x10-4 M, pH 6.5, (b) [HL]
= 1.4x10-5 M, [Co(II)] = 5.0x10-6 M, pH 6.0.
rpm) and the dispersed mixture contains HL. K’Si was obtained from the fitting of the
The rate of stirring was changed to 200 rpm Langmuir adsorption isotherm to be 4.4x101
(low speed), and the concentration of ligand in cm3. Using aSi = 8.7x10-7 mol for rhodamine B
the organic phase slightly increased due to the determined in toluene-water system, a is the
decrease in the interfacial area. In this system, maximum interfacial concentration of
the concentration of ligand was adsorbed very rhodamine B at the saturation state, which log
small at the interface. The amount of interfacial a=-10.29 mol cm-2 (Watarai, 1996). Therefore,
species, ni (mol) was calculated by, the K’ value was obtained to be 2.6x10-3 cm for
ligan at heptane-water interface. The interfacial
( A200 - A5000 ) Vo adsorption constants are very important to
ni = [HL]i Si = (1)
εl measure the kinetic reaction in the extraction
system or that was formed completely at the
where [HL]i is the interfacial concentration of interface.
the species (mol cm-2), Si the interfacial area
(17,000 cm2), A200 and A5000 are the absorbances 3.2. Interfacial complexation
in the organic phase under the low speed In Fig. 1b, after the observation of the
stirring and the high speed stirring conditions, interfacial adsorption behaviour of the ligand in
respectively. Vo, ε and l are the volume of the the heptane-water system, Co(II) ion was added
organic phase (50 cm-3), molar absorptivity into the dispersed mixture and caused a
(4.19x104 M-1 cm-1 at 462 nm in toluene), and decrease of HL (452 nm), but no extraction of
the optical path length of the flow cell (1 cm). the complex into the heptane phase (556 nm).
Interfacial adsorption constant, K’ in a dilute This phenomenon suggested that the
concentration of HL is defined as complexation took place at the interface, and
was adsorbed at the interface completely. The
[HL]i same results were observed also for the other
K' = (2)
[HL]o metal ions: Dy(III) and Gd(III) complexes both
in the toluene-water and heptane water systems,
where [HL]o and [HL]i is the concentrations of except for Cu(II) complex that can dissolve in
HL in the organic phase and at the interface, the aqueous phase. In the case of Ni(II)
respectively. From the Eq. (1), the value of complex in the heptane-water system, it would
[HL] at the interface was obtained as 6.68x10-13 be adsorbed at the interface completely when
mol cm-2 under the initial bulk phase the condition interfacial area was high by the
concentration of 2.0x 10-5 M HL, therefore K’ increase of the stirring rate (5000 rpm),
value of ligan was calculated as 3.34x10-5 cm. however if the stirring rate was decreased to
Fig. 1. Typical absorbance changes of Cu(II) 200 rpm, a part of Ni complex would be
complexation in toluene-water sytem (a), and extracted in the heptane phase. While, Zn(II)
Co(II) complexation in heptane-water system complex in the heptane-water system, and
(b) versa extraction time were observed at 200 Co(II), Dy(III), Gd(III) complexes both in the
rpm and 5000 rpm by the high-speed stirring toluene-water and heptane water systems were
method; (a) [HL] = 2.0x10-5 M, [Cu(II)] = still adsorbed at the interface completely,
2.0x10-4 M, pH 6.5, (b) [HL] = 1.4x10-5 M, although the interfacial area was decreased
[Co(II)] = 5.0x10-6 M, pH 6.0. drastically to 200 rpm.
0.4 0.4
0.2 0.2
0 0
0 50 100 150 300 400 500 600 700 800
Time / min Wavelength / nm
Fig. 2. (a) Interfacial adsorption of Zn(II) complex in toluene-water system was shown by the
absorbance change against the function of time. (b) The absorption spectra of Zn(II) complex were
observed when the low-speed stirring (200 rpm) at 172 min (solid line) and when the high-speed
stirring (5000 rpm) at 175 min (dashed line). The absorption maximum wavelength of Zn(II) complex
in toluene, λmax = 527 nm. [Zn(II)-complex] = 9.8x10-7 – 7.6x10-6 M in toluene, and aqueous buffer
solution without metal ion (pH 10.1).
[×10-9]
-9
1 Ni(II) complex
[ML2]i (mol dm ) / 10
Zn(II) complex
0.8
-2
0.6
0.4
0.2
0
0 1 2 3 5 4 6
-6
10-6 ]
[ML2]o (mol dm-3) / [×10
Fig. 3. Interfacial adsorptions of Zn(II) complex (black circle) and Ni(II) complex (white circle) in
toluene-water system showed the good fitting with those were calculated by the Eq. (5) of Langmuir
interfacial adsorption.
was decreased to 200 rpm, it caused the fast While A’ as the absorbance under the high-
desorption of complex from the interface into speed stirring was used to calculate the
the organic phase. The difference of absorbance concentration of complex in the organic phase,
(∆A) of the complex at λmax = 527 nm between [ZnL2]o,
both the stirring state was used to calculate the
concentration of metal complex at the interface, A'
[ML 2 ]o = (4)
[ZnL2]i, εl
∆A where the value of ε for ZnL2 in toluene at 527
[ML 2 ]i = (3)
nm = 1.01x 106 M-1 dm-1 [Yulizar et al., 2000].
ε l S i / Vo
Figure 3 shows the dependence of the the role the interface in the different solvents
interfacial complex concentrations (mol dm-2) and the various of metal systems to investigate
against the concentration of complex in organic the aggregate formation of the complex.
phase (mol dm-3). It showed a good fitting after
5. Acknowledgments
analyzing by an equation of the Langmuir
This work was financially supported by a
adsorption isotherm below,
Grant-in-Aid for Scientific Research (A) (No.
aK '[ML 2 ]o 12304045) and a Scientific Research of Priority
[ML 2 ]i = (5) Area (No. 13129204) from the Ministry of
a + K '[ML 2 ]o Education, Science, Sports and Culture, Japan.
Using the value of log ( a /mol dm-2) = -8.29, 6. References
we obtained the value of adsorption constant, Hanna G.J. and Noble R.D., (1985). Measurement
K’ of Zn(II) complex at the toluene-water of Liquid-Liquid Interfacial Kinetics, Chem. Rev.,
interface as 1.80x10-4 dm. The Ni(II) complex 85, 583-598.
showed also the phenomenon of Langmuir Onoe Y., Tsukahara S., Watarai H., (1998).
interfacial adsorption as shown in Fig. 3. The Catalytic Effect of N,N-Dimethyl-4-(2-
initial concentrations of Ni(II) complex in the Pyridylazo)aniline on the Extraction Rate of Ni(II)
toluene were in the range of 2.4x10-7 – 4.3x10-6 with 1-(2-Pyridylazo)-2-naphthol: Ligand-
M. The calculation of K’ for NiL2 at the Substitution Mechanism at the Liquid-Liquid
interface was conducted by the similar way as Interface, Bull. Chem. Soc. Jpn., 71, 603-608.
ZnL2 using the Eq. (3-5), which ε for NiL2 in Watarai H. and Funaki F., (1996). Total Internal
toluene at 524 nm is 9.97x 105 M-1 dm-1 and K’ Reflection Fluorescence Measurements of
at pH 6.0 was obtained to be 2.32x 10-4 dm. The Protonation Equilibria of Rhodamine B and
results proved that although the ligand was a Octadecylrhodamine B at a Toluene/Water
slightly adsorbed at the toluene-water interface, Interface, Langmuir, 12, 6717-6720.
however the formed Zn(II) and Ni(II) Watarai H., Gotoh M., Gotoh N., (1997). Interfacial
complexes would be adsorbed at the interface Mechanism in the Extraction Kinetics of Ni(II) with
remarkable stronger than ligand under the high- 2-(5-Bromo-2-pyridylazo)-5-diethylaminophenol
speed stirring. and Molecular Dynamics Simulation of Interfacial
Reactivity of the Ligand, Bull. Chem. Soc. Jpn., 70,
4. Conclusion 957-964.
The adsorption behavior of 5-Br-PADAP
ligand and Co(II), Ni(II), Cu(II), Zn(II), Dy(III) Watarai H., Sasaki K., Takahashi K., Murakami J.,
and Gd(III) complexes were investigated at the (1995). Interfacial Reaction in the Synergistic
Extraction Rate of Ni(II) with Dithizone and 1,10-
toluene-water and heptane-water interface by
Phenanthroline, Talanta, 42, 1691-1700.
the high-speed stirring method. The entire of
the observed metal complexes were adsorbed at Watarai H., Takahashi M., Shibata K., (1986).
the interface completely, except for Cu(II) Interfacial Phenomena in the Extraction Kinetics of
complex that dissolved in the aqueous phase, Nickel(II) with 2’-Hydroxy-5’-nonylacetophenone
Oxime, Bull. Chem. Soc. Jpn., 59, 3469-3473.
and Ni(II) and Zn(II) complexes were extracted
in the toluene. Yulizar Y., Ohashi A., Nagatani H., Watarai H.,
(2000). Kinetic Study of Ni(II) and Zn(II)
From the results, we obtained the values of the Complexation with a Pyridylazo Extractant by a
interfacial adsorption constant of the ligand and Centrifugal Liquid Membrane Method, Anal. Chim.
the complex those were very important to Acta, 419, 107-114
calculate the kinetic measurement of the
.
interfacial complex formation in the extraction
system. Considering interfacial adsorption
behavior of complex, we also could understand
Abstrak
Identifikasi korban musibah massal menggunakan urutan nukleotida Hypervariable Segment I
nt 16024-16364 DNA mitokondria (HVSI mtDNA) manusia telah mulai banyak dilakukan.
Beberapa database urutan nukleotida HVSI mtDNA yang disusun oleh berbagai kelompok
peneliti telah digunakan pula untuk mendukung proses identifikasi. Database yang ada saat
ini disusun oleh kelompok-kelompok dengan tujuan dan konsep yang berbeda-beda, sehingga
potensi database yang besar ini tidak dapat dimanfaatkan secara optimal untuk mendukung
proses identifikasi. Identifikasi dengan membandingkan urutan nukleotida pun sulit dilakukan
jika jumlah sampel yang harus diidentifikasi banyak, seperti pada musibah massal. Dalam
makalah ini kami melaporkan hasil identifikasi korban massal menggunakan sistem klasifikasi
HVSI nt 16024-16364 mtDNA manusia ditunjang database gabungan HVSI mtDNA. Database
gabungan adalah kumpulan data urutan nukleotida HVSI mtDNA manusia dari berbagai
database yang formatnya telah disamakan. Seluruh data diklasifikasikan berdasarkan jumlah
dan jenis perbedaan dengan standar urutan nukleotida mtDNA Cambridge. Urutan
nukleotida HVSI mtDNA para korban dan pembanding kemudian dibandingkan. Jika profil
HVSI korban sama dengan pembanding sehingga kemungkinan berasal dari garis keturunan
ibu yang sama, data harus dibandingkan dahulu dengan database gabungan untuk mencari
berapa orang yang memiliki profil sama. Hasil yang diperoleh menunjukkan bahwa sistem ini
mempercepat proses dan mempertajam spesifisitas identifikasi korban massal, khususnya jika
asal suku bangsa korban sulit diperkirakan. Sistem ini telah digunakan dalam proses
identifikasi korban bom Jakarta, 12 September 2004 dan dicobakan untuk rekonfirmasi
identifikasi korban bom Bali, 12 Oktober 2002.
Kata kunci: HVSI, identifikasi, mtDNA, musibah massal.
Abstract popular
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
1028
th
Proceeding
Fax : +62 (22) 2504154, Homepage of The 6 ITB-UKM Joint Seminar
: http://www.chem.itb.ac.id/jschem, E-mail : on Chemistry
jschem@chem.itb.ac.id
Yoni F. Syukriani, Merlyn Surja, Endang S. Atimah , A. S. Noer
mass disaster victims identification, especially when the victims are suspected originated from
different population. Here we report the identification of mass disaster victim employing
mtDNA HVSI nt16024-16364 classification system, supported by combined HVSI databases.
HVSI nucleotide sequence data from a variety of databases were accumulated, converted into
the same format, and classified into groups based on the type and the amount of differences
compared to Cambridge sequence. If HVSI sequence of the victim is identical with a reference
they cannot be excluded originated from people who shared the same maternal lineage; in
that case the identification is supported by counting the identical profile in the combined
database. This method accelerates identification process and improves its specificity in mass
victims identification, particularly when the victim’s population cannot be ascertain. The
method has been used in the identification of September 12th 2004 Jakarta bomb blast victims
and in reconfirmation of October 12th 2002 Bali bomb blast victims identification.
Keywords: HVSI, identification, mass victim, mtDNA.
yang jenazahnya rusak juga diperkirakan mM dNTPs, 30 pmol setiap primer, 1 U Taq
bermacam-macam. DNA polymerase dan 5 µl hasil lisis. Primer
Kasus kedua adalah musibah massal bom Bali, yang digunakan adalah HVSI forward: 5’-
12 Oktober 2002, yang menewaskan ratusan TGATTTCACG GAGGATGGTG -3’ (nt
orang dengan banyak jenazah dalam keadaan 16401-16419) dan HVSII reverse : 5’-
hancur. Mengingat lokasi ledakan adalah CACCATTAGC ACCCAAAGCT -3’(nt
tempat yang didatangi oleh wisatawan dari 15978-15998) (Noer et al., 1994). Protokol
banyak negara, maka asal suku bangsa sebagian temperatur reaksi: denaturasi 94oC 1’,
korban sulit diperkirakan. annealing 50oC 1’, elongasi 72oC 1’, sebanyak
30 siklus.
2. Percobaan
Database HVSI mtDNA Sekuensing mtDNA
Database dibuat dengan cara menggabungkan Produk PCR disekuensing menggunakan
data urutan mtDNA manusia (nt 16024-16364) prosedur dideoxy chain termination (Sanger et
berbagai populasi dunia al. 1977), yang dimodifikasi untuk DNA rantai
(http://www.ncbi.nlm.nih.gov/Genbank/index.h ganda sesuai spesifikasi yang disarankan oleh
tml) dan situs FBI (http://www.fbi.gov/hq/lab/ produsen (Pharmacia-LKB, Swedia). Primer
fsc/backissu/april2002/miller1.htm). yang digunakan dalam reaksi sekuensing
adalah primer yang juga digunakan dalam
Pekerjaan Laboratorium reaksi PCR. Proses sekuensing dilakukan
Pekerjaan laboratorium terdiri atas penyiapan menggunakan automated analyzer ABI Model
templat yang akan diamplifikasi, amplifikasi 373A di Laboratorium Rekayasa Genetika-KPP
PCR dan sekuensing. Bioteknologi ITB.
Templat merupakan hasil lisis barang bukti Analisis data urutan nukleotida
biologis dari tempat kejadian, baik berupa otot Seluruh data urutan nukleotida hasil reaksi
atau rambut yang diperoleh secara post mortem sekuensing diedit secara tersendiri, agar tidak
dari jenazah korban tidak dikenal masing- ada kesalahan pembacaan nukleotida oleh
masing sebanyak ~100 mg dipotong-potong software yang kadang-kadang terjadi. Masing-
sekecil mungkin secara steril. Bahan masing data diperiksa untuk dilihat perbedaan
pemeriksaan pembanding berupa darah yang dengan urutan nukleotida standar Cambridge,
diambil dengan prosedur yang lege artis. sehingga setiap sampel memiliki keterangan
Sampel darah (~50 µL) dan sampel lain mengenai profil jumlah nukleotida yang
didepigmentasi dengan 500 µL bufer TE (Tris- berbeda dengan standar dan pada posisi
HCl 10 mM; EDTA 0,1 mM; pH 7,5), nukleotida mana perbedaan tersebut. Profil
divorteks, kemudian disentrifugasi dengan perbedaan jumlah dan jenis antara sampel dan
kecepatan 8000 rpm 1’ dan supernatan dibuang. pembanding dibandingkan. Jika terdapat
Proses dilakukan beberapa kali (4-5 kali) sampel dan pembanding yang sama, maka
hingga supernatan tampak bersih. analisis dilanjutkan dengan mencari profil
tersebut dalam database gabungan dan jumlah
Pelet dilisis dengan 200 µL bufer lisis 1X [Tris-
orang yang terobservasi memiliki profil yang
Cl 50 mM pH 8,5; EDTA 1 mM pH 8,5; Tween sama dihitung.
20 0,5% (v/v)], dan proteinase K dengan
konsentrasi akhir 0,2 µg/µL (darah) atau 0,4 3. Hasil dan Pembahasan
µg/µL (otot, rambut). Campuran diinkubasi Database gabungan
dalam suhu 56oC 1 jam (darah) atau 1 malam Jumlah keseluruhan data yang diambil dari
(otot, rambut), kemudian diinaktivasi dalam kedua situs tersebut adalah 11.345 data. Data
suhu 95oC 10’. Hasil lisis disentrifugasi dengan yang diperoleh dari situs GenBank adalah 400
kecepatan 12.000 rpm selama 3 menit, dan data HVSI mtDNA, sedangkan data yang
supernatan berisi DNA digunakan sebagai diperoleh dari situs FBI berupa urutan
templat PCR (modifikasi Noer et al., 1994). nukleotida daerah D-loop (HVSI dan HVSII)
adalah 10945 yang terbagi kedalam dua
Seluruh reaksi amplifikasi PCR dilakukan kelompok data yaitu kelompok data forensik
dengan volume akhir 25 µl berisi 1 X PCR sebanyak 4839 data dan kelompok data
buffer (10 mM Tris-HCl, pH 8.3, 1.5 mM publikasi sejumlah 6106 data. Dari jumlah
MgCl2, 50 mM KCl, and 0.001% gelatine), 0.2
tersebut total data HVSI (nt 16024-16364) beberapa orang yang memiliki urutan mtDNA
adalah 9454. Data urutan nukleotida yang identik. Beberapa penelitian mengajukan
diperoleh dari kedua sumber data tersebut kemungkinan ditemukannya dua individu yang
terdiri atas beragam suku bangsa di dunia dan tidak memiliki hubungan kekeluargaan yang
disusun dengan format berbasis spreadsheet dekat untuk memiliki mtDNA identik
(Syukriani et al., 2004). Setiap haplotipe di (Stoneking et al., 1991). Namun, semuanya
dalam database terdapat catatan jumlah orang berdasarkan pada analisis RFLPs atau hanya
yang memiliki haplotipe tersebut. Data lengkap daerah-daerah tertentu pada mtDNA, dan
dapat diakses pada situs jaringan berdasarkan pada populasi-populasi tertentu
http://research.chem.itb.ac.id/database/mtDNA saja (Macaulay et al., 1999; Finnila et al.,
(menggunakan password yang dapat diperoleh 2000; Sajantila, 1996). Oleh karena itu,
dengan cara menghubungi kami). terdapat tantangan pemanfaatan analisis DNA
untuk musibah massal, khususnya jika korban
Dalam dekade terakhir analisis urutan
berasal dari berbagai macam ras, seperti halnya
nukleotida mtDNA mengambil bagian penting
pengalaman kami dalam identifikasi korban
dalam identifikasi forensik. Namun demikian,
musibah massal.
perkembangan metode analisisnya jauh
tertinggal degan metode analisis DNA inti, Identifikasi
meskipun mtDNA memiliki karakter-karakter Berikut ini adalah contoh hasil-hasil
khusus yag penting bagi identifikasi: terdapat pemeriksaan sampel korban dan pembanding
1000-10000 kopi molekul dalam tiap sel (Cann dari dua kasus musibah massal yang
et al., 1987; Wallace, 1994; Elson et al., 2001), ditampilkan dalam bentuk tabel. Data yang
tidak ada rekombinasi, dan diturunkan secara ditampilkan hanya sebagian dan bertujuan
maternal (Cann et al., 1987; Eyre-Walker, sebagai contoh, sedangkan data sebenarnya
1999). Laju mutasi mtDNA mencapai 1.7 X 10- berjumlah ratusan.
8
, atau 10-17 kali lebih cepat dibanding DNA
Dari Tabel 1 terlihat bahwa profil HVSI korban
inti (Sigurgardottir et al., 2000). Lebih jauh,
A identik dengan profil HVSI pembanding G
urutan nukleotida mtDNA menunjukan
sehingga korban A tidak dapat disingkirkan
polimorfisme tinggi sebagai konsekuensi
berasal dari orang yang memiliki hubungan
terkumpulnya mutasi (Stoneking, 1993;
keluarga dari garis keturunan ibu. Profil A/G
Wallace, 1995). Karakter ini yang mendasari
memiliki tiga perbedaan dengan urutan HVSI
konsep bahwa mtDNA memiliki kemampuan
(nt 16024-16364) standar Cambridge, yaitu
diskriminasi individu.
A(16182)C, A(16183)C, T(16189)C, dan profil
Mekanisme diturunkannya mtDNA melalui tersebut tercatat dalam database dimiliki oleh 2
garis maternal sering dianggap sebagai titik orang (Hispanik-Amerika) di antara 10.083
lemah analisis mtDNA, karena mekanisme ini orang.
mengakibatkan kemungkinan ditemukannya
Tabel 2 menunjukkan bahwa hasil identifikasi identik yang tercatat dalam database sebanyak
dapat dikelompokkan berdasarkan jumlah 1 di antara 9454 orang. PP5 terbukti identik
perbedaan dengan standar Cambridge. Data dengan SS16, dengan jumlah orang yang
pembanding PP3 memiliki 6 perbedaan dengan memiliki profil identik yang tercatat dalam
HVSI standar Cambridge tidak perlu database sebanyak 0 di antara 9454 orang.
dibandingkan dengan seluruh sampel, hanya
Identifikasi yang menggunakan sistem
perlu dibandingkan dengan sampel SS5 dan
klasifikasi jumlah dan jenis perbedaan dengan
SS11. Pembanding PP4 hanya perlu
standar Cambridge mungkin tidak terlihat
dibandingkan dengan SS1, SS2, SS10 dan
terlalu bermakna untuk digunakan pada kasus-
SS14, dan PP5 hanya perlu dibandingkan
kasus tunggal yang melibatkan 1-2 pasang
dengan SS3, SS12, SS16 dan SS19. PP3
sampel saja. Namun demikian, sistem ini
terbukti identik dengan SS5, dengan jumlah
sangat bermanfaat jika identifikasi melibatkan
orang yang memiliki profil identik yang
puluhan serta ratusan sampel karena relatif
tercatat dalam database sebanyak 2 di antara
cepat namun akurasinya tetap dapat diandalkan.
9454 orang. PP4 terbukti identik dengan SS6,
Penggunaan software yang mampu membuat
dengan jumlah orang yang memiliki profil
phylogenetic tree yang tersusun dari seluruh
C(16291)T, T(16304)C
C(16187)T, C(16223)T, C(16290)T, C(16296)T,
PP4 5
G(16319)A)
data sampel dan pembanding pernah disarankan kelompok besar dalam suatu populasi.
untuk mempercepat identifikasi korban massal Meskipun metode identifikasi menggunakan
(Syukriani et al., 2003). Namun, metode mtDNA tidak dapat memberikan derajat
tersebut hanya menganalisis sampel yang kepastian identifikasi yang sangat tinggi,
menurut phylogenetic tree memiliki namun tetap dapat memberikan bukti petunjuk
kekerabatan paling dekat, tanpa melakukan atas adanya suatu hubungan dalam kasus
analisis yang lebih teliti terhadap sampel lain identifikasi. Beberapa penelitian telah
yang sebenarnya merupakan proses yang tidak menyarankan cara menghitung derajat
dapat dikesampingkan dalam identifikasi kemungkinan adanya kesamaan profil mtDNA
forensik untuk mencegah terjadinya kesalahan antara dua orang yang tidak memiliki hubungan
sekecil mungkin. kekerabatan dari garis ibu, namun satu sama
lain saling berbeda, tergantung pada jumlah
Dalam proses identifikasi ini klasifikasi
sampel dan metode statistik yang digunakan,
dilakukan tidak hanya untuk data dalam
meskipun nilai tersebut berkisar pada angka
database, tetapi seluruh data sampel dan
5,5% (Stoneking et al., 1991).
pembanding juga diklasifikasi berdasarkan
jumlah. Hal ini menyebabkan proses Arti identiknya urutan nukleotida antara dua
membandingkan relatif lebih mudah dilakukan. orang telah ditafsirkan banyak ilmuwan dengan
Sebagai contoh, pada kasus II pembanding PP3 berbagai cara, namun komunitas forensik
hanya perlu dibandingkan dengan sebagian hingga saat ini belum mencapai konsensus
kecil data (2 data). tentang cara yang paling baik untuk hal
tersebut. mtDNA hanya dianggap unggul jika
Kriteria identik
kondisi sampel bahan pemeriksaan mengalami
Pola diturunkannya mtDNA menambah
degradasi akibat lingkungan, sedangkan
dimensi dalam pengambilan kesimpulan kasus
identifikasi menggunakan DNA inti diyakini
identifikasi. Seluruh kerabat yang berada dalam
telah mengatasi masalah ketidakpastian secara
garis keturunan ibu diperkirakan memiliki
statistik dengan perhitungan kemungkinan
profil mtDNA yang sama. AFDIL (US Armed
identiknya profil antara dua orang secara
Forces DNA Identification Laboratory)
kebetulan (probability of a random match)
mengindikasikan bahwa hasil penelitian
(Stoneking et al., 1991; Wilson, 1998). Asumsi
menunjukkan laju mutasi mtDNA mencapai 1
menggunakan persamaan Hardy-Weinberg
per 33 generasi (Parsons et al., 1997).
yang digunakan untuk menghitung frekuensi
Hasil menunjukkan adanya sampel-sampel genotipe pada DNA inti dianggap dapat
yang identik dengan pembanding. Meskipun menekan pengaruh yang mengurangi validitas
demikian, harus dipertimbangkan kemungkinan suatu kesimpulan identifikasi. Oleh karena itu,
adanya variasi yang tidak terdeteksi. Proses meskipun statistika pada analisis mtDNA telah
identifikasi menggunakan mtDNA yang selama diupayakan oleh beberapa peneliti (Bar et al.,
ini lazim dilakukan kenyataannya hanya 2000; Syukriani et al., 2004).
melibatkan sebagian rangkaian mtDNA
4. Kesimpulan
(HVSI/II; D-loop), sehingga terdapat
Identifikasi urutan nukleotida HVSI nt 16024-
kemungkinan ada perbedaan antara dua orang
16364 mtDNA manusia untuk korban musibah
yang terletak di luar daerah tersebut tidak
massal, dapat dilakukan secara efektif dengan
terdeteksi. TWGDAM (Technical Working
menggunakan sistem klasifikasi jumlah dan
Group on DNA Analysis Methods)
jenis perbedaan urutan nukleotida dengan
menyarankan luas daerah yang dianalisis
standar. Dengan sistem ini, identifikasi tidak
adalah nt 16024-16363 untuk HVSI dan nt 73-
perlu membandingkan korban, pembanding dan
340 for untuk HVSII (Biosystems mtDNA
database secara keseluruhan, karena yang
Sequencing Protocol, 1996).
diperlukan hanya membandingkan sampel-
Telah diterima banyak pihak bahwa haplotipe sampel yang memiliki jumlah perbedaan
mtDNA yang sama bukan saja dimiliki oleh dengan standar yang sama. Paradigma sistem
orang-orang yang berada dalam satu garis klasifikasi HVSI nt 16024-16363 berdasarkan
keturunan ibu, namun dapat juga dimiliki jumlah dan jenis perbedaan urutan nukleotida
secara kebetulan oleh orang lain. Beberapa dengan standar yang diterapkan pada database
haplotipe bahkan diketahui dimiliki oleh suatu gabungan ini dapat mendukung identifikasi
korban massal jika asal suku bangsa sulit Cann R.L., Stoneking M., Wilson A.C., (1987).
diperkirakan, tanpa harus memilih terlebih Mitochondrial DNA and human evolution. Nat.,
dahulu database populasi tertentu untuk 325:31-36.
memperkirakan spesifisitas identifikasi yang Elson., J. L. et al., (2001). Analysis of European
menentukan weight of the evidence. mtDNAs for recombination. Am. J. Hum. Genet.,
68:145-153.
