Anda di halaman 1dari 19

3/28/2016

About

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id
ContactUs

Home

Disclaimer

DaftarIsi

Priv acyPolicy

Kimia

Sitemap

Journal

TermofServ ice

Ebook

MountainClimber

Pengetahuan

Wisata

Search...

Search

BerandaPraktikumPERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(
PraktikumBiokimia)

ARTIKEL TERPOPULER

PERCOBAAN III - Urine Identifikasi Senyawa Dalam Urine ( Praktikum


Biokimia )
OLEHAHMADNAJIHULLAH
Bagikan:

Like

RABU,29APRIL2015
Tw eet

CARDIOPULMONARY
RESUSCITATION(CPR)/
RESUSITASIJANTUNGPARU
(RJP)TEKNIKTERBARU

CARAMEMBACAPETAKONTUR

TempatPerlindunganDarurat(
Shelter/Bivak)

PERCOBAANVIIIAktivitas
SpesifikEnzimAmilase(
PraktikumBiokimia)

KodeEtikPecintaAlam

STAYINGALIVESafetyand
SecurityGuidelinesFor
HumanitarianVolunterrsIn
ConflictAreasOlehDavidLloyd
Robert

PERCOBAANVIIISenyawaBio
OrganikLemak&Protein(Kimia
DasarI)

KOMPAS(PembahasanLengkap) 8
TEKNIKDASARDIALAMBEBAS

ABSTRAK
Percobaan ini bertujuan untuk mengidentifikasi senyawasenyawa yang terkandung dalam urine.
Prinsip percobaan ini adalah reaksireaksi khas pada masingmasing percobaan. Metode
percobaan yang bisa dilakukan adalah uji pemecahan ureum oleh urease, uji gula pereduksi, uji
adanyakreatinindenganpercobaanJAFFEdanWEYL,tesadanyaasamuratdangaramnyayang
menggunakanpercobaanMuroksiddanreduksiperak(SCHIFF),tesadanyasenyawaketon,dan
tes adanya protein untuk uji senyawa organik. Sedangkan identifikasi senyawa anorganik
dilakukan dengan tes adanya amonia, klorida, sulfat, fosfat dan kalsium. Dari percobaan yang
telah dilakukan didapatkan bahwa uji positif terjadi pada uji pemecahan ureum oleh urease, tes
adnyagulapereduksi,tesadanyakloridadantesadanyasulfat.

MembangunSikapMentalYang
TepatDalamKeadaanSurvival(
PsychologicalAspectsof
SURVIVAL)

10

DiberdayakanolehBlogger.

PERCOBAANIII
URINE:IDENTIFIKASISENYAWADALAMURINE
I.TUJUANPERCOBAAN
Untukmengetahuiunsurunsuryangterkandungdalamurine
II.TINJAUANPUSTAKA
2.1Urine
Urine atau air seni atau air kencing adalah cairan sisa yang diekskresikan oleh ginjal yang
kemudian akan dikeluarkan dari dalam tubuh melalui proses urinasi. Ekskresi urine diperlukan
untukmembuangmolekulmolekulsisadalamdarahyangdisaringolehginjaldanuntukmenjaga
homeostasiscairantubuh.Namun,adajugabeberapaspesiesyangmenggunakanurinesebagai
saranakomunikasiolfaktori.Urinedisaringdidalamginjal,dibawamelaluiuretermenujukandung
kemih,akhirnyadibuangkeluartubuhmelaluiuretra.
Fungsi utama urine adalah untuk membuang zat sisa seperti racun atau obatobatan dari dalam
tubuh. Anggapan umum menganggap urine sebagai zat yang "kotor". Hal ini berkaitan dengan
kemungkinan urine tersebut berasal dari ginjal atau saluran kencing yang terinfeksi, sehingga

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

1/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

urine pun akan mengandung bakteri. Namun jika urine berasal dari ginjal dan saluran kencing
yangsehat,secaramedisurinesebenarnyacukupsterildanhampirtidakberbauketikakeluardari
tubuh. Hanya saja, beberapa saat setelah meninggalkan tubuh, bakteri akan mengkontaminasi
urine dan mengubah zatzat di dalam urine dan menghasilkan bau yang khas, terutama bau
amonia yang dihasilkan dari urea. Urine dapat menjadi penunjuk dehidrasi. Orang yang tidak
menderita dehidrasi akan mengeluarkan urine yang bening seperti air. Penderita dehidrasi akan
mengeluarkanurineberwarnakuningpekatataucokelat.

(Anonim,2008)

Jenisurineadalahsebagaiberikut
a.Urinesewaktu
Urineyangdikeluarkansewaktuwaktubilamanadiperlukanpemeriksaan.Urinesewaktubiasanya
cukupbaikuntukpemeriksaanrutinyangmelengkapipemeriksaanfisikbadan.
b.Urinepagi
Urineyangpertamadikeluarkansewaktupasienbanguntidur.Urineinibiasanyalebihpekatdan
baiksekaliuntukpemeriksaankadarproteinsedimen,reduksi,reaksibiologidaricallimalninidan
sebagainya.
c.Urinepascaprandial
Urine yang pertama kali dikeluarkan setelah pasien makan (kurang lebih 1,53 jam sesudah
makan).Urineinibiasanyadipakaiuntukpemeriksaanreduksi.
d.Urine24jam
Urineyangdikumpulkanselama24jam.Urineiniakuratuntukanalisakuantitatif.
(TimDepKesRI,1994)
2.2PemeriksaanpadaUrine
2.2.1Pemeriksaankadarguladalamurine
Pengertiannya adalah memeriksa urine yang bertujuan untuk mengetahui kadar gula dalam
urine. Hal ini dilakukan pada pasien yang berpenyakit atau tersangka berpenyakit diabetes
mellitus. Cara pemeriksaan kadar gula dalam urine dapat dilakukan dengan memakai reagen
benedict,tabletkhususdantespita.
Pemeriksaan dengan menggunakan reagen benedict, perubahan warna yang ditunjukkan
adalahsebagaiberikut:
Warnabiru(tidakberubah)()
Warnabirukehijauan(+)
Warnahijau(kekuningan)(++)
Warnakuningkemerahan(+++)
Warnamerahbata(++++)
2.2.2Pengambilanbahanurine
Pengambilan urine sebagai bahan pemeriksaan untuk mengetahui faal glomeruli yang
bertujuanuntukmenyediakanurinesecarabertahapuntukpemeriksaanureum.
2.2.3Pengumpulanurineselama24jam
Meliputi:
Pengukuranberatjenisurine
Pemeriksaanjumlahdalamurine
Pengujianpemekatan
Pengambilanbahancreatininclearencetest
(TimDepKes,1994)
2.3SifatUrine
Sifatsifaturinediantaranyaadalah
a.volumeurinepadaorangdewasanomal6002.500mLdibentuktiaphari
b.volumeurineberkurangpadaiklimpanas
c.beratjenisantara1,0031,030
d.reaksiurinebiasanyaadalahasamdenganpHberkisarantara4,78,0
e.urinemenjadialkalibiladibiarkan
f.urineberwarnakuningpucatapabilanormal
g.urinesegarberaroma,tetapibaunyadapatberubaholehzatzatyangadadalammakanan
(Harper,1961)
2.4CiriciriUrineNormal
Jumlahrataratasatusampeldualiterseharinamunberbedabedasesuaidenganjumlahcairan
yang dimasukkan. Banyaknya akan bertambah pula apabila terlampaui banyak protein yang
dimakan sehingga tersedia cukup aliran yang diperlukan untuk mengalirkan ureanya. Warnanya
bening oranye pucat tanpa endapan tetapi kalanya terdapat lendir tipis nampak terapung di
dalamnya, baunya tajam, reaksinya sedikit asam terhadap lakmus dengan pH ratarata 6, berat
jenisberkisarantara1,010sampai1,028.
(Harper,1961)
2.5KomponenUtamaUrineManusia
Komponenutamapenyusunurinepadamanusiaterdiridari:
Komponen
Garamper24jam
Perkiraannisbahkons.
urine
Glukosa
Asamamino
Amoniak
Urine
Kreatinin

<0,05
0,80
0,80
25
1,5

<0,05
1,0
100
70
70

Asamurat
H+

0,7
pH58
3,0
1,7
0,2

20
Sampai300
1,0
15
5

0,15
6,3

2
1,5

Na+
K+
Ca2+
Mg2+
Cl
2

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

2/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id
HPO4

SO42
HCO3

1,2gP

25

1,4gS
0,3

50
0,2

Volume dan komposisi urine 24 jam bervariasi tergantung pada jumlah cairan yang masuk ke
tubuh.Datadiatasberlakubagiratarata24jamspesimendengantotalvolume1.200mL.
(Harper,1961)
2.6UnsurunsurAbnormaldalamUrine
a.Protein
Proteinuria(albumeurea)adalahadanyaalbumindanglobulindalamurinedalamkonsentrasi
yangabnormalnormaltidaklebihdari30200mgproteindiekstraksisetiapharidalamurine.

