NCGD Prosiding PDF

National Conference on Governance and Development 2018 29-30 October 2018 SOG-UUM
KERTAS KERJA UMUM (GENERAL PAPERS)
-GP01-
Tahap Amalan Penjagaan Kebersihan Masyarakat Di Selangor Berkaitan Wabak
Denggi
Hamidi Ismail, Siti Zaitun Osman, Tuan Pah Rokiah Syed Hussain
Pusat Pengajian Kerajaan
Universiti Utara Malaysia
hamidi@uum.edu.my
Abstrak
Negeri Selangor merupakan kawasan yang mencatatkanjumlah kes pesakit denggi tertinggi di
Malaysia seperti antara tahun 2013 hingga 2017. Kajian lepas masih gagal menjelaskan
tentang tahap amalan penjagaan kebersihan berkaitan wabak ini. Oleh itu, objektif kajian dan
penulisan ini adalah menentukan tahap amalan penjagaan kebersihan masyarakat di Selangor.
Kaji selidik melibatkan 447 responden untuk seluruh sembilan buah daerah di Selangor. Teknik
analisis yang digunakan adalah peratusan. Dapatan kajian menunjukkan bahawa nilai
peratusan tahap amalan penjagaan kebersihan berkaitan wabak denggi di Selangor adalah
sekitar 84.9 peratus iaitu tahap tinggi. Keseruluhannya,kajian mendapati dari segi amalan
penjagaan kebersihan bukan faktor penentu kepada munculnya wabak denggi berterusan di
Selangor. Kemunculan wabak ini secara berterusan mungkin disebabkan oleh lain-lain faktor
sebagaimana kajian terdahulu seperti cuaca dan iklim, kepadatan penduduk dan tepubina serta
sistem perparitan yang bermasalah.
Kata kunci: Aedes, Amalan Penjagaan Kebersihan, Selangor, Wabak Denggi
Abstract
The State of Selangor is an area that records the highest number of dengue cases in
Malaysia such as between 2013 and 2017. Previous studies have still failed to explain the level
of hygienic care practices in associated with the outbreaks. Therefore, the objective of this study
and writing is to determine the level of public hygiene practices in Selangor. The survey involved
447 respondents for all nine districts in Selangor. The analysis technique used is percentage.
The findings show that the percentage of public hygiene practices related to the dengue
outbreaks in Selangor is around 84.9 percent and it is at a high level. Overall, the study found
that in terms of public hygiene practices was not a determining factor in the emergence of a
continuing dengue outbreaks in Selangor. The emergence of the epidemic is likely to be due to
other factors described by previous studies such as weather and climate, population density and
the problematic drainage system.
Keywords: Aedes, Hygiene Care Practices, Selangor, Dengue Outbreaks
1. PENGENALAN
1
Wabak denggi adalah disebabkan oleh virus denggi yang dibawa oleh vektor nyamuk.
Vektor yang menyebabkan penyakit denggi adalah terdiri daripada dua jenis spesies nyamuk
aedes iaitu albopictus dan aegypti (Chan & Counsilman, 1985). Aedes aegypti merupakan
nyamuk yang biasa dijumpai dalam rumah, manakala aedes albopictus pula selalu ditemui di
luar kawasan rumah. Nyamuk aedes dapatdikenali dengan badan serta kakinya yang berbelang
hitam dan putih. Hanya nyamuk aedes betina sahaja boleh menyebarkan virus denggi serta
membiak dalam takungan airjernih dan aktif mengigit mangsa pada awal pagi atau senja.
Penularan penyakit denggi merupakan paling pantas di dunia yang dibawa oleh nyamuk.
Ini kerana, mengikut statistik 50 tahun kebelakangan ini, wabak denggi telah meningkat 30 kali
ganda dari bandar ke kawasan kampung. Dianggarkan 50 juta jangkitan denggi berlaku setiap
tahun dan 2.5 bilion orang yang tinggal di kawasan berendemik denggi, manakala pada tahun
2010 hampir 2.4 juta kes demam denggi dilaporkan. Justeru, Pertubuhan Kesihatan Sedunia
(WHO) menggesa komitmen yang tinggi untuk mengurangkan wabak denggi daripada terus
menular ke luar sempadan negara.Penularan wabak penyakit seperti denggi melibatkan
ruangan dan masa melibatkan faktor alam sekitar, perubahan guna tanah, penduduk,
persekitaran sosial dan ekonomi (Mohd Naim Mohamad Rasidi et al., 2013). Pengkaji-pengkaji
lain pula mendapati wabak ini boleh juga berpunca daripada gangguan habitat oleh Murray et
al. (2013), aspek kependudukan (Abdul Hadi Harman Shah et al., 2010), serta aspek cuaca dan
iklim oleh Er Ah Choy dan Wayandiana Abdullah (2017).
Amalan penjagaan kebersihan adalah perkara penting dalam kehidupan seseorang

kerana sekiranya tidak diamalkan dengan baik boleh mewujudkan pelbagai masalah seperti
penularan wabak penyakit. Menurut Hazura Abu Bakar dan Sharifah Norhaidah Syed Idros
(2007), amalan penjagaan kebersihan merupakan proses memelihara alam sekitar untuk
memastikan kesinambungan kehidupan manusia kerana dalam Islam menyarankan kehidupan
manusia tidak hanya terbatas kepada hubungan sesama manusia sahaja tetapi juga terhadap
alam sekitar. Hukil Sino et al. (2013) berpendapat amalan penjagaan kebersihan yang baik
dapat menjamin persekitaran selesa serta dapat menghindari dari pelbagai penyakit kerana ia
saling berhubungkait dalam kehidupan masyarakat.
Kajian lepas menunjukkan bahawa terdapat pelbagai fokus kajian terhadap wabak
denggi dilakukan. Umpamanya, isu pengetahuan dan cara hidup (Constantianus et al, 2006),
punca pembiakan nyamuk dan kesannya kepada manusia (Bilal Mat Junoh, 2012; Katyal et al.,
2003). Justeru, amalan penjagaan kebersihan oleh masyarakat dalam hal ini terdapat keperluan
untuk kajian ilmiah. Oleh itu, objektif makalah ini adalah untuk menentukan tahap amalan
penjagaan kebersihan masyarakat di Selangor.
Hal ini kerana, Selangor merupakan negeri yang paling kerap dan sentiasa tinggi kes
denggi setiap tahun (Jadual 1). Kes wabak denggi mula dilaporkan di Malaysia pada tahun
1901 di Pulau Pinang dan pada tahun 1962 kes pertama demam denggi berdarah pula
dilaporkan serta merebak ke seluruh negara pada tahun 1973. Menurut KKM (2015), Selangor
merupakan kawasan yang mempunyai bilangan kes denggi dan demam denggi berdarah
tertinggi di Malaysia. Sehingga 6 Jun 2015, bagi keseluruhan Negeri Selangor mencatatkan
jumlah kes sebanyak 28,549 orang dan diikuti oleh lain-lain negeri seperti Wilayah Persekutuan
Kuala Lumpur (WPKL), Putrajaya (3,108 orang), Perak (5,207 orang) serta Johor (3,195 orang).
Jumlah kes demam denggi yang dilaporkan dari Januari hingga 22 Jun 2016 adalah sebanyak
10,482 kes. Walau bagaimanapun, jumlah kes sedikit berkurangan kepada 1,915 kes yang
dilaporkan bagi tempoh yang sama pada tahun 2017. Sungguhpun begitu, Selangor masih
menjadi negeri pertama yang menyumbang kepada kes demam denggi (Jadual 1).
2
Jadual 1. Jumlah Kes Denggi di Selangor Dari Tahun 2013 Hingga 2017
Januari Januari
Januari Januari Januari hingga
hingga hingga
Negeri hingga hingga 22 18 Febuari
13 April 13 April
6 Jun 2015 Jun 2016 2017
2013 2014
Kes Kes Kes Kes Kes
(Kematian) (Kematian) (Kematian) (Kematian) (Kematian)
Selangor 15,535 (26) 3,023 (1) 28,549 (72) 5,136(9) 1047(0)
WPKL/Putrajay 726 (1) 148 (2)
a 2,049 (4) 526 (3) 3,108 (17)
Perak 1,914 (5) 595 (0) 5,207 (12) 406 (0) 175 (0)
Johor 1,662 (12) 655 (6) 3,195 (7) 1,655 (1) 135 (0)
Kelantan 1,542 (4) 407 (0) 683 (3) 188 (0) 107 (0)
Negeri 298 (3) 74 (1)
Sembilan 1,414 (2) 134 (0) 816 (7)
Melaka 879 (3) 143 (0) 833 (3) 242 (1) 31 (0)
P.Pinang 602 (3) 210 (0) 2,377 (6) 554 (3) 36 (1)
Sabah 370 (0) 241 (1) 1,324 (4) 320 (0) 46 (0)
Pahang 354 (0) 173 (0) 1,092 (5) 269 (0) 42 (0)
Sarawak 346 (2) 563 (2) 1,120 (2) 122 (0) 37 (1)
Terengganu 260 (1) 59 (0) 483 (2) 449 (5) 9 (0)
Kedah 207 (2) 215 (1) 414 (3) 87 (0) 20 (0)
Perlis 58 (0) 46 (0) 110 (1) 30 (0) 8 (0)
WP Labuan 10 (0) 0 (0) 1 (0) 0 (0) 0 (0)
MALAYSIA 27,202 (64) 6,990 (14) 49,312 (144) 10,482 (23) 1,915(5)
Sumber: Diolah daripada KKM (2017)
2. METODOLOGI
Negeri Selangor terletak di bahagian tengah pantai barat Semenanjung Malaysia dan
bahagian barat Banjaran Titiwangsa serta bersempadan dengan Negeri Perak di sebelah utara,
Pahang di sebelah timur dan Negeri Sembilan di sebelah selatan. Negeri Selangor mempunyai
keluasan sebanyak kira-kira 7,960 km persegi (Pejabat Daerah Tanah Kuala Selangor, 2015).
Selangor dibahagikan kepada sembilan daerah yang terdiri dari Sabak Bernam, Hulu Selangor,
Kuala Selangor, Gombak, Klang, Petaling, Hulu Langat, Kuala Langat dan Sepang.
Persampelan adalah dilakukan dengan berpandukan kepada pendapat Babbie (1986),

Krejcie dan Morgan (1970) serta Sekaran (2003). Menurut mereka, sekiranya jumlah populasi
sesebuah kawasan seramai 5,462,100 orang, maka saiz sampel yang ideal adalah seramai 447
orang dengan mengambil kira kecukupan sampel bagi analisis secara statistik inferensi. Jumlah
seramai 447 orang ini adalah berdasarkan kepada darjah keyakinan setinggi 95 peratus dan
darjah ketepatan setinggi alpha (α)= 0.035 iaitu berada antara α=0.05 hingga α=0.01 (Krejcie &
Morgan, 1970; The Research Advisors, 2006). Darjah ketepatan dan keyakinan ini adalah
bersesuaian dalam konteks kajian sains sosial, malah sedikit lebih baik berbanding dengan
α=0.05 (Krejcie & Morgan, 1970; The Research Advisors, 2006). Jumlah saiz sampel ini adalah
optimum kerana tidak melebihi 500 dan tidak kurang daripada 384 sampel (Jadual 2).
3
Jadual 2.Saiz Sampel Bagi Kawasan Kajian Mengikut Daerah
Daerah *Jumlah penduduk 2010 % Saiz sampel