5. Ucapan Terima Kasih
Proses identifikasi mtDNA kasus musibah Eyre-Walker A., Smith N.H., Smith J.M., (1999).
massal bom Jakarta, 12 September 2004 dan How clonal are human mitochondria? Proc. R. Soc.
bom Bali, 12 Oktober 2002, tidak dapat Lond. B., 266:477-483.
terlaksana tanpa kerjasama banyak pihak, Finnila S., Hassinen I.E., Ala-Kokko L., Majamaa
termasuk Kepala Kepolisian Negara Republik K., (2000). Phylogenetic network of the mtDNA
Indonesia, Tim DVI kedua kasus, KPP haplogroup U in Northern Finland based on
Bioteknologi ITB, Kelompok mtDNA ITB, sequence analysis of the complete coding region by
Perjan RS. Dr. Hasan Sadikin Bandung, dan Conformation-Sensitive Gel Electrophoresis. Am. J.
Hum. Genet., 66:1017-1026.
semua pihak yang telah membantu.
Pengembangan database, software dan metode Jehaes E., Gilissen A., Cassiman J.J., Decorte R.,
identifikasi merupakan bagian penelitian yang (1998). Evaluation of a decontamination protocol
dilaksanakan oleh Kelompok mtDNA for hair shafts before mtDNA sequencing. For. Sci.
Departemen Kimia ITB yang dibiayai oleh Int.., 94:65-71.
Hibah Pascasarjana periode 2004-2006 dari Holland M.M., Fischer D.L., Mitchell L.G.,
Direktorat Jendral Pendidikan Tinggi, Rodriguez W.C., Canik J.J., Merril C.R., Weedn
Departemen Pendidikan Nasional Republik V.W., (1993). Mitochondrial DNA sequence
Indonesia. analysis of human skeletal remains: Identification of
remains from the vietnam war. J. For. Sci., 38:542-
6. Daftar Pustaka 553.
A.S. Noer, Maelita R., Yoni F.S., Henny Y.Z., I.R.
Sudji, Syafrizayanti, Y. Ngili, Merlyn S., (2005). Holland M.M., and Parson T.J, (1998). MtDNA
Paradigma baru dalam analisis mtDNA manusia. Databases. Mitochondrial DNA Sequence Analysis
Prosiding Seminar Bersama UKM-ITB VI. in For. Casework: Methods and Current Issues.
Innsbruck., 9 June 1998.
Allen M., Engstrom A-S., Meyers S., Handt O.,
Saldeen T., von Haeseler A., (1998). Mitochondrial Hochmeister M.N., (1995). DNA Technology in
DNA Sequencing of Shed Hairs and Saliva on forensic applications. Mol. Asp. Med.: Rev. J. Phys.
robbery caps; sensitivity and matching probabilities. Biomed. Sci., 16(4):319-410.
J. For. Sci., 43(3):453-464 Macaulay V., Richards M., Hickey E., Vega E.,
Anderson S., Bankier A.T., Barrell B.G., de Bruijn Cruciani F., Valentina G., Scozzari R., Bonne-Tamir
M.H.L., Coulson A.R., Drouin J., Eperon I.C., B., Sykes B., Torroni A., (1999). The emerging tree
Nierlich D.P., Roe B.A., Sanger F., Scheier P.H., of west Eurasian mtDNAs: a synthesis of control-
Smith A.J.H., Staden R., Young I.G., (1981). region sequence and RFLPs. Am. J. Hum. Genet.,
Sequence and organisation of the human 64:232-249.
mitochondrial genome. Nat., 290:457-465. Merlyn S. dan Noer A.S., (2005). Klasifikasi HVSI
Andrews R.M., Kubacka I., Chinnery P.F., nt 16024-16364 mtDNA manusia ke dalam
Lightowlers N., Turnbull D.M., Howell N., (1999). haplogrup dan haplotipe. Prosiding Seminar
Nat.Genet., 23:147. Bersama UKM-ITB VI.
Bar W., Brinkmann B., Budowle B., Carracedo A., Noer A.S., Martasih F., Mulyani S., Muktiningsih.,
Gill P., Holland M., Lincoln P.J., Mayr W., Morling Wirahadikusumah M., (1994). Analisis variasi
N., Olaisen B., Schneider P.M., Tully G., Wilson urutan nukleotida D-loop mtDNA manusia dari
M., (2000). DNA Commission of the International berbagai daerah di Indonesia. Prosiding Seminar
Society for Forensic Genetics: Guidelines for Bersama UKM-ITB I, pp. 201-214.
mitochondrial DNA typing. Int. J. Legal Med., Parsons T.J., Munied D.S., Sullivan K., Woodyatt
113:193-196. N., Alliston-Greiner R., Wilson M.R., Berry D.L.,
Boles T.C., Snow C.C., Stover E., (1994). For. DNA Holland K.A., Weedn V.W., Gill P., Holland M.M.,
testing on skeletal remains from mass graves: A (1997). A high observed substitution rate in the
pilot project in Guatemala. J. For. Sci., 40(3):349- human mitochondrial DNA control region.
355. Nat.Genet., 15(4):363-368.
Sajantila A., Salem A.H., Savolainen P., Bauer K., identification. Seminar of the 8th Asia Pasific
Gierig C., Paabo S. 1996. Paternal and maternal Association of Societies of Pathologists Congress,
DNA lineages reveal a bottleneck in the founding of pp. 50.
the Finnish population. Proc. National Academy
Syukriani Y.F., Sudji I.R., Noer A.S., (2004).
Sci.., 93:12035-12039.
Pemanfaatan perangkat lunak spreadsheet Excel
Sanger F., Nicklen S., Coulson A.R., (1977). DNA untuk analisis mutasi DNA. Proceeding Seminar
sequencing with chain-terminating inhibitors. Proc. MIPA IV. Institut Teknologi Bandung. pp. 472-475.
National Academy of Sci. USA., 74(12):5463-5467.
Wallace D.C., (1994). Mitochondrial DNA
Stoneking M., Hedgecock D., Higuchi RG., Vigilant sequence variation in human evolution and disease.,
L., Erlich H.A., (1991). Population variation of (1994). Proceeding National Academy of Sci..,
human mtDNA control region sequences detected 91:8739-8746.
by enzymativ amplification and sequence-specific
Wallace D.C., (1995). Mitochondrial DNA variation
olifonucleotide probes. Am. J. Hum. Genet.,
in human evolutioN., degenerative disease and
48:370-382.
aging. Am. J. of Hum. Genet., 57:201-223.
Stoneking M., (1993). DNA and recent human
Wilson M.R., DiZinno J.A., Polanskey D., Replogle
evolution. Evol. Anthro., 2: 60-73.
J., Budowle B., (1995). Validation of mitochondrial
Sigurgardottir S., Helgason A., Gulcher J.R., DNA sequencing for For. casework analysis. Int. J.
Stefansson K., Donnelly P., (2000). The mutation Legal Med., 108(2):68-74.
rate in the human mtDNA control region. Am. J.
Wilson M.R. Mitochondrial DNA heteroplasmy
Hum. Genet., 66:1599-1609.
(Mitochondrial DNA sequence analysis in For.
Syukriani Y.F., Sampurna B., Noer A.S., (2003). casework: method and current issues workshop).
The Korean girls case: an illustration of mtDNA D- Innsbruck, 9 June 1998.
loop analysis role in Bali Bomb blast victim
Abstract
ETS–4 sampel, a microporous titanosilicate material, was prepared as Na,K-form using a
hydrothermal method. The resulting powder then was subjected to NH4 and Na(back)
exchange treatment sto modify the degree of defects within the structure. Characterisation
work on the resulting products shows that the treatments have increased the concentration of
defects in the structure. Photorectivity of adsorbed ethylene in ETS-4 materials under UV-
irradiation was studied using in-situ FTIR method. When ETS-4 samples were irradiated in
the presence of adsorbed ethylene, small amount of partial oxidation products were formed,
as shown by the presence of carbonyl and carboxyl groups in the region below 1800 cm-1.
Furthermore, partial oxidation products (acetaldehyde, acetic acid and acetate) and carbon
dioxide (a complete oxidation product) were observed when ETS-4 was irradiated in the
presence of a mixture of ethylene and oxygen (rasio 1:4). The increase in the concentration of
structure defects has shown to influence the photoreactivity of ETS-4, in which Na(be)-ETS-4
show to be more photoreactive than the as-prepared Na,K-ETS-4. The results are comparable
to that of ETS–10, another member from ETS family in which its photoreactivity study has
been studied extensively. This result gave information that could contribute to the
development of titanosilicate materials as alternative photocatalysts.
Keywords: titanosilicate, microporous, ETS-4, photoreactivity, ethylene.
1036
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Yuni K, Krisnandi and Russell F. Howe R
Figure 1 Schematic diagram of ETS–4 structure. Ti presents as octahedral Ti1 in Ti-O-Ti chains
and semioctahedral / square bipyramidal Ti2 in Titanosilicate bridging unit.
that of ETS-10, Lamberti (1999). The titanium a desicator overnight. Na-ETS-4 was prepared
in the bridging units was reported as by ion exchange of as-synthesized Na,K-ETS-
semioctahedral Philippou et.al (1996) or five- 4. Firstly, the as-synthesized ETS-4 was
coordinated in a square pyramidal environment exchanged with 1 M NH4NO3 solution at 60oC
Nair et.al (2001). The structure of ETS-4 is for 6 hours for several times to give NH4-ETS-
inherently disordered because of an intergrowth 4 sample. Then, the NH4-ETS-4 sample was
of four polymorph during synthesis, Braunbarth subjected to 1 M NaNO3 solution to obtain Na-
et.al (2000). back exchanged sample. From this point
onward this sample was called Na(be)-ETS-4.
The application of as-synthesised ETS-4 (with
Na+ and K+ as extraframework kations) has Characterization. X-ray difraction data were
been suppressed by the fact that the structure of collected in Stoe STADI/P diffractometer using
ETS-4 collapsed when it is calcined in the oven Cu Kα radiation, 2-theta range of 4-50 degree
at above 200oC, Philippou et.al (1996). and a step width of 0.2o. SEM images were
However, some low-temperature application obtained using a JEOL 2000EX Temscan
such as prevaporation membrane for microscope. UV-Vis diffuse reflectance spectra
alcohol/water separation has been reported, were obtained on an UV-3100 Shimadzu using
Braunbarth et.al (2000). In this paper, based on BaSO4 as an external standard. The apparent
the presence of titanium semiconductor in the bandgap energy of the sample were determined
framework of ETS-4, the investigation on the from the first-derivative of the Kubelka-Munk
photo-oxidation of ethylene on ETS–4 samples spectra.
is reported. The influence of defect content on
Photoreactivity study. The photoreactivity
the photoreactivity of ETS-4 is discussed. A
studies of ETS-4 in the presence of adsorbed
post-synthesis, ion-exchange treatment, was
ethylene, with and without the presence of
applied to increase the defect concentration in
adsorbed oxygen, were carried out in an
the ETS-4 material.
infrared vacuum cell with a quartz end on a
2. Experimental Nicolet FTIR Nexus spectrometer. Here, about
Sample preparation. Na,K-ETS-4 was 20 mg of sample was pressed into a transparent
sythesized followed a reported procedure, self-supporting pellet and loaded into the
Kuznicki (1990). Titanium(III) chloride (15% infrared cell. The pellet then was evacuated at
in HCl, Merck) and sodium silicate solution (27 150oC and 1x10-5 KPa for 2 hours. Ethylene
wt% SiO2, 8wt% Na2O, Merck) are used as gas was then introduced into the cell after it
titanium and silicon source, respectively. The was cooled down at rom temperature
resulting sample then was washed by double Irradiation was carried out for 6 hours in total
distilled water and dried at room temperature in using a pair of unfiltered UVitec® lamps with
light intensity of 1800 µW/cm2. Similar ETS-4 was still maintained after the sample
conditions were applied in the photo-oxidation was subjected to Na-back exchanged treatment.
experiment in the presence of oxygen, except a
SEM images of ETS-4 samples were displayed
mixed gas of ethylene and oxygen (pressure
in Figure 3. The morphology of the as-prepared
ratio 1:4) was used.
Na,K-ETS-4 crystals are similar to those
3. Results and Discussion reported in literature, Amaroli et.al (2000),
The diffraction pattern of Na,K-ETS-4 and Pavel et.al (2002). The morphology of the bulk
Na(be)-ETS-4 are given in Figure 2. The crystals of Na(be)-ETS-4 is slightly different
patterns of both ETS-4 samples were consistent from that of the as-prepared sample, in which
with the reported powder pattern, Philippou the crystals become more defective.
et.al (1996), Braunbarth et.al (2000), Nair et.al Furthermore, it can be seen that some fine
(2001), although some peaks had different particles appear on the surface of the crystals.
intensity. This indicates that the structure of This indicates that the crystals were damaged
after the sample was subjected to Na-back edge is blue shifted to a shorter wavelength. As
exchange treatment. a result, its apparent band gap is higher from
that of anatase (3.53 eV). This is due to the
Diffuse-reflectance spectra of ETS-4 samples
‘quantization effect’ that occurs when the size
are shown in Figure 4, with absorption appear
of the semiconductor particle is down nano-
in the wavelength below 500 nm. The spectrum
scale, Liu (1997). The spectrum of the Na(be)-
of as-prepared Na,K-ETS-4 gives a sharp
exchanged sample shows that the absorption
absorption edge with the center at 315 nm and
edge is red shifted with the center at 340 nm
the apparent bandgap (Eg) of 4.12 eV (see
(Eg of 3.95 eV). This indicates that electronic
inset). Compared to the spectrum of the anatase
transitions within the ETS-4 structure are
TiO2 (Figure 4c), the position of its absorption
slightly modified after ion exchange, caused by
Krisnandi,Y. K., (2004), Photoreactivity Studies of Synthesis and structure determination of ETS-4
Microporous Titanosilicate Materials, PhD Thesis, single crystals, Chem. Mater., 13(11), 4247-4254.
University of Aberdeen, Scotland, United Kingdom.
Park, D., Zhang, J., Ikeue, K., Yamashita, H., Anpo,
Kuznicki, S. M., (1990) US Patent 4938939. M., (1999), Photocatalytic oxidation of ethylene to
CO2 and H2O on ultrafine powdered TiO2
Lamberti, C. , (1999), Electron-hole reduced
photocatalysts in the presence of O2 and H2O,
effective mass in monoatomic ...-O-Ti-O-Ti-O-...
Journal of Catalysis 185, 114-119.
quantum wires embedded in the siliceous crystalline
matrix of ETS-10 , Microporous Mesoporous
Pavel, C. C.,Vuono, D., Catanzaro, L., DeLuca, P.,
Bilba, N., Nastro, A., Nagy, J. B., (2002), Synthesis
Mater. 30, 155-163. and characterization of the microporous
Liu, Y., Claus, R. C., (1997), J. Am. Chem. Soc. titanosilicates ETS-4 and ETS-10, Microporous
119, 5273-5274. Mesoporous Mater., 56, 227-239.
Martin, C., Martin, I., Rives, V., (1993), J. Chem. Philippou, A., Anderson, M. W., (1996), Structural
Soc. Faraday Trans., 89(22), 4131-4135. investigation of ETS-4 Zeolites, 16, 98-107.
Abstrak
Perpindahan intra-ionik dua elektron dalam skala nanodetik antara orbital eg dan t2g disebut
transisi spin. Gejala ini umumnya diamati pada senyawa yang mengandung inti koordinasi
[FeN6]. Untuk mempelajari fenomena transisi spin, telah dilakukan studi komputasi untuk
mempelajari pengaruh ligan fluor terhadap pemecahan orbital d pada kompleks [Fe(F6)] 4-.
Hasil studi komputasi menunjukkan bahwa ligan fluor berpengaruh terhadap energi
pemecahan orbital d serta model transisi spin yang terjadi.
Badrul Munir Md-Zain, Vun Vui Fui, Azman Sulaiman & Zaidi M. Isa
Abstract
Total DNA of two Tibicinid cicada species, Lemuriana sp. and Abroma maculicollis (Geurine)
(Homoptera: Cicadidae: Tibicinidae) collected during the recent scientific expedition to
Gunung Mandi Angin, Terengganu, were extracted. The size of total DNA was each estimated
to be around 20 KB base pairs. 16S rRNA gene fragment of each species was successfully
amplified using the following PCR conditions: 30 cyles of denaturation (30 seconds; 94oC),
annealing (120 seconds; 49oC), extention (90 seconds; 72oC) and final extension (9 minutes;
72oC). The PCR product size for this gene fragment was estimated to be 600 basepairs. The
following step which involved sequencing of 16S rRNA of these species was conducted and
found to be successful in detecting the genetic structure of each of these cicada species. The
results confirmed that the male and female specimens of Lemuriana sp. were indeed belonged
to this one species. Lemuriana sp. should be described as new species, since morphologically
it differed from all known cicada species of the genus and the Tibicinid family which includes
A. maculicollis. The results also indicated that sequences of Lemuriana would offer genetic
variation which can be used to define its phylogenetic position to other members of
Tibicinidae and possibly other cicadas as well.
Keywords: Lemuriana, Tibicinidae, Cicada, Mitochondria, 16S rRNA Sequences.
1044
th
Departement of Chemistry ITB, Jl. Ganesha
Proceeding 10,6Bandung
of The 40132,Joint
ITB-UKM PhoneSeminar
: +62 (22)on
2502103 ext 101,
Chemistry
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Badrul Munir Md-Zain, Vun Vui Fui, Azman Sulaiman & Zaidi M. Isa
the proposal of Lemuriana sp. being a new Azman, S. & Zaidi. M. I. 2002. Two new species of
species. the genus Puranoides Moulton from Malaysia
(Homoptera: Cicadidae). Serangga 7 (1-2): 1-14
4. Acknowledgements
The authors thank Dr. Adura M. Adnan and Mr Belshaw, R. & Quickle, D. 1997. A molecular
phylogeny of the Aphidiinae (Hymenoptera:
Mazlan Mohd Isa (Centre for Gene Analysis
Braconidae). Molecular Phylogenetics and
and Technology, CGAT) for the primers. Evolution 7: 281-293.
Gratitude is also extended to the director and
staff of the Department of Forestry, Peninsular Buckley, T. R., Arensburger, P., Simon, C., &
Malaysia, and dean and staff of the Faculty of Chambers, G. K 2002. Combined data, Bayesian
phylogenetics, and the origin of the New Zealand
Science & Technology, Universiti Kebangsaan
cicada genera. Syst. Biol. 51(1): 4-18.
Malaysia, for the support and hospitality during
the scientific expedition to Gunung Mandi Duffels, J. P. & M. I. Zaidi. 1999. A revision of the
Angin, where the samples of this study were genus Orientopsaltria Kato (Homoptera: Cicadidae)
obtained. Gratefully appreciated is the financial from Southeast Asia. Tjidshrift voor Entomologie.
142:195-297.
support for this study from the government of
Malaysia through the IRPA grants 08-02-02- Moulton, J.C. 1923. Cicadas of Malaysia. Journal
0019 EA301 and 09-02-02-0018 EA073. of Federated Malay States Museum, 11(2): 69-182.
Code
No Taxa Sex Locality
No.
Tibicinidae
1
Lemuriana sp. SC 120
F Sg, Cemerung, Mandi Angin, Terengganu
2 Lemuriana sp. SC 123
M Sg, Cemerung, Mandi Angin, Terengganu
1 2 3 4
Appendix 1. Data matrix of aligned 16S rRNA sequences of Tibicinid cicada species.
....|....|....|....|....|....|....|....|....|....|....|....|
5 15 25 35 45 55
Lemuriana sp. (F) TCAAAAACATGTTCTTTAG-ATATAAATTAAAGATCTATTCTGCCCAATGATTTTTAAAT
Lemiriana sp. (M) TCAAAAACATGTTCTTTAG-ATATAAATTAAAGATCTATTCTGCCCAATGATTTTTAAAT
A. maculicollis TCAAAAACATGTCCTTTAGGATTTTTATTAAAGGTTTATTCTGCCCAATGATTTTTGAAT
....|....|....|....|....|....|....|....|....|....|....|....|
65 75 85 95 105 115
Lemuriana sp. (F) GGCCGCAGTAAATTGACTGTGCAAAGGTAGCATAATAATTAGTCTTTTAATTGAAGGCTT
Lemiriana sp. (M) GGCCGCAGTAAATTGACTGTGCAAAGGTAGCATAATAATTAGTCTTTTAATTGAAGGCTT
A. maculicollis GGCTGCGGTAAATTGACCGTACAAAGGTAGCATAATAATTAGTCTTTTAATTGGAGGCT-
....|....|....|....|....|....|....|....|....|....|....|....|
125 135 145 155 165 175
Lemuriana sp. (F) GTATGAATGAATGGATGAAAAATTTTCTTTTTTAATTTAAACTAATTGAATTTAAAATTT
Lemiriana sp. (M) GTATGAATGAATGGATGAAAAATTTTCTTTTTTAATTTAAACTAATTGAATTTAAAATTT
A. maculicollis GTATGAATGAATGGATGAGAAATTAACTTTTTTTATTAAAAAAAATTGAATTTAAATTTT
....|....|....|....|....|....|....|....|....|....|....|....|
185 195 205 215 225 235
Lemuriana sp. (F) AAGTAAAAAATCTTAAATAAATGAGTGGGACGAGAAGACCCTATAGAGTTTGAAATAATT
Lemiriana sp. (M) AAGTAAAAAATCTTAAATAAATGAGTGGGACGAGAAGACCCTATAGAGTTTGAAATAATT
A. maculicollis AAGTAAAAAGTCTTAAATAATTGAGTGGGACGAGAAGACCCTGTAGAGTTTAAAATATTA
....|....|....|....|....|....|....|....|....|....|....|....|
245 255 265 275 285 295
Lemuriana sp. (F) TTTATTTATTGAA-ATTTAGA-ATTTATAG-TTAAAAAATTGATTTTATTTTTTGTTGGG
Lemiriana sp. (M) TTTATTTATTGAA-ATTTAGA-ATTTATAG-TTAAAAAATTGATTTTATTTTTTGTTGGG
A. maculicollis AAAATTTAATAATTATATAGATGAAAATAGATTTATAAATATATAATATTTTTTGTTGGG
....|....|....|....|....|....|....|....|....|....|....|....|
305 315 325 335 345 355
Lemuriana sp. (F) GTGACATTTAAAATAAAATAA-CTTTAATTAAATTTTCCATTTATTTATGTTTTATTGAT
Lemiriana sp. (M) GTGACATTTAAAATAAAATAA-CTTTAATTAAATTTTCCATTTATTTATGTTTTATTGAT
A. maculicollis GTGACATT-AAAATAAATTAAACTTTTAATTAATGCGTCATAAATGAATGATTTATTGAT
....|....|....|....|....|....|....|....|....|....|....|....|
365 375 385 395 405 415
Lemuriana sp. (F) CCAATTTTTTGATTTTAAGATTAAATTACCTTAGGGATAACAGCGTAATTAATTCGAAGA
Lemiriana sp. (M) CCAATTTTTTGATTTTAAGATTAAATTACCTTAGGGATAACAGCGTAATTAATTCGAAGA
A. maculicollis CCAATTTTTTGATTACAAGATTAAATTACCTCAGGGATAACAGCGTAATTAATTTGGAGA
....|....|....|....|....|....|....|....|....|....|....|....|
425 435 445 455 465 475
Lemuriana sp. (F) GTTCATATCGATGAATTAGATTGCGACCTCGATGTTGGATTAAGAAAAGAATTTGAGGCA
Lemiriana sp. (M) GTTCATATCGATGAATTAGATTGCGACCTCGATGTTGGATTAAGAAAAGAATTTGAGGCA
A. maculicollis GTTCATATCGATAAATTAGATTGCGACCTCGATGTTGGATTAAGAAAAGAGTT-AGGGCA
....|....|....|....|....|....|....|....|....|....|....|..
485 495 505 515 525 535
Lemuriana sp. (F) AAACTTAAGTATTTCTAGGTCTGTTCGACCTTTAATTTCTTACATGATTTG-AGTTC
Lemiriana sp. (M) AAACTTAAGTATTTCTAGGTCTGTTCGACCTTTAATTTCTTACATGATTTGGAGTTC
A. maculicollis AACTTTGAAT---CCTGGGTCTGTTCGACCTTTAATTTCTTACATGATTTGAGGTTC
Abstrak
Garam ferosenium (terbitan ferosena) mempunyai beberapa aktiviti biologi yang penting
seperti antikanser dan antimikrob. Dalam penyelidikan ini, sifat ketoksikan beberapa garam
ferosenium dan kesannya ke atas parasit malaria telah dikaji. Dalam kajian pertama, ujian
ketoksikan enam garam ferosenium terhadap larva nyamuk Aedes albopictus dan udang pepai
Artemia salina pada kepekatan 10, 100 dan 1000mg/L dalam keadaan statik selama 24jam
telah dilakukan. Hasil kajian mendapati semua garam adalah toksik terhadap kedua-dua
bahan uji tersebut walaupun kematian larva pada kepekatan 10mg/L lebih rendah berbanding
dua kepekatan yang lebih tinggi. Aktiviti ketoksikan terhadap A. Albopictus ditunjukkan
seperti berikut: Fc+-ClO4> [Fc][SbCl4]> Fc+-SnCl4> Fc+-SbCl5> HClO4> [Fc][BiCl4]>
[Fc+-BiBr4] 4 manakala ketoksikan terhadap udang pepai pula adalah seperti berikut:
HClO4~Fc+-ClO4> Fc+-SnCl4> Fc+-SbCl5 > [Fc][SbCl4]> [Fc][BiCl4]> [(Fc)4(BiBr4)4].
Walau bagaimanapun darajah ketoksikan semua garam ini lebih rendah daripada ketoksikan
kuprum logam. Dalam kajian kedua, mencit jantan strain ICR (Institute for Cancer Research)
telah digunakan sebagai haiwan percubaan untuk dijangkiti dengan parasit malaria rodent
Plasmodium berghei pzz1/00 pada takaran piawai 1x105 parasit per seekor mencit. Dalam
kajian ini garam ferosenium tetrakloroantimonat ([Fc][SbCl4] ) dan ferosenium stanum
tetraklorida (Fc+-SnCl4) telah digunakan untuk meneliti kesannya ke atas parasit malaria
dalam mencit berbanding kesan bahan antimalaria piawai iaitu klorokuina menggunakan
takaran piawai 10mg/100g berat badan (BB). Kumpulan-kumpulan mencit telah diperlakukan
seperti berikut: menerima rawatan awal (pra-rawatan) dengan bahan-bahan uji tersebut (
sama ada rawatan tunggal atau rawatan campuran 1:1 (garam ferosenium:klorokuina) 30
minit sebelum disuntik dengan parasit malaria, dirawat pada hari ke-5 atau ke-6 setelah
mencit mendapat jangkitan parasit (darjah parasitemia atau darjah jangkitan darah 5-20%)
dan diulang rawatan antara hari ke-12 dan ke-14 ataupun mencit diberi rawatan pertama
pada hari ke-6 dan rawatan kedua apabila parasitemia mencapai 20-30%. Hasil kajian
menunjukkan peningkatan parasitemia yang lebih perlahan pada mencit yang menerima
rawatan tunggal garam ferosenium berbanding parasitemia yang meningkat dengan cepat
pada mencit kumpulan kawalan positif (terjangkit tetapi tidak dirawat). Dalam rawatan
campuran pula didapati parasitemia pada mencit menjadi lebih rendah lagi. Walaupun
rawatan ini tidak berjaya memulihkan mencit daripada jangkitan tetapi tempoh
kemandiriannya lebih lama dan berbeza secara signifikan (p<0.05) dengan tempoh
kemandirian mencit kawalan positif. Sebagai perbandingan mencit yang dirawat dengan
klorokuina pulih daripada jangkitan malaria dan hidup >30 hari selepas dijangkiti. Hasil
penyelidikan ini menunjukkan bahawa garam ferosenium mempunyai kesan ke atas
perkembangan parasit malaria walaupun ia bersifat toksik. Kajian lanjut perlu dilakukan
bagi memastikan potensi garam ferosenium sebagai calon bahan antimalaria yang baru.