b.Glukosa
Normal, tidak lebih dari satu gram diekstraksi setiap hari. Glukosaria terjadi bila melebihi jumlah
tersebut.Glukosariadapatdisebabkanadanyastresdanemosi.Glukosariatidakdisebabkanoleh
diabetestetapidapatmenunjukkanadanyadiabetes.
c.Bendabendaketon
Pada keadaan normal, umumnya hanya diekskresi keton sebanyak 315 mg setiap hari,
jumlahnya meningkat pada kelaparan, gangguan metabolisme karbohidrat, kehamilan, dan
beberapajenisalkoholis.(Harper,1961)
2.7UnsurunsurNormaldalamUrine
a.Urea
Merupakan hasil akhir utama metabolisme protein pada mamalia. Biasanya merupakan 8090%
dan nitrogen urine total tetap pada diet rendah, protein urea jumlahnya rendah karena unsur
nitrogen lain secara relatif tidak dipengaruhi oleh diet. Sekresi urea meningkat seperti demam,
diabetesatauaktivitaskorteksberlebih.
(Harper,1961)
b.Amonia
Secara normal, jumlah amonia dalam urine sedikit. Namun jika terdapat diabetes melitus maka
jumlahamoniayangterkandungsangattinggi.
(Harper,1961)
c.Kreatindankreatinin
Kreatinadalahprodukpemecahankreatin.Koefisienkreatininidapatdigunakansebagaimetode
(indeks) mengenai jumlah urine yang dikumpulkan dalam 24 jam. Kreatinin diukur secara
kolorimeterdenganmenambahkanalkalipikratdalamurine.
(Harper,1961)
d.Asamurat
Asamuratadalahhasilakhiryangpentingdalamoksidasiurineyangsukarlarutdalamair,tetapi
membentuk garam yang larut dalam alkali. Oleh karena itu asam urat mudah mengendap dalam
urinebiladibiarkan,warnabirudiberikanasamuratbilaterdapatseanofosfongisfat.
(Harper,1961)
e.Asamamino
Asamaminoyangkeluardariurinesangatsedikitkarenaambangbatasurineuntukzatinisangat
tinggi.
(Harper,1961)
2.8PengujianpadaUrine
2.8.1Ujigulapereduksidenganmetodebenedict
Reagen benedict terdiri dari kupri sulfat, sodium karbonat, dan sodium sitrat. Reaksinya sama
dengan fehling yaitu gula pereduksinya akan dioksidasi menjadi asam aldonat, sedangkan
pereaksi benedict akan tereduksi menjadi Cu2O dengan adanya endapan merah bata, maka
menunjukkanadanyagulapereduksi.
(Harper,1961)
2.8.2Penentuankadarkreatininurine
Kreatinin diukur secara stoikiometri dengan menggunakan asam pikrat yang ditambahkan dalam
urine. Dengan adanya kreatin, campuran memberi warna ambar (Reaksi Jaffe) warnanya
dicocokkandenganstandarkreatininyangjugatelahdiberialkalipikrat.
(Harper,1961)
2.8.3Ujiadanyaprotein
Protein dapat ditemukan dengan memanaskan urine lebih baik, setelah disentrifus untuk
menghilangkan sedimen, kemudian ditambahkan asan asetat encer. Suatu awan putih atau
endapan yang menetap setelah penambahan asam menunjukkan bahwa dalam urine terdapat
protein.Padapengukurankuantitatifproteindiendapkandenganasamsikloasetatdankemudian
dipisahkanuntukanalisisbaiksecarakolorimetrimaupunanalisis.
(Harper,1961)

2.9Komposisiurine
Urineterdiridariairdenganbahanterlarutberupasisametabolisme(sepertiurea),garamterlarut,
damn materi organik. Cairan dan materi pembentuk urine berasal dari darah atau cairan
interstisial. Komposisi urine berubah sepanjang proses reabsorbsi ketika molekul yang penting
bagitubuhmisalglukosa,diserapkembalikedalamtubuhmelaluimolekulpembawa.Cairanyang
tersisa mengandung urea dalam kadar yang tinggi dan berbagai senyawa yang berlebih atau
berpotensi racun yang akan dibuang keluar tubuh. Materi yang terkandung di dalam urine dapat
diketahuimelaluiurinalisis.Ureayangdikandungolehurinedapatmenjadisumbernitrogenyang
baik untuk tumbuhan dan dapat digunakan untuk mempercepat pembentukan kompos. Urine
seorangpenderitadiabetesakanmengandunggulayangtidakakanditemukandalamurineorang
yangsehat.
(Anonim,2008)

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

3/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

2.10Penyakitpadaurine
Penyakit batu ginjal merupakan suatu penyakit yang banyak diderita oleh rakyat Indonesia yaitu
suatupenyakityangdisebabkanterdapatnyaendapanyangmengeras(membatu)didalamginjal.
Disebut juga penyakit kencing batu dan dalam istilah asing disebut renal stone, urolithiasis atau
calculusurinaria.
Batubatu ini tidak saja terdapat di dalam ginjal tetapi batu yang ada di ginjal dapat turun ke
saluran yang berada di bawahnya yaitu ureter, kandung kemih (bulibuli) dan saluran kencing
terluar(uretra)dandapatjugaterjadilangsungdikandungkemih.
Gejalagejala yang dapat ditimbulkan oleh penyakit ini adalah rasa nyeri di daerah pinggang
ataupundidaerahsalurankencinglainnya.Rasanyeriinimulaidariyangringansampaidengan
yang berat tergantung dari besar kecilnya batu yang terbentuk. Gejalagejala lain diantaranya
adalah pengeluaran urine tidak lancar, urine kadangkadang disertai dengan keluarnya darah
karenalukalukayangditimbulkanolehgesekanantarabatudengandindingsalurankencing.
(Anonim,2008)
2.11Ginjal
Ginjal merupakan organ penting yang menyaring material dari darah, yang berbahaya atau
berlebihan ataupun keduanya. Materialmaterial ini diekskresikan dalam urine. Sejumlah tes
dijalankan secara rutin di laboratorium klinik dengan sampel urine. Hal ini termasuk pengukuran
glukosaataugulapereduksi,keton,albumin,spesifikgrafitydanpH.
(Bettelhem,1995)
Manusiamemilikisepasangginjalyangterletakdibelakangperutatauabdomen.Ginjaliniterletak
di kanan dan kiri tulang belakang, di bawah hati dan limpa. Di bagian atas (superior) ginjal
terdapat kelenjar adrenal (juga disebut kelenjar suprarenal).Ginjal bersifat retroperitoneal, yang
berarti terletak di belakang peritoneum yang melapisi rongga abdomen. Kedua ginjal terletak di
sekitar vertebre. Ginjal kanan biasanya terletak sedikit di bawah ginjal kiri untuk memberi tempat
untukhati.Sebagiandaribagianatasginjalterlindungiolehigakesebelasdanduabelas.Kedua
ginjal dibungkus oleh dua lapisan lemak (lemak perirenal dan lemak pararenal) yang membantu
meredamgoncangan.
(Anonim,2008)
2.12SistemEkskresi
Sistemekskresipadamanusiadanvertebratalainnyamelibatkanorganparuparu,kulit,ginjal,dan
hati.Namunyangterpentingdarikeempatorgantersebutadalahginjal.
1.Ginjal
Fungsiutamaginjaladalahmengekskresikanzatzatsisametabolismeyangmengandungnitrogen
misalnya amonia.Amonia adalah hasil pemecahan protein dan bermacammacam garam, melalui
proses deaminasi atau proses pembusukan mikroba dalam usus. Selain itu, ginjal juga berfungsi
mengeksresikan zat yang jumlahnya berlebihan, misalnya vitamin yang larut dalam air,
mempertahankan cairan ekstraselular dengan jalan mengeluarkan air bila berlebihan, serta
mempertahankankeseimbanganasamdanbasa.Sekresidariginjalberupaurine.
Bentuk ginjal seperti kacang merah, jumlahnya sepasang dan terletak di dorsal kiri dan kanan
tulang belakang di daerah pinggang. Berat ginjal diperkirakan 0,5% dari berat badan, dan
panjangnya 10 cm. Setiap menit 2025% darah dipompa oleh jantung yang mengalir menuju
ginjal.Ginjalterdiridaritigabagianutamayaitu:
a.korteks(bagianluar)
b.medulla(sumsumginjal)
c.pelvisrenalis(ronggaginjal)
Bagian korteks ginjal mengandung banyak sekali nefron 100 juta sehingga permukaan kapiler
ginjalmenjadiluas,akibatnyaperembesanzatbuanganmenjadibanyak.Setiapnefronterdiriatas
badan Malphigi dan tubulus (saluran) yang panjang. Pada badan Malphigi terdapat kapsul
Bowman yang bentuknya seperti mangkuk atau piala yang berupa selaput sel pipih. Kapsul
Bowman membungkus glomerulus. Glomerulus berbentuk jalinan kapiler arterial. Tubulus pada
badanMalphigiadalahtubulusproksimalyangbergulungdekatkapsulBowmanyangpadadinding
selterdapatbanyaksekalimitokondria.Tubulusyangkeduaadalahtubulusdistal.