Petaling 1,812,600 33.2 148
Hulu Langat 1,156,600 21.2 95
Klang 861,200 15.8 71
Gombak 682,200 12.5 56
Kuala Langat 224,600 4.1 19
Kuala Selangor 209,600 3.8 17
Sepang 211,400 3.9 17
Hulu Selangor 198,100 3.6 16
Sabak Bernam 105,800 1.9 8
SELANGOR 5,462,100 100 447
Sumber: Jabatan Perangkaan Malaysia (2011)*
Bagi menentukan tahap amalan, pengkaji mengguna pakai teknik peratusan kerana ia
lebih mudah bibuat generalisasi dan sering juga menjadi rujukan ukuran. Dalam hal ini, pengkaji
mengoperasionalkan sesuatu tahap berasaskan kepada peratusan sebagaimana berikut. Kajian
meletakkan bahawa tahap tinggi seharusnya dalam lingkungan Skala 3 dan 4 dengan nilai
jumlah peratusan antara 71 hingga 100 peratus. Dalam konteks tahap sederhana pula
ditafsirkan melalui Skala 2 dengan nilai peratusan antara 41 hingga 70 peratus. Seterusnya,
tahap rendah pula merujuk kepada Skala 1 dengan nilai peratusan 40 peratus dan ke bawah.
Jumlah tinggi, sederhana mahupun rendah adalah berasaskan kepada penjumlahan nilai
peratus bagi skala yang ditentukan iaitu 3 dan 4 (tinggi), 2 (sederhana) dan 1 (rendah). Bagi
Skala 3 dan 4 dijumlahkan bersama kerana kaji selidik menetapkan bahawa ia adalah skala
yang baik atau tinggi.
3. HASILDAN PERBINCANGAN KAJIAN
Berdasarkan dapatan kajian berkenaan tahap amalan penjagaan kebersihan oleh

masyarakat di Selangor berkaitan penyakit denggi didapati ia adalah tinggi. Semua item ujian
menunjukkan taburan peratusan jawapan tertumpu kepada Skala 3 dan 4 berbanding dengan
lain-lain skala. Jumlah jawapan responden bagi Skala 3 adalah setinggi 47.7 peratus, manakala
bagi Skala 4 pula setinggi 37.2 peratus. Oleh kerana itu, sekiranya dijumlahkan skala jawapan
yang setuju dengan sangat setuju menjadikan keseluruhannya berjumlah 84.9 peratus (iaitu
dalam situasi amalan penjagaan kebersihan yang baik). Oleh kerana nilai peratusan berjumlah
84.9 peratus, maka ia berada dalam kedudukan tahap tinggi (71 hingga 100 peratus) (Jadual 3).
Jadual 3.Tahap Amalan Penjagaan Kebersihan Berkaitan Penyakit Denggi di Selangor

No %
Item ujian amalan Min SD
. 1 2 3 4
1 Saya sentiasa mendapatkan 3.06 734 2.9 15.2 54.6 27.3
maklumat mengenai penjagaan
amalan kebersihan yang betul
2 Saya sering membaca atau 3.09 742 2.9 14.5 53.0 29.5
menonton televisyen berkenaan
dengan kurangnya amalan
penjagaan kebersihan dalam
masyarakat
4
3 Saya memastikn tiada air yang 3.24 757 3.8 8.1 48.3 39.8
bertakung di sekitar kawasan
rumah termasuklah laluan air di
bahagian bumbung rumah
4 Saya menghubungi pihak yang 2.88 903 8.1 23 41.4 27.5
berkenaan jika terdapat rumah
kosong atau sampah yang menjadi
tempat pembiakan nyamuk aedes
5 Saya kerap menyapu sampah di 3.28 724 2.9 7.4 48.8 40.9
luar dan di dalam rumah bagi
memastikan kebersihan rumah
terjamin
6 Saya sering berganding bahu 3.06 766 2.9 17.9 49.9 29.3
dengan penduduk setempat serta
pelbagai agensi untuk
meningkatkan mutu penjagaan
kebersihan
7 Saya memastikan penggunaan 2.93 868 8.1 17 48.5 26.4
tayar buruk sebagai perhiasan
digunakan dengan betul bagi
menghindari pembiakan nyamuk
aedes di dalamnya
8 Memasukkan bekas-bekas yang 3.24 719 2.7 8.5 50.6 38.3
menakung air ke dalam plastik
sebelum membuangnya ke dalam
tong sampah
9 Saya sentiasa menggelakkan 3.41 666 1.6 5.4 43.6 49.4
persekitaran rumah saya daripada
berbau busuk dan tidak selesa
10 Mengelakkan membuang minyak 3.39 667 1.6 5.6 44.7 48.1
cat atau kimia di dalam longkang
yang boleh menyebabkan longkang
tersumbat dan air tercemar
11 Kesedaran bagi menghargai 3.47 634 9.0 4.9 40.9 53.2
keperluan amalan penjagaan
kebersihan perlu kerana ia
adalah anugerah dari tuhan
Keseluruhan 3.19 744 4.23 11.6 47.7 37.2
N= 447
Skala:1=Sangat Tidak Setuju (STS)2=Kurang Setuju (KS)3=Setuju (S)4=Sangat Setuju (SS)
Dalam konteks item ujian amalan, analisis menunjukkan Item Ujian 11 iaitu ―Kesedaran
bagi menghargai keperluan amalan penjagaan kebersihan perlu kerana ia adalah anugerah
dari tuhan‖ mempunyai jawapan paling kerap dengan 94.1 peratus berbanding lain-lain item
ujian; sebaliknya, Item Ujian 4 adalah paling rendah iaitu ―Saya menghubungi pihak yang
berkenaan jika terdapat rumah kosong atau sampah yang menjadi tempat pembiakan nyamuk
aedes‖ dengan hanya setinggi 68.9 peratus.
Justeru, tahap amalan penjagaan kebersihan oleh masyarakat di Selangor yang ingin
ditentukan oleh pengkaji mendapati ia masih dalam keadaan baik, sekalipun berlaku masalah
wabak denggi berterusan. Kes denggi yang berlaku berterusan dan lebih tinggi kejadiannya di
5
Selangor berbanding lain-lain negeri dalam hal ini bukan disebabkan oleh amalan kebersihan
masyarakat. Keadaan yang berlaku mungkin disebabkan oleh lain-lain faktor sebagaimana
pendapat kajian terdahulu seperti oleh Mohd Naim Mohamad Rasidi et al. (2013).Antaranya,
aspek gangguan habitat oleh Murray et al. (2013). Abdul Hadi Harman Shah et al. (2010)
tentang kependudukan kerana menentukan tahap urbanisasi atau tepubina sesebuah kawasan.
Bagi Er Ah Choy dan Wayandiana Abdullah (2017) pula mengaitkannya dengan aspek cuaca
dan iklim.
4. KESIMPULAN
Secara keseluruhannya, kajian ini membincangkan aspek amalan penjagaan kebersihan

berkaitan dengan wabak denggi di Selangor.Kajian ini dijalankan atas motivasi perlunya kajian
secara ilmiah tentang tahap amalan penjagaan kebersihan oleh masyarakat di Selangor
berkaitan dengan wabak denggi. Keperluan ini terserlah kerana kajian-kajian sebelumnya gagal
menerangkan tahap amalan penjagaan kebersihan berkaitan wabak denggi di Selangor.
Justeru, menerusi dapatan dan perbincangan kajian di atas, pengkaji mendapati tahap amalan
penjagaan kebersihan adalah baik, sekitar 84.9 peratus. Kejadian wabak denggi masih berlaku
dan kekal mendahului lain-lain negeri di Malaysia mungkin disebabkan oleh lain-lain faktor yang
dibincangkan di atas.Oleh kerana itu, kajian mencadangkan langkah pengurusan seterusnya
perlu menekankan aspek selain daripada amalan penjagaan kebersihan oleh masyarakat
kerana kemungkinan boleh mewujudkan wabak denggi secara berterusan di Selangor.
RUJUKAN
Abdul Hadi Harman Shah, Abdul Samad Hadi, Shaharudin Idrus & Ahmad Fariz Mohamed.
(2010). Kelestarian bandar sebagai habitat manusia. International Journal of the Malay
World and Civilisation 28(2), 175-194.
Babbie, E. (1986). The practice of social research. Ed. 4. Belmont, CA: Wadsworth Publishing
Co.
Bilal Mat Junoh. (2012). Krisis tentang penyakit demam denggi Negeri Selangor. Selangor:
Kolej Sains Kesihatan Bersekutu Sungai Buloh.
Carmen, L.P-G., Seda, H., Garcia-Rivera, E.J. & Clark, G.G. (2005). Knowledge and attitude in
puerto Rico concerning dengue prevention. Publica 17(4), 11-24.
Chan, K.L. & Counsilman, J.J. (1985). Effect of slum clearance, urban redevelopment and
vector controlon densities of Aedes mosquitoes in Singapore. Tropical Biomedicine 2,
139-147.
1 Constantianus, J.M., Koenraadt, W.T., Sithiprasasna, R., Ao James, U.K., Jones, W.
&Scott, T.W. (2006).Dengue virus serotype 4 and chikungunya virus coinfection in a
traveller returning from Luanda, Angola. The american Journal of tropical medicine and
Hygience.4(2), 75-92.
Er Ah Choy &Wayandiana Abdullah. (2017). Menangani wabak denggi di Malaysia: satu
tinjauan kaedah rawatan dan pencegahan. Geografia-Malaysian Journal of Society and
Space 12(9)
Hazura Abu Bakar & Sharifah Norhaidah Syed Idros. (2007). Pemeliharaan alam tabii
bersumberkan pengetahuan Islam. Pendidikan Sains 7(1),31-45.
Hukil Sino, Zurina Mahadi, Hasnah Haron, Muhammada Aizat Misrin, Nurul‘Izzah Ismail & Mohd
Hasamizi Mustapa. (2013). Hubungan di antara amalan kebersihan diri pengendali
6
makanan dan kebersihan kafetaria di kolej kediaman UKM. Jurnal Sains Kesihatan
Malaysia 11(1), 1-8.
Jabatan Perangkaan Malaysia. (2011). Laporan Banci Penduduk dan Perumahan Negara 2010.
Putrajaya: Jabatan Perangkaan Malaysia.
Katyal, R., Kumar, K., Gill, K.S. & Sharma, R.S. (2003). Impact of intervention measures on
DF/DHF cases and aedes aegypti indices in Delhi, India. Dengue Bulletin 27.
KKM. (2015). Virus Denggi. Http://www.moh.gov.my [Diakses pada 1 Mei 2015].
KKM. (2017). Virus Denggi. Http://www.moh.gov.my [Diakses pada 1 Mei 2018].
Krejcie, R. & Morgan, D. (1970). Determining sample size for research aktivities. Educational
and Psychological Measurement 30, 607-610.
Mohamad Naim Mohamad Rasidi, Mazrura Sahani, Hidayatulfathi Othman, Rozita Hod,
Shaharudin Idrus, Zainudin Mohd Ali, Er Ah Choy & Mohd Hafiz Rosli. (2013). Aplikasi
Sistem Maklumat Geografi untuk pemetaan reruang-masa: suatu kajian kes denggi di
Daerah Seremban, Negeri Sembilan, Malaysia. SainsMalaysiana 42(8), 1073–1080.
Murray, N.E.A., Quam, M.B. & Wilder-Smith, A. (2013). Epidemiology of dengue: past, present
and future prospects. Clinical epidemiology5, 299
Pejabat Daerah Tanah Kuala Selangor. (2015). Budaya hidup sihat langkah terbaik atasi
denggi. Http://www.selangor.gov.my [Diakses pada 30 Oktober 2015].
Sekaran, U. (2003). Research methods for business: a skill building approach. Ed. 4. New York:
John Wiley & Sons.
-GP02-
Penilaian Terhadap Kualiti Persekitaran dan Kehidupan Berasaskan