Kata kunci: ferosena, garam ferosenium, ketoksikan, parasitemia, parasit malaria
kelompok utama mencit (setiap kelompok perklorat dan korelasi aktiviti ketoksikan antara
terdiri daripada kumpulan-kumpulan enam ekor kedua-duanya adalah lemah (r=0.674).
mencit yang masing-masing menerima Perbezaan aktiviti yang ketara ini menunjukkan
perlakuan rawatan yang berbeza) telah memang garam ferosenium adalah toksik
digunakan untuk ujian ini iaitu: terhadap larva nyamuk yang diuji. Umumnya
aktiviti ketoksikan garam ferosenium terhadap
a) kelompok mencit yang menerima rawatan
larva nyamuk A. alpopictus dapat ditunjukkan
awal (pra-rawatan) larutan bahan-bahan uji
sebagai berikut: Fc+-Cl04> [Fc][SbCl4] > Fc+-
tersebut sama ada rawatan tunggal atau rawatan
SnCl4 > Fc+-SbCl5 >HCl04 >[Fc][BiCl4] > [Fc+-
campuran 1:1 (garam ferosenium:klorokuina),
BiBr4]4.
30 minit sebelum mencit disuntik dengan
parasit malaria; Ketoksikan garam ferosenium terhadap udang
pepai menunjukkan tidak kurang daripada 60%
b) kelompok mencit yang menerima rawatan
kematian berlaku pada kepekatan 10mg/L dan
setelah jangkitan parasit bermula (rawatan pos-
100% kematian bagi kepekatan >100mg/L dan
jangkitan). Rawatan diberikan pada hari ke-5
garam-garam ini menunjukkan darjah
atau ke-6 setelah mencit menerima suntikan
ketoksikan yang berbeza secara signifikan
parasit (dengan darjah parasitemia antara 5-
(p<0.05; Jadual 1). Korelasi aktiviti ketoksikan
20%) dan diulang rawatan antara hari ke-12
antara asid perklorik dan ferosenium perklorat
hingga -14 dan
adalah sangat kuat (r=1.00). Memandangkan
c) kelompok mencit yang menerima rawatan ketoksikan asid perklorik lebih tinggi terhadap
pos-jangkitan pada hari ke-6 dan rawatan kedua udang pepai berbanding larva nyamuk A.
apabila parasitemia mencapai 20-30%. albopictus maka dapat disimpulkan bahawa
udang pepai lebih sensitif terhadap keadaan
3. Hasil dan pembahasan
Ujian ketoksikan telah dapat menjelaskan sifat berasid berbanding larva nyamuk yang lebih
ketoksikan garam-garam ferosenium ke atas rintang. Kerintangan larva nyamuk ini mungkin
dua bahan uji yang digunakan (Jadual 1). boleh dijelaskan dengan kemampuannya untuk
Secara amnya boleh dikatakan bahawa semua hidup di mana-mana permukaan air seperti
garam ferosenium yang diuji adalah toksik. longkang, tin-tin kosong dll (Romi 1995)
Didapati juga bahawa udang pepai lebih sebagai suatu adaptasi terhadap keadaan
sensitif terhadap garam-garam ini berbanding persekitaran di mana larva nyamuk itu hidup
larva nyamuk. (Mallus 1982). Jujukan ketoksikan garam-
garam ini terhadap udang pepai boleh
JADUAL1. Tahap ketoksikan (purata % ditunjukkan sebagai berikut: HCl04 ~ Fc+-Cl04
kematian) garam ferosenium dalam kesemua > Fc+-SnCl4 > Fc+-SbCl5 > [Fc][SbCl4] >
kepekatan terhadap larva nyamuk A. albopictus [Fc][BiCl4] > [(Fc)4(BiBr4)4].
(A) dan udang pepai (A. salina) (B).
Hasil-hasil ujian ketoksikan ini jelas
a-c: turus dengan abjad yang sama tidak menunjukkan bahawa garam-garam ferosenium
menunjukkan perbezaan yang signifikan yang diuji adalah toksik dengan udang pepepai
(p<0.05) menunjukkan kesensitifan yang lebih tinggi
Semua garam ferosenium menunjukkan tahap berbanding larva nyamuk. Namun begitu darjah
ketoksikan yang sama terhadap larva nyamuk ketoksikan ini adalah lebih rendah berbanding
A. albopictus pada ketiga-ketiga kepekatan 10, garam kuprum (Romi et al. 2000) kerana
100 dan 1000mg/L. Walau bagaimanapun kuprum boleh menyebabkan kematian larva
terdapat perbezaan ketoksikan yang bererti nyamuk pada kepekatan yang begitu rendah
(p<0.05) pada kepekatan 100 dan 1000mg/L iaitu 1000ppb atau 1000ug/L. Selain saiz,
dan sebaliknya tiada perbezaan yang bererti struktur anion pada garam juga memainkan
(p>0.05) di antara semua garam pada kepekatan peranan dalam ketoksikan ini (Sanchez-fortun
10mg/L dengan menunjukkan kadar kematian et al. (1996). Pada amnya semakin besar saiz
yang rendah yang konsisten bagi semua garam anion semakin kurang ketoksikan garam
yang diuji. Hasil kajian juga mendapati larva tersebut.
nyamuk masih mampu bertahan pada Beberapa dapatan penting telah diperolehi
kepekatan 10 dan 100mg/L malah 100mg/L mengenai ciri antimalaria yang ditunjukkan
asid perklorik berbanding garam ferosenium oleh garam ferosenium terhadap malaria rodent
P. berghei tersebut. Pada amnya rawatan iaitu sekitar 29 hari dengan puncak parasitemia
dengan garam ferosenium tunggal mencit terawat dengan klorokuina-Fc+SnCl4
menunjukkan aktiviti antimalaria yang tidak lebih rendah. Hasil percobaan ini
begitu nyata tetapi rawatan dengan campuran mencadangkan bahawa ulangan rawatan
garam ferosenium-klorokuina telah dapat dengan garam ferosenium mungkin lebih
meredakan parasitemia dan memanjangkan menunjukkan aktiviti antimalaria garam yang
tempoh kemandirian mencit yang terjangkit. di uji.
Jadual 2 di bawah merumuskan hasil-hasil
Corak parasitemia pada mencit dalam
dalam kajian pertama iaitu mengenai kesan
percobaan ketiga (rawatan secara pos-jangkitan
prarawatan.
pada hari ke-6 dan diulang rawatan apabila
Purata puncak parasitemia bagi kumpulan parasitemia mencapai 20-30% iaitu sekitar hari
mencit kawalan positif (dijangkiti tetapi tidak ke-14; RAJAH 2) adalah hampir serupa dengan
dirawat) dan dua kumpulan mencit percobaan percobaan kedua tetapi dengan beberapa
yang menerima rawatan tunggal garam perbezaan yang ketara. Selepas rawatan
ferosenium tidak banyak berbeza begitu juga pertama dengan campuran klorokuina-garam
tempoh kemandiriannya sekitar 8-9 hari dengan ferosenium, parasitemia terus menurun ke aras
semua mencit mengalami maut (Jadual 2). <10% pada hari ke-12 tetapi meningkat semula
Parasitemia bagi kumpulan ini juga didapati ke aras >20% pada hari ke-14 sebelum dirawat
meningkat dengan cepat. Keadaan agak semula kali kedua. Akibat rawatan ini,
berlainan bagi dua lagi kumpulan mencit yang parasitemia didapati menurun semula ke aras
menerima rawatan campuran CQ-garam <10% pada hari ke-16, tetapi bagi kumpulan
ferosenium. Walaupun rawatan dengan CQ- yang menerima klorokuina-[Fc][SbCl4]
[Fc][SbCl4) tidak menghalang kematian mencit parasitemianya mendadak naik ke aras >40%
tetapi parasitemianya meningkat lebih perlahan tiga hari berikutnya dan menyebabkan semua
dan membolehkan mencit hidup sehingga 12 mencit maut. Parasitemia bagi kumpulan
hari. Aktiviti antimalaria jelas ditunjukkan oleh mencit yang menerima klorokuina-Fc+-SnCl4
rawatan campuran CQ-Fc+-SnCl4 dimana pula terus menurun semula setelah dirawat kali
terdapat hanya 16.7 kematian dan mencit yang kedua ke aras <5% sehingga hari ke-21
pulih hidup melebihi 30 hari. Parasit tidak sebelum meningkat semula secara perlahan-
ditemui pada mencit yang menerima rawatan lahan dan membolehkan mencit hidup sekitar
klorokuina dan semua mencit bermandiri lebih 29 hari. Parasitemia pada mencit kumpulan
daripada 30 hari. yang dirawat dengan klorokuina menunjukkan
kelainan iaitu ia kurang berkesan pada rawatan
Dalam percobaan kedua, kesan rawatan garam
kedua untuk menghapuskan parasitemia
ferosenium yang diberi secara pos- jangkitan
(RAJAH2) walaupun mencit dapat bertahan
menjelaskan lagi aktiviti antimalaria garam ini.
hidup lebih lama. Ini mencadangkan bahawa
Walaupun puncak parasetimia antara kumpulan
rawatan yang dilakukan apabila parasitemia
kawalan positif, kumpulan rawatan dengan Fc+-
melebihi 30% mungkin kurang berkesan dan
SnCl4 dan [Fc][SbCl4] masing-masing tidak
tidak membantu pemulihan mencit daripada
berbeza nyata (p>0.05), tetapi parasitemia
jangkitan malaria.
kumpulan rawatan ini meningkat lebih perlahan
dan dengan itu berjaya memanjangkan tempoh Hasil-hasil percobaan telah dapat menunjukkan
kemandirian mencit walaupun semuanya maut secara tidak langsung bahawa garam
(RAJAH 1). Dua kumpulan mencit yang ferosenium yang diuji iaitu Fc+-SnCl4 dan
menerima rawatan campuran klorokuina-garam [Fc][SbCl4] mempunyai aktiviti antimalaria
ferosenium pula menunjukkan corak terhadap parasit malaria P. berghei yang
parasitemia yang lebih rendah. Kedua-dua dipelihara dalam mencit. Ini dilihat daripada
kumpulan mencit yang menerima rawatan kemampuan garam-garam ini meredakan
campuran klorokuina-Fc+-SnCl4 dan parasitemia, memanjangkan tempoh
[Fc][SbCl4] menunjukkan corak parasitemia kemandirian mencit yang dijangkiti walaupun
yang serupa sama ada selepas rawatan pertama tidak berjaya menyelamatkan mencit daripada
(hari ke-6) maupun selepas rawatan kedua (hari maut.
ke-12). Dengan corak parasitemia begini
Walaupun klorokuina lebih berkesan merencat
tempoh kemandirian mencit menjadi lebih lama
parasitemia berbanding dengan rawatan
soluble antitumor agent. J. Cancer Res. Clin.Oncol. Romi, R., Lucas, M.D., Raineri, W., Pesce, M., Rey,
108(3), 336-340. A., Giovannangeli, S., Zanasi, F., Bella, A., (2000).
Laboratory and field evaluation of metallic copper
Mallus, A., (1982). Mosquitoes. Handbook of Pest
on Aedes albopictus (Diptera: Culicidae) larval
Control. Ed.6. hal. 690-715.
development. J. Med. Entomol. 37(2), 281-285.
Nordin, N.I., (2003). Sintesis dan kajian ketoksikan
Sanchez-fortun, S., Sanz, F., Barahona, M.V.,
dan aktiviti antimalaria beberapa garam ferosenium.
(1996). Acute toxicity of several organophosphorus
Tesis Sarjana Sains, Universiti Kebangsaan
insecticides and protection by cholinergic
Malaysia.
antagonists and 2 PAM on Artemia salina larvae.
Nordin, N.I., Yamin, B.M., Tee, S.T., Abu Hasan, Arch. Environ. Contam. Toxicol. 31, 391-398.
Z.A., Fun, H.K., Raj, S.S., Ibrahim, A.R., (2000).
Yamin, B.M., Fun, H.K., Sivakumar, K., Yip, B.C.,
Penyediaan semula garam ferosenium-BiBr3 dan
Shawkataly,O., (1996). Ferrocenium
kajian awal aktiviti antimalaria oleh Ferosenium-
tetrachloroantimonate. Acta Crystallography C52,
SnCl4. Prosiding Kimia Bersama ITB-UKM IV 12-
600-602.
13 April hal. 592-599.
Yamin, B.M., Boshaala, A.M.H., Othman, A.H.,
Osella, D., Ferrali, M., Zanello, P., Laschi, F.,
Hashim, M. (1998). Crystal structure of
Fontani, M., Nervi, C., Cavigiolio, G., (2000). On
ferrocenium-u-chloro-bis[dichlorodimetylstannate (
the mechanism of the antitumor activity of
IV)], C14H22Cl5-FeSn. Zeitschrift fur
ferrocenium derivatives. Inorganica Chimica Acta
kristallographie 213, 515-516.
306, 42-48.
Romi, R. (1995). History and updating the spread of
Aedes albopictus in Italy. Parasitologia 37, 99-103.
120
100
Peratus parasitemia
80
60
40
20
0
0 5 10 15 20 25 30 35
Hari selepas dijangkiti
Dirawat dengan klorokuina Kawalan positif
Dirawat dengan Fc+-SnCl4 Dirawat dengan [Fc][SbCl4]
Dirawat dengan klorokuina-Fc+-SnCl4 Dirawat dengan klorokuina-[Fc][SbCl4]
RAJAH 1. Perubahan peratus parasitemia bagi kumpulan mencit yang diberi rawatan ferosenium,
klorokuina dan campuran klorokuina-ferosenium dengan nisbah 1:1 bagi percobaan kedua. Rawatan diberi
sebanyak dua kali di sepanjang tempoh kajian.
100
90
80
70
Peratus parasitemia
60
50
40
30
20
10
0
0 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34
Hari selepas dijangkiti
RAJAH 2. Perubahan peratus parasitemia kumpulan mencit yang diberi rawatan ferosenium,
klorokuina dan campuran klorokuina-ferosenium dengan nisbah 1:1 bagi percobaan ketiga. Rawatan
diberi sebanyak dua kali sepanjang tempoh kajian.
JADUAL1. Tahap ketoksikan (purata % kematian) garam ferosenium dalam kesemua kepekatan terhadap
larva nyamuk A. albopictus (A) dan udang pepai (A. salina) (B).
JADUAL 2. Rumusan hasil kajian mengenai kesan prarawatan garam ferosenium ke atas mencit terjangkit
malaria.
Abstrak
Cacing tanah sudah sejak lama digunakan untuk pengobatan, khususnya di dunia pengobatan
tradisional. Berbagai penelitian melaporkan aktivitas antibakteri dan antipiretik cacing
tanah. Pada penelitian ini, cairan selom cacing tanah Pheretima sp. diisolasi dengan cara
perlakuan khusus (dipuasakan sehari dan direndam semalam sebelum pengambilan cairan
selom) dan tanpa perlakuan khusus. Kemudian, akitivitas cairan selom diuji dengan metode
difusi agar dan ditentukan kurva inhibisinya pada bakteri Eschericia coli, Bacillus
megaterium, Staphylococcus aureus, Serratia marcescens dan Pseudomonas aeruginosa.
Cairan selom dari cacing dengan perlakuan khusus memiliki aktivitas antibakteri pada
bakteri Gram positif B. megaterium dan S. aureus; namun sangat sedikit aktivitas antibakteri
terhadap bakteri Gram negatif E. coli, S. marcescens dan P. aeruginosa. Sementara, cairan
selom dari cacing tanpa perlakuan tidak menunjukkan aktivitas antibakteri. Aktivitas tertinggi
sebagai anti-B. megaterium menghambat pertumbuhan bakteri sebesar 6,6×107 sel/mg
protein setelah diinkubasi (37°C, 4 jam).
Kata kunci: antimikroba, cacing tanah, cairan selom, Pheretima sp.
penyebab kematian terbesar, hingga mencapai 2.3. Unit pembentuk koloni (CFU)
lebih dari 45% setiap tahunnya (Rossamund, Karena pertumbuhan bakteri pada fasa
2000). Penyakit infeksi tersebut antara lain eksponensial adalah linear, dari Hukum Beers,
penyakit demam tifoid, penyakit saluran OD600 berbanding lurus dengan konsentrasi sel
pernafasan, tuberkulosis dan malaria. Sebagian bakteri (CFU/ml). Nilai CFU ditentukan
besar orang yang meninggal akibat penyakit- dengan tahap berikut. Kultur bakteri uji yang
penyakit tersebut tidak tertolong karena alasan ditumbuhkan hingga OD600 sekitar 0,6
ekonomi. Padahal jika kita melihat ke dilarutkan dengan medium LB secara seri
sekeliling, cacing adalah sumber bahan baku dengan konsentrasi antara 100–108 kali lebih
obat potensial yang murah dan mudah encer. Satu ml masing-masing kultur ditebar di
diperoleh. atas permukaan agar, dan jumlah CFU dihitung
setelah inkubasi piring agar diinkubasi 37oC
Pada penelitian ini kami melaporkan aktivitas
selama 18 jam.
antibakteri cacing tanah lokal Pheretima sp.
2.4. Uji aktivitas antibakteri
2. Percobaan
Aktivitas antibakteri cairan selom ditentukan
2.1. Cacing tanah, mikroba uji, dan isolasi
secara kualitatif melalui metode difusi agar
cairan selom
Cacing tanah Pheretima sp. diperoleh dari (Bauer et al., 1966). Singkatnya, 30 µl cairan
peternakan cacing lokal (OSA, Bandung), selom ditotolkan di atas permukaan kertas
sedangkan bakteri yang digunakan adalah E. cakram berdiameter 0,6 mm. Kertas cakram
coli, B. megaterium, S. aureus, S. marcescens dipindah ke piring agar dan diinkubasi 37oC
dan P. aeruginosa yang diperoleh dari selama 16 jam. Aktivitas antibakteri
Laboratorium Mikrobiologi Departemen ditunjukkan dari daerah bening sekitar kertas
Teknik Kimia, Institut Teknologi Bandung, cakram. Sebagai pembanding positif,
Bandung. digunakan antibiotik amoksisilin.
Cairan selom diisolasi dari cacing tanah dengan Secara kuantitatif, aktivitas antibakteri cairan
metode yang dijelaskan sebelumnya (Lassalle selom diukur dari penurunan laju pertumbuhan
et al., 1988). Singkatnya, 50 gr cacing bakteri uji. Laju pertumbuhan bakteri uji pada
dibersihkan, dikeringkan di atas kertas halus, fasa eksponensial didefinisikan oleh lereng dari
dan distimulasi dengan listrik bertegangan 6V bagian linear kurva pertumbuhan bakteri, dan
untuk menginduksi kontraksi dan ekstrusi perubahan OD600 per menit sebanding dengan
cairan selom melalui pori-pori dorsal CFU/ml/min. Satu ml sampel cairan selom
permukaan kulit. Cairan selom dikumpulkan, ditambahkan ke medium bakteri uji dengan
dan disentrifuga 10000g selama 10 menit pada OD600 sekitar 0,1. Biakan diinkubasi pada 37oC
4oC. Supernatan (cairan selom) dikumpulkan, dengan kecepatan agitasi 150 rpm, dan nilai
OD600 diamati dalam interval waktu 30 menit.
disaring menggunakan kertas filter 0.2 µm
Sebagai kontrol, cairan selom diganti dengan
steril, dan digunakan selagi segar.
aquades. Laju pertumbuhan bakteri ditentukan
2.2. Pertumbuhan bakteri uji dari lereng kurva pertumbuhan bakteri pada
Semua galur bakteri ditanam dalam medium fasa eksponensial.
Luria Bertani (LB) dengan komposisi 1 g NaCl,
3. Hasil dan Pembahasan
1 g tripton bakter, dan 0,5 g ekstrak ragi dalam
3.1. Pertumbuhan bakteri uji
100 ml aquades pada suhu 37oC. Pertumbuhan
Pola pertumbuhan bakteri dimulai dari fasa
eksponensial bakteri diamati dari nilai
adaptasi, fasa pertumbuhan, fasa stasioner, dan
kerapatan optik pada panjang gelombang 600
diakhiri dengan fasa kematian. Pada fasa
nm (OD600) dengan nilai antara 0,2–1,0.
pertumbuhan, disebut juga fasa eksponensial,
Sementara media padat agar mengandung
jumlah sel bakteri bertambah dengan pesat.
komposisi nutrien yang sama dan ditambah
Karakteristik bakteri uji ditunjukkan pada
agar dengan konsentrasi akhir 15 g/l). Untuk
Tabel 1, dan fasa pertumbuhan teramati pada
menyiapkan piring agar, 50 µl kultur segar
nilai OD600 antara 0,2 dan 1,0. Pada kondisi ini
bakteri uji ditambahkan ke dalam 10 ml
telah ditentukan waktu pembelahan bakteri, dan
medium agar leleh, divortex, dan dituang ke
hasilnya B. megaterium dan S. Marcescens
cawan Petri steril. Piring-piring agar disiapkan
berturut-turut memiliki waktu pembelahan
segera sebelum pemakaian.
paling cepat dan paling lambat. Pada
a. E. coli
b. B. megaterium
c.S. aureus
d. S. marcescens
e. P. aeruginosa
Gambar 2. Aktivitas antibakteri cairan selom cacing (tanpa perlakuan khusus, kiri;
dan dengan perlakuan khusus, kanan)
amoksisilin dan cairan selom cacing tanah dan S. marcescens tetapi tidak memiliki
Pheretima sp. dengan perlakuan khusus tetapi aktivitas pada P. aeruginosa.
tidak sensitif terhadap cairan selom cacing
Cairan selom cacing yang tidak mengalami
tanpa perlakuan khusus.
perlakuan khusus tidak memiliki aktivitas
Uji difusi agar terhadap S. marcescens antibakteri pada semua bakteri uji. Sedangkan
menunjukkan daerah bening luas sekitar uji difusi agar pada cairan selom cacing yang
cakram amoksisilin tatapi tidak di sekitar menerima perlakuan khusus menunjukkan
cakram cairan selom, baik untuk cacing tanpa aktivitas antibakteri pada bakteri Gram positif,
dan dengan perlakuan khusus (Gambar 2d). yaitu B. megaterium dan S. aureus; tetapi tidak
Hal ini menunjukkan S. marcescens sensitif memiliki aktivitas antibakteri terhadap bakteri
terhadap amoksisilin tetapi tidak sensitif Gram negatif, yaitu E. coli, S. marcescens dan
terhadap cairan selom cacing tanah Pheretima P. aeruginosa. Jadi, cairan selom memiliki
sp. spektrum aktivitas antibakteri pada bakteri
Gram positif.
Uji difusi agar terhadap P. aeruginosa
menunjukkan tidak ada daerah bening di sekitar Dinding sel bakteri Gram positif memiliki
cakram amoksisilin dan cairan selom, baik peptidoglikan tebal sedangkan bakteri Gram
untuk cacing tanpa dan dengan perlakuan negatif lapisan peptidoglikan tipis namun
khusus (Gambar 2e). Hal ini menunjukkan P. memiliki membran luar dan daerah cairan
aeruginosa tidak sensitif terhadap amoksislin periplasma yang tebal yang diperkirakan dapat
dan cairan selom cacing tanah Pheretima sp. menghalangi senyawa antibakteri yang terdapat
dalam cairan selom untuk menembus dinding
Amoksisilin diketahui memiliki spektrum
sel bakteri Gram negatif sehingga tidak dapat
aktivitas antibakteri pada bakteri Gram positif
menghancurkan sel. Kemungkinan lain,
dan Gram negatif dengan cara inhibisi
senyawa antibakteri dalam cairan selom dapat
pertumbuhan dinding sel bakteri pada saat
menembus membran namun dapat berinteraksi
pertumbuhan peptidoglikan dan penyusunan
dengan enzim atau protein yang banyak
murein. Uji difusi agar menunjukkan
terdapat dalam daerah cair periplasma sehingga
amoksisilin memiliki aktivitas antibakteri
menjadi tidak aktif. Penelitian lebih lanjut
positif pada B. megaterium, S. aureus; E. coli,
diperlukan untuk penentuan dan pemurnian
senyawa antibakteri yang terdapat dalam cairan Cho, J.H., Park, C.B., Yoon, Y.G., Kim, S.C.,
selom serta mekanismenya pada sel bakteri. (1998). Lumbricin I, a novel proline-rich
antimicrobial peptide from the earthworm:
Karena B.megaterium adalah bakteri Gram purification, cDNA cloning and molecular
positif, dengan dinding selnya lebih tipis, characterization. Biochim. Biophys. Acta, 1408, 67–
diperkirakan bahwa aktivitas anti- 76.
B.megaterium disebabkan komponen dalam Deloffre, L., Salzet, B., Vieau, D., Andries, J.C.,
cairan selom dapat berpenetrasi melewati Salzet M., (2003). Antibacterial properties of
dinding sel. Uji kuantitatif dengan hemerythrin of the sandworm Nereis diversicolor.
menggunakan volume cairan selom 5% (v/v) Neuroendocrin. Lett., 24, 39– 45.
yang berkadar protein 25,5 mg/ml
Eng, J.V., Marcus, R., Hadler, J.L., Imhoff, B.,
menunjukkan aktivitas antibakteri secara Vugia, D.J., Cieslak, P.R., Zell, E., Deneen, V.,
signifikan. Besar aktivitas hambat pertumbuhan McCombs, K.G., Zansky, S.M., Hawkins, M.A.,
B. megaterium setelah diinkubasi pada 37°C Besser, R.E., (2003). Consumer Attitudes and Use
selama 4 jam adalah 6,6×107 sel/mg. of Antibiotics, Emerging Infect. Diseases J., 9, 582–
591.
4. Kesimpulan
Cairan selom cacing tanah memiliki aktivitas Lassalle, F., Lassegues, M., Roch, Ph., 1988.
antimikroba terhadapbakkteri Gram positif B. Protein analysis of earthworm coelomic fluid –IV.
megaterium dan S. aureus, dan sedikit pada Evidence, activity induction and purification of
Eisenia fetida andrei lysozyme (annelidae). Comp.
bakteri Gram negative E. coli, S. marcescens
Biochem. Physiol., B91, 187–192.
dan P. aeruginosa.
Milochau, A., Lassegues, M., Valembois, P., (1996).
5. Ucapan Terima Kasih Purification, characterization and activities of two
Penelitian ini didukung secara finansial oleh hemolytic and antibacterial proteins from coelomic
Departemen Pendidikan Nasional, melalui fluid of the annelid Eisenia fetida andrei. Biochim.
Hibah Bersaing. Biophys. Acta, 1337, 123–132.
6. Daftar Pustaka Rosamund, W., (2000). Antimicrobial resistance:
Bauer, A.W., Kirby, W.M.M., Sherris, J.C., Turck, the facts. Essential Drugs Monitor, 28 & 29:7–8.
M., 1966. Antibiotic susceptibility testing by
standardized single disk methods. Am. J. Clin.
Pathol., 45, 493–496.
Zuhrina Masyithah
Abstrak
Limbah hasil pengolahan minyak pala sampai saat ini belum dikelola dan dimanfaatkan
secara baik, padahal limbah pala masih mengandung trimiristin yang bernilai ekonomis.
Untuk menghasilkan rendemen trimiristin yang tinggi, pengolahan limbah pala dipengaruhi
tiga parameter utama yaitu jenis pelarut, konsentrasi pelarut dan variasi waktu perlakuan.