Pada rongga ginjal bermuara pembuluh pengumpul. Rongga ginjal dihubungkan oleh ureter
(berupa saluran) ke kandung kencing (vesika urinaria) yang berfungsi sebagai tempat
penampungan sementara urine sebelum keluar tubuh. Dari kandung kencing menuju luar tubuh
urinemelewatisaluranyangdisebuturetra.
2.Hati(hepar)
Hati disebut juga sebagai alat ekskresi di samping berfungsi sebagai kelenjar dalam sistem
pencernaan. Hati menjadi bagian dari sistem ekskresi karena menghasilkan empedu. Hati juga
berfungsi merombak hemoglobin menjadi bilirubin dan biliverdin, dan setelah mengalami oksidasi
akan berubah jadi urobilin yang memberi warna pada feses menjadi kekuningan. Demikian juga
kreatininhasilpemecahanprotein,pembuangannyadiaturolehhatikemudiandiangkutolehdarah
keginjal.Jikasaluranempedutersumbatkarenaadanyaendapankolesterolmakacairanempedu
akan masuk dalam sistem peredaran darah sehingga cairan darah menjadi lebih kuning.
Penderitanyadisebutmengalamisakitkuning.
(Anonim,2008)
2.13MekanismePembuanganUrine
Didalamginjalterjadirangkaianprosesfiltrasi,reabsorbsi,danaugmentasi.
1.Penyaringan(filtrasi)
Filtrasi terjadi pada kapiler glomerulus pada kapsul Bowman. Pada glomerulus terdapat selsel
endoteliumkapileryangberpori(podosit)sehinggamempermudahprosespenyaringan.Beberapa
faktor yang mempermudah proses penyaringan adalah tekanan hidrolik dan permeabilitias yang
tinggipadaglomerulus.Selainpenyaringan,diglomelurusterjadipulapengikatankembaliselsel

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

4/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

darah, keping darah, dan sebagian besar protein plasma. Bahanbahan kecil terlarut dalam
plasma, seperti glukosa, asam amino, natrium, kalium, klorida, bikarbonat, garam lain, dan urea
melewatisaringandanmenjadibagiandariendapan.
Hasil penyaringan di glomerulus berupa filtrat glomerulus (urine primer) yang komposisinya
serupa dengan darah tetapi tidak mengandung protein. Pada filtrat glomerulus masih dapat
ditemukanasamamino,glukosa,natrium,kalium,dangaramgaramlainnya.
2.Penyerapankembali(reabsorbsi)
Volume urine manusia hanya 1% dari filtrat glomerulus. Oleh karena itu, 99% filtrat glomerulus
akan direabsorbsi secara aktif pada tubulus kontortus proksimal dan terjadi penambahan zatzat
sisasertaureapadatubuluskontortusdistal.
Substansi yang masih berguna seperti glukosa dan asam amino dikembalikan ke darah. Sisa
sampah kelebihan garam, dan bahan lain pada filtrat dikeluarkan dalam urine. Tiap hari tabung
ginjalmereabsorbsilebihdari178literair,1.200ggaram,dan150gglukosa.Sebagianbesardari
zatzatinidireabsorbsibeberapakali.
Setelah terjadi reabsorbsi maka tubulus akan menghasilkan urine sekunder yang komposisinya
sangat berbeda dengan urine primer. Pada urine sekunder, zatzat yang masih diperlukan tidak
akan ditemukan lagi. Sebaliknya, konsentrasi zatzat sisa metabolisme yang bersifat racun
bertambah, misalnya ureum dari 0,03% dalam urine primer dapat mencapai 2% dalam urine
sekunder.
Meresapnya zat pada tubulus ini melalui dua cara. Gula dan asam amino meresap melalui
peristiwa difusi, sedangkan air melalui peristiwa osmosis. Reabsorbsi air terjadi pada tubulus
proksimaldantubulusdistal.
3.Augmentasi
Augmentasiadalahprosespenambahanzatsisadanureayangmulaiterjadiditubuluskontortus
distal.Komposisiurinyangdikeluarkanlewatureteradalah96%air,1,5%garam,2,5%urea,dan
sisasubstansilain,misalnyapigmenempeduyangberfungsimemberiwarnadanbaupadaurine.
(Anonim,2008)
2.14Ketergantungan Aktivasi GTP Pada Apoprotein Urease dalam Kompleks dengan Protein
TambahanBerupaUreD,UreFdanUreG
Sintesis logam yang mengandung enzim sering membutuhkan dukungan dari protein tambahan.
Tugas tersebut di mainkan oleh banyak protein tambahan yang tergolong rendah. Klebsiella
aerogenes, sebuah nikel yang mengandung enzim dilengkapi dengan sistem ideal untuk
mempelajaripemasanganmetallocenter.
Di sini, kami menggambarkan sebuah metode untuk mengisolasi kompleks yang mengandung
apoprotein urease dan protein pembantu berupa UreD, UreF dan UreG. Kami mempertunjukkan
bahwa apoprotein urease dalam kompleks di aktifkan untuk tingkat tipe enzim yang sedikit liar.
Ketika diinkubasi dengan ion nikel dan bikarbonat dengan konsentrasi yang tinggi. Secara
signifikan kami juga mengamati ketergantungan aktivitas nikel. Pada fisiologi ilmu yang
bersangkutan pada tingkat bikarbonat tapi hanya dalam persen GTP. Didasarkan pada
pembelajaran meliputi kesukaran hidrolisis yang sama pada GTP. Kami menyimpulkan bahwa
hidrolisisnukleotidatidakhanyapadaikatansampingyaitudiperlukandalamprosesini.
Urease adalah nikel yang mengandung enzim yang berfungsi sebagai faktor dahsyat pada
beberapa penyakit manusia. Struktur kristal enzim heterotrimerik dari Klebsiella aerogenes yang
menampakkandinuclearmettalocenter.
(Soriano&Harosinger,1999)
2.15Pengaruh Padatan PadaAktivitas Enzim Urease, Penilaian Karbondioksida dan Mineralisasi
Nitrogen
Pengaruh padatan pada aktivitas enzim urease, penilaian CO2 dan mineralisasi nitrogen pada
tanah yang diberi urea dan tidak diberi urea.Tanah dipadatkan pada komposisi 0 kg cm2, 2 kg
cm2dan4kgcm2dandiinkubasikanselama28hari.Perubahanpadaenzimurease,penilaian
CO2 dan mineralisasi nitrogen yang diukur selama periode inkubasi. Aktivitas enzim urease
menurunsecarasignifikan(P<0.05)padasemuasampeltapitelahdiamatibahwaadapengaruh
negatifpadapadatanaktivitasenzimureasedanpenilaianCO2padatanahyangdiberiurea.
Tergantung pada waktu inkubasi, tanah yang diberi urea mempunyai waktu 5 lebih dari NH4+
dan 4 waktu lebih dari NO3 daripada tanah yang tidak diberi urea. Selanjutnya padatan
disebabkannitrifikasipadakeduakelompoktersebut(P<0.05).
Tanahyangpadatmungkinmenyebabkanmasalahdenganperubahanporostanah.Sejakhalini
mempunyai pengaruh pada aktivitas biologi yang sama baiknya pada bentuk fisik tanah,
pertumbuhan tanaman dan akar mungkin berpengaruh negatif. Aktivitas enzim urease pada
sampel kontrol 34,33 pada hari pertama menurun menjadi 28,73 mg N/kg tanah selama 28 hari.
Bagaimanapun,ketika2kg/cm2tekananditerapkan,tidakadaaktivitasureaseyangterlihatpada
14dan28harimasainkubasi.Perubahanaktivitasureasepadasampeltanahdengandantanpa
penambahanureasetergantungpada49mgNtiap100gramtingkattanahpada28hariinkubasi.
Aktivias enzim urease pertama kali, kedua dan ketiga masa inkubasi berubah secara signifikan
ketikatekanan2kg/cm2diterapkanpadatanah.
(Karacadkk,1997)
2.16 Preparasi dan Karakterisasi dari Amobilisasi Urease pada glutaraldehyde crosslinked
chitosanbeads
Urease telah diamobilisasi oleh beberapa tetes glutaraldehid berposisi trans dengan chitosan
yang dipreparasi pada gelombang mikro tanpa pancaran sinar. Aktivitas dan hasil dari aktivitas
ureaseberturutturut10,83U/gBdan47,7%.Kondisidariamobilisasiureasetelahdioptimalkan.
Sifatureatelahtelahditelitidandibandingkandenganenzimbebaslainnya.
Urease(ureaamydohydrolyse,EC3.5.1.5)merupakanenzimyangpalingefisienuntukmengubah
ureamenjadiamoniumdankarbondioksida.Enziminisangatpentingdalampenentuanureadalam
darah, urine, dan keringat, dan dalam proses dialisis untuk menghilangkan urea pada perlakuan
uremia.
Penggunaan enzim ini seringkali terbatas karena harganya yang mahal, kelangkaan,
ketidakstabilan, dan kesulitan dalam pembentukan kembali setelah bereaksi. Walaupun demikian
enzim yang diamobilisasi biasanya menunjukkan aktivitas katalitik yang rendah dari pada enzim
lain. Enzim ini lebih stabil, dapat digunakan kembali, dan lebih murah sehingga enzim yang
diamobilisasilebihbanyakdigunakandalampenelitian.
Dalam proses amobilisasi, urease diamobilisasi secara kovalen pada chitosan yang telah
diaktifkan melalui gugus amino dari protein enzim yang direaksikan dengan gugus aldehid dari
beberapa tetes glutaraldehid berposisi trans dengan chitosan. Untuk mendesain matriks
amobilisasienzim,beberapaparameteryangmempengaruhiamobilisasienzimtelahditeliti,seperti
fraksi volume glutaraldehid, rasio tetesan urea, waktu proses amobilisasi, dan pH selama
amobilisasi berlangsung. Parameter kinetik, sifat, dan stabilitas dari hasil amobilisasi enzim di