Konsep Bandar Selamat di Malaysia
Tuan Pah Rokiah Syed Hussain1dan Hamidi Ismail2

1 Pusat Pengajian Kerajaan, Universiti Utara Malaysia, sh.rokiah@uum.edu.my
2 Pusat Pengajian Kerajaan, Universiti Utara Malaysia, hamidi@uum.edu.my
Abstrak
Selaras dengan perkembangan pembandaran di Malaysia pada masa kini pelbagai

pendekatan telah diperkenalkan dan diamalkan dalam mempertingkatkan aspek keselamatan
awam di kawasan bandar. Objektif terpenting adalah untuk mempertingkatkan kualiti
persekitaran dan kehidupan melalui keselamatan awam, terutama dilihat daripada sudut kadar
jenayah. Bagi mengekalkan keharmonian dan jaminan keselamatan kepada suatu tahap yang
memuaskan, suatu pendekatan diperkenalkan oleh kerajaan, iaitu menerusi konsep Bandar
Selamat, yang diperkenalkan pada awal tahun 2004 untuk dipraktiskan ke seluruh negara.
Tujuan utama kajian ini adalah untuk menilai sama ada konsep bandar selamat telah berjaya
dilaksanakan bagi seluruh bandar di negara ini atau sebaliknya. Persoalan kajian ini adalah
untuk menilai sejauhmanakah tahap keselamatan awam dapat dipertingkatkan melalui konsep
Bandar Selamat. Kajian akan menilai data statistik jenayah mengikut pendekatan Konsep
Bandar Selamat daripada tahun 2004 sehingga 2016. Peningkatan kadar jenayah setiap tahun
sudah pasti menunjukkan bahawa masih terdapat bandar-bandar di Malaysia yang kurang
selamat dan pihak kerajaan perlu melaksanakan program-program Bandar Selamat kepada
7
masyarakat dengan lebih kerap agar kesedaran terhadap Konsep Bandar Selamat dapat
ditingkatkan dalam kalangan masyarakat. Di samping itu pihak kerajaan juga perlu membentuk
persekitaran bandar dan taman-taman perumahan yang selamat dan aman sejahtera, iaitu
bebas daripada cengkaman jenayah, melalui prinsip rekabentuk persekitaran yang selamat,
memperkasakan kawasan sasaran dan pembangunan komuniti melalui kegiatan sosial dan
kemasyarakatan. Selain itu, beberapa dasar dan konsep rancangan pembangunan negara yang
berkaitan dengan aspek pengurangan jenayah seperti Yayasan Pencegahan Jenayah Malaysia
atau Malaysia Crime Prevention Foundation (MCPF) dan Crime Prevention through
Environmental Design (CPTED) juga turut dibincangkan bagi menangani kadar jenayah di
negara ini.
Kata Kunci: Jenayah, keselamatan awam, Konsep Bandar Selamat, Malaysia
1. PENGENALAN
Bandar selamat atau “safer cities” merupakan suatu konsep pembangunan bandar yang
diwujudkan di bawah program yang dianjurkan oleh United Nation iaitu “Urban Habitat” pada
tahun 1996. Selain itu, bandar selamat juga merupakan sebuah konsep mikro yang bertujuan
untuk mencapai matlamat pembangunan yang lebih makro iaitu dengan membangunkan
sebuah bandar yang mapan dan berdaya huni. Konsep pembangunan makro ini telah
meletakkan syarat bahawa aspek keselamatan sebagai salah satu ciri utama kesejahteraan
bandar berdaya huni. Justeru, pembentukan bandar selamat lebih memberi fokus kepada
perkara berkaitan keselesaan, kesejahteraan, keselamatan dan kesihatan komuniti (Wan Rozali
Wan Hussin 2007). Di Malaysia, konsep pembangunan bandar selamat ditakrifkan sebagai
sebuah bandar yang bebas daripada segala ancaman fizikal, sosial dan mental. Dengan kata
lain, persekitaran bandar hendaklah sentiasa terpelihara daripada kejadian yang mampu
mengganggu kesejahteraan dan keselamatan komuniti. Di samping itu, konsep bandar selamat
juga dikenali sebagai Crime Prevention through Environmental Design (CPTED) yang
berkonsepkan kepada idea bahawa reka bentuk persekitaran fizikal secara efektif boleh
mempengaruhi perlakuan manusia daripada melakukan kesalahan dan mengurangkan
perasaan takut terhadap insiden jenayah serta meningkatkan kualiti persekitaran dalam
kehidupan. Ini kerana kadar jenayah yang tinggi akan menjejaskan kehidupan masyarakat yang
tinggi terutamanya di bandar daripada segi psikologi dan fizikal serta menjadi dilema dalam
kalangan mereka apabila berada di tempat awam (Abdul Rahman Embong 2011).
2. ASAS PEMBENTUKAN BANDAR SELAMAT
Pembentukan bandar selamat telah diasaskan oleh Jabatan Perancangan Bandar dan
Desa (JPBD) pada tahun 2004 setelah mendapat kelulusan dalam mesyuarat Jemaah Menteri.
Selain itu, pelaksanaan program bandar selamat adalah berdasarkan kepada empat matlamat
utama iaitu pertama; mewujudkan sebuah bandar yang bebas daripada keganasan merosakkan
harta benda dan nyawa seperti ragut, pecah rumah, kecurian dan sebagainya, kedua;
mewujudkan sebuah bandar yang bebas daripada kemusnahan akibat bencana alam, ketiga;
mewujudkan bandar yang bebas daripada kemerosotan sosial dan moral seperti penagihan
dadah, vandalisme, salah guna kuasa dan sebagainya, dan keempat; mewujudkan sebuah
8
bandar yang bebas daripada kemalangan sama ada di luar atau dalam bangunan seperti
kemalangan jalan raya, kebakaran dan sebagainya (Faizah Md. Latif 2015).
Selain itu, pada tahun 2010 takrifan bandar selamat telah dibuat sikit pengubahsuaian
yang merangkumi tiga strategi pelaksanaan iaitu sebuah bandar yang bebas daripada
kemusnahan dan malapetaka akibat bencana alam; sebuah bandar yang bebas daripada
kemerosotan sosial dan moral; dan ketiga adalah sebuah bandar yang bebas daripada
berlakunya kemalangan yang mampu meragut nyawa sama ada di dalam atau di luar
bangunan. Justeru, secara amnya, kewujudan bandar selamat adalah bertujuan untuk
membangunkan sebuah bandar yang selamat daripada segi sosial dan alam sekitar bagi
memastikan sebuah komuniti sesebuah bandar itu dapat menjalani kehidupan dengan selamat,
sihat dan sejahtera (Jalalaludin Abdul Malek dan Mohd Asruladlyi Ibrahim 2015).
3. KONSEP BANDAR SELAMAT DI NEGARA MAJU
Program Bandar Selamat sebagai Bandar bebas jenayah sebenarnya bertitik tolok
daripada program Bandar Selamat yang dilancarkan di peringkat antarabangsa. UN-Habitat
merupakan badan antarabangsa yang bertanggungjawab mencetuskan idea tentang konsep ini
rentetan daripada peningkatan kadar kes jenayah dibandar yang telah menimbulkan pelbagai
episod keganasan. Fenomena ini mendapat perhatian UN-Habitat sehingga membawa kepada
pelancaran Program Bandar Selamat pada tahun 1996. Di peringkat antarabangsa, UN-Habitat
dengan kerjasama daripada pelbagai agensi pertubuhan dunia yang lain seperti United Nations
Development Programme (UNDP), United Nation Children‟s Fund (UNICEF) dan United Nations
Economic, Social and Cultural Organization (UNESCO) telah bertindak menyokong dan
menggalakkan pihak-pihak berkuasa tempatan melaksanakan Program Bandar Selamat
(Crawford 1998).
Menurut Crawford (1998), dari segi perspektif kriminologi di United Kingdom, Konsep
Bandar Selamat atau ―safe city‖ bukanlah merupakan suatu perkara baru kerana program ini
telah dimulakan semenjak 1980-an lagi. Menurut Crawford program ini telah dirangka sebagai
satu inisiatif yang praktikal untuk mengurangkan insiden jenayah, khususnya di persekitaran
kawasan kediaman iaitu melalui kerjasama dengan agensi awam dan swasta. Pelaksanaan
program ini berlandaskan prinsip mencegah jenayah sebelum masalah lain muncul
disebabkannya iaitu melalui konsep “prevention is better than cure” dan menolak amalan
konvensional pencegahan jenayah seperti menangkap, mendakwa, memenjarakan dan
memulihkan penjenayah yang disifatkan sebagai jauh lebih tinggi kosnya.
Di Amerika Syarikat, pencegahan jenayah dilakukan melalui pelbagai kaedah melalui
penglibatan komuniti secara intensif termasuklah program pengawasan kejiranan, pengawasan
jenayah, masyarakat dan rondaan basikal dan ―Community Policing” telah dilaksanakan dengan
kerjasama pihak polis. Di Kanada pula, pelbagai aktiviti telah dirancang bersama dengan
penduduk, pihak polis, pihak berkuasa tempatan dan pihak swasta untuk mengatasi masalah
jenayah dan menyalurkan sumber maklumat bagi membentuk badan pencegahan jenayah di
peringkat kejiranan. Misalnya, antara 1882-1988, Brampton City telah memperkenalkan
pelbagai aktiviti sebagai langkah mencegah masalah vandalism iaitu program “students
teaching awareness and responsibility today” (START), “neighborhood watch” dan “seniors
taking extra precautions” (STEP). Dengannya program tersebut secara berterusan dapat
menarik pelbagai lapisan masyarakat seperti belia, kanak-kanak dan orang tua bagi
mewujudkan bandar yang selamat dan dapat menjamin kesejahteraan masyarakat setempat
(UNDP 2000).
4. PELAKSANAAN BANDAR SELAMAT DI MALAYSIA
9
Pelaksanaan bandar selamat adalah bertitik tolak daripada peningkatan kadar jenayah
yang tinggi sekitar tahun 1996 iaitu sebanyak 87,902 kes kepada 121,176 kes pada tahun 1997
iaitu peningkatan sebanyak 37.85 peratus. Peningkatan kadar jenayah ini amat
membimbangkan dan hal juga adalah berpunca daripada krisis ekonomi yang melanda negara
pada ketika itu. Rentetan daripada peristiwa tersebut, Yayasan Pencegahan Jenayah Malaysia
(YPJM) telah mengemukakan kepentingan program bandar selamat pada tahun 1998 bagi
menangani masalah peningkatankadar indeks kes jenayah sehingga membawa kepada
pelaksanaan Program Bandar Selamat pada tahun 2004 (Lee 1998). Selain itu, indeks jenayah
merupakan dapat dibahagikan kepada dua jenis jenayah iaitu jenayah kekerasan dan jenayah
harta benda. Jenayah kekerasan merangkumi kes bunuh, rogol, samun, merusuh,
mencederakan, ugutan jenayah, dan seumpamanya manakala jenayah harta pula melibatkan
kes mencuri, merompak, ragut, pecah rumah dan seumpamanya. Walau bagaimana pun,
jenayah harta benda merupakan jenayah yang sering berlaku terhadap masyarakat tempatan
dan pelancong asing (Ainur Zaireen Zainuddin dan Jalaludin Abdul Malek 2009; Sharuddin
Idrus 2015).
Selain itu, Jabatan Perancangan Bandar dan Desa (JPBD) telah mengeluarkan buku
panduan ―Program Bandar Selamat‖ yang mempunyai 23 langkah pencegahan jenayah yang
terangkum dalam tiga strategi utama iaitu pertama strategi pencegahan jenayah melalui reka
bentuk persekitaran fizikal; kedua memperkasakan kawasan sasaran dan; ketiga
melaluikegiatan kemasyarakatan dan pendidikan kesedaran awam. Selain itu, di Malaysia
terdapat beberapa Bandar yang telah diisytiharkan sebagai bandar selamat iaitu Bandar
Kajang, Alor Star, Kuala Lumpur, Kota Kinabalu, bandaraya Shah Alam dan Kuantan (JPBD
2004; Kamalruddin Shamsudin 2004).
Selain itu, penulisan kertas kerja ini adalah bertujuan untuk menilai sejauhmanakah tahap
keselamatan awam dapat dipertingkatkan melalui konsep Bandar Selamat semenjak
diperkenalkan pada tahun 2004. Justeru, kajian akan menilai data statistik jenayah mengikut
pendekatan Konsep Bandar Selamat iaitu bagi jenayah kekerasan dan jenayah hartabenda
daripada tahun 2004 sehingga 2016 (selama 12 tahun).
5. ANALISA KADAR JENAYAH KE ARAH MEREALISASIKAN BANDAR SELAMAT DI