Dipilih tiga jenis pelarut yaitu benzene, n-heksane dan kloroform pada variasi konsentrasi
37%, 65%, 75% dan 98% serta waktu ekstraksi dari 6 hingga 12 jam. Isolasi trimiristin
dilakukan secara sokletasi mengggunakan pelarut yang bervariasi dan diikuti dengan
kristalisasi menggunakan pelarut etanol. Campuran kristal disaring dan dilakukan analisa
terhadap kristal trimiristin yang terbentuk. Dari hasil pengamatan disimpulkan bahwa jenis
pelarut, konsentrasi pelarut dan waktu operasi mempengaruhi hasil ekstraksi yang diperoleh.
Pada rentang pengamatan yang dilakukan diperoleh bahwa benzene merupakan jenis pelarut
yang terbaik. Peningkatan konsentrasi benzene dan waktu ekstraksi akan meningkatkan
rendemen trimiristin. Rendemen trimiristin yang diperoleh adalah sebesar 21,6% dengan
kandungan trimiristin berdasarkan hasil analisa KGC sebesar 89,86% serta titik lebur
54,50C.
Kata kunci: limbah pala, jenis dan konsentrasi pelarut, trimiristin, waktu ekstraksi.
1062
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Zuhrina Masyithah
sokletasi menggunakan berbagai variasi benzene lebih selektif dalam melarutkan zat
pelarut. Ekstrak yang diperoleh berupa dan dalam prosesnya menghasilkan sejumlah
campuran pelarut dan trimiristin kemudian kecil lilin albumen dan zat warna.
dipisahkan lebih lanjut dengan rotary
Untuk konsentrasi 60%, rendemen yang
evaporator. Hasil ekstrak murni yang diperoleh
dihasilkan dengan menggunakan pelarut
dari rotari evaporator dilarutkan dalam etanol
benzene cukup jauh berbeda dengan pelarut
panas, kemudian didinginkan hingga terbentuk
lain dengan konsentrasi yang sama, sedangkan
kristal trimiristin.
untuk konsentrasi 75% rendemen yang
3. Hasil dan Pembahasan dihasilkan untuk tiap pelarut hanya berbeda
Pengaruh Konsentrasi sedikit. Gambar 2 juga menunjukkan bahwa
Hasil analisa sampel menggunakan pelarut n- pelarut benzene pada konsentrasi 60% hingga
heksane, benzene dan kloroform pada variasi 98% meningkatkan rendemen trimiristin yang
konsentrasi 37%, 60%, 75% dan 98%; variasi sangat signifikan jika dibandingkan dengan
volume pelarut 150, 200, 250 ml serta waktu pada penggunaan konsentrasi pelarut kurang
ekstrasi 6, 9 dan 12 jam dipaparkan pada dari 60%.
Gambar 1 hingga 6. Gambar 1 menunjukkan
Pengaruh Waktu Ekstrasi
pengaruh konsentrasi terhadap perolehan
Waktu ekstraksi dimulai pada saat masuknya
trimiristin, dimana terlihat bahwa benzene
limbah minyak pala ke dalam sokletasi dan
menghasilkan rendemen yang lebih tinggi
tungku pemanas dihidupkan. Hasil
dibandingkan pelarut lain yaitu 21,6% pada
pengamatan pada Gambar 3 dan 4
konsentrasi 98%. Hal ini disebabkan karena
menunjukkan bahwa jika waktu ekstraksi
benzene mempunyai sifat yang lebih stabil
diperpanjang maka rendemen yang dihasilkan
dibandingkan pelarut lainnya. Selain itu
24 18
22 16
20
14
Rendemen Trimiristin (%)
18
12
16
10
14
8
12
6
10 Benzen Benzen
n-Heksan 4 n-Heksan
8
Kloroform Kloroform
6 2
30 40 50 60 70 80 90 100 30 40 50 60 70 80 90 100
Konsentrasi Pelarut (%) Konsentrasi Pelarut (%)
Gambar 1. Pengaruh Konsentrasi terhadap Trimiristin Gambar 2. Pengaruh Konsentrasi terhadap Trimiristin
yang dihasilkan pada volume pelarut 250 ml dan yang dihasilkan pada volume pelarut 150 ml dan
waktu ekstraksi 12 jam waktu ekstraksi 12 jam
24 24
Konsentrasi 98% Konsentrasi 98%
Konsentrasi 75% Konsentrasi 75%
21 21
Konsentrasi 60% Konsentrasi 60%
Konsentrasi 37% Konsentrasi 37%
Rendemen Trimiristin (%)
18 18
15 15
12 12
9 9
6 6
3 3
3 6 9 12 15 3 6 9 12 15
Variasi Waktu (jam) Variasi Waktu (jam)
Gambar 3. Pengaruh Variasi Waktu terhadap Gambar 4. Pengaruh Variasi Waktu terhadap
Trimiristin yang dihasilkan pada volume pelarut 250 Trimiristin yang dihasilkan pada volume pelarut 250
ml Benzene ml n-Heksane
8 13
Benzen Benzen
12
n-Heksan n-Heksan
7 Kloroform Kloroform
11
Rendemen Trimiristin (%)
8
5
7
6
4
3 4
75 100 125 150 175 200 225 250 275 75 100 125 150 175 200 225 250 275
Jumlah Pelarut (ml) Jumlah Pelarut (ml)
Gambar 5. Pengaruh Jumlah Pelarut terhadap Gambar 6. Pengaruh Jumlah Pelarut terhadap
Trimiristin yang dihasilkan pada Konsentrasi 37% Trimiristin yang dihasilkan pada Konsentrasi 60%
akan semakin besar. Untuk proses ekstraksi diperoleh, kadar trimiristin yang dihasilkan
selama 12 jam pada konsentrasi 98% dihasilkan adalah 89,86%.
rendemen sebanyak 21,6%. Hasil ini jauh lebih
Titik Lebur
baik dibandingkan pada saat waktu ekstraksi 9
Titik lebur rata-rata dari trimiristin yang
jam (15%) dan 6 jam (13%) untuk konsentrasi
dihasilkan adalah 54,5oC. Hasil ini sesuai
yang sama. Waktu ekstraksi yang lebih panjang
dengan literatur dimana rentang titik lebuh
memberi kesempatan pada pelarut yang
trimiristin adalah 54-55oC pada 1 atm
digunakan untuk mengambil sebagian besar
(Memphis and Tennessee, 1964).
trimiristin yang terdapat dalam limbah hasil
pengolahan minyak pala.
4. Kesimpulan
Pengaruh Volume Pelarut
Dari hasil analisa dan pembahasan penelitian
Peningkatan jumlah penggunaan pelarut juga
turut meningkatkan rendemen trimiristin yang dapat disimpulkan bahwa jenis pelarut yang
digunakan menentukan hasil ekstraksi. Pelarut
dihasilkan. Gambar 5 menunjukkan bahwa 250
benzene menunjukkan hasil yang lebih baik
ml pelarut benzene menghasilkan rendemen
yang lebih besar daripada pelarut n-heksane dibandingkan pelarut n-heksane dan kloroform.
Kemurnian pelarut juga menentukan hasil
dan kloroform pada konsentrasi yang sama.
ekstraksi, dimana semakin murni suatu pelarut
Sementara untuk jumlah pelarut 200 ml, n-
heksane dan kloroform mempunyai rendemen yang digunakan maka rendemen trimiristin
akan semain besar. Hal yang sama juga
yang sama besar. Hasil yang sama diperoleh
dijumpai pada penambahan waktu ekstraksi.
pada Gambar 6. Perbedaan rendemen yang
diperoleh pada jumlah pelarut 250 ml dan 200 5. Daftar Pustaka
ml dengan menggunakan pelarut benzene Indra S., Mimpin G., Firman S., (1999).
cukup signifikan dibandingkan dengan Pemanfaatan Trimiristin yang Terdapat dalam
menggunakan pelarut lain dengan volume Limbah Hasil Pengolahan Minyak Pala untuk
pelarut yang sama. Gambar 6 juga Ditransformasikan menjadi Miristimida, Majalah
Universitas Sumatera Utara, 1(2), 38-43.
menunjukkan bahwa peningkatan volume
pelarut juga turut meningkatkan rendemen Memphis S., Tennessee W., (1964). Fatty Amides
trimiristin. Their Properties and Applications, Humko Produk
Chemical Division National Products
Kadar Trimiristin Corp.,California.
Kadar trimiristin yang terkandung dalam kristal
yang diperoleh dapat dilihat melalui alat Rismunandar, (1988). Budidaya dan Tata Niaga
Pala, Penerbit Swadaya, Jakarta.
kromatografi. Untuk hasil optimum yang
Elektroda Pasta Karbon yang Dimodifikasi dengan Xilenol Oranye untuk Analisis
Timbal
Abstrak
Pada penelitian ini elektroda pasta karbon yang dimodifikasi dengan xilenol oranye (XO)
telah dikembangkan untuk analisis ion Pb2+ di dalam beberapa matriks air. Xilenol oranye
menunjukkan kemampuan untuk mengakumulasi ion Pb2+ lebih banyak di permukaan
elektroda sehingga pengukuran menjadi lebih sensistif. Elektroda ini memiliki daerah linier
hingga konsentrasi ion Pb2+ terendah 1 ppb. Kebolehulangan pengukuran elektroda sangat
baik dengan standar deviasi pengukuran 6,5%. Analisis spike sampel dalam matriks air laut,
air sungai dan air mineral menunjukkan bahwa elektroda ini memberikan akurasi
pengukuran yang sangat baik dengan persen perolehan kembali berkisar antara 97 – 103 %
pada daerah konsentrasi ion Pb2+ antara 0,01 – 10 ppm. Akurasi pengukuran sedikit
berkurang pada konsentrasi yang lebih rendah.
Kata kunci: voltametri, timbal, xilenol oranye, pasta karbon, elektroda
akan digunakan sebagai pemodifikasi elektroda Hampir pada semua komposisi pasta karbon
pasta karbon untuk analisis ion Pb2+ secara yang dipelajari arus stripping yang diperoleh
anodic striping voltametri. dengan elektroda SXO lebih tinggi dari
elektroda SG. Hal ini menunjukkan bahwa XO
2. Percobaan
dapat meningkatkan akumulasi ion Pb2+ pada
Zat Kimia: Bahan-bahan kimia yang digunakan
permukaan elektroda. Arus maksimum
dalam penelitian ini adalah Pb(NO3)2 (Fluka
diperoleh pada komposisi SXO 30%. Elektroda
99,99%), HNO3 (Merck 65%), parafin padat
dengan komposisi ini selanjutnya digunakan
(Merck), grafit (Fisher 99,99%), silika gel
pada proses karakterisasi berikut.
(Merck 99%), xilenol oranye (Merck 99%).
Zat-zat ini digunakan tanpa pemurnian lebih Kebolehulangan pengukuran: Untuk
lanjut. Air ekstra murni dengan hambatan jenis mempelajari kebolehulangan pengukuran,
18,2 MΩ-cm diperoleh melalui pemurnian larutan Pb2+ 1 ppm diukur berulang sebanyak
aquades dengan alat pemurni air Barnsted. 20 kali dengan kondisi pengukuran yang sama.
Arus puncak yang diperoleh pada pengukuran
Peralatan dan metode: Pengukuran voltameri
berulang yang dilakukan dengan elektroda
dilakukan dengan potensiostat ADInstrument
SXO dan SG ditunjukkan pada Gambar 2.
dengan sistem tiga elektroda yang dilengkapi
dengan A/D converter Powerlab 400 dan E- Deviasi standar relatif pada pengukuran
chem Basic Program untuk pengolahan data. berulang dengan elektroda SXO dan SG
Elektroda pembanding dan elektroda pembantu berturut turut adalah 6,5 dan 6,3 %. Nilai ini
yang digunakan berturut-turut adalah Ag/AgCl menunjukkan bahwa kedua elektroda cukup
(NaCl 3 M) dan kawat platina. Pengukuran baik untuk digunakan pada pengukuran ion
dilakukan dengan teknik square wave anodic Pb2+.
stripping voltammetry (SWASV). Kurva kalibrasi: Daerah kerja elektroda
Pembuatan Elektroda: Silika gel (SG) dipelajari dengan membuat kurva kalibrasi
direndam di dalam larutan xilenol oranye (XO) pada daerah konsentrasi Pb2+ antara 0,001-0,01
0,001 M (pH = 1) dengan perbandingan ppm. Kurva kalibrasi dibuat pada empat daerah
berat(g)/volume(mL) 1: 50 selama 90 menit konsentrasi yaitu 0,001-0,01 ppm; 0,01-0,1
sambil diaduk. Silika gel yang telah menyerap ppm; 0,1-1 ppm dan 1-10 ppm. Tipikal kurva
xilenol oranye (SXO) dipisahkan secara kalibrasi yang diperoleh ditunjukkan pada
dekantasi dan dikeringkan pada 60°C selama 4 Gambar 3
jam. Pada pembuatan elektroda pasta karbon, Elektroda SXO dapat mengukur ion Pb2+
SXO dicampur dengan grafit dan parafin hingga konsentrasi 1 ppb sedangkan elektroda
dengan perbandingan tertentu. Elektroda ini SG hanya dapat mengukur ion Pb2+ hingga
selanjutnya disebut dengan elektroda SXO. konsentrasi 10 ppb. Hal sekali lagi
Untuk studi perbandingan, juga dibuat menunjukkan kemampuan XO untuk
elektroda pasta karbon yang dimodifikasi hanya meningkatkan akumulasi ion Pb 2+
pada
dengan silika gel. Elektroda ini selanjutnya permukaan elektroda. Kelinieran kurva
disebut dengan elektroda SG. Pada pembuatan kalibrasi yang diperoleh cukup baik untuk
elektroda, komposisis parafin dibuat tetap 30% analisis.
w/w sementara komposisi SXO, SG dan grafit
dibuat bervariasi. Akurasi pengukuran: Untuk menguji akurasi
pengukuran timbal dengan kedua elektroda ini,
3. Hasil dan pembahasan dilakukan penentuan persen perolehan kembali
Pengaruh xilenol oranye: Untuk mempelajari dari analisis spike sample di dalam matriks air
pengaruh XO terhadap peningkatan sensitifitas laut, air sungai dan air mineral. Hasil analisis
pengukuran ion Pb2+ dengan metode ASV, Pb2+ di dalam ketiga matriks air ini ditunjukkan
larutan standar Pb2+ 1 ppm dianalisis dengan pada Tabel 1-3 berikut.
elektroda SXO dan SG dengan berbagai
komposisi. Kurva antara arus stripping dan Nilai persen perolehan kembali analisis timbal
komposisi SXO dan SG pada elektroda di dalam ketiga matriks air yang dipelajari
ditunjukkan pada Gambar 1. mendekati 100%. Ini menunjukkan akurasi
analisis yang sangat baik. Akurasi pengukuran
dengan elektroda SXO sangat baik pada daerah Ouangpipat W., Lelasattarathkul T., Dongduen C.
kosentrasi 0,01 – 10 ppm namun berkurang and Liawruangrath S., (2004). Bioaccumulation and
pada konsentrasi lebih kecil dari 0,01 ppm. Di determination of lead using treated-Pennisetum-
lain pihak akurasi pengukuran dengan elektroda modified carbon paste electrode, Talanta, 61(4),
455-464.
SG cukup baik pada daerah konsentrasi 0,1 –
10 ppm dan berkurang pada konsentrasi Yantasee W., Lin Y., Fryxell G. E., Busche B. J.,
dibawah 0,1 ppm. Data ini sekali lagi (2004). Simultaneous detection of cadmium, copper,
menunjukkan kemampuan XO dalam and lead using a carbon paste electrode modified
meningkatkan akumulasi ion Pb2+ di with carbamoylphosphonic acid self-assembled
monolayer on mesoporous silica (SAMMS), Anal.
permukaan elektroda.
Chim. Acta, 502(2), 207-212.
4. Daftar Pustaka Yuan S., Chen W., Hu S., (2004). Simultaneous
Brainina Kh. Z., Stozhko N. Yu., Belysheva G. M., determination of cadmium (II) and lead (II) with
Inzhevatova O. V., Kolyadina L. I., Cremisini C., clay nanoparticles and anthraquinone complexly
Galletti M., (2004). Determination of heavy metals modified glassy carbon electrode, Talanta, 64(4),
in wines by anodic stripping voltammetry with 922-928.
thick-film modified electrode, Anal. Chim. Acta,
514(2) 227-234. Zaporozhets, O. A., Tsyukalo, L. Ye., (2002)
Xylenol Orange Adsorbed on Silica Surface As a
Demetriades D., Economou A., Voulgaropoulos A., Solid Phase Reagent For Lead Determination Using
(2004) A study of pencil-lead bismuth-film Diffuse Reflectance Spectroscopy, Talanta, 58, 861-
electrodes for the determination of trace metals by 868.
anodic stripping voltammetry, Anal. Chim. Acta,
519(2), 167-172.
LAMPIRAN
0.07
0.06
Arus Puncak (mA)
0.05
0.04
SXO
0.03 SG
0.02
0.01
0
0 20 40 60
Komposisi (%)
(a)
0.06
0.05
ySXO = 0.0053x + 0.0035
Arus Puncak (mA)
2
0.04 R = 0.9915
0.03 SXO
ySG = 0.0053x + 0.0013
0.02 SG
2
R = 0.9937
0.01
0
0 2 4 6 8 10
Konsentrasi (ppm)
(b)
0.1
0.09
0.08
Arus Puncak (mA)
Gambar 3. Kurva kalibrasi Pb2+ (a) 1-10 ppm dan (b) 0,1-1 ppm
Abstract
In the program for the search of bioactive compounds from Indonesian rain forest plants
water- and organic-soluble extracts of the twigs of Taxus sumatrana (Miquel) de Laubenfels
have been evaluated for their α-glucosidase inhibitory activity. The ethanol- and ethyl
acetate-soluble extracts showed significant activity (IC50 ± 15 µg/ml). From phytochemical
preliminary evaluation, it was suggested that the active compounds were probably either
flavonoids or taxane diterpenoids. Further isolation work using high performance liquid
chromatography, a known anticancer paclitaxel has been isolated, as one of the active
compounds.
Key words: taxus, α-glucosidase, taxol, paclitaxel.
Appendix
O OH
N+ HO OH
-
O
O
O O OH
O
p-nitrophenyl-α-D-glucopyranoside N+ HO OH
-
O
+ O
OH O
α-glucosidase p-nitrophenol α-D-glucose
(yellow)
Table 1. α-glucosidase inhibition activity of T. sumatrana twigs ethanol extracts and its
fractions
0H C-H
(3633) (2942) C=O
(1713)
Aromatic
NH2 or NH C-O-C (707)
(1646) (1247)
13
Figure 6. C NMR spectra of Compound 8 (125 MHz, CDCl3)
Abstract
Chicken essence, raw meat and cooked meat from spent hen and broiler chicken were
analysed for nutrients composition (AOAC method). Sensory evaluation of chicken essence
from spent hen, broiler and a marketed product (Brand’s) and amino acid profile analysis
(HPLC method) were also carried out. From the study, spent hen’s essence contained 1.34%
protein and 1.5% fat while broiler’s essence had 6.2% protein and 2.62% fat. There were
differences in fat, protein, water and total ash composition in raw and cooked meat of both
type of chicken. Raw spent hen’s meat contained 18.6% protein, 0.99% fat, 73% water and
1.1% total ash while raw broiler’s meat contained 17.01% protein, 1.86% fat, 78.18% water
and 0.84% total ash. Cooked spent hen’s meat contained 30.7% protein, 1.39% fat, 60.6%
water and 0.81% total ash and cooked broiler’s meat showed 21.79% protein, 1.45% fat,
71.45% water and 0.51% total ash in the composition. The color of broiler’s essence is the
lightest and the deepest red while for yellowness, spent hen’s essence had the highest
intensity. From sensory evaluation, spent hen’s essence had the characteristics of chicken
essence that was most favored by the consumers. Spent hen’s essence showed the highest
value in all evaluated attributes. Fifteen amino acids were detected in chicken essence. The
major amino acid component in spent hen’s essence is histidine (248 mg/100g), while for
broiler essence, it was glycine at 474 mg/ 100 g. Lysine was the lowest acid amino component
in both essences of chicken.
Keywords: nutritional composition, sensory evaluation, chicken essence
were carried out to achieve the end product that significantly higher compared to spent hen’s
is more acceptable to consumers. essence. The low protein content of spent hen
essence is due to less dissolved protein during
2. Experimental
the extraction of juice compared to broiler that
Preparation of Chicken Essence
is high in dissolved protein. However, protein
Defatted and deskinned chicken meat (500g)
content in spent hen meat (raw or cooked) was
was steamed with 600ml water. It was steamed
higher than broiler meat (Table 2).
at 160˚C for 1 hour. No additive was added.
The essence of chicken was diluted with 100ml From Table 1, fat content in broiler’s essence
water, then filtered with Whatman filter paper was also significantly higher compared to spent
(No. 1) using vacuum filtration system. The hen essence while Table 2 showed that broiler
amount of chicken essence collected were 50- meat (cooked and raw) were higher compared
60ml. It was sterilized in an autoclave at 121˚C to spent hen meat. Higher fat content in
for 15 min. The container was also sterilized to broiler’s essence is due to the low consumption
prevent contamination and microbial growth. of energy compared to layers (Hague et al.
1994). Spent hen were older and the fat within
Proximate Analyses
muscles was less due to the energy
Protein content was determined using
consumption during laying eggs. However, the
Macrokjedahl method while fat content was
visible fat was more compared to broiler. Body
determined using Monjonnier method
fat content was determined by the feed and
(A.O.A.C 1984). Moisture and ash content
activity of the chicken (Hirata et al. 1988).
were determined by using oven methods
(A.O.A.C 1984). Moisture content in broiler is significantly
higher compared to spent hen meat. Wu &
Color Measurement
Shiau (2002) showed lower moisture content in
The color of chicken essence were determined
spent hen. Lower moisture content resulted in
for L (lightness), a (redness) and b (yellowness)
less juiciness in the texture and explained the
using a Minolta Chromameter CR-100.
less popularity of spent hen (Kondaiah 1988).
pH Determination On the other hand, ash content is significantly
pH of chicken essence were determined by higher in both raw and cooked spent hen (Fig
using a pH meter Model 8314 that was 2). High content of ash in spent hen meat
calibrated at pH 7.0. probably contributed by the waste from feed
such as antibiotic and mineral (Ismail et al
Sensory Evaluation
Sensory evaluation was carried out using the 2000).
Hedonic Scale of 1=lowest and 5= highest for Table 3 showed that broiler essence is the
scoring various attributes. A panel of 30 people lightest and most reddish among all three
was used to evaluate the color, viscocity, treatments while spent hen essence is the most
sweetness, aroma, chicken flavor and overall yellowish sample. Spent hen essence is darker
acceptance of these samples. due to the mioglobin pigment in the muscles
and meat. The darkness of the meat increased
Amino Acid Analyses
Amino acid profile were determined by using with age as the myoglobin increased (Lawrie
HPLC (High Performance Liquid 1991). Redness of the treatments maybe
Chromatography). contributed by Millard Reaction during cooking
or from animal feed that contained carotenoid
Statistical Analyses (Hoffman & Fisher 2000). Anthocyanin in
The data were analyzed using the Statistical chicken feed made from corn can be a major
Analyses System (SAS) program version 6.12 factor to the yellowness of the treatments
(SAS 1995). Treatments showing significant (Hoffman & Fisher 2000).
differences (p<0.05) were subjected to the
Duncan’s Multiple Range Test. Table 4 showed that there was significant
difference among the three treatments. All the
3. Results and Discussion treatments showed that chicken essence were
Table 1 showed the protein and fat contents of not acidic and more toward neutral (Hague et
broiler’s and spent hen essences. The protein al. 1994).
and fat content of broiler’s essence was
Figure 1 showed the data collected from encouraged to lower the production costs
sensory scores of color, viscosity, aroma, without compromising on nutritional and
chicken flavor, sweetness, overall acceptance sensory values, as reflected in the production of
among 30 panels. Spent hen essence had the spent hen chicken.
highest score for every attribute and was the
5. References
most likable product for the panelists although Amudobe, F. O. & Fetuga, B. L. 1984. Amino acid
there was no significant difference among the composition of seeds of some lesser known tree
three treatments for color and viscosity. The crops. Food Chem. 13: 299-307.
chicken flavor, sweetness aroma of spent hen
Crush, K. G. 1970. Carnosine and related substances
chicken essence was significantly highest
in animal tissues. Comp. Biochem. Physiol. 34: 3-
among the treatments. The marketed products 30.
(Brand’s) had the lowest score and were
significantly different in aroma, chicken flavor, Hague, M. A., Warren, K. E., Hunt, M. C. , Kropf,
sweetness and overall acceptance. The panels D. H., Kastner, C. L., Stroda, S. L. & Johnson, D. E.
still prefer the spent hen essence among the 1994. Endpoint temperture, internal cooked color
and expressible juice color lationships in ground
three treatments.
beef patties. Journal of Food Science. 59 (3): 465-
Five samples were injected into the analytical 470.
instrument (HPLC) where two of them were Hamm, D. R. 1970. Properties of meat protein. In
samples of broiler’s essence and spent hen Lawrie, R. A. Proteins as human food. Pg. 170-179.
essence. The rest were blank and standard. London: Butterworths.
Every sample required about 50 minutes to
Hirata, A., Wang, F. C., Kimura, T. & Ohtake, Y.
determine the presence of amino acid in 1988. Fatty acid composition of lipids of meats and
broiler’s essence and spent hen’s essence. various internal organs from culled laying hen.
The composition of amino acid in spent hen’s Nippon Shokuhin Kogyo Gakaishi. 35 (3): 204-209
essence and broiler’s essence was shown in Hoffman, L. C. & Fisher, P. 2000. Comparison of
Fig. 2. Both samples contained 15 amino meat quality characteristics between young and old
acids:- aspartic acid, theonine, serine, glutamic ostriches. Meat Science 59: 335-337
acid, glysine, alanine, valine, metionine, Ismail, M., Manickam, E., Danial, A. D., Rahmat,
isoleusine, tyrosine, phenylaline, lysine, A. & Yahay, A. 2000. Chemical composition and
histidine, and proline. The higest composition antioxidant activity of Strobilanthes crispus leaf
of amino acid in spent hen’s essence are extract. J. Nutr Biochem. 11: 536-542.
histidine (248mg/ 100g) followed by glutamate Kondaiah, N., Panda, B. 1988. Effect of live weight
acid (215mg/100g) and glysine (138mg/ 100g). dreesed weight and age on the yields of carcass
The lowest composition was lysine 918mg/ components from spent hens. Indian J. animal Sci.
100g). 58: 246-252
On the other hand, the highest composition of Lawrie, R. A 1991. Meat Science. 5th edition.
amino acid in broiler’s essence is glycine Oxford: Pergamon Press.
(474mg/ 100g), glutamate acid (203mg/ 100g), Nagai, H., Harada, M., Nakagawa, M., Tanaka, T.,
proline (166mg/ 100g), histdine 9153mg/ 100g) Gunadi, B., Setiabudi, M. L. \J., Uktolseja, J. L. A.
while the lowest was lysine (7mg/ 100g). and Miyata, Y, 1996. Effects of chicken extract on
the recovery from fatigue caused by mental
The higher quantity of amino acid in broiler’s
workload. Applied Human Science. 15: 281-286.
essence was probably contributed by the higher
protein content compared to spent hen’s Sim, M. K. 1977. Effects of oral feeding of Brand’s
essence. Lysine was found least in both Essence of Chicken on the level of 5-Hydroxyindole
samples as lysine can be destroyed during acetic acid in the cerebrospinal fluid of the rat.
heating in Millard reaction (Amubode & International Journal of Food Sci. and Nutritional
48: 113-117.
Fetuga 1984).
Sturman, J. A. 1993. Taurine in development.