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

5/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

bawahkondisioptimumkemudianditentukan.
(ZuPeiLiang,2005)
2.17PreparasiBiomimetikBubukHApadaTemperatur37CdidalamKandunganUreadanEnzim
UreasedalamAliranTubuh.
Calciumhydroxyapatite(HA:Ca10(PO4)6(OH)2),adalahsalahsatukomponensenyawaanorganik
yang ada pada tulang manusia. Pada aplikasi tulang sintetik, Calcium hydroxyapatite (HA:
Ca10(PO4)6(OH)2) dipreparasi sebagai tahap awal dan bubuk biokeramik submikron. Bubuk
karbonatHAdisintesisdarikalsiumnitrattetrahidratdangaramdiamoniumhidrogenphospatyang
dilarutkan didalam larutan sintetik tubuh (SBF), yang mengandung urea (H2NCONH2) dan enzim
urease, di bawah kondisi biomimetik 37 C dan pH 7,4, dengan sebuah teknik preparasi secara
kimia. Pada bubuk terdapat juga kandungan ion Mg dan Na, secara intensif dimasukkan oleh
larutan SBF, juga oleh air murni, seama pada proses sintesis. Karakterisasi dan analisis kimia
pada sintetis biomimetik bubuk HA ditunjukkan dengan scanning electon microscopy (SEM),
Powder Xray diffraction (XRD), Fouriertransformed infra red spectroscopy (FTIR), dan
inductivelycoupled plasma atomic emission spectroscopy (ICPAES). Penambahan enzim urease
dengan jumlah yang telah ditentukan pada urea dalam sintetik aliran tubuh menggunakan Ha
sintesis ditunjukkan pada pemasukkan yang membutuhkan kontrol pH untuk pencapaian kondisi
biomimetik.
(Bayraktar,1999)
2.18Biosensor Urea dari Susunan SolGel Film dengan Penyebab Kromoionofor Nile Blue dan
EnzimUrease
Optikbiosensorureadibuatdenganbeberapalayersolgelfilm.Susunansolgelfilmdipengaruhi
kromoionofor nile blue ( ETH 5294 ) dan beberapa enzim urease tanpa membutuhkan adanya
prosedur kimia. Respon absorbansi dari biosensor diperhatikan dengan menggunakan panjang
gelombang 550 nm, agar terjadi deprotonisasi kromoionofor. Dari format multi layer sol gel film
tersebut menggunakan enzim lebih tinggi dalam biosensor sehingga dapat tercapai hasil yang
lebihbaik.Optikbiosensorureamengkonstruksidaritigalayersolgelfilmyangisinyatentangurea
yang mendemonstrasikan kelebaran dari respao dengan range mencapai 100 Mm urea ketika
dibandingkan dengan biosensor yang menggunakan 12 layer film. Analisa urea dalam sampel
urine dengan optik biosensor urea menunjukkan hasilnya dengan metode spektrofotometri dan
menggunakanreagenpdimetilaminobenzaldehid(R2=0,982,n=6).Ratarataureadarisample
urinemenggunakanbiosensorureasekitar103%.
(Alqasaimehdkk,2007)
2.19PembelajaranPadaKristalUrease
Dalam suatu studi yang diterbitkan oleh salah satu dari kami dinyatakan bahwa kristal urease
diaktifkan oleh tripsin. Yang barubaru ini WaldschmidtLeitz dan Steigerwaldt mengulangi
percobaan tersebut dan melaporkan bahwa hasil yang didapatkan berlawanan dengan temuan
kami, urease dari kristal tidak diaktifkan oleh tripsin dan oleh sebab itu tidak suatu protein yang
diumumkan oleh Sumner dan rekanannya dan oleh kami. perbedaan yang radikal ini dalam hasil
yang sangat sederhana suatu eksperimen yang dituntut suatu penjelasan. Pertama kami
mengulangi eksperimen sama dengan cara yang diuraikan oleh WaldschmidtLeitz dan
Steigerwaldt. Kita dapat mengkonfirmasikan hasil mereka adalah hasil sebenarnya. Hal tersebut
adalah urease, apakah kemurnian atau kasar, tidak ada pengaktifan oleh tripsin dalam suatu
penyanggafosfatpH7(0.5~).
Bagaimanapun,padapekerjaanyangyanglebihawaldilakukandilakukanolehWaldschmidtLeitz
dan Steigerwaldt telah gagal mengamati sesuatu yang tidak penting yang nampak. Karena
mengandung air larutan urease dari kristal yang tidak stabil, Sumner dan Hand pada 1928
mengusulkan penambahan gum Arab. Hal ini untuk melindungi urease kristal dari pengaktifan
genap untuk suatu hari. Karena alasan ini dalam pekerjaan yang telah dilakukan tidak ada
eksperimen yang berhasil tanpa adanya getah. Oleh karena itu kami mengulangi eksperimen
dengan penambahan gum Arab yang telah mampu mengkonfirmasikan hasil terdahulu, yakni
tripsinmerupakanpengaktifureasedarikristal.
(TauberdanKleiner,1931)
2.20 Urease dari Suatu Isolat Coccoid yang Berpotensi : Pemurnian, Karakterisasi dan
PembandingandenganUreaseMikrobiayangLain
SL100merupakanprototipdariisolatecoccoidpostifpergramnyadengansuatuadhesitertentu
dari mucin gastric dan merupakan wakil organisme patogenik berpotensial yang diperoleh pada
biopsydaripasienyangmengalamikekacauanlambung.Ureasedariisolateinimerupakansuatu
fraksi yang penting dari jumlah protein sell dan hasil pemurniannya bahwa pemurniannya
dihubungkandengansuatufraksidindingsel.Ureasedibersihkan138lipatanuntukmemperjelas
homogenitas, disebabkan oleh elektroforesis gel dengan aktivitas spesifik 1,120 U/mg. Urease
menjaditidakstabilselamapemurniantanpakehadirannikel,yangberfungsisebagaimetlosenter
dalam urease mikrobia yang lain. Ketika nikel sulfat diberikan selama pertumbuhan (5 M) dan
penambahanbufferselamaprosessonikasidanpemurnian(100M).Akhirnyaureasedistabilkan
padasuhuruangselamaituprosespemurnianberlangsung.Pemurnianureaselebihstabildalam
asam dan lebih aktivitasnya lebih stagnan setelah diinkubasi selama 30 menit pada pH 1,3.
Parameter kinetiknya, relatif melimpah, dan komposisi bagiannya lebih mirip dari urease
Helitobakter daripada urease dari spesies mikrobia yang lain. Kesamaan ini merupakan
konsekuensi suatu adaptasi dari organisme ini untuk membentuk koloni dari perut dan
menandakanbahwaureasemungkinsuatufaktoryangjahatselamamembentukkoloni.
Telah diketahui bahwa beberapa kasus dari penyakit lambung dan kerusakan lambung pada
manusiadisebabkanolehHelicobacterpylori.Samasepertikerusakanlambungyangdisebabkan
oleh Helitobacter felis yang menginfeksi pada anjing, kucing dan tikus dan oleh Helicobacter
mustelae yang menginfeksi musang, sementara itu Helicobacter heilmannii penyebab kerusakan
lambungpadapadakebanyakanhewan.Salahsatupenanggulangandenganmemberikanurease
dosistinggi.Faktanya,setelahdiberikanureasedosistinggimeunjukkanmelindungilambungdari
asamlambungdenganmenetralkanasamdenganpemberianamoniakmelaluihidrolisisurea.
(Lee&Calhoun,2003)
2.21AnalisaBahan
2.21.1Aquades
Sifatfisik:beratmolekul18g/mol
titikbeku00C
titikdidih1000C
berwarnajernih
Sifatkimia:bersifatpolar
larutdalamdimetilalkoholdanetiletanoat
mempunyaiikatanhidrogen
mempunyaitetapandielektriktinggi

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

6/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id
(Basri,1996)