MALAYSIA DARIPADA TAHUN 2004 SEHINGGA 2016
Berdasarkan analisa kadar jenayah selama 12 tahun bagi negeri di Semenanjung

Malaysia iaitu daripada tahun 2004 sehingga 2016 mendapati semakin meningkat sehingga
tahun 2011 dan mengalami penurunan kes sehingga ke tahun 2016 bagi hampir semua jenis
jenayah. Analisa kadar jenayah ini melibatkan jenayah kekerasan seperti bunuh, rogol, samun
berkawan bersenjata api, samun berkawan tanpa bersenjata api, samun bersenjata api, samun
tanpa senjata api dan kes mencederakan. Bagi jenayah hartabenda pula melibatkan curi, curi
motokar, curi motosikal, curi van/lori/jentera berat, curi ragut, pecah rumah dan curi. Bagi
statistik jenayah untuk tahun 2004 mendapati kes tertinggi dicatatkan di negeri Selangor bagi
jenayah kekerasan dan jenayah hartabenda dengan masing-masing merekodkan sebanyak
6,741 kes dan 38,276 kes. Selain itu, Johor dan Kuala Lumpur juga mencatatkan kes jenayah
yang agak membimbangkan bagi kedua-dua jenis jenayah, Johor jenayah kekerasan sebanyak
3,847 kes dan jenayah harta benda sebnayak 18,656 kes. Bagi Kuala Lumpur sebanyak 3,548
kes jenayah kekerasan dan 17,685 kes bagi jenayah hartabenda (Rajah 1 dan Jadual 1).
10
50,000
45,000
40,000
35,000
30,000
25,000 JUMLAH JENAYAH KEKERASAN
20,000
15,000 JUMLAH JENAYAH HARTABENDA
10,000
5,000 JUMLAH JENAYAH INDEKS
-
JUMLAH JENAYAH JALANAN
Rajah 1: Graf garisan mengenai kejadian jenayah mengikut negeri di Semenanjung Malaysia bagi tahun
2004
Jadual 1Statistik kejadian jenayah mengikut negeri di Semenanjung Malaysia bagi tahun 2004
**Nota:Mengikut Tarikh Kertas Siasatan Dari 1/1/2004 Hingga 31/12/2004

Sumber:http://www.data.gov.my/data/ms_MY/dataset/statitisk-jenayah-indeks-seluruh-malaysia-
mengikut-jenis-jenayah-negeri-dan-tahun (1/6/2018).
Seterusnya, bagi tahun 2005 kadar jenayah kekerasan meningkat kepada 22,039 kes
berbanding 21,767 kes bagi tahun 2004 dan begitu juga bagi jenayah hartabenda telah
meningkat kepada 135,326 kes berbanding 134,596 kes tahun 2004. Kadar jenayah bagi
kekerasan dan hartabenda paling tinggi dicatatkan di negeri Selangor, Johor dan Kuala Lumpur
(Rajah 2 dan Jadual 2).
50,000
45,000
40,000
35,000
30,000
20,000
10,000
5,000
- JUMLAH JENAYAH INDEKS
2005
11
Jadual 2: Statistik kejadian jenayah mengikut negeri di Semenanjung Malaysia bagi tahun 2005
Nota:Mengikut Tarikh Kertas Siasatan Dari 1/1/2005 Hingga 31/12/2005

Sumber: http://www.data.gov.my/data/ms_MY/dataset/statitisk-jenayah-indeks-seluruh-malaysia-
Selain itu, kadar jenayah bagi tahun 2006 didapati telah mengalami peningkatan yang
tinggi berbanding tahun sebelumnya. Misalnya, bagi jenayah kekerasan tahun 2005 sebanyak
22,039 kes dan telah meningkat sebanyak 9,369 kes pada tahun 2006 dengan jumlah
keseluruhan sebanyak 31,408 kes manakala, bagi jenayah hartabenda meningkat sebanyak
30,046 kes pada tahun 2006 (tahun 2005 sebanyak 13,326 kes berbanding tahun 2006
sebanyak 165,372 kes). Peningkatan sebanyak 9,369 kes untuk jenayah kekerasan dan 30,046
bagi kes jenayah harta benda adalah dilihat sebagai suatu peningkatan yang amat ketara.
Negeri Selangor, Kuala Lumpur dan Johor masih lagi mencatatkan jumlah kes jenayah yang
paling tinggi bagi tahun 2006 (Rajah 3 dan Jadual 3).
60,000
50,000
40,000
20,000
2006
Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2006 Hingga 31/12/2006

12
Seterusnya, jika diperhatikan kadar jenayah bagi tahun 2007 juga terus meningkat bagi
kedua keas iaitu jenayah kekerasan dan hartabenda. Perbandingan jenayah kekerasan bagi
tahun 2006 adalah sebanyak 31,048 kes dan telah meningkat sebanyak kepada 35,159 kes
pada tahun 2007 iaitu peningkatan sebanyak 4111 kes. Bagi jenayah hartabenda pula, pada
tahun 2006 sebanyak 165,372 kes meningkat kepada 174,423 kes pada tahun 2007 iaitu
dengan peningkatan sebanyak 9,051 kes. Peningkatan kadar jenayah yang banyak berlaku
adalah disumbangkan oleh negeri Selangor yang terus mencatatkan peningkatan kadar jenayah
tahun demi tahun. Misalnya, bagi jenayah kekerasan tahun 2006 adalah sebanyak 9,518 kes
dan pada tahun 2007 adalah sebanyak 11,321 kes iaitu pertambahan sebanyak 1803 kes
manakala kes jenayah hartabenda sebanyak 41,875 kes dan meningkat kepada 47,271 kes
pada tahun 2007 dengan pertambahan sebanyak 5,396 kes (Rajah 4 dan Jadual 4).
70,000
60,000
50,000
40,000
20,000 JUMLAH HARTABENDA
10,000
2007
Nota:Mengikut Tarikh Kertas Siasatan Dari 1/1/2007 Hingga 31/12/2007
Sementara itu, tren kejadian jenayah pada tahun 2008 menunjukkan terdapat
peningkatan bagi jenayah kekerasan iaitu sebanyak 2,658 kes (2007; 35,159 kes dan 2008;
37817 kes) manakala bagi jenayah hartabenda telah mengalami sedikit penurunan iaitu pada
tahun 2007 sebanyak 174,423 kes berbanding 2008 sebanyak 173,828 kes iaitu penurunan
sebanyak 595 kes. Walau bagaimana pun negeri Selongor, Kuala Lumpur dan Johor masing-
masing mencatatkan peningkatan kes bagi kedua-dua jenis jenayah ini pada tahun 2007 (Rajah
5 dan Jadual 5).
13
70,000
60,000
50,000
40,000
30,000 JENAYAH KEKERASAN
10,000
2008
Statistik kejadian jenayah pada tahun 2009 adalah meningkat bagi jenayah kekerasan
berbanding tahun 2008 iaitu sebanyak 37, 817 kes meningkat kepada 42,365 kes pada tahun
2009 dengan peningkatan sebanyak 4, 548 kes. Bagi Jenayah hartabenda pula diperhatikan
mengalami sedikit penurunan iaitu pada tahun 2008 sebanyak 17,3828 kes menurun kepada
170,313 kes pada tahun 2009 (merosot sebanyak 3,515 kes). Selain itu, negeri Selangor,
Johor, Kuala Lumpur dan Pualau Pinang antara negeri yang mencatatkan kes jenayah tertinggi
bagi kedua-dua jenayah tersebut pada tahun 2009 (Rajah 6 dan Jadual 6).
60,000
50,000
40,000
20,000
JUMLAH HARTABENDA
10,000
2009
14

Seterusnya, bagi kes jenayah tahun 2010 dapat diperhatikan telah mengalami penurunan
bagi kedua-dua jenis jenayah iaitu jenayah kekerasan dan harta benda. Misalnya, pada tahun
2009 kes jenayah kekerasan adalah sebanyak 42,365 kes berbanding 34,133 kes pada tahun
2010 di mana, penurunan sebanyak 8,232 kes. Begitu juga bagi jenayah kekerasan yang
mengalami penurunan sebanyak 18,284 kes di mana pada tahun 2009 sebanyak 170,313 kes
dicatatkan dan pada tahun 2010 pula sebanyak 152,029 kes yang disiasat. Penurunan kes
jenayah ini merupakan suatu penunjuk yang positif terhadap pelaksanaan program bandar
selamat (Rajah 7 dan Jadual 7).
60,000
50,000
40,000
20,000
JUMLAH HARTABENDA
10,000
2010