4. Conclusion Physiol. Rev. 73: 119-147
Spent hen essence was popular among the
consumers compared to the broiler’s essence Utusan Malaysia. 2001. Pati ayam rangsang
and marketed product. Utilization of spent hen kecerdasan. 18 April: 2.
(a by-product from the egg industry) is
Wu, H. C. & Shiau, C. Y. 2002. Proximate in commercial chicken and other meat essences. J.
composition, free amino acids nd peptides contents Food and Drug Analysis. 10 (3): 170-177
APPENDIX
Table 2. Nutritional compounds of raw and cooked broiler and spent hen meat.
Nutritional Raw Broiler Raw Spent Hen Cooked Broiler Cooked Spent
components Meat Meat Meat Hen Meat
Protein (%) 17.01 c 18.6 c 21.79 b 30.7 a
Fat (%) 1.86 a 0.99 c 1.45 b 1.39 b
b a c
Ash (%) 0.84 1.1 0.51 0.81 b
Moisture (%) 78.18 c 73.0 b 71.45 b 60.6 a
a-c
– Means with different superscript for row are significantly different (p<0.05)
Table 3. Color measurement of broiler’s, spent hen and market product (Brand’s).
Color Broiler’s essence Spent hen essence Brand’s essence
L (Lightness) 30.0 a 29.5 b 28.9 b
A (Redness) 1.45 a 0.35 c 0.89 b
B (Yellowness) 1.45 b 2.22 a 0.75 b
a-c
– Means with different superscript for row are significantly different (p<0.05)
Sensory Evaluation
5 a a a a
4 a a aaa brand's
Mean score
a b b b b
3 broiler
c c c c
2 spent hen
1
0
aroma
color
Attributes sweetness
a-c
– Means with different superscript for row are significantly different (p<0.05)
Eli Rohaeti
Abstract
Polyurethane is a polymeric material which contains a urethane group (-NHCOO-) in
the backbone of the macromolecule. The urethane groups are the product of the reaction
between isocyanate and hydroxyl groups. This polymer material is one of the most important
synthetic polymeric material in the market, with a wide variety of features such as sheets,
fibers, foams, adhesives, and lacquers.
The basic building blocks for polyurethanes are isocyanates and polyols. The properties of
polyurethanes depend largely on the building blocks, especially the kind of the polyol and
isocyanate.
About 90% of the polyols used in polyurethane synthesis are hydroxyl-terminated polyethers.
Saturated polyesters with terminal hydroxyl-groups are used to make both flexible and rigid
polyurethane. Not only pure synthetic compounds but also various natural substances such as
sucrose, molasses, lignin, and carbohydrates have been explored as possible polyol resources
in the polyurethane synthesis. Those natural substances are natural materials having
appropriate reactivity due to its functional groups such as hydroxyl groups. Blends of polyols
are often used to obtain the best combination of processability, cost, and the properties of the
final product. Several aromatic and aliphatic diisocyanates are available but some 95% of all
polyurethanes are based upon the two aromatic diisocyanates, toluene diisocyanate (TDI) and
diphenylmethane diisocyanate (MDI) and its derivatives.
Key words : isocyanate, polyol, polyurethane, urethane.
powders. These are then converted to useful polyisocynate mixtures are formulated to offer
articles by one of the thermoplastic processing a range of differing functionalities.
techniques which involve heating, shaping the Functionality is defined as the average number
melted polymer under pressure, and cooling. of chemically-reactive groups on each
The properties of articles made in this way are individual molecule present. Table 1 shows that
almost entirely dependent upon the properties the functionalities of the products available
of thermoplastic polymer purchased from the range from 2.0 to about 3.0.
manufacturer. The polymerization of most
Some 90 percent of the polyols used in making
polyurethanes, however, is carried out by the
PU’s are polyethers with terminal hydroxyl
converter and not by the chemical
groups. Hydroxyl-terminated polyesters are
manufacturer. The latter sells polyurethane
also used to obtain PU’s with special
chemical components, usually in the form of
properties. Polyesters are usually more
liquids, and provides advice and information to
expensive than polyethers, but competitively
enable the customer to make the polyurethane
priced polyesters (made from recovered
by mixing the chemical components in
diacids), have been developed, particularly for
specified proportions.
use in making rigid foams.
The exceptions are some polyurethane
The choice of polyol, especially the size and
elastomers which are made by the chemical
flexibility of its molecular structure and its
manufacturers. These include elastomeris
functionality (the number of isocyanate-
polyurethane fibres (spandex fibres), which are
reactive hydroxyl groups per molecule of
sold directly to textile nanufacturers, and
polyol) controls, to a large extent, the degree of
thermoplastic polyurethane ealstomers, which
cross-linking achieved in the polymer that is
are supplied in granular or sheet form for
formed in the reaction with the polyisocyanate.
conversion into articles by injection moulding,
That degree of cross-linking has a dominant
extrusion, blow-moulding, calendaring,
effect on the stiffness of the polymer. To obtain
lamination or some other established
a rigid foam there must be a stiff polymer
thermoplastic conversion process.
network and, hence a high degree of cross-
MAKING POLYURETHANES FROM linking; for flexible foam a proportionally
ISOCYANATES AND POLYOLS lesser degree of cross-linking is needed. Table
The basic building blocks for polyurethanes 2 shows the characteristics of the polyols to
(PU’s) are diisocyanates and macroglycols, make the two principal classes of PU’s.
also called polyols. The commonly used
Most polyols and polyisocyanates used in the
isocyanates are tolylene diisocyanate (TDI),
manufacture of PU’s are liquid at ambient
diphenylmethane diisocyanate (MDI) and
temperatures (ca. 18oC) and are easily handled.
polymeric isocyanate (PMDI) mictures
The reactions which produce a solid polymer
manufactured by phosgenating polyamines
are rapid and substantially complete within two
derived from the acid-catalyzed condensation
minutes. The solid product can generally be
of aniline with formaldehyde. MDI and PMDI
handled within five minutes from the start of
are coproducts, and separation is achieved by
mixing, although rates can be varied
distilling part of the MDI from the reaction
enormously by the choice of catalyst and its
micture.
concentration. The reaction are exothermic-the
A major method of varying the properties of heat generated may be used to vaporize a liquid
the final polyurethane (PU) is by varying the ‘blowing agent’ such as a fluorocarbon, when
type of isocyanate used. Isocyanates may be the reacting chemicals will polymerize and
modified in many ways to give products with expand to produce a PU foam. Alternatively,
differing physical and chemical properties. some water may be incorporated in the polyol
Several aromatic and aliphatic isocyanates are so that it reacts with the polyisocyanate to
available, but about 95 percent of all PU’s are release carbon dioxide gas.
based on two of them. These are TDI, MDI and
A urethane group is formed by the chemical
its derivatives. Such polyisocyanate mixtures
reaction between an alcohol and an isocyanate.
can be processed further to give a variety of
PU’s result from the reaction between alcohols
compositions, known as MDI variants, which
with two or more reactive hydroxyl groups per
have a wide range applications. The
molecule (diols or polyols) and isocyanates that temperature ranges are used in fabrication from
have more than one reactive isocyanate group liquid reactants:
per molecule (a diisocyanate or
a) ambient to 500C, used for one shot and
polyisocyanate). This type of polymerization is
simple pouring process;
called addition polymerization.
b) 50 – 1000C, prepolymer and quasi-
There have been considerable research put
prepolymer processes;
forth to develop an understanding of the
property-structure relationships in segmented c) greater than 120oC, synthesis of linear
PU’s (Huang and J. Lai, 1997 : 1563). A series (thermoplastic) urethanes.
of hydroxyl terminated polybutadiene (HTPB) In general as the temperature increases
based PU’s were synthesized by solution progressively to 1400C all reaction rates tend to
polymerization with different types of converge, hence favouring cross-linking
diisocyanates, hard segment contents, NCO/OH reactions and especially biuret crosslinking. As
ratio and polymerization methods. velocity rates with the various urethane
Spectroscopic and stress-strain studies were reactants change with temperature, the need for
carried out to elucidate the structure-property good temperature control in obtaining a
relationships existing in these polymers. It was consistent product becomes obvious.
found that the binding of the hard segment and
the flexibility of soft segments had subtle Increased temperature also has an important
effects on the properties of stress-strain at effect on the properties of the cured polymer
break. The segregation between hard and soft since both the allophanate and biuret linkages
segments was manifested by incompatibility tend to dissociate at higher temperatures giving
between hard and soft segments, steric a more linear polymer. Some results are given
hindrance of urethane groups, and the extent of in Table 3.
interchain hydrogen bonding, which affects the The conditioning of the chemicals before use is
segregation and hence the stress-strain property done in various ways depending on the scale of
of the prepared films. Films with higher hard manufacture and the temperature requirements
segment content and NCO/OH ratio, MDI and of the particular process. Some processes, such
the one-stage polymerization method exhibit as elastomer manufacture from isocyanates and
higher stress at break and lower strain at break. polyols that are solid at room temperature, may
The higher value of hydrogen bonding index be operated at elevated temperatures. But most
(HBI) was observed for higher NCO/OH PU’s are made from isocyanates and polyols
values, hard segment content and one-stage that are liquid at room temperature. Many of
PU’s. The degree of segregation and strain at these of PU processes may be initiated by
break are increased as the HBI value decreased. adjusting the catalyst level at any convenient
PU’s with mixed diisocyanates of MDI and temperature ranging from about 150C to about
IPDI (isophorone diisocyanate) exhibit lower 300C, although there is often an optimum range
stress at break than that with the single of temperatures that guves the best product or
diisocyanate of MDI-based PU’s. the lowest costs.
Temperature control and conditioning Polyurethanes from plant components
The viscosity, density, and chemical reactivity Natural polymers are materials which are
of the polyols and the isocyanates vary with the highly adaptable to their circumstances. They
temperature. Controlling the temperature of the are also materials having appropriate reactivity
chemical components is therefore essential to because of functional groups such as hydroxyl
the reproducible processing of PU’s. Changes groups. Natural polymers having more than two
in temperature may not only change the rate at hydroxyl groups per molecule can be used as
which the PU polymerization takes place, but polyols for PU synthesis.
they may also affect the quality of the final
product. ( Hatakeyama, et all., 1995 : 743)
In general increasing temperature The core structure of prepared PU’s consists of
promotes faster urethane elastomer formation saccharide and lignin linked by urethane
and also controls its structure. Three general bonding. It can be assumed that the PU’s
obtained are essentially copolymers having
Ulrich, Henrie (1982), Polyurethane, dalam Woods, George (1987), The ICI Polyurethanes
Introduction to Industrial Polymers, Hanser Book, John Wiley & Sons, New York, 1 – 15.
Publishers, New York, 83 – 88.
Abstrak
Karakterisasi DNA Polimerase termostabil dari bakteri termofilik Bacillus thermohilus ssp1
(DNA Pol BTC16). Telah dilakukan optimasi pH, suhu, variasi Mg+2], [Mn+2] and [K+].
Hasil karakterisasi menunjukkan aktivitas polimerase tertinggi ditunjukkan pada pH 7,8,
suhu 80°C, [ Mg+2 ]= 3 mM, [ Mn+2 ] = 3 mM dan [K+ ] = 25 mM. Kinetikan reaksi
enzim menunjukkan Vmaks terhadap dNTP sebesar 1,15 unit mg-1, Km sebesar 1,37 x 10-4 M
dan kcat sebesar 1,55 x 10-2 detik-1 serta kcat / Km 11, 31 x 101 detik-1 M-1. Aktivitas DNA
Pol BTC16 dapat diinhibisi oleh aphidicolin dan N-etilmaleimida (NEM), dengan nilai IC50
berturut-turut 9,35 µg/mL dan 32, 89 µg/mL. Dari data-data kinetika di atas serta efek
inhibitor oleh aphidicolin dan N-etilmaleimida menunjukkan bahwa DNA Pol BTC16
mempunyai kemiripan sifat dengan DNA Pol kelas B dan mempunyai residu sistein pada
sisi katalitiknya.
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Pollution sources and their effects on drinking water quality: A case study of
Semenyih River Basin
School of Chemical Sciences & Food Technology, Faculty of Science and Technology, 43600 UKM Bangi,
Selangor Darul Ehsan, e-mail address: mpauzi@pkrisc.cc.ukm.my
Abstract
Semenyih River is the main source of raw water for the Semenyih Water Treatmant Plant
(SWTP). The SWTP, with the production capacity of 150 MGD, supplies treated water to the
new administrative centre of Putrajaya in addition to areas of Cyberjaya, Bandar Baru
Bangi, Sepang, KLIA and USJ. The river basin has experienced rapid development since the
last decade in line with the development of new Kuala Lumpur International Airport (KLIA),
the Airport City, the Cyberjaya and the Multimedia Supercorridor that has resulted in the
degradation of the water quality. This is further compounded by newer proposed development
programmes within the Kajang-Semenyih Corridor and the Bangi-Beranang Corridor which
will not only increase the environmental load but also creating inflating demand for clean
water. A study was carried out to determine the extent of the basin water quality degradation
and their impacts on the quality of the treated water produced by the SWTP. In addition to
common water quality parameters, the levels of microorganics namely trihalomethanes and
other volatile organic compounds (VOCs) were determined. This study has shown that VOCs
are present in the treated water, ranges from undetectable to 104.3 µg/l. This may be
attributed to the presence of precursor substances in the raw water and the chlorination
practices used by the SWTP. Analysis of the raw water quality at selected sampling locations
also showed significant variations in the physical, biological and chemical characteristics as
the river flows down stream indicating the impacts of the varied landuse. The decline in raw
water quality and the findings of anthropogenic chemicals, shows that better catchment
management is badly needed.
Muhayatun
Pusat Penelitian dan Pengembangan Teknik Nuklir, BATAN, Jalan Tamansari 71, Bandung, 40132,
Indonesia, e-mail: hayat@bdg.centrin.net.id
Abstrak
Analisis aktivasi neutron menggunakan pembanding multielemen merupakan suatu metode
yang umum digunakan untuk analisis multielemen. Metode tersebut memerlukan waktu
preparasi lama dan biaya besar. Meskipun SRM (standard reference material) telah sering
digunakan sebagai standar pembanding, tetapi pada beberapa keadaan menghasilkan nilai
yang berbeda. Pada keadaan tertentu juga tidak mungkin untuk membandingkan kondisi
iradiasi standar dan sampel jika terjadi ketidak homogenan fluks. Untuk mengatasi berbagai
keterbatasan tersebut, perlu digunakan metode standardisasi K0 - analisis aktivasi neutron
(K0-AAN). Penelitian metode standardisasi K0 merupakan suatu lingkup penelitian yang luas,
melibatkan berbagai parameter yang spesifik untuk suatu jenis reaktor tertentu dan
membutuhkan waktu yang lama. Pada penelitian ini telah dilakukan analisis beberapa sampel
partikulat udara menggunakan metode K0-AAN pada fasilitas reaktor HWRR (heavy water
research reactor) di Beijing China. Iradiasi sampel untuk nuklida yang berumur paruh
pendek dilakukan pada masing-masing sampel selama 5 menit. Pencacahan hasil iradiasi
pendek dilakukan selama 5 menit setelah dead time berada pada nilai dibawah 10%. Iradiasi
sample untuk nuklida yang berumur paruh panjang dilakukan selama 2 hari dengan waktu
tunda 2-3 hari. Analisis dilakukan mengunakan program SPAN dan ADV-NAA. Hasil analisis
iradiasi pendek dan panjang masing-masing menunjukkan 13 unsur dan lebih dari 17 unsur
dapat terdeteksi. Sejumlah unsur yang dapat terdeteksi seperti antara lain sebagai berikut: Ti,
I, Br, Mg, Mn, Cu, Na, V, K, Cl, Al, Ca, S, Nd, Sm, Mo, Au, As, Sb, La, Ce, Lu, Se, Th, Cr, Yb,
Hf, Cs, Sc, Rb, Fe, Zn, Co dan Eu. Dibandingkan dengan analisis aktivasi neutron
menggunakan metode relatif yang hanya mampu mendeteksi sekitar 20 unsur, maka
penggunaan metode K0 sangat diperlukan dalam pegembangan metode AAN, sehingga dapat
lebih mengefisienkan waktu, tenaga dan biaya dalam melakukan analisis multielemen.
Sertifikasi larutan standar logam, cadmium , timbal dan merkuri dengan metode
titrasi kompleksometri EDTA
ABSTRAK
Dalam sertifikasi bahan acuan larutan standar logam Timbal (Pb),cadmium (Cd) dan
Merkuri (Hg) untuk analisis unsur logam diperlukan metode yang handal.dan tertelusur ke
Standar Nasional/ Internasional satuan ukuran . Metode titrasi kompleksometri merupakan
metode yang cukup handal dan pada prinsipnya adalah metode primer yang tertelusur ke
Standar Nasional/Internasional satuan ukuran. Pada sertifikasi ini metode titrasi
kompleksometri dilakukan secara automatik dengan larutan standar Etilen Diamin Tetra
Asetat ( EDTA) dan detektor fotometri. Untuk penentuan Cd dilakukan pada pH 6 dengan
indikator xylenol orange, pada panjang gelombang 550 nm. sedangkan untuk analisis Pb
dilakukan pada pH 10 dengan indikator Eriochrom Black T (EBT) pada panjang gelombang
660 nm dan untuk analisis Hg dilakukan pada pH 6 dengan indikator xylenol orange pada
panjang gelombang 550 nm .
Validasi metode untuk penentuan Larutan Cd, Pb dan Hg ini telah dilakukan dengan hasil
sebagai berikut :
Akurasi metode pada analisis larutan standar Cd ( NIST-SRM 3108) memberikan nilai
perolehan kembali (recovery) 99,46 % dengan deviasi standar (n=4 ) adalah 0,21%,
sedangkan untuk analisis larutan Pb ( NIST-SRM 3128 ) memberikan nilai 99,56 % dengan
deviasi standar ( n=8) adalah 0,12 % dan untuk analisis larutan standar Hg ( NIST-SRM
3133 adalah 99,56% dengan deviasi standar ( n= 6) adalah 0,16 %. Presisi metode
ditentukan dengan cara pengukuran contoh sebanyak 7 kali pengulangan , dan hasil yang
diperoleh memberikan nilai standar deviasi relatif (RSD) = 0,046 %untuk analisis Cd; 0,12
% untuk analisis Pb dan 0,18 % untuk analisis Hg. Metode ini memberikan hasil yang linier
antara 4 sampai 20 mLuntuk larutan Cd ( 1000 mgr /L ) , 5 sampai 30 mLuntuk larutan
Pb( 1000 ppm) dan 4 sampai 30 mL untuk larutan Hg ( 1000 mgr/L ). Ketiga metode
tersebut tidak memberikan kesalahan sistematik yang cukup berarti serta mempunyai limit
kuantitasi = 3,5 mg untuk Cd , 6,0 mg untuk Pb dan 5,0 mg untuk Hg .
Hasil analisis contoh kandidat bahan acuan untuk larutan Cd = 999 ± 6 mg/mL,untuk
kandidat bahan acuan larutan Pb = 1000 ± 7 mg /L dan untuk larutan Hg = 1007 ± 8
mg/L.
Kata Kunci : Larutan standar logam Sertifikasi , Titrasi kompleksometri , Validasi metode.
satuan ukuran dan akan memberikan nilai xylenol orange. Bahan acuan bersertikat (
ketelitian dan ketepatan yang tinggi. SRM ) larutan Zn 2+ (NIST 3168 a ) , larutan
standar Pb 2+ ( NIST 3128), Larutan standar
Berdasarkan prinsip tersebut diatas maka
Cd2+ ( NIST –3108 ) , Larutan Standar Hg (
metode titrimetri termasuk metode primer yang
NIST –3133).
sangat sesuai jika digunakan pada penentuan
konsentrasi untuk sertifikasi bahan II.2. Contoh yang diuji
acuan..Penentuan titrimetri untuk larutan ion Kandidat bahan acuan larutan standar Cd, Hg
logam yang telah dikenal sejak lama adalah dan Pb di dalam HNO3 0,5 N
metode titrasi kompleksometri dengan
II.3. Peralatan
menggunakan EDTA sebagai larutan pentitrasi.
Timbangan analitik, Automatic titrator merk
Metode ini telah digunakan untuk analisis Mettler Toledo DL 77 , Phototrode DP 660,
berbagai unsur logam yang mana setiap logam DP550, Buret piston dan alat-alat gelas lainnya
memerlukan kondisi titrasi yang spesifik. Pada
II.4. Pembuatan Pereaksi dan Larutan
penelitian ini metode titrasi kompleksometri
Standar
untuk logam logam Cd,Pb dan Hg akan
II.4.1 Pembuatan larutan EDTA 0,02 M
digunakan untuk sertifikasi bahan acuan larutan
Diti.mbang dengan teliti 7,44 gram EDTA di
standar logam tersebut.
dalam botol timbang , dilarutkan dengan akua
Berbagai metode titrasi kompleksometri dapat nanopore kemudian dimasukkan ke dalam
digunakan untuk penentuan ion Cd ,Pb maupun labu takar 1 Liter dan di encerkan sampai tanda
Hg ( Meites L,1962 ). Diantaranya adalah batas dengan akua nanopore . Larutan tersebut
metode penentuan Cd dengan titrasi ditempatkan didalam botol polietilen atau di
kompleksometri menggunakan indikator dalam botol gelas yang telah direndam dalam
Xylenol orange pada pH 6, metode penentuan larutan EDTA 0,2 % panas selama 3 jam
Pb dengan indikator EBT pada pH 10 dan
II.4.2. Pembuatan larutan standar Zn 2+
metode penentuan Hg dengan indikator xylenol
0,02 M dari SRM NIST 3168 a
orange pada pH 6. Metode ini dipilih karena
Ditimbang dengan teliti 13,2313 gram larutan
memberikan perubahan warna yang cukup
standar Zn 2+ ( SRM NIST 3168 a ) di dalam
tajam pada titik akhir titrasi sehingga
labu takar 100 mL , kemudian diencerkan
diharapkan dapat memberikan nilai presisi dan
dengan HNO3 0,5 M sampai tanda batas
akurasi yang tinggi.
II.4.3. Pembuatan Larutan standar Pb 2+
Untuk mengetahui unjuk kerja dari metode
dari SRM NIST 3128
perlu dilakukan validasi metode yang bertujuan
Ditimbang dengan teliti 27,6757 gram larutan
untuk melengkapi bukti bukti yang objektif
standar Pb 2+ ( SRM NIST 3128 ) , kemudian
apakah metode tersebut memenuhi. persyaratan
dimasukkan ke dalam labu takar 250 mL, dan
yang ditetapkan dan sesuai dengan tujuan dari
diencerkan dengan asam nitrat 0,5 N sampai
pengujian tersebut. Dalam validasi metode ini
tanda batas.
ada 6 langkah yang dilakukan yaitu
penentuan akurasi, presisi, kesalahan II.4.4. Pembuatan larutan standar Cd dari
sistematik , linearitas dan limit SRM NIST 3108
kwantitasi.(Toledo M) serta perhitungan Ditimbang dengan telilti 9,878 gram larutan
ketidakpastiannya. standar Cd2+ ( SRM NIST 3108 ), kemudian
dimasukkan ke dalam labu takar 100 mL, dan
Dalam makalah ini akan dibahas tentang
diencerkan dengan asam nitrat 0,5 N sampai
validasi ketiga metode tersebut ,serta
tanda batas
penerapannya dalam analisis /sertifikasi
kandidat bahan acuan larutan standar logam. II.4.5. Pembuatan larutan standar Hg dari
SRM NIST 3133
II. BAHAN DAN METODE
Ditimbang dengan teliti 24,9719 gram larutan
II.1.Bahan Kimia
standar Hg2+ ( SRM NIST 3133 ) , kemudian
Semua bahan kimia yang digunakan adalah
dimasukkan ke dalam labu takar 250 mL, dan
murni (p.a) yang terdiri dari : amoniak ,
diencerkan dengan asam nitrat 0,5 N sampai
amonium klorida, asam tartrat, asam nitrat,
tanda batas.
heksametilentetramin, EDTA , EBT. dan
dipengaruhi oleh pH dari larutan. Pada pH yang III.2. Penentuan repetabilitas (presisi)
tinggi ( kira kira 12 ) kebanyakan EDTA ada metode :
dalam bentuk tetraanion ( Y4-) , sedangkan Dalam penentuan repetabilitas dilakukan
pada pH yang lebih rendah ada dalam bentuk dengan cara menganalisis contoh kandidat
HY 3-. Dengan demikian kondisi pH dari bahan acuan yang dibuat oleh PP-Kimia –LIPI
larutan perlu diperhatikan pada titrasi ini. dengan konsentrasi kurang lebih 1000 mg/L
Selain kondisi pH yang perlu diperhatikan sebanyak minimal 7 kali kemudian ditentukan
juga adalah adanya kemungkinan terbentuknya deviasi standar ny (SD) .Pada percobaan ini
senyawa kompleks lain yang bereaksi dengan dilakukan pengamatan terhadap mL larutan
logam atau pun indikator yang digunakan peniter yang digunakan . Data yang diperoleh
yang dapat menggganggu pada titik akhir dapat dilihat pada Tabel 2.
titrasi . Berbagai kondisi titrasi dari berbagai
Dari hasil yang diperoleh menunjukkan bahwa
logam telah dilakukan dan dapat dilihat pada
ketiga metode tersebut mempunyai ketelitian
literatur ( Meites L,1962 ). Pada penelitian ini
yang baik dengan nilai RSD berturut turut
telah dipilih metode penentuan logam Cd
untuk analisis Cd, Pb dan Hg adalah 0,046 %,
dengan menggunakan indikator Xylenol
0,12 % dan 0,18 % .
orange pada pH 6 , metode penentuan Pb
dengan indikator EBT pada pH 10 dan metode III.3. Penentuan limit kuantitasi.
penentuan Hg dengan indikator Xylenol Dalam penentuan limit kuantitasi ini dititrasi
orange pada pH 6. Metode metode tersebut di sejumlah larutan yang masing masing
atas telah divalidasi untuk keperluan mengandung Cd, Pb dan Hg dimana
sertifikasi bahan acuan. Dalam validasi kandungan logam tersebut divariasi dari besar
metode ini telah dilakukan pengujian terhadap menjadi semakin kecil. Setiap konsentrasi
presisi ( repetabilitas ), akurasi, limit dianalisis sebanyak 7 kali pengulangan, dan
kuantitasi,, linieritas, kesalahan sistematik dan ditentukan nilai RSD nya.. Selanjutnya
perhitungan ketidakpastian pengujian dari ditentukan berapa mg logam logam tersebut
masing-masing logam . Hasil yang diperoleh yang repetabilitas titrasinya sudah melampaui
adalah sebagai berikut batas nilai RSD yang masih diterima.Untuk
mendapatkan nilai tersebut dibuat kurva
III.1 Penentuan akurasi metode :
hubungan antara mg ion logam tersebut
Akurasi metode diuji dengan cara
terhadap nilai RSD seperti gambar 1 berikut
menganalisis larutan standar yang diketahui
ini
konsentrasinya (SRM ) yang mana pada
penelitian ini digunakan SRM dari NIST yaitu Dimana limit kuantitasi dapat dihitung dari
SRM No 3108 untuk analisis Cd , SRM No kurva tersebut yaitu, konsentrasi contoh yang
3128 untuk analisis Pb dan SRM No 3133 memberikan nilai RSD =0,30 %.
untuk analisis Hg dengan konsentrasi dari Dari kurva tersebut diatas diperoleh bahwa
masing masing standard tersebut adalah 9,12 ± limit kuantitasi untuk Cd adalah 3,5 mg (0,031
0,03mg/g Cd ; 9,98 ± 0,03mg/g dan 10,00 ± mmol), Pb =6 mg (0,0289 mmol) dan Hg = 5,0
0,02 mg/g. mg ( 0,0249 mmol )
Dari hasil analisis SRM , akurasi metode III.4. Penentuan kesalahan sistimatik :
ditunjukkan oleh nilai perolehan kembali Penentuan kesalahan sistimatik dilakukan
(recovery), yaitu , dengan cara melakukan titrasi pada berbagai
Hasil analisis jumlah mL ion logam , kemudian dibuat
% recovery = x100%
NilaiSRM kurva antara mL ion logam yang dititrasi
terhadap mL titran dan ditentukan persamaan
Hasil yang diperoleh dapat dilihat pada tabel
garis regresinya. Titrasi dikatakan tidak
1.:
memberikan kesalahan sistimatik yang cukup
Dari hasil yang diperoleh menunjukkan bahwa berarti apabila nilai intersep ( a) dari
ketiga metode tersebut cukup akurat dengan persamaan garis regresi ≤15 µL.
recovery mendekati 100% .