2.21.2Phenolphtalein
Sifatfisik:kristaltakberwarna
dalambentukcairanberwarnaputihkekuningan
Sifatkimia:rumusmolekulC20H14O4
larutdalamalkoholdanpelarutorganiklainnya
takberwarnadalamlarutanasamdanberwarnamerahmudadalamlarutanbasa
perubahanpH8,210,0
(Mulyono,2001)
2.21.3Fenolmerah
Sifatfisik:titikleleh420C
titikdidih1820C
densitas1,1g/mL
Sifatkimia:senyawayangbersifatasam
C6H5OHyangberubahmenjadimerahmuda(pink)bilaterkotoriatauterkenacahaya
(Mulyono,2001)
2.21.4Natriumkarbonat(Na2CO3)
Sifatfisik:padatankristalputih
titikleleh8510C(anhidrous)
densitas2,5(anhidrous)dan1,4(dekahidrat)
Sifatkimia:larutdalamair
mudahmelapukolehudara
sebagaisodapembersih
(Mulyono,2001)
2.21.5Reagentbenedict
Sifatfisik:menghasilkanwarnajinggadengangulapereduksi
Sifatkimia:reagenpengoksidasiuntukmenentukanadanyagulapereduksi
terdiridarinatriumkarbonatdannatriumnitrat,kuprisulfatdanair
(Pringgodigdo,1973)
2.21.6Asamasetat(CH3COOH)
Sifatfisik:merupakanasamtakberwarna
baumenyengat
kemurniannya99,52%
titikdidih118,50C
titikbeku1170C
Sifatkimia:larutdalamairdanasampekat
(Pringgodigdo,1973)
2.21.7Natriumhidroksida(NaOH)
Sifatfisik:titikleleh3180C
titikdidih1390C
densitas2,1g/mL
padatanputih
Sifatkimia:senyawabasakuat
higroskopis,korosif
mudahmenyerapCO2membentukNa2CO3
(Mulyono,2001)
2.21.8Asamnitrat(HNO3)
Sifatfisik:zatcairtidakberwarnaatauagakkekuningantitikleleh410C
titikdidih830C
density1,5g/mL
Sifatkimia:asamanorganik
berasapdankorosif
sebagaioksidatorkuat
(Mulyono,2001)
2.21.9NH4OH
Sifatfisik:titikleleh780C
titikdidih33,50C
berbentukcairan
tidakberwarna,berbautajam
Sifatkimia:merupakansenyawabasa
(Mulyono,2001)
2.21.10AgNO3
Sifatfisik:titikleleh2120C
densitas4,3g/mL
padatankristaltakberwarna
Sifatkimia:menghasilkancerminperakdandebagaireagenanalitik.
(Mulyono,2001)
2.21.11HCl
Sifatfisik:titikleleh1140C
titikdidih850C
densitas1,27(udara=1)
gastakberwarna,berbautajam
Sifatkimia:asamkuat
sangatlarutdalamair
merupakanhasilreaksiantaraNaCldanH2SO4
(Mulyono,2001)
2.21.12Asampikrat
Sifatfisik:padatankristalkuning
titikleleh1220C
density1,8g/mL
Sifatkimia:2,4,6trinitrofenol
asamC6H3N3O7
beracun,mudahmeledak
(Mulyono,2001)
2.21.13Amoniumsulfatpadat
Sifatfisik:merupakanpadatankristalorthorombikberwarnaputih
beratmolekul132,4g/mol
densitas1,67g/mL

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

7/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

Sifatkimia:sangatlarutdalamairdantidaklarutdalametanol.
(Basri,1996)
2.21.14Urine
Sifatfisik:berwarnaagakkekuningan,berbau
beratjenisantara1,0031,030
Sifatkimia:bersifatagakasamdenganpHberkisarantara4,78,0
(Harper,1961)
2.21.15Sodiumnitroprusid
Sifatfisik:cairanjernih,garamNa
(Basri,1996)
2.21.16BaCl2
Sifatfisik:kristalputih
titikleleh9630C
titikdidih15600C
Sifatkimia:digunakandalamekstraksibariummelaluielektrolisisdibuatdenganmelarutkan
BaCO3dalamasamhidrokloridadanmengkristalkanhidrat.
(Daintith,1990)
2.21.17Tepungkedelai
Sifatfisik:berbentukserbuk,berwarnakecoklatan
Sifatkimia:merupakanprodukolahandarikacangkedelai
sebagaisumberprotein
(Anonim,2008)
2.21.18K2C2O4
Sifatfisik:berbentukkristal
tidakberwarna
Sifatkimia:beracun,dapatmenyebabkaniritasi
larutdalamair
senyawainidapatdigunakansebagaisumberutamaasamoksalat,larutanpereaksidalamkimia
analisisdanbahanpembersih.
(Basri,1996)
2.21.19Amoniummolibdat
Sifatfisik:berbentukcairanbening
Sifatkimia:senyawainimerupakangaramdariamoniadanasammolibdat
rumusmolekul(MH4)6MoO7O24.H2O
(Arora,2004)
III.METODEPENELITIAN
AlatdanBahan
Alat
Tabungreaksi
gelasukur
pipettetes
spatula
pengaduk
pemanaslistrik
penangasair
kakitiga
gelasbeker250mL
dropplate
kertassaring
corong
erlenmeyer
cawanporselin
3.1.2Bahan
sampelurine
akuades
phenolftalein
fenolmerah
reagenbenedict
CH3COOH0.1M
tepungkedelai
amoniumsulfatpadat
amoniummolibdat
NaOH2M
HNO3pekat
NaCO3
NH4OH
BaCl2
K2C2O3
HClpekat
3.2SkemaKerja
3.2.1SenyawaOrganikdalamurine
3.2.1.1PemecahanUreumolehUrease

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

8/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

3.2.1.2TesAdanyaGulaPereduksi

3.2.1.3TesAdanyaKreatinin

3.2.1.4TesadanyaAsamUratdanGaramnya
a.PercobaanMuroksid

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

9/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

3.2.1.5Tesadanyasenyawaketon(PercobaanRhoten)

3.2.1.6TesAdanyaProtein

3.2.2SenyawaAnorganikdalamUrine
3.2.2.1TesAdanyaAsamAmino

3.2.2.2TesAdanyaKlorida

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

10/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

3.2.2.3TesAdanyaFosfatdanKalsium

3.2.2.4TesAdanyaSulfat

IV.DATAPENGAMATAN
No
1

Perlakuan

Hasil

Ket

PemecahanUreummenjadiUrease
3mLurine+4tetesfenolmerah+

Terbentuklarutan

Na2CO32%
penambahanCH3COOH
pemanasanhingga60oC

Warnalarutanmenjadiagakmemudar

penambahantepungkedelai

Larutanmenjadikeruh

pengocokan,pendiaman

Terbentukendapantepungkedelai
danwarnasedikitmerahjambu
padasemuasampelurine
Sampelurinepria

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

11/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id
Sampelurinewanita

+
+

3mLakuades+4tetesfenol

Warnalarutantetapjernih

merah+Na2CO32%
penambahanCH3COOH
pemanasanhingga60oC
penambahantepungkedelai
pengocokan,pendiaman

TesAdanyaGulapereduksi
1mLurine+5mLBenedict

Terbentuklarutanberwarnabiru

pemanasan

Terbentukendapanmerahbata

pendinginandengancepat

Sampelurinepria

+++

Sampelurinewanita

++++

TesAdanyaKreatinin
a.PercobaanJAFFE
5mLurine+1mLasampikrat
jenuh+1mLNaOH2M
5mLakuades+1mLasam

Urinepriaberwarnajinggakuning

Urinewanitaberwarnajinggakuning

Padaakuadesberwarnakuning

pikratjenuh+1mLNaOH2M
b.PercobaanWEYL
5mLurine+5tetesNa
nitropusid
penambahanNaOHhingga
alkalis
penambahanbeberapatetes

Urinepriaberwarnakuningkecoklatan

Urinewanitaberwarnakuning
kecoklatan

CH3COOH
4

TesAdanyaAsamUratdan
Garamnya
a.PercobaanMuroksid
0.5mLurine+3tetesHNO3
pekat
pemanasansampaikering
b.PercobaanReduksiPerak