15
Sementara itu, jika diperhatikan bagi kejadian jenayah pada tahun 2011 juga mengalami
penurunan kes untuk kedua-dua jenis jenayah. Bgi kejadian jenayah kekerasan telah
mengalami penurunan sebanyak 3,471 kes iaitu pada tahun 2010 sebanyak 34,133 kes dan
pada tahun 2011 pula sebanyak 30,662 kes. Selain itu bagi kejadian jenayah hartabenda juga
mengalami penurunan kes di mana pada tahun 2011 sebanyak 135,633 kes berbanding tahun
2010 sebanyak 152,029 kes iaitu penurunan sebanyak 16,396 kes. Walau bagaimana pun,
negeri Selongor, Kuala Lumpur, Johor dan Pulau Pinang antara negeri yang mencatatkan kes
jenayah tertinggi bagi kedua-dua jenis jenayah tersebut (Rajah 8 dan Jadual 8).
50,000
45,000
40,000
35,000
30,000
20,000
10,000
-
2011

Selain itu, kejadian jenayah bagi kedua-dua jenis untuk tahun 2012 juga terus
mencatatkan penurunan kes misalnya, pada tahun 2011 kejadian jenayah kekerasan adalah
sebanyak 30,662 kes berbanding sebanyak 29,950 kes pada tahun 2012 iaitu penurunan
sebanyak 712 kes. Bagi jenayah hartabenda pula pada tahun 2011 adalah sebanyak 135,633
kes telah mengalami penurunan kepada 123,719 kes pada tahun 2012 iaitu penurunan
sebanyak 11,914 kes. Antara negeri yang mencatatkan kejadian jenayah tertinggi pada 2012
bagi kedua-dua jenis adalah negeri Selangor, Johor dan Kuala Lumpur (Rajah 9 dan Jadual 9).
16
50,000
45,000
40,000
35,000
30,000
20,000
10,000
-
2012

Bagi tahun 2013, kejadian jenayah terus mengalami penurunan kes bagi kedua-dua jenis
di mana, pada tahun 2012 kejadian jenayah kekerasan adalah sebanyak 29,950 kes
berbanding tahun 2013 adalah sebanyak 29,375 kes iaitu penurunan sebanyak 575 kes.
Sementara itu, kes jenayah hartabenda pula mencatatkan sebanyak 123,719 pada tahun 2012
dan menurun kepada 117,689 kes pada tahun 2013 iaitu penurunan sebanyak 6,030 kes (Rajah
10 dan Jadual 10).
50,000
45,000
40,000
35,000
30,000
20,000
10,000
-
17
2013

Kejadian jenayah pada tahun 2014 juga mencatatkan penurunan di mana pada tahun
2013, kejadian jenayah kekerasan adalah sebanyak 29,375 kes telah menurun kepada 25,425
kes pada tahun 2014 dengan penurunan sebanyak 3950 kes. Kejadian jenayah hartabenda
pula adalah sebanyak 117687 kes pada tahun 2013 dan pada tahun 2014 adalah sebanyak
103,119 kes iaitu penurunan sebanyak 14,568 kes. Negeri Selangor dan Kula Lumpur masih
mengekalkan jumlah kejadian jenayah tertinggi pada tahun 2014 bagi kedua-dua jenis jenayah
(Rajah 11 dan Jadual 11).
40,000
35,000
30,000
25,000
15,000
-
2014
18
Bagi tahun 2015pula kejadian jenayah kekerasan dicatatkan sebanyak 21,810 kes
berbanding 25,425 kes pada tahun 2014 iaitu penurunan sebanyak 3615 kes. Bagi jenayah
hartabenda pula pada tahun 2015 adalah sebanyak 93,735 kes berbanding 103,119 kes bagi
tahun 2014 dengan penurunan sebanyak 9,384 kes (Rajah 12 dan Jadual 12).
35,000
30,000
25,000
20,000
5,000
2015

Seterusnya, bagi tahun 2016 pula bagi jenayah kekerasan mencatatkan peningkatan
sebanyak 516 kes (bagi tahun 2015 sebanyak 21,810 kes dan tahun 2016 sebanyak 22,326
kes). Bagi kejadian jenayah hartabenda pula terus mencatatkan penurunan kes iaitu sebanyak
3,707 kes di mana pada tahun 2015 adalah sebanyak 93,735 menurun kepada 90,028 pada
tahun 2016. Negeri Selangor terus mengekalkan negeri yang paling tinggi mencatatkan kes
jenayah di negara ini secara keseluruhannya (Rajah 13 dan Jadual 13).
19
35,000
30,000
25,000
20,000
JENAYAH KEKERASAN
15,000
- JUMLAH JENAYAH JALANAN
2016

Rumusannya, berdasarkan analisis kadar jenayah kekerasan dan hartabenda selama 12

tahun iaitu bermula tahun 2004 sehingga 2016 mendapati terdapat dua fasa atau tren kejadian
jenayah di Semenanjung Malaysia iaitu bermula tahun 2004 sehingga 2010 kadar kejadian
jenayah telah mencatatkan peningkatan tahun demi tahun. Hal ini mungkin disebabkan oleh
kegawatan ekonomi yang dialami negara juga menjadi antara salah satu penyumbang terhadap
peningkatan kejadian jenayah. Namun daripada tahun 2011 sehingga 2016, kadar kejadian
jenayah mula mencatatkan penurunan bagi kedua-dua jenis. Selain itu, penurunan kadar
jenayah ini juga pasti ada kaitan dengan pelaksanaan bandar selamat yang berkaitan projek
fizikal bandar selamat dan pelaksanaan program bersama awam bagi tujuan memastikan
keselamatan dan kesejahteraan awam dapat ditingkatkan (Sarday 2017; Crawford 1988).
Hal ini berkemungkinan disebabkan oleh pelaksanaan program atau strategi berkaitan
bandar selamat merupakan antara salah satu menjadi faktor penyumbang kepada penurunan
kadar jenayah di Semenanjung Malaysia. Ini termasuklah pengasingan laluan pejalan kaki
dengan laluan motor, pemasangan ―bollard‖, memperbanyakkan pondok polis, papan tanda
peringatan jenayah kawasan ragut, pemasangan Closed Circuit Television (CCTV),
pemasangan lampu di kaki lima premis dan kawasan laluan awam (Saravanan 2015). Dengan
kata lain, pelaksanaan program bandar selamat pada tahun 2004, telah berjaya mencegah
jenayah melalui perancangan persekitaran, penglibatan komuniti/awam dan agensi kerajaan
(Shaharudin Idrus 2015).
Selain itu, kepentingan pelaksanaan program bandar selamat juga dilihat sebagi suatu
perkara penting iaitu dapat meningkatkan kualiti hidup masyarakat di mana masyarakat dapat
20
menikmati kehidupan yang lebih berkualiti iaitu dengan menekankan aspek keselamatan. Aspek
keselamatan merupakan satu elemen penting dan telah diperakui oleh Teori Hierarki Maslow
(1968) yang telah meletakkannya sebagai ukuran kedua terprnting selepas keperluan psikologi
bagi mencapai kualiti hidup yang baik (Faizah Md Latif 2015; Wan Rozali Wan Hussin 2007;
Crawford1998).
6. KESIMPULAN
Konsep bandar selamat telah dikenalpasti sebagai satu program mencegah masalah
jenayah yang kian meningkat saban tahun di negara ini. Pihak berkuasa tempatan dan pihak
polis sahaja tidak harus dipertanggungjawabkan untuk menjaga keselamatan awam
tetapi,menjaga keselamtan awam adalah tanggungjawab bersama. Selain itu, matlamat
pengecahan jenayah dan mewujudkan bandar selamat hanya boleh dicapai melalui penglibatan
dan kerjasama antara agensi kerajaan, pihak swasta dan masyarakat dan kaedah ―prevention is
better than cure” harus menjadi pegangan agar kadar jenayah dapat dikurangkan. Oleh itu,
amat bertepatan bagi semua pihak untuk mengaplikasikan pelaksanaan pencegahan jenayah
secara intensif agar dapat mencapai matlamat yang digariskan iaitu menjadi sebuah negara
maju menjelang tahun 2020 yang bebas daripada kegiatan jenayah dan seterusnya menjamin
keselamatan dan kesejahteraan masyarakat.
RUJUKAN
Abdul Rahman Embong. (2011). Pembandaran dan kehidupan bandar di Semenanjung

Malaysia. Akademika 81 (2), 23-29.
Ainur Zaireen Zainudin & Jalaludin Abdul Malek. (2009). Keberkesanan program bandar
selamat dari persepsi penduduk, kajian kes: Bandaraya Shah Alam. Jurnal Teknologi
Vol 53, 13-34.
Crawford, H.(1998). Crime prevention and community safety: politics, plicies and practice. New
York: Logman.
Faizah Md. Latif. (2015). Kearah pengurangan indeks jenayah jalanan di Malaysia. Journal of
Society and Space, Vol 10, 56-68.
Jalalaludin Abdul Malek dan Mohd Asruladlyi Ibrahim. (2015). Bandar selamat dan keselamatan
komuniti. Journal of Society and Space, Vol 10, 97-117.
Jabatan Perancangan Bandar dan Desa. (2004). Program bandar selamat: Ilstrasi 23 langkah
pencegahan jenayah. Kuala Lumpur: Jabatan Perancangan Bandar dan Desa.
Kamalruddin Shamsudin. (2004). Peranan pegawai perancang bandar dalm pelaksanaan
pogram bandar selamat. Kuala Lumpur: Jabatan Perancangan Bandar dan Desa
Lee, T. (1998). Perlu segera wujudkan konsep bandar selamat. Utusan Malaysia. 11 Februari
1998.
Shaharudin Idrus. (2015). Cabaran penuhi hasrat jadikan bandar berdaya tahan.
http//www.bharian.com.my (1/6/2018).
Sarday, J. (2017). Ciri-ciri bandar selamat. http://md.jaissarday. com.2017 (1/6/2018).