Data hasil percobaan penentuan kesalahan
sistematik untuk ketiga metode diatas dapat
dilihat pada Gambar 2.
Guide,2000) Pada makalah ini cara 3. Eurachem/ Citac Guide ,(2000) Quantifying
menghitung ketidakpastianya tidak akan Uncertainty in Analytical Measurement, 2 nd
dijelaskan tetapi contoh perhitungan untuk Ed.,52-58.
analisis Pb dapat dilihat pada tulisan 4. ISO guide to The expression of Uncertainty of
sebelumnya pada literatur ( Nuryatini, 2003) measurement,International Organization for
Standardization , Geneva Switzerland, (1993)
Hasil yang diperoleh untuk analisis kandidat
bahan acuan larutan standar Cd , Pb dan Hg 5. ISO Guide 30,( 1992) Term and definition used
dan nilai ketidakpastiannya adalah sebagai in connection with Reference materials,
berikut : Second edition,3.;6.
LAMPIRAN
Limit Kuantitasi
3.3
3
2.7
2.4
Pb
2.1
RSD
1.8 Cd
1.5 Hg
1.2
0.9
0.6
0.3
0
0 5 10 15 20 25 30 35
mg ( Pb,Cd dan Hg )
9
8
7
6
Pb
mL titran
5
Cd
4
Hg
3
2
1
0
0 5 10 15 20 25 30 35
mL lar standar
Linieritas
1015
995
konsentrasi (mg/L)
Pb
975
Cd
955
Hg
935
915
895
0 10 20 30 40
mL lar standar
Sri Widarti
Politeknik Negeri Bandung (POLBAN)
Abstract
Isoelectric points (pIs) of equine influenza A viral proteins were determined, found to be 4.2,
4.3 and 4.4. An anion exchange chromatography (Q Sepharose FF, 1 mL) was selected to
purify the ultrafiltered concentrated virus at pH 7 since hemagglutinin (HA) did not show any
activity at pH 5 and lower pHs. Percentage HA recovery of the purified virus eluted by 1 M
NaCl was 29.21%, while DNA was also bound to and eluted from the matrix.
In another experiment, polyethylene glycol (PEG) consisting of MWs 4, 6 and 8 kDa were
examined for virus precipitation from clarified virus culture broth. Precipitation with PEG
(MW 4 kDa, 37.5% w/v) showed highest HA recovery (72%) activity. DNA could be
precipitated by PEG (8 kDa) at a concentration of 25% (w/v) without precipitating virus.
PEG precipitation was found better than anion exchange chromatography with respect to HA
recovery.
has become one important issue. High quality multi step is less, around 60%.5 Alternative
of influenza vaccines can be obtained only by methods are needed to increase influenza A
efficient production and purification.2 virus recovery from culture broth. The aim of
the research is to develop a strategy to capture
In many cases, the regulation on the
and elute gel filtered purified equine influenza
manufacture of healthcare and food products
virus on an ion exchange column compare with
makes the separation and purification as a
precipitation method using polyethylene glycol.
crucial and challenging component of
commercial biotechnology. The ratio of 2. Experimental
fermentation to product recovery costs is about 2.1. Material
60:40 for many older antibiotics such as Clarified virus culture broth was used in
tetracycline. For recombinant DNA precipitation method and ultrafiltered
fermentation products such as gamma concentrated virus in an ion exchange method
interferon, the cost of downstream purification (Max Planck Institute, Magdeburg, Germany).
is very important and can amount to 80-90% of Polyacrylamide gel (Mini clean gel IEF ultra,
the total manufacturing cost. The commercial Sinus, Germany) and sinulyte solution (Sinus,
success in biotechnology products is highly Heidelberg, Germany) were used to determine
dependent on the successful development and Isoelectric points (pIs) of equine influenza A
application reliable and sensitive bio-separation viral proteins. Polyethylene glycol (PEG)
methods. 3 consisting of MWs 8 kDa (Sigma, Germany ),
6 and 4 kDa (AppliChem, Darmstadt,
Influenza viruses were produced by their
Germany) were used as received. DNA
replication within MDCK cell cultivated.4
concentration was assayed using pico green
These viruses will bud from the cell. To
dsDNA quantification methods (Pico Green ds
achieve influenza virus that obey the regulation
DNA Quantification Kit, Molecular Probes,
for vaccine purity, influenza viruses should
The Netherlands).
purify from cell debris such as protein and
DNA. 2. 2. Isoelectric focusing6,7
Polyacrylamide gel is used to run isoelectric
Influenza viruses have hemaglutinin and
focusing. The gel was soked in sinulyte
neuraminidase glycoprotein which are
solution. Gel was run at 700 v, 6 mA and 4 w
amphoteric on their envelope. The charge of
for 20 minutes. Equal amount of culture broth
the protein depends on the pH. At certain pH,
was diluted with sample diluter with ratio 50:50
the protein does not carry any charge and is
and sonicated by sonicator for 30 secs, 3 times.
known as isoelectric point (pI) that can be
determined by isoelectric focusing method. 15µL of pI marker proteins (10 mg/mL) was
When pH greater than pI, the charge of protein mixed with sample diluter (50:50) and 25 µL of
is negative and pH less than pI the charge of virus culture were loaded to sample applicators.
protein is positive. Based on this properties The gel was run at 500 V, 4 mA, 4 w for 20
virus will capture to an anion exchange minutes, followed by running the gel at 2000
matrices when pH greater than its pI and V, 7 mA, 9 w for 90 minutes and at 2500 V,
capture to kation exchange matrices when the 7mA, 9 w for 15 minutes.
pH less than its pI. The focused gel was stained by silver staining.
Precipitating of influenza virus is a means of The distances traveled by the proteins and the
concentrating and pre-purification in pI markers were measured. The pI of the viral
downstream processing. Some precipitating protein was calculated from the correlation
agent such as polyethylene glycol (PEG) is between the pI and distance traveled by the pI
used. Variation of PEG concentration and markers.
molecular weight can be carried out to 2.3. Dialysis
determine optimal condition of influenza virus Dialysis of culture broth was carried out at pH
precipitation. 4, 4.5 and 5 over night at 4oC using 20 mM
Present method of influenza virus purification Glycine-HCl buffer. Hemagglutinin (HA)
is multi step. Virus broth culture is purified by activities of the dialyzed sample were measured
sequences of purification: depth filtration, ultra by the method described by S.J. Flint et al.8
filtration and gel filtration. Recovery of this
2.4. Ion Exchange Chromatography (IEC)9,10 The marker proteins on the gel showed several
Anion exchange chromatography using 1 mL bands according to their pIs (Figure 1a).
Sepharose FF column was carried out. The Marker proteins at the left hand side and
column was equilibrated with 10 mL start proteins in the virus sample on the same gel, at
buffer (20 mM Tris-HCl, pH 7) at flow rate 1 the right hand side on the top are shown in
mL/min. Nine ml of the ultrafiltered sample Figure 1b. The magnified view of the viral
was loaded to the column at flow rate 0.5 proteins in the sample showed three distinctly
ml/min. Six fractions (1.5 mL each) were visible bands which were closed to each other
collected. The column was washed with start (Figure 1c).
buffer solution, 20 fractions were collected.
A linear relationship between pI of the marker
Column were eluted with 1 M NaCl at flow
proteins versus the distance traveled by these
rate 0.5 mL/min, 11 fractions were collected.
proteins on the gel was drawn and shown in
HA, protein and DNA of all fractions were
Figure 2. The distance traveled by three
assayed.
proteins in the virus sample were 6.4, 6.5 and
2.5. Precipitation11 6.8 cm. Based on the following equation (from
Polyethylene glycol (PEG) consisting of MWs the calibration curve, Figure 2),
8, 6 and 4 kDa were mixed with clarified
pI = -0.9481 X + 10.629 X =
culture broth till total volume was 40 mL and
distance traveled by the band
the final concentration of PEGs varied 12.5, 25
and 37.5% (w/v). The resulted solutions were pIs of proteins are 4.25, 4.36 and 4.46,
centrifuged at 2500 g, 4oC for 30 min. HA, respectively.
protein and DNA of supernatants and The abnormality of the pI marker bands are due
precipitates were assayed. to physical damage of the gel. Therefore, the
2.6. HA, DNA and protein assay closer view of the pI marker proteins are shown
2.6.1. HA assay separately. From the pI values of the viral
Hemagglutinin (HA) was assayed by method proteins, it is concluded that these proteins are
described by by S.J. Flint et al.8The HA activity acidic. Above the values of these pIs, these
was expressed by logarithm value of the sample proteins are negatively charged whereas below
dilution. that they are positively charged.
2.6.2. DNA assay To decide to use type of ion-exchanger, the
DNA concentration was assayed using pico antigenic activities (HA) of the dialyzed virus
green dsDNA quantification methods. The at pH 4.0, 4.5 and 5.0 were evaluated. HA
DNA quantification method was calibrated activities were lost at these pHs. Since at pH
whether 2 to 1.95.10-3 µg/mL in the higher 7.0 the HA activity was found and around this
range and 0.04 to 4.10-5µg/mL in the lower pH HA activity is measured routinely using
range. The DNA concentrations of the sample PBS buffer, anion exchanger at pH 7 was
were calculated from standard calibration chosen as the chromatographic method for
curve. capture of the virus.
2.6.3. Protein assay 3. 2. Anion Exchange Chromatography
Protein concentrations were determined by HA activities, protein and DNA concentration
Bradford standard assay12 using microplates. A profiles of loading, washing and elution
standard curve was plotted using 0.008 to 0.04 fractions on the anion exchange column are
(mg/mL) in the super lower range, 0.03 to shown in Figure 3.
0.1(mg/mL) and in the lower range and 0.2 to Material balances of HA, protein and DNA are
1.0 (mg/mL) in the higher range. Protein summarized in Table 1. The percentage of HA,
concentrations of samples were calculated from protein and DNA unadsorbed are 8.6, 53.3 and
standard calibration curve. 19.2%, respectively whereas the percentage of
3. Result and discussion HA, protein and DNA from the bed during
3.1. Isoelectric Focusing of Viral Proteins washing are 1.8, 12.4 and 7.8 %, respectively.
Silver stained migrated viral proteins and pI Twenty nine percent of HA, 19.8% of protein
markers in a gel are shown in Figure 1. and 15.8% of DNA were recovered in the
eluted samples whereas 81.4% of protein and
85.3% of DNA were removed from the eluted to virus and contaminating proteins. Higher
samples. Capacity of the column for influenza percentage of virus precipitation indicates that
A virus is 4.06 log/0.1 mL HA units which the surface of glycoproteins is more polar than
corresponds to 8.16 mL of ultrafiltered culture that of the contaminating proteins.
broth.
An Increase in chain length of PEG which is
Lower recovery of HA (29.2%), DNA (15.8%) due to higher MWs decreases precipitation.
and protein (19.8%) indicates binding of HA, This phenomenon can be explained on the basis
DNA and proteins to the column is strong, of fitting of certain chain length of PEG into
which could not be eluted efficiently by the use the cavity of glycoprotein surface. Differing
of current elution buffer (1M NaCl). A PEG MWs did not affect DNA precipitation
negligible amount of HA in the wash may be which is not clearly understood. Precipitation
attributed to the virus coming out of the void of DNA with 25% (w/v) PEG (8 kDa) allows
space of the ion exchanger. Higher protein the separation of DNA from the virus in the
unadsorbed to the column compared to the first step and subsequented virus can be
adsorbed one attributes the contaminating precipitated by 37.5% (w/v) PEG (4 kDa) with
proteins. less contaminating DNA.
The reasons for the low recovery of HA (29%), 4. Conclusion
protein (19.2%) and DNA (15.8%) are not The viral proteins separated by isoelectric
clearly understood. The most probable reason is focusing were found acidic, which suggests the
the tight binding of all components to the use of anion exchange chromatography for
matrix, which could not be eluted from the capture and elution of the influenza virus.
column at lower concentration of NaCl. A Anion exchange chromatography could adsorb
better design of elution by higher concentration the virus efficiently, but the elution was not
of NaCl could improve recovery. Higher very effective. This method could not separate
reduction of contaminating proteins and DNA DNA from the virus sample.
establishes greater degree of purity of the virus.
On the other hand precipitation with PEG of
3.3. PEG Precipitation MWs 4 kDa and concentration 37.5% (w/v)
Percentages of HA, protein and DNA achieved the highest HA recovery. The
concentration in the supernatant in varying precipitation method could remove most of the
PEG concentrations and MWs are shown in contaminating proteins. DNA could be
Figure 4. Proteins and virus particles were not precipitated by 25% (w/v) PEG of 8 kDa and
precipitated in 12.5 and 25% (w/v) PEGs subsequently virus with 37.5% (w/v) PEG of 4
consisting of MWs 4, 6 and 8 kDa (Figure 4a kDa. This method is very useful for virus
and 4c). DNAs were not precipitated in 12.5% concentration, DNA and protein removal. HA
(w/v) PEGs of MWs 4 and 6 kDa, but recovery by precipitation method is higher than
precipitated in 25% (w/v) PEG 8 kDa (Figure anion exchange method of purification.
4b).
References
Percentages of HA, protein and DNA in the 1. Basler, F, Christhoper and Palese, Peter (2000),
precipitate is shown in Figure 5. Percentage of Encyclopedia of Microbiology Volume 2, 2nd
HA recovered by 37.5% (w/v) PEG edition, 797-804.
precipitation of MW 4, 6 and 8 kDa are 72, 69 2. Nayak, D (2002), Downstream processing of
and 43%, respectively. Percentage of protein influenza virus, Max Plank Institut für Dynamik
precipitated are 6.4, 13.3 and 47.3%, complexer technischer Systeme, Magdeburg.
respectively. The value for DNA precipitation http://www.mpi-magdeburg.mpg.de/research/project/
are 95, 91 and 91% using above-mentioned 3. Blanch, Harvey.W and Clark, Douglas.S
PEGs. (1996), Biochemical engineering, Marcel
Polar-polar interaction of the virus particles Dekker Inc, New York, USA.
with PEG caused virus precipitation which is 4. Genzel, Y and Sann, H (2000), Influenza vaccine
detected by HA activity. The greater percentage production in microcarrier systems, Max Plank
of DNA precipitation than virus and protein Institut für Dynamik complexer technischer
may be explained on the basis of higher polar- Systeme, Magdeburg. http://www.mpi-
polar interaction of DNA with PEGs compared magdeburg.mpg.de/research/project/
5. Nayak, D.P., Lehmann, S., Reichl, U., Use of 8. Flint.J.S., et al (2000), Principles of virology,
expanded bed chromatography for downstream ASM press, American Society for Microbiology,
processing of equine influenza virus, Max Plank Washington.
Institut für Dynamik complexer technischer
9. Handbook from Amersham Biosciences, Ion
Systeme, Magdeburg. http://www.mpi-
exchange chromatography: Principle and Methods.
magdeburg.mpg.de/research/project/
10. HiTrap IEX Selection Kit, Amersham
6. Westermeie, Reiner (1997), Electrophoresis in
Biosciences, Sweden.
Practice, 2nd ed, VCH Verlagsgesellschaft mbH,
Germany. 11. Rosenberg, Ian.M, (1996), Protein analysis and
purification, Braun-Brumfield, Boston, USA
7. Isoelectric Focusing in the presence of urea with
clean gel IEF ultra, ETC electrophorese-Technik 12. Turkova, Jaroslava (1993), Bioaffinity
chromatography, 2nd ed, Elsevier Science Publisher
B.V, Netherlands.
LAMPIRAN
Figure 1. Silver stained isoelectric focusing gel. Clear view of the marker proteins
pI marker proteins and viral proteins (b) Closed view viral proteins (c)
12
y = -0.9481x + 10.629
pI of the marker proteins
8 R2 = 0.9765
0
0 2 4 6 8 10
Distance (cm)
3.5
3 Elution
Log HA/0.1 mL Washing
2.5
2 Loading
1.5
1
0.5
0
0 10 20 30 40 50 60
Volume (mL)
0.8 (a)
Elution
Washing
0.6
DNA ( g/mL)
Loading
0.4
0.2
0
0 10 20 30 40 50 60
Volume (mL)
(b)
0.06
Washing Elution
Protein (mg/mL)
Loading
0.04
0.02
0
0 10 20 30 40 50 60
Volume (mL) (c)
Figure 3. Adsorption, washing and elution profiles of HA (a), DNA (b) and
protein (c) on Q Sepharose FF
120 120
% of protein in the
% DNA in the
supernatant
supernatant
100 80
80 40
60 0
10 20 30 40 0 10 20 30 40
PEG (%, w/v) PEG (%, w/v)
(a) (b)
Percentage of HA in the
120
supernatant
80 PEG MW 4 kDa
PEG MW 6 kDa
40 PEG MW 8 kDa
0
10 20 30 40
PEG (%, w/v)
(c)
Figure 4. Percentages of protein (a) DNA (b) and HA (c) in supernatant versus
PEG concentrations
100
80
% precipitation
DNA
60
HA
40
Protein
20
0
3 5 7 9
PEG MW (kDa)
Umar A. Jenie
1110
th
Proceeding of The 6 ITB-UKM Joint Seminar on Chemistry
Departement of Chemistry ITB, Jl. Ganesha 10, Bandung 40132, Phone : +62 (22) 2502103 ext 101,
Fax : +62 (22) 2504154, Homepage : http://www.chem.itb.ac.id/jschem, E-mail : jschem@chem.itb.ac.id
Umar A. Jenie
He/she has to be able to develop his/her synthesis efforts (Corey and Cheng, 1989). The
creative thingking in moving of the chessman; Maestro of organic synthesis, Prof. Dr. RB.
in order that he/she could win the game, and Woodward (1956) was expressing the
not be trapped by this tough enemy. If he/she important of developing synthesis design
could not develop his/her creative thingking, strategy, when he said: “Synthetic objectives
he/she would be schaackmat by the enemy; and are seldom, if ever, taken by chance, nor will
then all steps of the game were useless. the most painstaking or inspired, purely
Similarly, creativity of synthetic organic observational activities suffice. Synthesis must
chemists emerges when he/she is facing with always be carried out by plan, and the synthetic
strong and tough ‘enemy’, i.e., complexity of a frontier can be defined only by terms of the
target molecule. He/she must be able to create degree to which realistic planning is possible,
chemical reaction steps in order to construct the utilizing all of the intellectual and physical
complex target molecule in a proper manner. tools available”.
One error in choosing a right chemical step
How could a synthesis scheme which illustrate
within a series of reactions would be
a pathway of chemical reaction, be set up or be
devastating to all reaction steps already done,
made, especially for a complex target
and in turn the target molecule could not be
molecule? In other words, how to set up a
achieved.
synthesis design for a complex target
Structural Complexity of Target Molecules molecule? The answer depends on the chemists
and Their Synthesis Design: Problem on the and the problem. It has also change over time.
Synthesis of Chlorophyll-a and Vitamin B- Thought must begin with perception, - the
12. process of extracting information which aids in
What is the complexity of a target molecule? logical analysis of the problem. Cycles of
From chemical synthesis point of view, the perception and logical analysis applied
factors which conspire to make a synthesis reiteratively to a target (molecule) structure and
difficult to plan and to execute, are those which to the ‘data field’ of chemistry, lead to the
give rise to structural complexity. In the development of concepts and ideas for solving
organic synthesis term, molecular size, element a synthesis problem (Corey and Cheng, 1989).
and functional group content, cyclic Moreover, Corey stated that ‘as the reiterative
connectivity, stereocenter content, chemical process is continued, questions are raised and
reactivity, and structural instability all answered; and propositions are formed and
contribute to molecular complexity in the evaluated with result that ever more penetrating
synthetic sense (Corey and Cheng, 1989). The insights and more helpful perspective on the
important in and usefulness of studying the problem emerge’. The ideas which are
complex molecule synthesis are given by Corey generated can vary from very general ‘working
and Cheng (1989), when they stated that notions on the problem hypotheses’ to quite
“molecular complexity can be used as an sharp and specific concepts.
indicator of the frontiers of synthesis, since it
Strategy used by Woodward (1960) for
often causes failures which expose gaps in
synthesizing the chlorophyll-a was a good
existing methodology. The realization of such
example of synthesis design based on
limitations can stimulate the discovery of new
development of perception and logical analysis
chemistry and new ways of thinking about
of the target molecule. A porphyrin derivative
synthesis”.
with methyl acrylate side chain at C-15 and
The successful synthesis of a complex methoxycarbonyl at C-13, was used as
molecule depends upon the analysis of problem antermediate in the total synthesis of
to develop a feasible scheme of synthesis. This chlorophyll-a. (Scheme-1).
synthesis scheme illustrates a pathway from
Substituents interactions at C-13, C-15, and C-
starting material/s, through intermediates, to a
17 which happen within the intermediate
target molecule, all of which are connected by
molecule gives rise to a sterical strain, since a
feasible chemical reactions for required
rigid structure of sp2-hybridized porphyrin ring
conversions. Such analysis to get a feasible
system has no spaciousness ‘room’ for these
scheme of synthesis is known as synthesis
bulky substituents. Consequently the geometric
design which become the ‘hearth’ of all
structure of pyrrolic C and D moeties will be
AcHN
A B A B
N N N N
H Mg
H
N N N N
D 15 C H D C
17 13
CO2CH3 H
H
O
CO2CH3 CO2CH3
CO2CH3
H H
CH2
O
Chlorophyll-a
folding out of porphyrinic plane. This nature of with the pyrrolic D resulted in the formation of
the intermediate structure which gives rise to a a dihydro derivative of the pyrrolic D ring
sterical strain, was manipulated by Woodward system (Scheme-2).
to solve the main constraint of the synthesis
The success in the construction of the
process of the chlorophyll-a, i.e., by applying
dihydroporphyrin intermediate has paved the
regioselective hydrogenation of the pyrrolic
way to formation of the chlorophyll-a.
ring D at C-17/C-18. In Woodward perception,
Perception which was set up by Woodward to
this sterical strain could be deleted, if the sp2-
make the dihydro-intermediate, i.e.,
hybridized system of C-17/C-18 is converted
stereochemical strain release-, was the key for
into the sp3 one, which will increase the ‘room’
the success of the chlorophyll-a total synthesis.
spaciousness. In other words, the sp3-
He did a total synthesis of the chlorophyll-a
hybridized system is thermodinamically more
using 55 reaction steps, helped by 17 research
stable than the sp2 one; therefore, selective
assistants, and needed 4 years to complete his
hydrogenation at position C-17/C-18 will be
synthesis. He was awarded a Nobel Prize in
favoured by this sterical strain effect which is
Chemistry at 1965.
due to substituents interactions at C-15, C-13,
and C-17 (Scheme-1). With this conversion At certain step within the synthesis process,
from sp2-hybridized system into the sp3 one, chemists frequently faces constraint, that
those substituents at C-13, C-15, and C-17 will chemical reaction does not work properly. In
be pisitioning at above and below of the that case, a smart innovation is indeed needed
porphyrinic plane, and therefore the geometric to overcome the problem. A total synthesis of
structure of the porphyrin ring system backs to Vitamine B-12 by Woodward and Eschenmoser
flat (planar) again. Such a geometric structure (Eschenmoser 1974 op cit Fuhrhop and
is indeed possesed by the chlorophyll-a, and Penzlin, 1984), is a good example on how to
Woodward has found its synthesis design based overcome such constraint; and how does
on this facts (Fuhrhop and Penzlin, 1984). Acid Woodward overcome it by developing a new
catalyzed intramolecular reaction between theory on Conservation of Orbital Symmetry
olefinic double bond of the acrylate side chain
AcHN AcHN
A B A B
N N N N
H H+
H H
H
N N N N
H+ D C H D C
17 15 13 15
17 13
CO2CH3 + CO2CH3
H
H H H
CO2CH3 CO2CH3
CO2CH3 CO2CH3
- H+
AcHN
A B
N N
H
Chlorophyll-a H
N N
H D C
17 15 13
CO2 CH3
H
CO2CH3
CO2 CH3
founded by him and his colleague, Rould During that time, Woodward and his colleague:
Hoffmann. Roald Hoffmann founded a rule concerning
conservation of orbital symmetry. Later on, this
Problem faced by Woodward and Eschenmoser
new rule is known as a Woodward Hoffmann
was their failure to use sulfide coupling
Rule (WHR). The WHR has been developed,
reaction or enamine to connect directly the ring
and proven to be a useful rule for synthesis
A and D at C-1 (Scheme-3), in order to
catalyzed by light. Thus, based on the WHR
construct cobyric acid ring structure (a
Eschenmoser has been able to directly
vitamine B-12 nuclei)(Fuhrhop and Penzlin,
connecting the ring-A and D using
1984). Such an unresolved-problem has forced
photochemical approach. He has irradiated an
the collaborative reasearch to get stuck for a
intermediate compound of tetracyclic-cadmium
long while.
complex (Scheme-4).
This irradiation was successfully connecting As stated before, the complexity of the target
the ring-A and D at C-1, and forming a right molecule frequently becomes a serious problem
configuration of cobyric acid nuclei with 95% faced by most organic chemists. One of the
stereoselectivity (Ollis, 1980). The molecule complexity is the present of stereo
photosynthesis mechanisms proceeded within centers or chiral centers within the target
two step of reactions (Scheme-4). First, by molecule. A target molecule which consists of
influence of light, an antarafacial hydrogen two chiral centers for example, will give 22 = 4
shift from C-19 to C-1’ was occured (this mixture of isomeric products (March, 1985);
reaction known as sigmatropic 18-electron the more chiral centers present within the target
rearrangement). Secondly, a conrotatory molecule, the more isomer products will be
thermally allowed cyclization of the produced. Since only one isomer of target
intermediate 16-π-electron mesoionic occured molecule is needed, separation of these isomers
(Eschenmoser, 1974; Pfaltz, 1977 op cit. must be done. Again the more chiral centers
Fuhrhop and Penzlin, 1984). The succeed of present within the target products, the more
Eschenmoser has paved the way to continue the isomers will be resulted, and in turn the more
collaborative research between Woodward and tedious separation and purification of so many
Eschenmoser to synthesize the vitamine B-12. isomeric mixtures must be carried out. Corey
Finally, on February 12, 1972, the synthesis of overcome this problem by developing a
vitamine B-12 has been completed. This stereospecific synthesis reaction.
collaborative research took 11 years, involving The synthesis of erythronolide-A (an aglycone
99 research assitants from 19 countries. part of erythromycin-A) carried out by Corey is
Retrosynthesis Analysis and Stereospecific a good example of the usage of stereospecific
Reaction: The Case of Erythronolide-A reaction for synthesis of target molecule having
Synthesis a lot of chiral centers. Erythronolide-A has 10
In the decade of 1970s, method for synthesis chiral centers, with absolute configuration of
design was founded, developed, and 2R,3S,4S,5R,6R,8R,10R,11R,12S,13R
standardized by Prof. Dr. James Elias Corey of (Scheme-5)(Corcoran, 1981; Nakagawa and
the Harvard University. The method was Omura, 1984). If the synthesis of that
known as retrosynthesis analysis or antithesis compound was carried out without
analysis. Basically, the retrosynthesis analysis stereochemical consideration, it would give
is an analytical work on paper, i.e., a paper 1024 isomer products, (210 = 1024). Out of
chemistry. It is involving stepwise ‘bond 1024 isomers, only one isomer is desired, i.e.,
disconnections’ within the target molecule until the one that has an absolute configuration of
starting material/s is/are founded. This method 2R,3S,4S,5R,6R,8R,10R,11R,12S,13R. To
was further developed by Dr. Stuart Warren of isolate one of desired isomer out of 1024 ones,
Cambridge University, and it is then known as is a mission impossible. Therefore, Corey was
the disconnection approach. carrying out a total synthesis of the
erythronolide-A using stereospecific reaction
Based on retrosynthesis consideration, Corey
approach.
has successfully synthesized more than 100
complex molecules of natural product. Among Retrosynthesis analysis of erythronolide-A
them are giberellic acid, picrotoxins, resulted starting materials of fragment-A and
erythronolide-A, and erythronolide-B. This fragment-B (Corey et al., 1978a; Corey et al.,
retrosynthesis analysis method has made 1978b, Corey et al., 1979; Schomburg et al.,
organic chemists easier in preparing the blue- 1980)(Scheme-5). Corey used these fragments
print for their synthesis; and because of this as starting materials for total stereospecific
method, synthesis of complex natural products synthesis of the erythronolide-A. The fragment-
has rapidly developed in the last two decades. A was an hepten-2-iodide derivative,
His success in developing retrosynthesis potentially consisted of 10 carbon atoms, i.e.,
analysis method, and its positive impact to the C-10, C-11, C-12, C-13, C-14, and C-15 of the
industrial world, Corey was awarded Nobel erythronolide-A ring to be constructed. The
prize in chemistry in 1990. potentially carbon atoms of C-12 dan C-13
have already had desired absolute
configuration. The fragment-B was hexano-
CO2CH3 CO2CH3
1'
CO2CH3
CN H H H2C
1
A19 H D H
N N
Cd
N N
H B C CO2CH3
H
CO2CH3
CO2CH3
CO2CH3 CO2CH3
1'
CO2CH3
CN H H H3C
..