Urinepriaterbentukendapankuning

kecoklatankering
Urinewanitaterbentukendapan

kuningkecoklatankering
Urinepriatidakmemberiperubahan

pembasahankertassaring

padakertassaring(kertassaring

denganAgNO3

tetapputih)

penetesandengancampuran5

Urinewanitajugatidakmemberi

tetesurine+5tetesNa2CO32%

perubahanwarnapadakertas

saring(kertassaringtetapputih)
5

TesAdanyaSenyawaKeton
10mLurine+(NH4)2SO4padat

Larutanmenjadijenuh

pengocokan
penambahan3tetesNanitropusid

Urinepriatetapkuningjernih

5%+2mLNH4OHjenuh

Urinewanitatetapkuningjernih

pengocokan,pendiaman30menit
6

TesAdanyaProtein
penyaringan10mLurine
pemanasan

Warnaurinemenjadipudar

penambahan35tetesCH3COOH

Urinepriatetapberwarnakuning

pengamatan

pudarjernih
Urinewanitatetapberwarnakuning

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

12/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id
pudarjernih

TesAdanyaAmino
2mLurine+2tetesPP+23tetes
Na2CO32%

Terbentuklarutanurineberwarna
merahjambupadasemuasampel
urine

pemanasansampaimendidih

Warnalarutanurinepadakedua
sampelmenjadikuningkecoklatan

peletakkankertassaringbasah
olehPPdiatasmuluttabungreaksi

Tidakadaperubahanwarnapada
keduakertassaring

pengamatanperubahanpada

Urinepria

kertassaring

Urinewanita

Urinepriaterbentukendapanyang

TesAdanyaKlorida
2mlurine+2tetesHNO3pekat+2
teteslarutanAgNO3

larutdenganamoniumhidroksida

pengamatan

berlebih
Urinewanitajugaterbentukendapan

yangdapatlarutdenganamonium
hidroksidaberlebih
9

TesAdanyaFosfatdanKalsium
10mLurine+1mLNH4OHhingga
alkalis
pemanasan

Urinepriatidakterbentukendapan

penyaringan

Urinewanitatidakterbentukendapan

pencucianendapandengan
akuades

pelarutanendapandalam1mL
CH3COOH2%
pembagiankedalam2tabung

tabungI+1tetesHNO3pekat+3

tetesamoniummolibdat

10

pemanasan

tabungII+3tetesK2C2O4

pengamatan

TesAdanyaSulfat
2mLurine+1tetesHClpekat+3
tetesBaCl2
pengamatan

Urinepriaterbentukendapan

Urinewanitaterbentukendapan

V.
V.HIPOTESA
Pada percobaan ini senyawasenyawa dan unsurunsur sekarang yang terkandung dalam
protein. Identifikasi meliputi senyawa organik serta senyawa anorganik dalam urine. Identifikasi
senyawa organik dalam urine yang akan dilakukan adalah pemecahan ureum oleh urease, tes
adanya gula pereduksi, tes kreatinin yaitu percobaan JAFFE dan WEYL, tes asam urat dan
garamnya,yaitupercobaanmuroksiddanreduksiperak(SCHIFF),tessenyawaketon,tesprotein.
Sedangkan identifikasi senyawa anorganik dalam urine meliputi tes adanya ammonia, adanya
klorida,tesadanyafosfatdankalsium,dantesadanyasulfat.Daribeberapaidentifikasiyaitutes
gula pereduksi akan menunjukkan kekeruhan atau endapan merah bata jika terdapat gula
pereduksi. Uji positif untuk senyawa keton yaitu adanya warna jingga, uji positif adanya protein
jikatimbulendapan,tespemecahanureumolehureasedenganadanyawarnamerahmuda,pada
percobaanWEYLadanyacincinmerahdanendapanyangbanyak,tesmuroksiddenganujipositif
adanyawarnakecoklatan,ujipositifSCHIFFterbentukcincinperak.Sedangkanuntuktesadanya
amoniaujipositifnyaadalahwarnamerahmudapadakertassaring,ujipositifadanyakloridayaitu
adanyaendapankeruhdanakanlarutjikapenambahanNH4OHberlebih,ujipositifuntuktesfosfat
yaitu adanya endapan kuning, uji positif tes kalsium yaitu timbul endapan atau kekeruhan yang
tidaklarut,ujipositifadanyasulfatadalahdenganadanyaendapankeruh
VIPEMBAHASAN

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

13/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

Percobaan identifikasi senyawa dalam urine ini bertujuan untuk mengetahui unsurunsur yang
terkandungdalamurine.Urineatauairseniatauairkencingadalahcairansisayangdiekskresikan
olehginjalyangkemudianakandikeluarkandaridalamtubuhmelaluiprosesurinasi.Eksreksiurin
diperlukanuntukmembuangmolekulmolekulsisadalamdarahyangdisaringolehginjaldanuntuk
menjagahomeostasiscairantubuh.Namun,adajugabeberapaspesiesyangmenggunakanurine
sebagai sarana komunikasi olfaktori. Urine disaring di dalam ginjal, dibawa melalui ureter menuju
kandungkemih,akhirnyadibuangkeluartubuhmelaluiuretra.
Fungsi utama urine adalah untuk membuang zat sisa seperti racun atau obatobatan dari dalam
tubuh. Anggapan umum menganggap urin sebagai zat yang "kotor". Hal ini berkaitan dengan
kemungkinan urine tersebut berasal dari ginjal atau saluran kencing yang terinfeksi, sehingga
urinenyapunakanmengandungbakteri.Namunjikaurineberasaldariginjaldansalurankencing
yangsehat,secaramedisurinsebenarnyacukupsterildanhampirtidakberbauketikakeluardari
tubuh. Hanya saja, beberapa saat setelah meninggalkan tubuh, bakteri akan mengkontaminasi
urindanmengubahzatzatdidalamurindanmenghasilkanbauyangkhas,terutamabauamonia
yang dihasilkan dari urea.Urine dapat menjadi penunjuk dehidrasi. Orang yang tidak menderita
dehidrasi akan mengeluarkan urine yang bening seperti air. Penderita dehidrasi akan
mengeluarkanurineberwarnakuningpekatataucokelat.
Identifikasisenyawadalamurinesangatpentingkarenadenganadanyaidentifikasisenyawadalam
urine bisa mengetahui ada dan tidaknya suatu penyakit dalam tubuh. Identifikasi urine bisa
dilakukandenganbeberapametodeberikut.
6.1SenyawaOrganikDalamUrine
6.1.1PemecahanUreumOlehUrease
Tujuan dari percobaan ini adalah untuk mengetahui adanya ureum dalam urine yang dapat
dipecah oleh enzim urease. Prinsip percoban ini adalah pemecahan ureum oleh enzim urease.
Padapercobaaniniyangberperansebagaisumberenzimureaseadalahtepungkedelai.Prosedur
pertama yang dilakukan adalah menambahkan indikator fenol merah pada urine pria dan wanita
sertapadaakuadessebagaipembanding.Penambahanindikatorfenolmerahinibertujuanuntuk
menandaiperubahanpHyangterjadipadalarutan.
Reaksifenolmerah:

(Anonim,2008)
Perubahan pH ini untuk menandai pH optimum enzim urease bekerja optimal. Fenol merah
merupakan indikator dengan range pH 6,08,4 dan pada suasana asam membentuk warna
kuning.
(Underwood,1986)
Penambahan natrium karbonat berfungsi untuk mencapai pH yang diinginkan yaitu pH enzim
ureasebekerjaoptimumpadasuasanabasa.PencapaianpHtersebutditandaidenganperubahan
warna. Penambahan asam asetat akan menghasilkan larutan berwarna kuning, baik pada urine
maupunakuades.Fungsiasamasetatadalahuntukmemberikansuasanaasam.
Selanjutnyadipanaskansehinggawarnalarutanpadaurinedanakuadesmenjadikuningmuda.
Fungsi pemanasan adalah untuk mencapai suhu optimal enzim urease, sehingga enzim tersebut
bekerja secara optimal pada proses pemecahan ureum. Kemudian penambahan tepung kedelai
kedalamsampelurinedanakuades.Fungsitepungkedelaiadalahsebagaisumberenzimurease.
Padasampelurinemenghasilakanlarutankuningkeruh,sedangkanpadaakuadesmenghasilkan
larutankuningyanglebihbening.Daripercobaandidapatkanhasilyangpositifpadakeduasampel
urine.
Reaksiyangterjadiadalah:

(Kusnawidjaya,1987)
6.1.2TesAdanyaGulaPereduksi
Ujiinibertujuanuntukmengidentifikasiadanyagulapereduksidalamurine.Prinsippercobaanini
adalah reaksi reduksi. Penambahan reagen benedict ini bertujuan untuk membentuk endapan
merahbataguguspereduksiyangterdapatdalamurinesaatdipanaskan.
Reaksiyangterjadiadalahsebagaiberikut:

(Martoharsono,1993)
Penambahanreagenbenedicttersebutmembuatlarutanmenjadiberwarnabirukemudianlarutan

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

14/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

tersebut dipanaskan. Pemanasan yang dilakukan bertujuan untuk mempercepat reaksi. Setelah
dipanaskan, dalam larutan yang berwarna biru, pada bagian dasar tabung reaksi terbentuk
endapanmerahbatayangmenunjukkanujipositif.
Tidak digunakan fehling pada percobaan ini karena benedict lebih peka daripada fehling untuk
mengidentifikasi adanya asam urat atau kreatinin sedangkan jika digunakan fehling maka asam
uratataukreatininakanmereduksifehlingsehinggagulapereduksitidakbisateridentifikasi.
Dari hasil percobaan didapatkan kedua sampel urine menunjukkan uji positif mengandung gula
pereduksi yang menunjukkan abnormalitas pada urine. Orang yang mempunyai urine jenis ini
menderitapenyakitDiabetesMelitus(DM).