Saravanan Anna Malai. (2015). Tahap keberkesanan langkah pencegahan jenayah melalui
program bandar selamat: satu kajian di bandar Kajang. http://bandar selamat kajian
kes bandar kajang (1/6/2018)
Wan Rozali Wan Hussin. (2007). Kualiti hidup sosial dan proses pembandaran di Malaysia.
Pulau Pinang: Universiti Sains Malaysia.
UNDP. (2000). Human development report. http//hdr.undp.org/report 2000.
21
http://www.data.gov.my/data/ms_MY/dataset/statitisk-jenayah-indeks-seluruh-malaysia-
-GP03-
Is Inclusive Microfinance Approach an Effective Strategy for Poverty Reduction in
Nigeria?
Sa’idu Idris1 and Salisu Ahmed Kabiru2

1 Department of Public Administration, Faculty of Management Sciences, Usmanu Danfodiyo University,
Sokoto, sidris@yahoo.com
2 School of Government, COLGIS, UUM, salisuahmed18@gmail.com
Abstract
In Nigeria, the formal financial system provides services only to about thirty-five per cent (35%)
of the economically active population whilst the remaining sixty-five per cent (65%) are excluded
from access to financial services and these 65% are often served by the informal financial
sector through Non-governmental Organizations (NGOs), microfinance institutions, money
lenders, friends, relatives and credit unions, etc. Inclusive finance approach is a paradigmatic
shift for micro financing in the twenty-first (21st) century to promote the regulations of
microfinance and broaden the activities of financial systems to reduce the incidence of poverty
in Nigeria. The paper observes that the outcome of inclusive finance approach has led to
increased savings account from 77.2% in 2012 to 80.6% in 2014. Thus, there has been an
increase in the proportion of adults that are formally included by 2008-2014 from 23.6% to
48.6% with an increase of 25 million people thereby indicating improvements in financial
inclusion (access to financial services) which contributes to economic growth, wealth creation
and poverty reduction. The paper suggested that the apex bank (CBN) should prepare and
maintain grounds upon which the inclusive finance approach could succeed such that average
poor Nigerian could have access to financial operations for improved living conditions.
Key Words:Microfinance, Inclusive finance, Paradigm shift, and Poverty reduction
1. INTRODUCTION
Conventional microfinance has in recent times, been considered as one of the vital and socially
desirable parts of the overall financial systems, locally and globally. It is an indispensable
instrument designed to assist the large segment of societies, usually the under-banked and
under-served, low income individuals in the global and national efforts to fight high and growing
incidence of poverty that bedevils humanity on large scale, over the years.
Effective management of the Nigerian economy in the 21st century can be possible through
managing the financial system by funding low-return but socially desirable and relevant projects
that would boost economic activities for the greater number of the citizens. To achieve this
objective, however, conventional microfinance system requires amongst other things, proper
regulations in its activities through various microfinance policy measures as contained in
22
Section 28 sub-section (1) (b) of the CBN Act 24 of 1999 (as amended) in the pursuance of the
provisions of Sections 56-60 (a) of the Bank and Other Financial Institutions Act (BOFIA) 25 of
1991 (as amended). The policy recognizes existing informal institutions and brings them within
the supervisory purview of the CBN, creating a platform for the regulation and supervision of
microfinance policy and framework.
Generally therefore, microfinance is about providing financial services to the poor who are
traditionally not served by the conventional financial institutions. Three (3) features distinguish
microfinance from other formal financial products. These are: i) smallness of loans advanced
and/or savings collected; ii) absence of asset-based collateral, and iii) simplicity of operations.
By streamlining the microfinance sector into the financial sector of the Nigerian economy, the
Micro Finance Institutions (MFIs) would provide the stimulus for economic growth and
development; harmonize operating standards and provide a strategic platform for the evolution
of standard microfinance institutions; promote appropriate regulation, supervision and adoption
of best practices. In these circumstances, an appropriate policy has become necessary to
develop a long-term, sustainable microfinance sub-sector (CBN, 2006).
This paper, therefore, attempts to highlight how inclusive microfinance approach can be used as
effective strategy to curb the menace of poverty in Nigeria. The paper relied on secondary data
mainly reports generated from Central Bank of Nigeria (CBN) and Enhancing Financial
Innovation and Access (EFInA) for the discussion of salient issues on the subject matter. The
paper is thus, structured into four (4) sections: the first is the introductory; the second section
covers conceptual issues on microfinance and inclusive finance approach. The third section
deals with discussion while the last section concludes the paper.
1.1. Problem in Context
The prolonged dilemma of microfinance sector in Nigeria has generated a lot of fears to many
Nigerians; this is despite attempts to broaden the financial system in the country through
inclusive micro finance approach introduced since 2005. In 2010 for example, the Target
Examination conducted by the CBN on Microfinance Institutions (MFIs) in Nigeria shows that
from February, 2010 to June, 2010, out of the eight hundred and twenty (820) MFIs across the
country, a total of two hundred and twenty-four (224) were found to be terminally distressed and
technically insolvent and had been closed up for at least six (6) months. This was attributed to a
number of factors such as gross undercapitalization in relation to the level of operations; poor
asset liability, management owing to portfolio mismatch, heavy investment in fixed assets
beyond the maximum limit prescribed, operating losses sustained as a result of high
expenditure on staff and overhead costs, weak management evidenced by poor asset quality,
poor credit administration, inadequate controls, high rate of fraud and labour turnover. These
myriads of problems cannot go unchecked if sound financial system is to be maintained. The
concern of this paper is; how has this paradigm shift promotes the operations of microfinance
enterprise in Nigeria? And to what extent has this policy measure enhanced the accessibility
ofthe poor into the financial sector?
23
2. LITERATURE REVIEW
2.1. Conceptual Issues
Microfinance is generally aimed at providing financial services to the poor or low-income

clients which include consumers and self-employed who had little or no access to financial
institutions. As a microenterprise development model, microfinance is considered as an
essential poverty reduction strategy. Micro credit has been introduced to address the poorest of
the poor who do not have access to credit (Yunus, 2003). Principally, microfinance ensures the
provision of savings, credit and other financial and business products that are micro in size to
poor clients, who are conventionally believed to lack the capacity to save and the ability to pay
the high interest rates charged by commercial banks on credit. From the above stand point,
Wrenn (2007) argues, microfinance is aimed at providing financial services such as savings,
loans and insurance to poor people living in both urban and rural settings, who are unable to
obtain such services from the formal financial sector.
The development of this financial sub-sector would enhance the provision of financial
services and products such as very small loans, savings, micro-leasing, micro-insurance and
money transfer to assist the very or exceptionally poor in expanding or establishing their
business. Micro savings are deposit services that allow low-income savers to keep small
amounts of money for future use. Often without minimum balance requirements, savings
accounts allow households to save in order to meet unexpected expenses and plan for future
investments (Klinkhamer, 2008). The use of savings has changed from a focus that was
predominantly on agricultural inputs to needs such as school fees, school uniforms, business
working capital and loan repayments. Over the past two decades, increased access to savings
services through credit union networks, village savings groups and other financial service
providers has demonstrated that Africa‘s poor have a strong demand for savings. So,
microfinance is a form of financial development that has primarily focused on alleviating poverty
through providing financial services to the poor (Khan and Rahaman, 2007). In fact, no doubt,
access to affordable, safe and reliable financial services provides the necessary lubricant for
economic growth and contributes to achieving poverty reduction.
2.2. Microfinance and Poverty Reduction: The Correlate
The primary target of microfinance initiative is to include people who are financially
excluded (have never had any banking relationship in their lives) either due to poor financial
literacy, remoteness from bank locations, complete ignorance of what banking is or considered
lacking assets of any kind due to their poor financial status. The poor, according to the United
Nations (2010), are lacking access to credits due to lack of financial assets, especially land that
could be used as collateral for securing loans from conventional financial institutions.
There are therefore, strong links between poverty and lack of productive assets, as people
living in poverty not only lack income, but also do not have assets needed to generate income.
Take land for example, which is a critical asset particularly for the rural poor. Land can be used
as collateral for loans for investment, or sold to raise capital for investment in an income
generating activity. A study carried out by Chronic Poverty Research Centre (2004) has
demonstrated that in India, over 30% of the landless and near landless live in poverty whilst in
Bangladesh, the landless made up of two-thirds of people living in poverty. The study also found
out that, land ownership (farmlands) increased the propensity of investment in education of
children to reduce intergenerational poverty. Consequently, impaired access to productive
resources can be used to explain the extent of poverty in a given country hence, the inability of
the poor to have access to agricultural land, physical capital and financial assets deepens the
incidence of poverty. When livelihoods are secured,people have secured ownership of, or
24
access to, resources (both tangible and intangible) and income earning activities, including
reserves and assets, to off-set risks, ease shocks, and meet contingencies. Therefore,
microfinance creates access to productive capital for the poor, which together with human
capital, would generate employment and enables people to move out of poverty (Otero, 1999).
So, the provision of microfinance gives the poor people the means to protect their livelihoods
against shocks as well as to build up and diversify their livelihood activities.
2.3. The Nigeria’s Inclusive Microfinance: Policy Objectives, Target and Strategies
By inclusive finance approach, we mean integrating microfinance into the formal financial
system. Based on the recent trends in microfinance the world over, the United Nations Capital
Development Fund (UNCDF) inclusive finance, (Sector Development Approach) has made a
strategic shift in December, 2002 to concentrate its microfinance programmes on building
inclusive financial sector. This financial sector development approach is based on the premise
that microfinance services will over time, become an integrated part of the financial system and
is founded on the recommendations of ―The Blue Book‖ Building Inclusive Financial Sectors for
Development. The central aim is to deepen the financial system of a given country to ensure
sustainable access to financial services by poor and low-income people. The main features of
the Sector Development Approach otherwise known as Inclusive Financial Approach are:
i. Financial Sector Assessment: diagnosis of the financial sector with a view to identifying
constraints and opportunities that need to be addressed to allow for full participation of
poor households and micro and small firms into the financial sector;
ii. Nationally-owned vision, strategy and action plans for inclusive financial sectors based
on multi-stakeholders consultations, a national strategy and action plan is adopted by
the government outlining the main areas that need to be addressed to promote financial
inclusion.
The UNCDF‘s Inclusive Financial Sector Development ensures that: (a) investment
requirements for increased financial inclusion are met in a structured and coherent way, and (b)
regulatory and policy constraints to financial inclusion are continuously registered and
addressed by stakeholders, including ultimately national government (through Central Banks)
thereby improving the enabling environment for financial sector development and financial
inclusion.
i. Make financial services accessible to a large segment of the potentially productive