A19 + 1 D H
N N
Cd
N N
antarafacial C
Cyclization H B CO2CH3
H
CO2CH3 CO2CH3
CO2CH3
1'
CO2CH3 CO2CH3
CN H H H3C
19 1
A D H
N N
Cd
N N
H B C CO2CH3
H Cobyric Acid
Deriv ativ e
CO2CH3
CO2CH3
Scheme-4: Cyclization to form cobyric ring is possible, based on the Woodward-Hoffmann Rule
(WHR)
lactone derivative with thioester chain, and already been built at such, so that they have
potentially consisted of carbon atoms of C-1, also had desired absolute configuration.
C-2, C-3, C-4, C-5, C-6, C-7, C-8, and C-9 of Stereospecific reaction between the fragment-A
the erythronolide ring to be built. The potential and fragment-B was proceeding via Grignard
carbon atom of C-2, C-3, C-5, and C-8 have modification, and then it was followed by 22
O
OBz
9 8 I
10
10
BzO 4 3
5 2
11 7
HO OH OH 11 6 1
12 6
MTMO 12
+ O
13 5 13
O
14 O 4 OH 14
OTBDMS O
1 3
15 2
15
O OH 7 8
9 S N
Fragment-A
Erythronolide-A MTM: Methylthiomethyl Fragment-B
10 C-Chiral Atoms TBDMS: tert-Butyldimetihylsilyl
further steps, to get an erythronolide-A with Corcoran, J.W., 1981, Biochemical Mechanism in
natural absolute configuration. the Biosynthesis of Erythromycins in Antibiotics
Vol.IV: Biosynthesis, Corcoran J.W.(Ed), Springer-
Concluding Remarks Verlag, Berlin-New York, 132-174.
Organic synthesis chemistry is basically a kind
Corey, E.J. and Cheng, X.M., 1989, The Logic of
of chemical sciences as well as a chemical
Chemical Synthesis, John Wiley & Sons, New
method for construction organic molecules, York-Singapore, 1-3.
using simpler molecule/s as starting materials.
Corey, E.J.; P.B. Hopkins; S. Kim; S.-e. Yoo; K.P.
The aim of organic synthesis activities can be Nambiar; and J.R. Falck, 1979, J. Am. Chem. Soc.,
directed to construct totally new molecules, or 101, 7131.
to make natural molecules. Total synthesis of
Corey, E.J.; S. Kim; S.-e. Yoo; K.C. Nicolaou; and
natural molecules having complex structure, L.S. Melvin, Jr.; D.J. Brunelle; J.R. Falck; E.J.
such as the chlorophyll-a and vitamine B-12, Trybulski; R. Lett; and P.W. Sheldrake, 1978b, J.
could only be carried out just for academic or Am. Chem. Soc., 100, 4620.
scientific purposes, i.e., to confirm their
Corey, E.J.; E.J. Trybulski; L.S. Melvin, Jr.; K.C.
chemical structures.
Nicolaou; J.A. Secrist; R. Lett; P.W. Sheldrake; J.R.
In molecular construction, the main problem of Falck; D.J. Brunelle; M.S. Haslanger; S. Kim; and
complexity of the target molecules, such as S.-e. Yoo, 1978a, J. Am. Chem. Soc., 100, 4618.
molecular size and functional groups can be Fuhrhop, J. and G. Penzlin, 1984, Chlorophyll a, -
overcome by accurate observation and Comprehension of Structural Features and
calculation of physicochemical nature of the Synthesis; Corrins; and Macrolides in Organic
target molecules, especially their geometric Synthesis. Concepts, Methods, Starting
structure, as already done by Woodward in the Materials, Verlag Chemie, 233-235; 235-238; dan
synthesis of chlorophyll-a. Whereas problems 290-291.
on cyclic connectivity and the present of March, J., 1985, Stereochemistry dalam Advanced
chiral centers within the target molecules, can Organic Chemistry. Reactions, mechanisms, and
be overcome by using specific photo-reaction Structures, John Wiley & Sons, New York-
based on, for example the Woodward Hoffmann Singapore, 82-130.
Rule, as done by Woodward and Eschenmoser Nakagawa, A. and S. Omura, 1984, Structure and
in the synthesis of vitamine B-12; or by using Stereochemistry of Macrolides in Macrolide
chemo and regioselective reactions carried out Antibiotics. Chemistry, Biology and Practice,
by Corey in the total synthesis of the S.Omura (Ed), Academic Press, Inc., Orlando-
erythronolide-A. Tokyo, 37-84.
References Ollis, W.D., 1980, Robert Burns Woodward, - an
Conforth, J.W., 1994, The Trouble with Synthesis, Appreciation, Angew. Chem., 210-215.
Aldrichimica Acta, 27(3), 71-77.
Schomburg, D.; P.B. Hopkins; W.N. Lipscomb; and Woodward, R.B., 1956, Perspective in Organic
E.J. Corey, 1980, J. Org. Chem., 45, 1544. Chemistry, A.R. Todd (Ed), Interscience, New
York, 155-184.
Streitwieser, A. and C.H. Heathcock, 1976,
Introduction to Organic Chemistry, Macmillan Woodward, R.B., 1960, Totalsynthese des
Publishing Co. Inc., New York. Chlorophylls, Angew. Chem., 72, 651-662.
Unang Supratman,1) Tri Mayanti,1) Tati Herlina,1) Euis Julaeha,1) Nurlelasari,1) Desi
Harneti,1) and Hideo Hayashi2)
1)
Department of Chemistry, Faculty of Mathematics and Natural Sciences, Padjadjaran University,
Jatinangor, Sumedang 40600
Corresponding author. Tel: 62-22-7794391; Fax: 62-22-7794391
E-mail: unang04@hotmail.com
2)
Division of Applied Biological Chemistry, Graduate School of Agriculture and Life Science, Osaka
Prefecture University, Sakai, Osaka 599-8431, Japan
Abstract
During the random screening of Indonesian plants for insecticidal compounds, Kalanchoe
pinnata and K. daigremontiana were found to show a potent insecticidal activity against the
third larvae of silkworm (Bombyx mori).
K. pinnata leaves were shown to produce a new insecticidal bufadienolide, bryophyllin C, and
a known bufadienolide, bryophyllin A, together with an inactive bersaldegenin-3-acetate,
meanwhile a new insecticidal bufadienolide, methyl daigremonate and three known
bufadienolides, bersaldegenin-1,3,5-orthoacetate, daigremontianin, and bersaldegenin-1-
acetate were isolated from the leaves of K. daigremontiana.
In order to clarify the functional groups responsible for the insecticidal activity, two α-
pyrone opening derivatives were prepared and their insecticidal activity was compared with
those of other bufadienolides. As a result, both the orthoacetate and α-pyrone moiety seemed
to be essential structural elements for exhibiting a potent insecticidal activity. In addition,
oxygenated substituents at C-11 and C-12 in ring C enhanced the insecticidal activity.
Keywords: Kalanchoe; Crassulaceae; Bufadienolide; Bryophyllin; Insecticidal activity
ocurring bufadienolide orthoacetates. Tetrahedron Supratman, U., Fujita, T., Akiyama, K., and
Lett., 20, 1709-1712 Hayashi, H., 2000. New insecticidal bufadienolide,
bryophyllin C, from Kalanchoe pinnata. Biosci.
Kupchan, S., Hemingway, R.J., and Hemingway,
Biotechnol. Biochem. 64, 1309-1311.
J.C.,1969. Tumor inhibitor XLIV. The isolation and
characterization of hellebrigenin-3-acetate and Supratman, U., Fujita, T., Akiyama, K., and
hellebregenin-3,5-diacetate, bufadienolide tumor Hayashi, H., 2001. Insecticidal compounds from
inhibitors from Bersama abyssinica, J. Org. Chem., Kalanchoe daigremontiana. Phytochemistry, 58,
12, 3894-3898. 311-314.
Appendix
O O
O O
R3
CH3 CH3
R2 H R1 H
R1 H CHO H
O
O H OH H OH
O
R2
1. R1=CHO, R2=OH, R3=H2 3. R1=OH, R2=OAc
2. R1=CH2OH, R2=OH, R3=H2 7. R1=OAc, R2=OH
4. R1=CHO, R2=OH, R3=O
5. R1=CHO, R2=H, R3=H2
OH O
HO
OCH3
CHO H
O O
O H
O
6.
O
O
O
H
CH3 HO
HO OCH3
H CHO H
2% NaOH-MeOH
CHO H
30 min, RT O O
O H
O O
O H OH
O (8)
O
(1) O
O
H
CH3
OCH3
H CHO H
2% NaOH-MeOH
CHO H
30 min, RT O O
O H
O O
O H OH
O
(5) (9)
Abstrak
Termodinamika merupakan ilmu yang merambah semua bentuk sistem di alam. Saat ini
termodinamika berkembang bukan hanya di ranah keadaan setimbang, tetapi juga di daerah
tak setimbang yang melibatkan proses-proses tak reversibel. Untuk itu akan dibahas bentuk
termodinamika di tiga ranah keadaan, yaitu: keadaan setimbang, keadaan dekat setimbang
dan keadaan jauh dari setimbang, yang masing-masing memiliki ciri dan perilaku tersendiri.
Sejalan dengan itu berkembang pula pendekatan molekular pada keadaan setimbang, dekat
setimbang dan jauh dari setimbang. Bila ranah setimbang telah sepenuhnya difahami, maka
ranah dekat setimbang, yang secara nyata menggambarkan proses-proses yang berlangsung
di alam, mulai difahami pada tataran fenomenologi maupun molekular. Sebaliknya, keadaan
jauh dari setimbang masih merupakan tantangan besar, meskipun saat ini tampak
perkembangan yang menarik. Berbeda dengan keadaan dekat setimbang yang dapat
dikembalikan ke keadaan setimbang, sistem pada keadaan jauh dari setimbang tidak selalu
dapat dikembalikan ke keadaan setimbang. Sistem semacam itu dxapat secara spontan
berubah menghasilkan struktur baru yang belum ada sebelumny dan tidak diramal
sebelumnya, melalui proses yang dikenal sebagai self organization. Melalui konsep ini, yang
dipelajari pada sistem-sistem terbuka, termodinamika mulai merambah berbagai sistem,
antara lain: sistem biologi, sistem informasi dan sistem sosial. Akan dibahas apa yang harus
dilakukan pada sistem perkuliahan kimia agar dapat mengantisipasi perkembangan ini di
masa depan.
∆U = δ (1)U + δ (2 )U + ... s = R ln ⎢⎜ 2 ⎟ ⎥
⎢⎣⎝ h ⎠ N A ⎥⎦
dengan N A bilangan Avogadro, sesuatu yang Apabila produksi entropi sistem dinyatakan
tak mungkin diperoleh dari termodinamika sebagai
klasik. Dengan kedua pengembangan yang
di S = ∫ σ dV
parallel ini, terbentuklah kaitan antara
gambaran mikroskopik dengan sifat dengan σ produksi entropi per satuan waktu
makroskopik.
per satuan volum, maka berdasar Hukum
Ranah Keadaan dekat Setimbang. Kedua haruslah
Ciri utama sistem termodinamika yang tak
σ ≥0
setimbang adalah adanya ketidak-seragaman
atau ketidak-homogenan harga besaran Dalam hal inilah termodinamika ranah dekat
intensifnya. Dengan kata lain, di dalam sistem setimbang lebih maju dari termodinamika
akan ada gradien harga besaran intensif, setimbang, karena memberi rumusan bagi
seperti: suhu, kerapatan, tekanan atau potensial produksi entropi per satuan waktu per satuan
kimia. Sebagai akibat adanya berbagai gradien volum, yang diungkapkan terhadap fluks dan
ini, yang juga disebut sebagai gaya gaya yang ada pada sistem dalam bentuk
termodinamika, di dalam sistem akan didapati
berbagai aliran atau fluks yang sehubungan σ = ∑ JjXj
j
dengan gradien tertentu. Gradien suhu akan
menghasilkan aliran atau fluks energi, gradien Fluks hanya terjadi apabila ada gaya di dalam
konsentrasi atau potensial kimia akan sistem, sehingga fluks merupakan fungsi dari
menghasilkan aliran zat atau diffusi, sedangkan gaya-gaya tersebut. Dalam ranah dekat
gradien kerapatan momentum menghasilkan setimbang, dapat digunakan bentuk kefungsian
aliran viskose. Keadaan sistem semacam ini yang paling sederhana yaitu bentuk linear.
bertolak belakang dengan persyaratan bagi Untuk itu persamaan bagi fluks adalah
berlakunya termodinamika klasik, yaitu
keseragaman harga variabel intensif. Ini berarti J j = ∑ L jk X k
k
hasil-hasil termodinamika klasik tidak dapat
digunakan untuk memahami sistem tidak dengan L jk adalah koeffisien fenomenologi,
setimbang, sehingga perlu dikembangkan yang memberikan sumbangan gaya X k pada
secara tersendiri termodinamika tidak
fluks J j . Menggunakan bentuk ini, produksi
setimbang atau termodinamika tak reversibel.
entropi menjadi bentuk kuadrat dalam gaya-
Analisis sistem tak setimbang didasarkan atas gaya, yang harganya harus selalu positif
perubahan entropi sistem, dS , yang dalam hal berdasar Hukum Kedua
ini terbagi menjadi dua sumbangan
dS = de S + di S
σ = ∑∑ L jk X j X k > 0
j k
dengan de S adalah pertukaran entropi antara Secara matematik, kepastian positif ini
sistem dengan lingkungan atau alam sekitarnya, terpenuhi apabila koeffisien fenomenologi yang
sedangkan di S adalah produksi entropi di diagonal berharga positif, yaitu L jj > 0 . Yang
dalam sistem sebagai akibat proses-proses tak terakhir ini berakibat bahwa beberapa
reversibel. Berdasarkan Hukum Kedua harus koeffisisen transport, seperti koeffisien
berlaku hantaran kalor λ serta koeffisien diffusi D
( di S ) ≥ 0 harus berharga positif, sesuai dengan
pengamatan.
sedangkan de S dapat positif atau negatif Ada dua hal penting lain yang menyangkut
bergantung besar aliran antropi masuk atau produksi entropi ini. Yang pertama
keluar sistem. Bagi sistem tersekat tidak ada menyangkut koeffisien-koeffisien
antaraksi entropi dengan sekiranya, de S = 0 , fenomenologi yang luar diagonal L jk . Untuk
sehingga ini Onsager menunjukkan bahwa dengan
( dS )E ≥ 0 pemilihan gaya dan fluks yang tepat koeffisien
yang menghilangkan keadaan sebelumnya yang Berbagai struktur baru, baik dalam lingkup
simetrik. Karena itu gejala ini disebut pula waktu maupun ruang, yang dihasilkan oleh
sebagai proses perusakan simetri (symetry pengorganisasian diri terjadi dalam sistem
breaking process). terbuka. Kelangsungan struktur tersebut
memerlukan keterbukaan sistem, yang
Beberapa contoh pengorganisasian diri dapat
mengambil sebagai masukan zat-zat dengan
diambil dari perubahan cuaca yang
kadar energi tinggi tetapi entropi rendah, dan
menimbulkan tornado di Amerika. Pertemuan
mengubahnya menjadi zat berkadar energi
udara dingin dari utara dengan udara panas dari
rendah tetapi entropi tinggi yang dilepas ke
selatan membuat menjadi udara menjadi sistem
lingkungan sekitarnya. Dengan demikian
yang sangat menyimpang dari kesetimbangan.
terjadi proses dissipasi energi, sehingga bentuk-
Sistem mereaksi dengan membentuk struktur
bentuk tersebut kemudian disebut oleh
baru, suatu vorteks udara dengan kekuatan
Prigogine sebagai bentuk dissipatif
tinggi yang dikenal sebagai tornado. Udara
(dissipative structure). Makhluk hidup adalah
yang sebelumnya tidak berstruktur sekarang
salah satu contoh bentuk dissipatif!
dibentuk menjadi putaran gas. Contoh lain
adalah gejala effek Benard, yang terjadi Dengan mengambil contoh suatu sistem kimia
apabila suatu cairan diletakkan di antara dua terbuka yang di dalamnya dapat berlangsung
bidang parallel dengan bidang bawah berbagai reaksi, terdapat beberapa
dipanaskan. Apabila perbedaan suhu antara kemungkinan bentuk dissipatif yang dapat
bidang bawah dan atas diperbesar lebih lanjut, terjadi. Salah satunya adalah berlangsungnya
saat perbedaan itu melampaui batas tertentu reaksi ossilasi (oscillating reaction), suatu
akan diamati terjadinya bentuk-bentuk reaksi yang bermula dari pengamatan
geometri pada cairan. Bentuk-bentuk ini Bellousov dan Zabotinskii dan yang sekarang
dikenal sebagai sel Benard. sudah menjadi satu cabang sendiri dalam
termodinamika dan kinetika kimia. Proses
Sebagai hukum alam utama, Hukum Kedua
perusakan simetri dalam lingkup ruang telah
berlaku bagi semua sistem, termasuk sistem
pula diamati bagi sistem kimia, antara lain
biologi. Gejala pertumbuhan sel secara
terjadinya pola-pola Turing. Kedua contoh ini
perlahan menjadi tumbuhan dan mahluk yang
akan dibahas.
serba teratur, sehingga secara perlahan pula
berlangsung penurunan entropi yang seolah Suatu sistem reaksi kimia dapat dibuat jauh dari
tidak sejalan Hukum Kedua, kini dapat kesetimbangan apabila konsentrasi pereaksi
difahami melalui konsep pengorganisasian diri dan hasil reaksi dijaga tetap, dengan cara
Prigogine. Penurunan entropi ini diimbangi memasukkan pereaksi dan mengeluarkan hasil
dengan pelepasan entropi ke sekitarnya selama reaksi secara teratur. Agar terjadi bentuk
sel tersebut tumbuh, dengan mengubah dissipatif berupa reaksi osillasi, diperlukan
masukan energi dan massa menjadi entropi adanya tahap otokatalisis. Suatu model reaksi
yang dilepas ke luar. yang banyak dipelajari adalah model
“Brusselator”, yang rangkaian reaksinya seperti
Sejalan dengan itu otak pun merupakan sistem
berikut
termodinamika yang masukan dan keluarannya
adalah informasi, sehingga proses dalam otak A→X
pun dapat mengalami pengorganisasian diri, B+ X →Y + D
yang mungkin melatarbelakangi proses
kreatifitas. Bila otak dipenuhi berbagai 2 X + Y → 3X
informasi yang saling bertentangan sehingga X→E
mengalami ketidak seimbangan yang besar, dengan konsentrasi pereaksi-pereaksi A dan B
otak dapat keluar dengan konsep baru sama dijaga tetap. Reaksi ketiga adalah suatu reaksi
sekali, yang merupakan suatu keteraturan otokatalisis. Dengan menjadikan semua tetapan
(order) baru sebagai jalan keluar dari ketidak- laju berharga satu, laju perubahan konsentrasi
setimbangan. Otak yang tidak pernah zat-zat antara X dan Y adalah
didedahkan (exposed) pada tantangan
karenanya sulit untuk menjadi kreatif (dalam
konteks pengorganisasian diri).
dX dx ∂2 x
= A − BX + X 2 Y − X = ( B − 1)x + A2 y + Dx 2
dt dt ∂r
dY dy ∂ 2
y
= BX − X 2 Y = − Bx − A2 y + Dy 2
dt dt ∂r
yang menghasilkan konsentrasi steady state Titik steady state sekarang diganggu bukan
B hanya oleh gangguan dalam waktu tetapi juga
X ss = A dan Yss = . Apabila sistem bergerak
A gangguan dalam ruang, dengan akibat
sekitar steady state, konsentrasi kedua zat konsentrasi zat-zat antara menjadi fungsi
antara dapat dinyatakan sebagai periodik dari ruang. Bila zat-zat tersebut
X (t ) = Xss + x(t ) berwarna, akan terbentuk pola-pola konsentrik,
yang dikenal sebagai pola Turing. Apabila
Y (t ) = Yss + y(t ) ruang sebelumnya adalah simetrik, timbulnya
pola-pola ini merusak simetri, karenanya
yang pada linearisasi menghasilkan persamaan
bentuk dissipatif ini disebut sebagai perusakan
bagi perubahan x dan y dengan waktu
simetri (symmetry breaking).
dx Rekonstruksi molekular pada ranah non-linear
= ( B − 1)x + A2 y ≡ f ( x , y )
dt belum berkembang dengan baik, karena
dy sulitnya masalah persamaan differensial yang
= − Bx − A2 y ≡ g( x , y ) tak linear. Dalam teori kinetik gas, keadaan
dt
jauh setimbang ini didapat dengan mengambil
Matriks Jacobian persamaan ini adalah suku berikutnya dalam pendekatan
penyelesaian persamaan Boltzmann, yaitu
⎡ ∂f ∂f ⎤
⎢ ∂x ∂y ⎥ f = f (0) + ξ f (1) + ξ 2 f (0)
J=⎢ ⎥
⎢ ∂g ∂g ⎥ yang disebut sebagai pendekatan Burnett.
⎢ ⎥
⎣ ∂x ∂y ⎦ Beberapa penyelesaian dalam bentuk
penyederhanaan telah dilakukan, khususnya
sehingga Tr ( J ) = B − 1 − A2 dan Det( J ) = A2 . dalam masalah-masalah aliran jet dan rambatan
Kestabilan titik steady state bergantung harga supersonik, karena disitulah terjadi gradien-
Tr ( J ) , yang adalah harga konsentrasi awal gradien yang tajam dalam berbagai besaran
kedua pereaksi yang dibuat tetap. Titik akan intensif.
stabil apabila Tr ( J ) < 0 , di mana setiap Dalam usaha-usaha memperluas cakupan
gangguan akan kembali ke titik tersebut. termodinamika ke arah sistem-sistem tak
Mengikuti teori Poincare-Bendixon, gerak setimbang, baik yang dekat maupun yang jauh
osillasi terjadi apabila Tr ( J ) ≥ 0 , yang berarti dari kesetimbangan, banyak dijumpai gejala-
gejala yang tak dapat difahami melalui hukum-
konsentrasi pereaksi harus B ≥ 1 + A2 . Ini hukum termodinamika yang ada. Karena itu
berarti terbentuknya struktur dissipatif tidak
beberapa kalangan mulai melontarkan gagasan
cukup hanya membuat sistem jauh dari
tentang Hukum Termodinamika Keempat, yang
kesetimbangan, tetapi juga bergantung pada mencakup keadaan tak setimbang. Salah satu
pengaturan harga batas dari sistem
calon untuk itu adalah azas timbal-balik
bersangkutan (gambar 1).
Onsager. Calon lain adalah azas produksi
Dalam gambar 1, konsentrasi zat-zat dianggap entropi minimum. Namun hingga saat ini
homogen dalam sistem. Keadaan menjadi belum ada kata sepakat tentang masalah ini.
berbeda apabila konsentrasi zat tidak lagi
Implikasi terhadap Pengajaran
homogen, sehingga ada gradien konsentrasi
Termodinamika.
yang menimbulkan proses diffusi. Pada
persamaan bagi perubahan x dan y terhadap
waktu perlu ditambahkan perubahan sebagai
akibat diffusi, yaitu
B
daerah terjadi
osilasi
B = 1 + A2
Gambar 1
4. S.R. de Groot & P. Mazur, Non-Equillibrium 11. B.C. Eu, Kinetic Theory and Irreversible
Thermodynamics (North-Holland, Amsterdam, Thermodynamics (John Wiley, New York,
1969). 1992).
5. G. Nicolis, “Stability and Dissipative 12. Rebeka K. Adiwinata, “Landasan Kinetika
Structures in Open Systems Far from bagi Pengaruh Reaksi Kimia pada Koeffisien
Equillibrium” dalam Advances in Chemical Fenomenologi”, Tesis Magister, Program
Physics Vol. XIX (John Wiley, New York, Pasca Sarjana, ITB, 1993.
1971).
13. S. Imam Rahayu, ”Teori Antaraksi antara
6. I. Prigogine, Thermodynamics of Irreversible Reaksi Kimia dan Proses Diffusi dalam
Processes (John Wiley, New York, 1961) Campuran Gas-gas” (Lap. Penelitian no
11213191, ITB, 1995).
7. I. Prigogine, “Time, Structure and
Fluctuations”, Nobel Lecture, 1977. 14. I.G.M. Sanjaya, “Kontribusi Reaksi Kimia
dalam Teori Kinetik Gas”, Dissertasi, Program
8. P. Glendinning, Stability, Instability and
Pasca Sarjana, ITB, 2004.
Chaos (Cambridge Univ. Press, Cambridge,
1994). 15. R.J. Field & M. Burger, Oscillation and
Travelling Waves in Chemical Systems (John
9. S. Chapman & T.G. Cowling, Mathematical
Wiley, New York, 1985)
Theory of Non-Uniform Gases, 3rd Ed.
(Cambridge Univ. Press, Cambridge, 1970) 16. I.R. Epstein & J.A. Pojman, An Introduction to
Nonlinear Chemical Dynamics (Oxford Univ.
10. S. Imam Rahayu, Teori Kinetik Gas (Dirjen
Press, Oxford, 1998).