6.1.3TesAdanyaKreatinin
6.1.3.1PercobaanJAFFE
Metode ini dilakukan untuk menunjukkan adanya kreatinin dalam urine. Prinsip percobaan ini
adalahpemecahankreatinin.Padametodeini,sampelurineditambahdenganasampikratjenuh
yang menghasilkan warna kuning pekat pada sampel urine dan warna kuning terang pada
akuades.KemudianditambahdenganNaOHyangmenghasilkanwarnajinggakuningpadakedua
sampel. Hal ini terjadi dengan memprotonkan nitrogen dalam suasana basa yang kemudian
terbentukkreatininrantailurus.Terbentuknyawarnajinggakuninginimenunjukkanujipositifyang
merupakan tanda telah terpecahnya kreatinin dalam urine menjadi kreatinin dan garam asam
pikrat. Dari percobaan yang telah dilakukan didapatkan hasil bahwa pada kedua sampel urine
positif mengandung kreatinin. Hal ini ditunjukkan dengan perubahan warna pada kedua sampel
urinemenjadikuningjingga.
Reaksiyangterjadi:

(Martoharsono,1993)
6.1.3.2PercobaanWEYL
Percobaan ini bertujuan untuk mengetahui adanya kreatinin dalam urine. Prinsip percobaan ini
adalah penambahan larutan basa untuk menghasilkan warna. Penambahan Sodium Nitroprusid
danNaOHbertujuanagarkreatinindapatbereaksidenganbasadanmenunjukkanwarnamerah.
Selanjutnya pada penambahan asam asetat berfungsi agar kreatinin menunjukkan warna reaksi
yang berbeda terhadap suasana asam yaitu kembali menjadi berwarna kuning. Uji positif yang
menunjukkanadanyakreatininadalahperubahanwarnamenjadimerahsaatditambahkanlarutan
basadankembaliberwarnakuningsaatpenambahanasam.Daripercobaanyangtelahdilakukan
didapat hasil bahwa pada urine wanita positif mengandung kreatinin sedangkan pada urine pria
jugamemberiujipositifmengandungadanyakreatinin.
Reaksiyangterjadiadalahsebagaiberikut:

(Martoharsono,1993)
6.1.4TesAdanyaAsamUratdanGaramnya
6.1.4.1PercobaanMuroksid
Percobaan ini bertujuan untuk mengidentifikasi senyawa asam urat dan garamnya dalam urine.
Prinsip percobaan ini adalah pemutusan ikatan rangkap pada asam urat. Penambahan HNO3
pekatdalampercobaaniniadalahuntukmemutusikatanrangkappadaasamurat(C=O)menjadi
ikatantunggalCOHdanmengeliminasiikatantunggalCHmenjadiikatanrangkapC=Nsehingga
dihasilkansenyawaberwarnakuningkecoklatan.
Reaksinya:

(Martoharsono,1993)
Pemanasan yang dilakukan bertujuan untuk mempercepat reaksi yang terjadi. Dari hasil
percobaan yang telah dilakukan didapat hasil terbentuknya endapan kuning kecoklatan pada
keduasampelurine.Haliniberartibahwadalamkeduasampelurinetersebutmengandungasam
urat.
6.1.4.2PercobaanReduksiPerak(SCHIFF)
Percobaaninibertujuanuntukmengetahuiadanyaasamuratdangaramnyadalamurine.Prinsip

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

15/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

percobaan ini adalah reduksi ionAg+ menjadiAg. Uji positif pada percobaan ini adalah adanya
lapisan seperti cermin perak yang menempel pada kertas saring. Penambahan larutan Na2CO3
bertujuan untuk membentuk garam dari asan urat ketika Na2CO3 bereaksi dengan asam urat.
PenambahanAgNO3bertujuanuntukmereaksikanAgNO3tersebutdengangaramdariasamurat
dan membentuk lapisan warna perak pada kertas saring akibat adanya reduksi Ag+ menjadiAg
olehgaramsodium(Na+)dariasamurattersebut.
Reaksiyangterjadiadalah:

(Kusnawidjaya,1987)
Dari hasil percobaan didapat hasil terbentuk endapan kuning kecoklatan pada kedua sampel
urine.Halinimenandakanbahwadalamsampelurinetersebuttidakmengandungasamurat.Hal
inidikarenakankandunganasamuratdalamurinesangatsedikit.
6.1.5TesAdanyaSenyawaKeton
Tujuan dari percobaan ini adalah untuk mengetahui adanya senyawa keton yang terkandung
dalam urine. Prinsip percoban ini adalah pengoksidasian gugus keton. Uji positif adanya keton
ditandai dengan terbentuknya warna jingga setelah berlangsungnya reaksi. Penambahan
(NH4)2SO4 padat bertujuan untuk mengkondisikan larutan urine yang asam menjadi netral.
Selanjutnya, ditambahkan dengan larutan nitroprusid dan NH4OH jenuh bertujuan agar reaksi
oksidasigugusketondapatberlangsungdalamsuasanabasa.
Reaksiyangterjadi:

(Kusnawidjaya,1987)
Darihasilpercobaandidapatkanbahwapadakeduasampelurinetidakterjadiperubahanwarna.
Kedua sampel urine tersebut tetap berwarna kuning jernih. Hal ini menandakan bahwa dalam
keduasampelurinetersebutnegatiftidakmengandunggugusketon.
6.1.6TesAdanyaProtein
Tujuan dari percobaan ini adalah untuk mengidentifikasi adanya protein dalam urine. Prinsip
percobaan ini adalah pemecahan protein menjadi monomermonomernya yang lebih sederhana.
Pertamakaliyangdilakukanadalahmenyaringurinedengantujuanagarpengotorpengotordalam
urine bisa terpisah. Kemudian urine tersebut dipanaskan dan ditambahkan asam asetat 2N.
Pemanasan ini bertujuan untuk mempercepat reaksi. Penambahan asam asetat berfungsi untuk
membuat protein yang ada dalam urine terdenaturasi sehingga terbentuk endapan yang
menandakanadanyaproteindalamurine.
Reaksiyangterjadi:

(Kusnawidjaya,1987)
Darihasilpercobaandidapatkanbahwapadakeduasampelurinelarutantetapbeningdantidak
terbentuk endapan. Hal ini menandakan bahwa dalam sampel urine tersebut tidak mengandung
protein.
6.2SenyawaAnorganikdalamUrine
6.2.1TesAdanyaAmonia
Percobaan ini bertujuan untuk mengidentifikasi senyawa amonia yang terdapat dalam urine.
Prinsip percobaan ini adalah reduksi NH4+ menjadi NH3. Urine ditambah dengan Na2CO3 yang
bertujuanuntukmembentukNH3.Ujipositifpercobaaniniadalahterbentuknyawarnamerahmuda
pada kertas saring. Kemudian ditambahkan indikator PP yang bertujuan untuk menandai
perubahanpHdariasammenjadibasasetelahpenambahanNa2CO3.
Reaksiphenolftalein(PP)adalah:

(Underwood,1986)
Pemanasan yang dilakukan bertujuan untuk mempercepat reaksi. Pada kertas saring ditetesi
denganindikatorPPyangbertujuanuntukmengetahuiadanyagasyangbersifatbasayangtimbul
selamaprosespemanasan.Gasyangbersifatbasatersebutdapatmerubahwarnakertassaring
yangtelahditetesiindikatorPPmenjadimerahmuda.Darihasilpercobaandidapatbahwakedua
sampelurinetersebutnegatif.Dalamkeduasampelurinetidakmengandungamoniakarenakertas
saring tersebut tidak berubah menjadi merah muda. Hal ini dikarenakan tidak ada gas amonia
yangdibebaskanselamareaksi.
Reaksiyangterjadi:

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

16/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

(Martoharsono,1993)
6.2.2TesAdanyaKlorida
Percobaan ini bertujuan untuk mengidentifikasi adanya klorida dalam urine. Prinsip percoban ini
adalah reaksi pembentukan kompleks dan reaksi pengendapan. Pada percobaan ini urine
ditambahdenganHNO3pekatdanAgNO3.FungsipenambahanHNO3pekatuntukmenguraikan
ikatanionikantaraClyangpadaumumnyaberikatandenganNa+.PenambahanAgNO3bertujuan
untuk mengendapkan Cl menjadiAgCl. Penambahan NH4OH berlebih adalah untuk melarutkan
endapan AgCl menjadi ion kompleks [Ag(NH4OH)]+. Uji positif dari percobaan ini adalah
terbentuknyaendapanatauwarnamerahmudayangdapatlarutjikaditambahkandenganNH4OH
berlebih. Hasil percobaan yang dilakukan didapat bahwa pada kedua sampel urine terbentuk
endapan dan warna merah muda yang kemudian larut dengan adanya penambahan NH4OH
berlebih. Hal ini menandakan bahwa dalam kedua sampel urine tersebut positif mengandung
klorida.
Reaksiyangterjadi:

(Martoharsono,1993)
6.2.3TesAdanyaFosfatdanKalsium
Percobaan ini bertujuan untuk mengidentifikasi adanya fosfat dan kalsium dalam urine. Prinsip
percobaan ini adalah reaksi pengendapan. Uji positif adanya fosfat dalam urine ditandai dengan
terbentuknya endapan warna kuning. Sedangkan Uji positif adanya kalsium adalah terbentuknya
endapan atau larutan yang keruh. Pada percobaan ini urine ditambah dengan larutan amonium
hidroksida yang berfungsi untuk membuat larutan bersifat alkalis. Kemudian larutan tersebut
dipanaskanuntukmempercepatreaksinya.Padasaatpemanasanlarutantidakterbentukendapan
sehingga ujinya negatif yang menandakan bahwa dalam kedua sampel urine tersebut tidak
mengandungfosfatdankalsium.
Reaksiyangterjadi:

(Kusnawidjaya,1987)
6.2.4TesAdanyaSulfat
Percobaan ini bertujuan untuk mengidentifikasi adanya sulfat dalam urine. Prinsip percobaan ini
adalahpengendapanionsulfat.Ujipositifpercobaaniniadalahterbentuknyaendapanputihatau
keruh pada larutan. Pada percobaan ini kedua sampel urine ditambah dengan HCl pekat dan
BaCl2. Penambahan HCl pekat bertujuan untuk mengkondisikan larutan dalam suasana asam.
SedangkanpenambahanBaCl2bertujuanuntukmengendapkanionSO42menjadiBaSO4yang
berwarnaputihdantidaklarut.
Reaksiyangterjadi:

(Kusnawidjaya,1987)
Dari hasil percobaan didapat hasil bahwa pada kedua sampel urine baik urine pria dan wanita
mengandungsulfatyangditandaidenganterbentuknyaendapan.

VII.KESIMPULAN
7.1Unsurunsuryangterkandungdalamurineantaralain:
7.1.1SenyawaOrganik:
Ureum,gulapereduksi,kreatinin,asamuratdangaramnya,ketondanprotein.
7.1.2SenyawaAnorganik
Amonia,klorida,fosfatdankalsiumsertasulfat
7.2Identifikasisenyawadalamurinebisadilakukandenganujipemecahanureumolehurease,uji
gulapereduksi,ujiadanyakreatinindenganpercobaanJAFFEdanWEYL,tesadanyaasamurat
dangaramnyayangmenggunakanpercobaanMuroksiddanreduksiperak(SCHIFF),tesadanya
senyawaketon,dantesadanyaproteinuntukujisenyawaOrganik.
7.3Identifikasi senyawa Anorganik dilakukan dengan Tes adanya amonia, klorida, sulfat, fosfat
dankalsium
7.4Darihasilpercobaandidapatkanbahwa:
7.4.1Pemecahanureumolehureasepadakeduasampelurinedidapatujipositif.
7.4.2Tesadanyagulapereduksijugamemberiujipositifpadakeduasampelurine.
7.4.3Tes adanya kreatinin pada percobaan JAFFE kedua sampel urine menunjukkan uji positif
mengandungkreatininsedangkanpadapercobaanWEYLkeduasampelmemberiujinegatiftidak

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

17/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

mengandungkreatinin.
7.4.4TesadanyaasamuratdangaramnyapadapercobaanMuroksiddanreduksiperak(SCHIFF)
keduasampelurinememberiujinegatif.
7.4.5Tesadanyasenyawaketondantesadanyaproteinkeduasampelurinememberiujinegatif.
7.4.6Tesadanyaamoniakeduasampelurinememberiujinegatif.
7.4.7Tesadanyakloridadantesadanyasulfatkeduasampelurinememberiujipositif.
7.4.8Tesadanyafosfatdankalsiumkeduasampelurinememberiujinegatif.
DaftarPustaka
Alqasaimeh, Heng & Ahmad, A Urea from Stacked SolGel Films with Immobilized Nile Blue
ChromoionophoreandUreaseEnzim,UniversityKebangsaanMalaysia,Malaysia.
Anonim,2008,SistemEkskresipadaHewanVertebrata,www.ilmupedia.com.
,2008,Ginjal,www.wikipedia.com.
Arora,H.,2004,DictionaryofChemistry,A.I.T.B.SPublisherandDistributors(Regd.),Delhi.
Basri,S.,1996,KamusKimia,RinekaCipta,Jakarta.
Bettelhem, 1995, Urinary Tract Infections, Definitions and Classification. Mosby Year Book Inc,
Missouri.
Daintith,J.,1990,KamusKimiaLengkap,Erlangga,Jakarta.
Harper,1961,ReviewofPhysiologicalChemistry,MedicalPublication,Canada.
Karaca,A., Baran,A., & Kaktanir, K., 1997, The Effect of Compaction on Urease EnzymeActivity,
Carbon Dioxide Evaluation and Nitrogen Mineralisation,Ankara University, Faculty ofAgriculture,
SoilScienceDepartment,AnkaraTURKEY.
Kusnawidjaya,1987,Biokimia,Alumni,Bandung.
Lee & Calhoun, 2003, Urease From Potentially Pathogenic Cocoid Isolate: Purification,
Characterization and Comparison to Other Microbial Urease, Departement of Chemistry, City
CollegeofNewYork,NewYork.
Martoharsono,1993,BiokimiaJilid3,UniversitasGajahMadaPress,Yogyakarta.
Mulyono,2001,KamusKimia,PT.GramediaPustakaUtama,Bandung.
Pringgodigdo,A.G.1973,EnsiklopediaUmum,YayasanParaBukuFranklin,Jakarta.
Soriano&Hausinger,1999,GTPDependentActivationOfUreaseApoproteininComplexwiththe
UreD,UreF,andUreGAccessoryProteins,DepartementofMicrobiologyandBiochemistry,USA.
Tauber&Kleiner,1931,StudiesonCristallineUrease,DepartmentofPhysiologicalChemistry,New
YorkHomeopathicMedical,NewYork.
TimDepKesRI,1994,BakteriuriInfektif,DepartemenKesehatanRI,Jakarta.
Underwood,1986,QuantitativeAnalysis,PrenticeHallInc,NewYork.
Tinggalkankomentarjikainibermanfaat
Download
Tag:Praktikum

PREVIOUS

NEXT

SURVIVAL(PengetahuanDasar)

PERCOBAANIIEnzim(PraktikumBiokimia
)

Artikel Terkait
PERCOBAAN VII REAKSI KIMIA III : KATALIS ENZIMATIS (KIMIA DASAR II)
ABSTRAKTelahdilakukanpercobaanyangberjudul,KatalisEnzimatis.
Tujuandaripercobaaniniadalahuntukmenget

PERCOBAAN V Reaksi Kimia II Sintesa Dan Stoikiometri


ABSTRAKTelahdilakukanpercobaanyangberjudulReaksiKimiaII:Sintesa
danStoikiometri.Tujuanpercobaaniniadalahm

PERCOBAAN III SIFAT KOLIGATIF LARUTAN : PENURUNAN TITIK BEKU (Kimia Dasar I)
PERCOOBAANIIISIFATKOLIGATIFLARUTAN:PENURUNANTITIKBEKUI.
TUJUANPERCOBAAN1.1.Mampumenjelaskanpengaruhzat

PERCOBAAN VII REAKSI KIMIA III : KATALIS ENZIMATIS ( Praktikum Kimia Dasar II )
ABSTRAKTelahdilakukanpercobaanyangberjudul,KatalisEnzimatis.
Tujuandaripercobaaniniadalahuntukmengetahuipengar

PERCOBAAN VI Reaksi Asam-Basa Asam Polikromatik (Kimia Dasar II)


AbstrakTelahdilakukanpercobaandenganjudulReaksiAsamBasa:Asam
Polikromatik.Tujuandaripercobaaniniadalahunt

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

18/19

3/28/2016

PERCOBAANIIIUrineIdentifikasiSenyawaDalamUrine(PraktikumBiokimia)Najih.web.id

0Comments

Sortby Oldest

Addacomment...

FacebookCommentsPlugin

0 Komentar untuk "PERCOBAAN III - Urine Identifikasi Senyawa Dalam


Urine ( Praktikum Biokimia )"

MasukkankomentarAnda...

Berikomentarsebagai:

Publikasikan

Unknown(Google)

Keluar

Beritahusaya

Pratinjau

PARTNERSHIP

LABEL

BLOG ARCHIVE

DownloadMusic

Ebook

Maret2016(3)

DownloadSoftware&Games

MateriKuliah

Februari2016(3)

IntermolecularChemistry

MountainClimber

Januari2016(20)

MENGENAI SAYA

OrganicChemistry

Desember2015(7)

Pengetahuan

November2015(8)

PhysicalChemistry

Oktober2015(8)

Praktikum

September2015(2)

Research

Juli2015(1)

Wisata

Juni2015(3)

ahmad
najihullah Moreinfo
Ikuti

Mei2015(20)

26

April2015(27)

Lihatprofillengkapku
Copyright2015:Najih.web.idAllRightsReserved
Templatebynajih

http://www.najih.web.id/2015/04/percobaaniiiurineidentifikasi.html

19/19