Nigerianpopulation which otherwise would have little or no access to financial services;
ii. Provide synergy and mainstreaming of the informal sub-sector into the national financial
system;
iii. Enhance service delivery by microfinance institutions to micro, small and medium
entrepreneurs;
iv. Contribute to rural transformation amongst others.
2.3.1. Policy Target
i. To cover the majority of the poor but economically active population by 2020 thereby
creating millions of jobs and reducing poverty;
ii. To increase the share of micro credit as a percentage of total credit to the economy from
0.9 per cent in 2005 to at least twenty per cent (20%) in 2020; and the share of micro
25
credit as a percentage of Gross Domestic Product (GDP) from 0.2 per cent in 2005 to at
least five per cent (5%) in 2020;
iii. To promote the participation of at least two-third of the States and Local Governments
(LGs) in micro credit financing by 2015;
iv. To eliminate gender disparity by improving women‘s access to financial services by five
per cent (5%) annually; and
v. To increase the number of linkages among development banks, specialized finance
institutions and microfinance banks by ten per cent (10%) annually.
2.3.2. Policy Strategies
i. License and regulate the establishment of Microfinance Banks (MFBs);

ii. Promote the establishment of NGO-based microfinance institutions;
iii. Strengthen the regulatory and supervisory framework for MFBs;
iv. Promote sound microfinance practice by advocating professionalism, transparency and
good governance in microfinance institutions;
v. Mobilize domestic savings and promote the banking culture among low-income groups;
vi. Strengthen the capital base of the existing microfinance institutions;
vii. Broaden the scope of activities of microfinance institutions;
viii. Strengthen the skills of regulators, operators and beneficiaries of microfinance initiatives;
ix. Clearly define stakeholder‘s roles in the development of the microfinance sub-sector,
and
x. Collaborate with donors, coordinate and monitor donor assistance in microfinance in line
with the provisions of this policy.
Since 2005, the Central Bank of Nigeria gave approval-in-principle to Action, a United States-
based Microfinance Company and seven (7) others, including indigenous firms, to operate as
Microfinance Banks (MFBs) in the country. These companies are: Susu MFB, Lagos, Integrated
MFB, Lagos, MTC MFB, Lagos, Osun State Collage of Technology (OSCT), Esa Oke, Osun,
Wize Trade MFB, Lagos, Mustason MFB, Lagos and First Global MFB, Port Harcourt, River
State.
To secure the apex bank‘s approval, newly licensed MFBs are required to comply with
conditions precedence to the commencement of operations as contained in the regulatory and
supervisory framework for microfinance banks in Nigeria released in 2005. However,
Microfinance banks can be established by individuals, groups of individuals, community
development associations, private corporate entities, or foreign investors (CBN, 2005). Under
the regulatory and supervisory framework for microfinance banks, the CBN stated that two
categories of licenses are available for promoters (both local and foreign) of microfinance banks
based on geographical coverage.
The first category is Microfinance Banks licensed to operate as a Unit Bank (also known as
Community Banks) and which operate and open branches within a specified Local Government
Area (LGA). According to CBN, the minimum capital requirement was N20 million or such
amount as may be prescribed by it from time to time. The second category is Microfinance
Banks licensed to operate in a State and open branches within a specified State of Federal
Capital Territory with a minimum capital requirement of N1 billion or such an amount as may be
prescribed by the CBN from time to time (CBN, 2006).
26
3. Discussion
At the beginning of the twenty-first (21st) century, the theory and practice of microfinance has
witnessed a shift from microfinance approach to inclusive finance approach as a new paradigm
for micro financing the world over. To ensure the sustainable provision of financial services to
micro entrepreneurs, the Microfinance Policy is a framework that regulates the operations and
activities which was launched in 2005 to promote synergy and mainstream it into the formal
financial sector of the nation‘s financial system.
The Nigerian government through its apex bank has since in 2005 embraced inclusive finance
approach within the framework of CBN‘s regulations. However, Experts have argued that, the
future of Nigerian microfinance sector seems bleak as only eighteen (18) millions out of
Nigeria‘s active adult population, about twenty-one per cent (21%) can access financial services
to boost economic development (Anyanwu, 2004). Dauda Toure, the Resident Country
Representative of the United Nations Development Programme (UNDP) succinctly notes that:
About sixty-four (64) million Nigerians or seventy-four per cent (74%) has
never been banked, while only four (4) million or five per cent (5%) have
previously owned a bank account. Although various stakeholders have
keyed into the country‟s microfinance landscape through inclusive finance
approach more than five (5) years ago, very little impact has been
recorded; the Nigeria‟s experience indicates that there are possibilities that
the set objectives of the microfinance sector may not be achieved by 2020.
The sector‘s poor record of performance according to Mr. Toure, was attributed to the apparent
lack of capacity, inadequate coordination and synergy, policy shortfall, lack of detailed
articulation of stakeholder‘s roles and responsibilities in the various sector‘s operation. Further
highlighting the challenges facing the financial sector, the CBN‘s report had shown that the
formal financial system provides services only to about thirty-five per cent (35%) of the
economically active population while the remaining sixty-five per cent (65%) are excluded from
access to financial services. These 65% are often served by the informal financial sector
through Non-governmental Organizations (NGOs), microfinance institutions, money lenders,
friends, relatives and credit unions (CBN, 2006). However, the non-regulation of the activities of
some of these institutions has serious implications for the Central Bank of Nigeria‘s ability to
exercise one aspect of its mandate of promoting monetary stability and a sound financial
system.
A decade after the inclusive financial approach in Nigeria, the Enhancing Financial Innovation
and Access (EFInA) in its 2015 report, ―the Landscape of Financial Inclusion and Microfinance
in Nigeria‖ indicates that a fairly improvement in microfinance banks financial activities. For
example, savings account increased from 77.2% in 2012 to 80.6% in 2014, loans raised from
19.8% to 28.3% even with a decrease in current accounts from 28.8% to 29.6%. This has led to
an increase in the proportion of adults that are formally included by 2008-2014 from 23.6% to
48.6% with an increase of 25 million people. Thus, indicating improvements in financial inclusion
(access to financial services) which would contribute to economic growth, wealth creation and
poverty reduction. Nevertheless, despite inclusion, EFInA 2015 report shows that microfinance
27
banks users dropped from 4.6 million in 2012 to 2.6 million in 2014. And there were closure of
224 microfinance banks in 2010 due to lack of trust.
4. CONCLUDING REMARKS
From the foregoing contents of the paper, no doubt, the financesector is a critical component of
the Nigerian economy which serves as the essential balm that provides the necessary
lubrication for sound management of the economy.Of course,one of the major reasons for
microfinance is to enhance the provision of diversified microfinance services on a long term
sustainable basis for the poor and low income groups thus, promoting financial inclusion. In
Nigeria, poor households are typically excluded from the formal banking system for lacking
collateral, but the CBN, in its efforts to strengthen the microfinance banks, has put in place
measures to operating standards of microfinance institutions to promote access to banking and
financial institutions by average Nigerian citizen.
This paper, therefore, submits that inclusive finance approach is a potent instrument for
streamlining micro-enterprise registration, loosening collateral and can foster a supportive
climate for microfinance operations in the Nigerian financial sector and the global financial
systems. It is therefore recommended that, for microcredit to be appropriate, empowerment
programmes should be put in place where the clients could have the capacity to repay the loan
under the terms by which it is provided. The CBN should prepare and maintain grounds upon
which the inclusive finance approach could succeed such that average poor Nigerian could
have access to financial operations for improved living conditions.
REFERENCES
Anyanwu, C. M. (2004). Microfinance institutions in Nigeria: Policy, Practice and
Potentials,Paper Presented at the G24 Workshop on ―Constraints to Growth in Sub
Saharan Africa‖,Pretoria-South Africa, by the Deputy Director Central Bank of Nigeria,
November 29-30.
CBN, (2005). Microfinance policy regulatory and supervisory frameworks for Nigeria, Central
Bank of Nigeria, Abuja.
CBN, (2006). Microfinance, Abuja: Adgozo Limited (Press Division).
CPRC, (2004). The Chronic Poverty Report 2004-05, Institute for Development Policy and
Management, University ofManchester.
EFInA, (2015). The landscape of financial inclusion and microfinance in Nigeria, DFID and Bill
and Melinda Gate Foundation. Retrieved on 15/03/2017 from www.efina.org.ng.
Khan, M. A. and Rahaman, M. A. (2007). Impact of microfinance on living standards,
Empowerment and Poverty alleviation of poor people. A case on microfinance in the
Chittagong District of Bangladesh. An Unpublished Masters Degree Thesis. Amea
School of Business.
Klinkhamer, M. (2008). Microfinance sector recovery, AYANI- Inclusive Financial Sector
Consultants, Working Paper, 263.
Microfinance Africa, (2010). Access to financial services in Nigeria, Microfinance in Nigeria:
National Microfinance Development Strategy for Nigeria.
http://allafriend.com/stories/20060822176html.
Otero, M. (1999). Bringing development back into microfinance, Journal of Microfinance, 1(1): 8-
9.
28
United Nations Capital Development Fund, (1997). Microfinance: Nigeria, Country Report,
UNCDF. http://www.ucdf.org/english/microfinance/reports/country-feasibility.
http://c.gap.org
http://web-worldbank.org. http://www.microfinance-gateway.org/content/article/3438.
United Nations, (2010). The United Nation‟s Development Goals Report 2010. New York p. 17.
Wrenn, E. (2007). Perception of the impact of microfinance and livelihood security.
www.kimmagedsc.ie. Retrieved on 12/3/2016.
Yunus, M. (2008). Creating a world without poverty. New York: Social Business and the Future
of Capitalism, Public Affairs.
-GP04-
Engaging In Environmental Management: Compulsory Or Volunteerism
Raman Mariyappan1, Zainal Md. Zan2 and Amirulikhsan Zolkafli3

1 School of Government, Universiti Utara Malaysia, raman@uum.edu.my
2 School of Government, Universiti Utara Malaysia, zainal@uum.edu.my
3 School of Government, Universiti Utara Malaysia, amirulikhsan@uum.edu.my
Abstract
Environmental management arguably is very much related to sustainable issues which

warrants outmost attention from stakeholders.So, what exactly is environmental management?
It is a systematic process which involves individuals (professionals and non-professionals),
government organizations, private sectors (small, inter-mediate and multi-national) and non-
governmental organizations national and international). The stakeholders must participate
actively in various environmental management programs whether in micro or macro level.
Volunteers play a key role in natural resource management: their commitment, time and labour
constitute a major contribution towards managing environments in Australia and throughout the
world. From the point of view of environmental managers much interest has focussed on
defining tasks suitable to volunteers. However, we argue that an improved understanding of
what motivates volunteers is required to sustain volunteer commitments to environmental
management in the long term. This is particularly important given that multiple government
programs rely heavily on volunteers in Australia, a phenomenon also noted in the UK, Canada,
and the USA. Whilst there is considerable research on volunteering in other sectors (e.g.
health), there has been relatively little attention paid to understanding environmental
volunteering. On the other hand, whether law and order can sustain environmental management
towards sustainable development. Conclusively, this paper examines whether volunteerism or
compulsory participation will spearhead the survival of physical environment which enrich the
humankind in many ways.
Key Words:Environmental Management, Volunteerism
1. INTRODUCTION
Man and physical environment interaction interpreted in many perspectives. Man as the
master of the planet always want to be on the winning side, doesn‘t matter the seriousness of
the consequences. Man with the knowledge and technology advancement enjoyed a great
29
windfall from exploiting the elements of physical environment such as timber, minerals, water,
energy, space and many other benefits. Natural exploitation brings in different type of damages
to the environment, depends on the man-made activity (BabaganaGutti, 2012). Man must held
responsible for his deeds that has downgraded the natural systems.Kapur. R (2016), explains
that population explosion has deterrent effects on natural resources. As the population
increases in an alarming rate, the consumption and usage of the natural resources has also
registered many fold increases.So, there must be a way to curb these environmental
degradation. Man always has the notion that managing the nature is very costly affair, time
consuming and requires plenty man power involvement (Raman Mariyappan, 2017).The natural
environment benefits greatly from the work of volunteers. However, little is known as to why
people are willing to volunteer their time to such programs.Rappe conducted a study in 2007
involving 401 volunteers from six natural resource organizations. The study identified and
assessed motivations of volunteers within the conservation and natural resources arena. The
results suggest that there are many volunteer motivations, although ‗helping the environment‘
clearly emerged as most important. Second-tier motivations included ‗improving areas that
volunteers use for their own recreation‘, ‗expressing their values‘, ‗learning about the natural
environment‘ and ‗socializing with people with similar interests‘. Managers need to consider
these motivations, developing programs in order to provide volunteers with an experience that
meets their motivations. By developing programs with volunteer motivations in mind, managers
will better be able to recruit and retain volunteers within their organizations(Rappe, 2007).
2. THE PUZZLE
Raman Mariyappan (2016) illustrated that volunteerism is much needed aspect to be