Pendidikan Tinggi, Jakarta, 2001)
Bambang Ariwahjoedi
Abstrak
Perilaku mesofasa karbon pada gegala diperrumit oleh adanya kereaktifan kimia pada
temperatur pengamatan serta oleh lebarnya rentang dari struktur molekul spesi-spesi yang
berada dalam sistem gegala itu. Sementara kompleksitas ini menyarankan penggunaan
aluran transformasi waktu/tempartur, pertimbangan perilaku fasa hipotetis dari gegala yang
mengandaikan tidak adanya perubahan komposisi keseluruhan dengan waktu telah cukup
membantu dalam interpretasi gejala termal yang diamati. Dalam makalah ini diusulkan dan
dijelaskan konstruksi suatu diagram fasa yang dapat secara lebih umum dipakai dalam
interpretasi maupun prediksi peralihan mesomorfik dalam sistem gegala karbon.
dua molekul pada semua koordinat molekul. ln (1 - xI) = ln(1 - xN) - [ε / 2kBT] (xN P2,N')2 (6)
Hubungan antara sumbu panjang (molekul
berbentuk batangan) dan sumbu optik mesofasa ln xI = ln xN - [ε / 2kBT] (xN P2,N')2 - ln ZN (7)
diberikan pada Gamb. 5. Energi potensial Kedua persamaan terakhir pada keadan "semu"
anisotropik semu bagi molekul mesogen setimbang akan memberikan syarat
tunggal dinyatakan sebagai
ln [1 + xN(1/ZN - 1)] = [ε / 2kBT] (xN P2,N')2 (8)
Um(θ) = x ε P2' P2 (cos θ) (1)
Dengan menyelesaikan persamaan serentak
dengan θ sudut antara sumbu panjang molekul tak-linier (3 dan 8) bagi P2,N' dan xN, dan
dengan sumbu optik mesofasa, x fraksi mol menyulih kedua besaran terakhir ke dalam Pers.
mesogen, P2' parameter keteraturan orientasi (6 dan 7) dapat diperoleh xI. xI dan xN
jarak jauh, ε parameter energi potensial kemudian dapat dialurkan dalam suatu diagram
anisotropi menurut teori Maier-Saupe [7] yang fasa (Gamb. 6).
kaitannya dengan suhu peralihan fasa kristal 3. Hasil dan Pembahasan
cair murni TNI dapat dinyatakan sebagai Diagram fasa hasil percobaan yang dilaporkan
ε = -4,541 kB TNI oleh Mochida dan Korai [6] dan diagram fasa
hasil kalkulasi berdasarkan Teori Medan
P2 adalah fungsi Legendre jenis kedua yang di Molekular Kristal Cair oleh Shishido dkk.[7]
dalam konteks ini dapat dinyatakan sebagai diberikan pada Gamb. 7. Karena diagram fasa
P2 = [(3θ2 - 1)/4] ln [(1 + θ) / (1 - θ)] - 3θ/2 (2) hasil eksperimen dinyatakan sebagai fraksi
P2' pada Pers. (1) dinyatakan dengan integral berat dari fraksi tak-larut benzena di dalam
π/2
gegala mesofasa, maka secara perhitungan
telah diasumsikan bahwa berat molekul dari
P2' = ∫ P2 (cos θ) exp[-Um(θ)/kBT] sin(θ) dθ/Z (3)
fraksi larut benzena dan fraksi tak-larut
0 benzena adalah identik.
dengan Z fungsi partisi orientasi molekul Pada perbandingan diagram fasa hasil
mesogen bentuk batangan yang dinyatakan percobaan dan hasil kalkulasi pada Gamb. 7,
melalui integral yang nampak bahwa di antara kedua garis
π/2 peralihan fasa yang dimulai dari sekitar 720 K
Z = ∫ exp[-Um(θ) / kBT] sin(θ) dθ (4) pada 100%-brt fraksi tak-larut benzena, fasa
nematik dan fasa isotropik berada bersama-
0
sama dala kesetimbangan semu. Meskipun
dengan kB tetapan Boltzmann dan T suhu hasil perhitungan memperlihatkan
Kelvin. Batas integrasi diambil 0 sampai π/2 kecenderungan yang mirip dengan
karena molekul mesogen tidak terdiri dari kecenderungan yang diamati pada perilaku
gugus kepala dan ekor yang berbeda sehingga peralihan fasa gegala mesofasa ini, nampak
sin (θ) = -sin (π - θ). penyimpangannya masih cukup besar. Pada
suhu yang sama, komposisi dapat menyimpang
Karena volum pencampuran kecil maka
hingga 30%-brt (perbedaan hampir 100%),
perubahan volum cairan/lelehan dapat
sementara pada komposisi yang sama, suhu
diabaikan, sehingga energi bebas Gibbs (G)
dapat meleset sampai 130 K (perbedaan lebih
dapat dianggap sama dengan energi bebas
dari 20%).
Helmholtz (A). Pada kesetimbangan fasa
isotropik dan nematik berlaku kondisi 4. Catatan Penutup dan Saran-saran
Dari kajian yang dilakukan dan dilaporkan
µ1,I = µ1,N dan µ2,I = µ2,N (5) pada makalah ini, dapat disimpulkan bahwa:
dengan subskrip 1 dan 2 menyatakan berturut- Meskipun perlakuan secara pendekatan Teori
turut molekul-molekul mesogen dan Medan Molekular dari campuran mesogen-
nonmesogen, dan I dan N menyatakan berturut- nonmesogen dapat sedikit banyak dipakai
turut fasa-fasa Isotropik dan Nematik. Melalui untuk menjelaskan diagram fasa dari gegala
hubungan termodinamik antara fungsi partisi Z mesofasa, namun pendekatan ini masih
dan fungsi Helmholtz A, dapat dituliskan memerlukan banyak pengetatan anggapan-
persamaan (6 dan 7) berikut
anggapan yang telah diambil secara longgar di sebagaimana telah disebutkan di depan bahwa
dalam kalkulasi. sistem gegala mesophasa adalah sistem yang
cukup reaktif pada suhu lunak hingga lelehnya.
Beberapa anggapan yang ditarik secara longgar
dan perlu pengetatan antara lain: Terakhir, sebagai pembanding yang shahih
diperlukan diagram fasa sistem mesofasa
Andaian molekul bentuk batangan sangat
karbon hasil eksperimen yang pengukurannya
berbeda dari kenyataan yang dihadapi pada
lebih akurat dan presisi. Kebanyakan diagram
mesofasa karbon di mana molekul berbentuk
fasa yang dilaporkan di literatur, termasuk dari
lempengan/cakram diskotik.
Mochida dan Korai [6] adalah hasil mikroskopi
Mengingat molekul cakram orientasinya dapat cahaya terpolarisasi, yang hasilnya sangat
dinyatakan oleh arah vektor satuan tegak lurus mengandalkan pada citra hasil refleksi
bidang molekularnya, maka sudut θ tidak permukaan, bukan mewakili fasa utuh
diukur terhadap sumbu panjang molekul lagi, (ruah)nya.
melainkan terhadap vektor satuan arah
molekul.
Berbagai faktor perbaikan terhadap berbagai
Dalam sistem mesofasa karbon hampir tak asumsi dalam perhitungan teoritik sebagaimana
pernah dijumpai molekul sferis, melainkan tersebut di atas, tengah diimplementasi dalam
nonmesogen berupa molekul aromatik berat pekerjaan pemodelan komputasional yang
molekul rendah ataupun molekul alisiklik berat tengah ditangani dalam kelompok penulis.
molekul rendah. Hasil implementasi diharapkan akan dapat
Anggapan bahwa gegala mesophasa hanya dipublikasikan mendatang, pada kesempatan
merupakan campuran biner dari mesogen dan event maupun media ilmiah yang lain.
mesogen perlu diperketat dengan adanya Daftar Lambang
komponen ketiga yang senantiasa berreaksi G energi bebas Gibbs
secara kimia dan beralih dari nonmesogen ke A energi bebas Helmholtz
mesogen.
kB tetapan Boltzmann
Mengingat sistem mesofasa karbon yang jauh P2 fungsi Legendre jenis kedua
dari kondisi ideal (sangat interaktif) maka
P2' parameter keteraturan orientasi
anggapan bahwa energi bebas Gibbs identik
dengan energi bebas Helmholtz perlu dikritisi. T suhu Kelvin
Konsekuensi dari kegagalan asumsi ini TNI suhu peralihan nematik-isotropik
mengakibatkan bahwa Pers. (6 dan 7) harus
Um(θ) potensial anisotropik semu
dirombak.
x fraksi mol mesogen
Asumsi keadaan setimbang pada sistem gegala
mesofasa yang kenyataannya senantiasa reaktif Z fungsi partisi orientasi
hingga akhir pembentukan kokas, perlu ε parameter energi
diperbaiki dengan faktor kereaktifan kimia µ potensial kimia
dalam komputasi yang lebih kaku lagi.
Asumsi bahwa berat molekul fraksi larut 5.Ucapan Terimakasih
benzena yang identik dengan fraksi yang tak- Penulis berterimakasih kepada para ex-
larut benzena, adalah sangat tidak benar, mahasiwa bimbingan tugas akhir dalam
mengingat cincin aromatik terkondensasi pada Kelompok Material Karbon & Grafit yaitu
molekul mesofasa yang tak-larut benzena dapat Sdr.Gunawan,SSi. yang telah menyiapkan ter
berjumlah puluhan kali lebih banyak dari pada dan mengkarakterisasi gegala dari batubara
jumlah cincin terkondensasi dari molekul fraksi Bukit Asam dan Sdr.Wildan Usman
larut benzena. Data GPC pada kedua fraksi ini Mihardja,SSi. yang telah mengkonversi dan
yang banyak dijumpai di literatur dapat dirujuk mengkarakterisasi gegala residu minyak bumi
[10]. Ashland Aerocarb-240.
Secara mendasar anggapan bahwa pada
kesetimbangan fasa seluruh komponen di kedua
fasa adalah sama, agak kurang tepat mengingat
6. Daftar Pustaka karbon [dari J.E. Zimmer & J.L. White , Adv.
1. J.D. Brooks & G.H. Taylor, Nature, vol. 697, hal. Liq. Cryst. vol. 5 hal. 157, (1982)]
206 (1965)
Gambar 2. (A) Mikrograf cahaya terpolarisasi
2. B. Ariwahjoedi, Tesis PhD., Universitas yang menunjukkan perkembangan
Sheffield, UK, hal. 264 (1991). pembentukan mesofasa karbon selama pirolisis
3. B. Ariwahjoedi & B. Rand, di dalam Ext. Abstr. fasa cair gegala antara 400 hingga 500oC[dari
19th Bienn. Conf. on Carbon, Amer. Carbon Soc., G. Savage, Carbon-Carbon Composites,
The Penn. State Univ., Univ. Park, USA, June 25- Chapman & Hall, London, hal.169, (1993) (B)
30, (1989). Dua macam simetri kristal pada sferula
4. B. Ariwahjoedi & B. Rand, di dalam Ext. Abstr., mesofasa karbon [dari Acuan (9)].
Carbone '90, International Carbon Conference,
Gambar 3. (A dan B) Anisotropi pada
Groupe Francais D'Etude Des Carbones, Paris,
France, July 16-20, (1990).
koaservat lio/hidrotropik dan (C) Skema
pembentukan tetesan nematik pada mesofasa
5. R.J. Diefendorf, di dalam Ext. Abstract, 16th karbon ternitrasi/tersulfonasi (D) Pengaruh
Bienn. Conf. on Carbon, hal. 26, (1983). perputaran tatakan sampel mikroskop terhadap
6. I. Mochida & Y. Korai, J. Fuel Soc. Jap., vol. 64, pola salip Maltese[dari Acuan (2)].
hal. 796, (1985).
Gambar 4. Diagram fasa sistem mesogen dan
7. M. Shishido, H. Inomata, K. Arai & S. Saito, non-mesogen dengan (A) struktur molekul
Carbon, vol. 35 [6], hal. 797, (1997). yang mirip (B) struktur molekul yang berbeda
8. R.L. Humphries & G.R. Luckhurst, Proc. Roy. [dari Acuan (5)]
Soc. Lond. A., vol. 352, hal. 41, (1976). Gambar 5. Konfigurasi molekul mesogen
9. R. Hurt, G. Krammer, G. Crawford, K. Jian & C. terhadap sumbu optik dari mesofasa kristal cair.
Rulison, Chem. Mater., Vol. 14, hal. 4558, (2002).
Gambar 6. Skema tipikal diagram fasa gegala
10. W.C. Stevens & R.J. Diefendorf, di dalam mesofasa karbon.
Carbon '86, International Conference on Carbon,
Deuts. Keram. Gess. E.V., Baden-baden, 30 June-4 Gambar 7. Perbandingan diagram fasa hasil
July 1986, hal.199, (1986). kalkulasi teoritis dengan diagram fasa hasil
percobaan [dari Acuan (7)].
Keterangan Gambar-gambar:
Gambar 1. Representasi skematik dari
susunan molekul dalam gegala mesofasa
Abstrak
Senyawa TNTA (1,3,5-triazido-2,4,6-trinitrobenzena) merupakan salah satu material yang
bersifat sangat eksplosif. Reaksi penguraiannya berlangsung sangat cepat dan menghasilkan
produk akhir berupa karbon monoksida (CO) dan nitrogen (N2). Telah dilakukan studi kimia
kuantum terhadap mekanisme reaksi pirolisis (Z)-1-azido-2-nitroetena dan 2-nitrofenil azida
yang digunakan sebagai model reaksi pirolisis TNTA. Salah satu tahap awal reaksi berupa
pembentukan struktur lingkar lewat pelepasan N2. Optimasi geometri, serta perhitungan
frekuensi dan energi dilakukan awalnya pada tingkat teori Hartree-Fock (HF) dan Becke3-
Lee-Yang-Parr (B3LYP) dengan menggunakan himpunan basis 6-31G(d), dan dilanjutkan
dengan tingkat teori yang lebih tinggi. Untuk tahap pembentukan lingkar dan N2, digunakan
hipotesis dua macam mekanisme reaksi, yaitu reaksi pertahap, yang melibatkan dua keadaan
transisi (TS1 dan TS2) dan satu senyawa antara cis-I1, dan reaksi serempak, yang hanya
melibatkan satu keadaan transisi TS3. TS1 dan TS3 berhasil diperoleh pada keadaan singlet,
sedangkan TS2 dan cis-I1 berhasil diperoleh pada keadaan triplet. Perhitungan tetapan laju
(k) tahap tersebut menghasilkan nilai sekitar 18 × 10-4 s-1. Penggunaan 2-nitrofenil azida
dipilih untuk melihat pengaruh lingkar aromatik terhadap reaksi yang terjadi. Seperti telah
diduga, walaupun diamati adanya pengaruh aromatik, tetapi pengaruhnya tidak terlalu besar
terhadap mekanisme reaksi, karena gugus samping yang terlibat dalam reaksi amatlah
reaktif. Kajian awal tahap-tahap selanjutnya pada mekanisme reaksi pirolisis TNTA setelah
pembentukan lingkar benzofuroksan telah pula dilakukan melalui kedua molekul di atas
sebagai model.
Kata Kunci : TNTA, (Z)-1-azido-2-nitroetena, 2-nitrofenil azida, ab initio, pirolisis
H -O H
1139
Emelia. O 431 Hidayah Sahar 117
Emilio L 1000 Hideo Hayashi 912
Endang Asijati Ichsan 245, 921 Hitoshi Watarai 1023
Endang S. Atimah 1028 Ho, C.W 953
Endang Saepudin 253 Hokcu S 132
Endom Ismail 259, 769 Huang Nay Ming 617
Engku Norbaya Muda 854 I Wayan Dasna 893
Eny Kusrini 263, 641 I Wayan Muderawan 409
Erlin Nurtiyani 889 I Wayan Suja 409
I. Ahmad 217
Euis H. Hakim345, 357, 449, 467, 508, 534, I. M. Arcana 402, 574
672, 696, 720, 735, 744, 779, 818, 841, 878, I. M. Said 18
982, 1000 I.N. Tika 86, 1090
Euis Julaeha 280 Ibrahim Abdullah 415, 419, 713
Evi Susanti 283, 306 Ibrahim Baba 241, 393, 439, 728, 1007
F. Madayanti 86, 100, 164, 231, 309, 375, Ibrahim Komo 424
514, 761, 1020 Ibrahim N.Hasan 711
F.A. Asmuruf 289 Ida I 132
Fadhli Hadana Rahman 293 Idris, A.B 431
Fahimah Martak 298 Iis Siti Jahro 439
Faika Dwiyanti 883 Ijan Khushaida M. Jan 619
Farah Diba Abu Bakar 302 Ikenna Alphonse Osisi 191
Farah N 1080 Ikram M. Said 1000
Fariati 283, 306 Ikram M. Said 357, 444, 449, 508, 522, 672,
Fasade Miharja Beangi 1057 724, 744, 779, 818, 878, 1000
Fauziah Hanim Shaarani 302 Indra Noviandri 401, 666, 902
Firman AP 314 Intan Asri 991
Francis Wong 687 Iqbal Musthapa 449
Francisca N. Liman 401 Ishak Ahmad 453
Gapor, M.T 691 Ismail A Rahman 548, 641
Gatot Trimulyadi R 328 Ismail B. S 459
Gede Wibawa 333, 567 Ismail Bahari 640
Geri Gopir 487 Ismunandar 439, 463, 540, 813, 1043
Ghisalberti 1000 Isni Marlianti 328
H. Helwati 86 Isnida, I 691
H. Pramono 86 J. Kader 496
H. Yohandini 375 J.J. Mohamed 807
Habibah HJ Jamil 338 Jalifah L
Hafizan Juahir 619 Jalifah L Jalifah Latif
Hairul, M 467
Halimah Muhammad 459 Jalifah Latip 357, 467, 508, 597, 672, 720
Hanapi Usman 345 724, 779, 818, 841, 854, 878, 982, 1000
Hanis bt Mohd Yusoff 27 Jamaluddin Mohd. Daud 471
Hapipah Mohd Ali 259, 350, 769 Jarnuzi Gunlazuardi 477, 478
Harry Kurniawan 945 Jatmika Setiawan 415
Hary 549 Johari Ibahim 985
Haryoto Saroyobudiyono 357 Joseph JL 823
Hasnah M. Sirat 361 Jumaat Hj. Adam 487
Hasnah Muin 368 Jumat Salimon 487, 492, 801
Hasrina, H 467 K. Nadarajah 496
Hayat Sholihin 150 K. ORIHARA 289
Hedi Surahman 477 K. Weisz 550
Hefill Hardiman 463 Kadariah 328
Hendyk Krisna Dani 373 Kalaivani Nadarajah 12
Hens Saputra 380 Khairul Amdani 859
Herman, S 642 Khairul Asmak Abd. Kadir 492
Hermin Sulistyarti 374 Khairul Faizal Pa’ee 504
Hery Suwito 387, 678 Khiew Poh Sim 617
Hesti Lina 309 Kholifatu Rosyidah 508
1140
Khuzaimah 293 Merlyn Surja 1028
Kosela, S 766, 908 Mimin A 298
Krohn, K 766, 908 Mohamad MD Tan 338
Kuniyoshi Shimizu 917 Mohamed Noor Hasan 580
Kuswandi 567 Mohamed Rozali Othman 801
L. Ambarsari 86, 514 Mohammad Alinor bin Abdul Kadir 618
L. B. Din 18, 158, 196, 444, 449, 508, 522 Mohammad B. Kassim 293, 739
672, 724, 744, 779, 818, 841, 878, 1000 Mohd Cairul Iqbal Mohd Amin 646
L. B. S. Kardono 521 Mohd Khan Ayob 155
L.R. Sihasale 849 Mohd Rozali Othman 712
Laily B. Din 196 Mohd Sharizan Ahmad Shahrifun 155
Lee Lay Meng 361 Mohd Wahid Samsudin 522
Lee Yook Heng 79, 527, 687, 714, 796, 836 Mohd Yazid Ahmad 34
Lengga Priani 309 Mohd. Shuhaimi Othman 543
Leong, C.K 431 Mohd.Khan Ayob 790
Lia D. Juliawaty 345, 449, 508, 672, 735, 744, Mohsen Nasirian 640
779, 818, 841, 878, 1000 Muhamad Daud 34
Lik Anah 583 Muhamad A. Martoprawiro 636, 830, 1043
Lince Yarni 521 Muhamad Barzani Gasim 487
Lindarti Purwaningsih 540 Muhamad Mat Salleh 659
Lukman Makmur 345, 449, 508, 534672, 735, Muhamad Samudi Yasir 117, 653, 787
744, 779, 818, 878 Muhamat Syahroni 253
M Hasan Abadi 463 Muhammad Ali Zulfikar 558
M. A. Fulazzaky 320 Muhammad Barzani 543
M. Arif Batutah 567 Muhammad I. Saleh 191, 263, 641
M. Asy’ari 100 Muhammad Naqib 1
M. Ekhwan Toriman 619 Muhammad Sum Hj Idris 683
M. Hasan 574 Muhammad Yahaya 659
M. P. Widhiastuty 692 Muhayatun 1092
M. Sindumarta 1090 Muhtadi 672
M. Utoro Yahya 637 Muji Harsini 666
M.A. Hamid 807 Mulyadi Tanjung 94, 387, 678
M.A. Nawi 551 Muntaz Abu Bakar 642, 683
M.A. Sulfikar 402 Mursyidah 659
M.Noor Jalaluddin 345 Musa Ahmad 79, 527, 687, 796, 836
Md. Pauzi Abdullah 1091 Musalmah Mazlan 691, 985
M.R. Moeis 86, 514 N. ASANO 289
M.S. Shaari 807 N. M. Surdia 604, 756
M.Z. Ibrahim 551 N.S. Mulyani 100
Mahani Mansor Clyde 165 Naili Sofianingsih 583
Mahdi Che Isa 34 Nanik Fauziah 678
Mahfud 583 Nanik Nurcahyani 583
Mahmiah 678 Nanik Siti Aminah 94, 678, 696
Maimon Abdullah 589, 712 Neni Frimayanti 580
Maimunah Sokro 141 Ng Seik Weng 769, 1007
Mamik M Q 387 Ngai Mun Hong 361
Mamot Said 597 Nik Idris Nik Yusof 196, 982
Mansor Abdul Hamid 548 Nikmans Hattu 702
Margono 549 Nizam Said 158
Maria Goretti 550 Nobuo Tanaka 710
Mariko Katajima 345, 696 Noerati 703
Marlia Mohd Hanafiah 487 Noor Aini Abdul Hamid 985
Marlina 604 Noor Azilah M Kasim 711
Masatake Niwa 696 Noor Hapeedah M. A 467, 720
Maskat, M.Y 106, 953 Noor Hasani Hashim 191
Masni Mohd Ali 609 Noorlela 60
Mazlan Othman 642, 424 Noorshida Mohd Ali 714
Mazlin B. Mokhtar 619 Nor Anisah Abdullah 53
Md Soot Ahmad 617 Nor Muhammad Mahadi 302
1141
Norazam Hassan 53 Rusli Daik 293
Nordin Hj Lajis 350, 769 Russell F. Howe 1036
Norela Sulaiman 589, 712 Rustaman 830
Norhafipah, M 467 S. Achmad 604
Norhayati Abdullah 53 S. Ekawardhani 849
Norhayati Ali 191 S. H. Inayat-Hussain 1007
Norizan Ahmat 724 S. M. Monjurul Alam 962
Norlinda Daud 713 S. Nurbaiti 849
Normah Awang 728 S. Purwadaria 756
Norrakiah Abdullah Sani 46, 53, 504 S. Suryowidagdo 521
Norziah Mohd Hani 191 S. Wafiroh 209
Novi Christina 137 S.I. Rahayu 574
Nugrahaningsih 306 S.S.Chow 551
Nugroho,DA 766 Sadijah Achmad 223
Nur Huda Faujan 46 Saepurahman 1057
Nurakmal Othman 53 Sagir Alva 836
Nurlelasari 735 Sahibin Abd. Rahim 487
Nurul Fadhilah K. Aripin 350 Sahidin 841
Nurul Irian Putra 636 Salma, M.Y 106
Nurul Izza, N 1049 Salmijah Surif 589, 712
Nurul Qomariah 309 Saraswati 847
Nurul, A 766 Satirah Zainalabidin 854
Nurulhuda Edy Muslim 487 Scott Donne 935
Nuryatini 872, 1093 Seik Weng Ng 298, 350
Nurziana Ngah 739 Selvi, C 431
Nyoman S. Suastri 744 Serly Jolanda Sekewael 848
Osman Hassan 155, 953 Setiaty Pandia 859
P. Aditiawati 100, 761 Shahani Shahar 589
P. Yatiman 756 Shahidan Radiman 42, 617
P.E. Susilowati 761 Shajarahtunnur Jamil 361
Paden Morat 854 Sharifuddin M. Zain 350, 619, 769
Parlan 893 Sheila Nathan 302
Patrick Perlmutter 216 Shigeo Tanaka 444
Pudjiastuti, P 766 Siswati Setiasih 60, 773, 864
Puvaneswary Subramaniam 769 Siti Aisyah 878
R. Flora Mariana 773 Siti Azma J 823
R. SATO 289 Siti Channah 945
R. Suratman 756 Siti Nadiah Abdul Halim 350
R. Y. Perry Burhan 748 Sjamsul A. Achmad 345, 449, 508, 534, 696,
R.J. Talib 807 735, 672, 744, 779, 818, 841, 878, 982, 1000
Rahmat Wibowo 478, 773 Slamet 477
Ramlan Omar 487 Soewarno T. Soekarto 790
Rani Maharani 779 Soleh Kosela 871
Rashdan MM 823 Sri Hidayati 373
Redzuwan Yahaya 653, 787 Sri Sudiono 185
Revan A 549 Sri Sumartini 872
Reza Brahma 223 Sri Widarti 1102
Rifa Rachmah 71 Subandi 761
Rita Hayati 790 Sue Mian, T 691
Rita Sundari 79, 796 Sufian Idris 158
Riyanto 801 Suhana Samat 597
Rohana Adnan 263, 641 Sumardi 872
Rohasmizah Hashim 46 Sumi Hudiyono 883
Roland De Marco 64 Supriyatna Sutardjo 280, 912
Ros Kusuma Dewi 478 Sura Menda Ginting 185
Rosdiana 813 Suriah Abd Rahman 155
Rossi M.T 60 Susanto Imam Rahayu 439, 666, 882, 902
Rusdiyah Fatatik 818 Susilowati HS 883, 889
Ruslan Abdullah 823 Sutrisno 893
1142
Suwarso, W.P 766, 908 Wan Zurinah Wan Ngah 985
Suwito, H 766, 908 Wawang Suratno 991
Suyanta 902 Widianingsih 646
Suyanto 908 Winda Puspitasari 245
Syafruddin 912 Winiati, S 908
Syahida Maarof 155 Wiwit Nurhayati 373
Takashi Kamiyama 911 Wong Pick Foon 712
Tan Choon Chek 543 Yana M. Syah 345, 357, 449, 467, 508, 534,
Tan Y. A 459 672, 696, 720, 735, 744, 779, 818, 841,
Tati Herlina 912 878, 982, 1000
Tiaras Sinambela 917 Yang Farina 393, 728, 1007
Tita Puspitasari 921 Yanti Sabarinah Soebianto 245, 921
Tjodi Harlim 345 Yanty Maryanty 1020
Trismilah 864 Yepy Hardi R 889
Tukiran 917 Yeun LH 823
Ujang. S 642 Yip Foo Win 1007
Umar A. Jenie 1110 Yoki Yulizar 1023
Umar Hamzah 926 Yoni F Syukriani 11, 1028
Umi Syafa’ah 917 Yudhi Utomo 306
Ummy Mardiana 110 Yuni Fatisa 199
Unang Supratman 280, 678, 912, 1118 Yuni K. Krisnandi 1036
Utami Sri Hastuti 283 Yusamsutin 94
Vun Vui Fui 165, 1044 Yusthinus T. Male 1043
Wahyu Budi Utomo 935 Zackiyah 132
Wahyudi Priyono Suwarso 945 Zaenal Awaludin 478
Wan Aida 106 Zaidi M. Isa 1044
Wan Aini Wan Ibrahim 962 Zaihan Jalaludin 619
Wan Fuad Wan Hassan 338, 970 Zainal-Abidin B.A.H 1049
Wan Jefri Basirun 350, 769 Zakaria 985
Wan Mokhtar Wan Yusoff 155 Zalifah Latif 449, 744
Wan Ngah, W.Z 691 Zeily Nurachman 1057
Wan Nor Azami Wan Omar 471 Zuhrina Masyithah 1062
Wan Ramli Wan Daud 293 Zulfikar 1
Wan Zuhairi Wan Yaacob 170, 976 Zuriati Zakaria 522
Wan Zuraida Wan Mohd. Zain 982
1143