emphasized in environmental management of hilly terrains in Malaysia. The existing law,
enactments and guidelines contributes towards environmental management but the participation
is very much forceful rather than volunteerism. Is there any means to encourage the mass to
actively participate in environmental management with sheer voluntary work? Understanding the
nature at work will solve or at last minimize man‘s impact on environment. The masses should
be exposed to the importance of nurturing the Mother Nature from young withinformal and
informal education. Environmental sustainability education, the dissemination of environmental
education for sustainable development into the community, should be a lifelong process and not
one restricted to a learner's years in institution of education. Informal environmental
sustainability education, including personal involvement in NGO environmental action, can be
an effective way of increasing the understanding of environmental and sustainability issues.
NGO projects help provide practical environmental education to environmentally aware people
who have built their careers in other areas. In the process, they help environmental awareness
to trickle into areas of life where it would not ordinarily impinge (Haigh, 2006). Engagement in
practical work and action research may help overcome some of the negativity linked to many
assessments of the human impact on the environment and, working together, universities and
NGOs can more effectively ‗think globally and act locally‘. NGOs may provide the best hope for
helping to change the destructive aspects of modern society but they are vulnerable through
financial dependency on sponsors, volunteers and donor (Haigh, 2006).
So, volunteerism must be embedded in any program that enhances sustainable
development which promotes reasonable environmental management.
3. DISCUSSIONS
30
Management education for sustainable development, sustainable consumption in higher

education institutions, and higher education for sustainable development in Central and Eastern
Europe can be considered as three highly relevant emerging areas in research on higher
education for sustainable development. The transformation of management education to meet
the increasing societal demands for responsible business has been reinforced in the light of the
current economic situation. In this context, it is explored which competencies are needed for
tomorrow's business professionals and which concepts and approaches are useful to foster
these competencies. With regard to sustainable consumption, several universities have initiated
creative projects that have transformed campus life and have had an impact on staff's and
students' attitudes and behaviour. Moreover, initiatives in Central and Eastern Europe show
interesting developments, for example how sustainability issues have been integrated into the
curriculum, particularly in the context of intense coal mining as well as urban planning. Thus,
this Special Volume of the Journal of Cleaner Production presents the current progress in
concepts and practices in the three emerging areas management education for sustainable
development, sustainable consumption in higher education institutions, and higher education for
sustainable development in Central and Eastern Europe, which to date have not been
intensively discussed in the scientific discourse on higher education for sustainable
development. In an overall manner, the Special Volume provides evidence that the following
issues are of particular importance for future research and development in higher education for
sustainable development: measuring learning outcomes; accounting for different geographical,
political and cultural contexts for higher education for sustainable development; and prioritising
strategies for sustainable organisational change (MaikAdomBent et al., 2014).
Raman Mariyappan (2017) conducted a study testing nine items on volunteerism
managing highlands of Penang Island (Table 1) among 762 respondents from various group in
Penang. The first item was ‗willingness to contribute a small portion of income to help reduce
the problem of highland environment‘ registered 83.6 per cent of not inclining towards monetary
contribution towards environmental management. Kimberly Yao (2015) through a study
suggests that the relationship between giving and volunteerism are complement (r=.3777). In
addition to multiple and binomial logit regressions, a multinomial logit regression shows that a
combination of income, age, marital status and sex, religion, number of children, political party
affiliation, and self-rank of social position significantly affect the complementarity between
donating and volunteering.
The second item ‗involvement as volunteer helps the government in managing the
environment to reduce the problem of highland areas‘ registered 72.7 per cent of the
respondents with agreeable and highly agreeable answers. So, the public realize that
volunteerism helps the authority to reduce the environmental problem. This is supported by the
findings by Rebecca Nesbit, Robert K. Christensen and Jeffrey L. Brudney (2017), volunteerism
will strengthen the organization and it will create a cascading of the volunteerism process.The
third item ‗being able to sacrifice the individual comforts is like pursuing luxury, wealth and
excessive profits can contribute to reduce the problem of highland environment‘ registered 53.3
per cent answering not willingness. So, the public is not willing to forego their comforts in order
to reduce the environmental problems. A study by David Tilman and Clarence Lehman (2001),
discusses about human‘s wealth accumulation lifestyle damages the ecosystems in non-
reversible manner.The fourth item ‗environmental preservation activities are not troublesome as
it reduces the problem of highland environment‘ registered 94.4 per cent condoning strongly.
The public strongly belief that preservation activities must be promoted to curb the
environmental problems. This is supported by Karl Pillemer et al., (2017), saying a structured
program can be implemented nevertheless of age to cultivate preservation activities among
volunteers.
The fifth item ‗education towards volunteerism should start from younger age emphasizing
the preservation of highland environment‘ registered 81 per cent agreeing strongly. According to
31
a study by EllenAlmers, Per Askerlund and Sofia Kjellstrom (2017), utilizing forest gardens as
urban settings for outdoor environment education for children can motivate them to be part of
environmental preservation volunteers.The sixth item ‗The willingness to pay more for buying
eco-friendly products can reduce the problem of highland environment‘ registered 75.2 per cent
agreeing strongly. Voluntarily buying eco-friendly products, even though costly can contribute
towards reducing environmental problems. Lorek and Agnieszka (2015) argue that price plays
essential role in promoting eco-friendly products. The practice of buying eco-friendly products
getting popular due to promotion by various NGO‘s on the importance of sustainable
development which emphasize environmental preservation.The seventh item ‗Self-esteem in the
preservation of highland environment such as clean river / forest-filled hills is essential for self-
esteem from an aesthetic aspect‘ registered 96.6 per cent respondents agreeing strongly
regarding self-esteem in preserving environment for green tourism. Public prefers individual
should poses a high self-esteem towards issues such as clean river, virgin forest, green
mountains, blue sea and undisturbed environment for tourism purposes. A study by E. Scott
Geller (1995) belief that community-based interventions are needed to decrease environment-
destructive behaviors and to increase environment-protective behaviors. Intervention agents are
needed to implement these interventions on a large scale, and this requires people to "actively
care" enough to emit other-directed (or altruistic) behaviors for environmental protection. Person
factors that influence one's propensity to actively care include self-esteem, belongingness, self-
efficacy, personal control, and optimism. Thus person-based psychology defines the states or
expectancies needed in people to increase their willingness to actively care for the environment,
and behavior-based psychology offers the technology for changing behaviors and attitudes
(including actively caring person states).
The eighth item ‗Voluntary Action as a high-level environmental conservation is not a
status for the community‘ registered 82.7 per cent of the respondents agreeing that
volunteerism preserving environment not related to community status. Meaning that the society
must function as a whole to protect the environment. Anyone regardless of social status can
volunteer to reduce the environmental problem. The ninth item ‗Communities should act
rationally in preserving the environment so that their safety is not threatened in terms of
reducing the problem of highland areas‘ registered 98 per cent of the respondents agreeing
strongly that volunteerism must be incorporated with individual safety.
Table 1Voluntarism and Environmental Management of the Penang Highlands

Tested Items Scale Frequency
(%)
Willing to contribute a small portion of income to HNA 243 (31.9)

help reduce the problem of highland environment
NA 216 (28.3)
LA 178 (23.4)
A 99 (13.0)
HA 26 (3.4)
Involvement as volunteer helps the government in HNA 7 (0.9)

managing the environment to reduce the problem of
highland areas NA 28 (3.7)
LA 173 (22.7)
32
A 481 (63.1)
HA 73 (9.6)
Being able to sacrifice the individual comforts is like HNA 215 (28.2)
pursuing luxury, wealth and excessive profits can
contribute to reduce the problem of highland NA 48 (6.3)
environment
LA 143 (18.8)
A 196 (25.7)
HA 160 (21.0)
Environmental preservation activities are not HNA 1 (0.1)

troublesome as it reduces the problem of highland
environment NA 14 (1.8)
LA 28 (3.7)
A 623 (81.8)
HA 96 (12.6)
Education towards volunteerism should start from HNA 1 (0.1)

younger age emphasizing the preservation of
highland environment NA 11 (1.4)
. LA 131 (17.2)
A 369 (48.4)
HA 250 (32.8)
The willingness to pay more for buying eco-friendly HNA 36 (4.7)

products can reduce the problem of highland
environment NA 129 (16.9)
LA 24 (3.1)
A 436 (57.2)
HA 137 (18.0)
Self-esteem in the preservation of highland HNA 1 (0.1)

environment such as clean river / forest-filled hills is
essential for self-esteem from an aesthetic aspect NA 8 (1.0)
LA 32 (4.2)
A 465 (61.0)
HA 256 (33.6)
33
Voluntary Action as a high-level environmental HNA 0 (0.0)

conservation is not a status for the community
NA 4 (0.5)
LA 128 (16.8)
A 403 (52.9)
HA 227 (29.8
Communities should act rationally in preserving the HNA 1 (0.1)

environment so that their safety is not threatened in
terms of reducing the problem of highland areas NA 1 (0.1)
LA 13 (1.7)
A 491 (64.4)
HA 256 (33.6)
Notes: N=762
HNA -Highly Not Agreeable NA -Not Agreeable
LA -Less Agreeable A -Agreeable
HA -Highly Agreeable
4. CONCLUSION
Generally volunteerism functions in a society where values such as caring, sharing,

respect, preservation for environment is an essential part of the community. The community
willing to sacrifice for sustainable development will prosper the survival of the whole community.
REFERENCES
Agnieszka, L. a. (2015). Current Trends In The Consumer Behaviour Towards. Retrieved from
https://www.econstor.eu/bitstream/10419/178880/1/ees_15_2_01.pdf.
BabaganaGutti, G. M. (2012). Environmental Impact Of Natural Resources Exploitation In
Nigeria And The Way Forward. Journal of Applied Technology in Environmental
Sanitation, 95-102.
David Tilman and Clarence Lehman. (2001). Human-caused environmental change: Impacts on
plant diversity and evolution. National Academy of Sciences colloquium, "The Future of
Evolution". The National Academy of Sciences.
Ellen Almers, P. A. (2017). Why forest gardening for children? Swedish forest garden educators'
ideas, purposes, and experiences. The Journal Of Environmental Education, 49.
Geller, E. S. (1995). Actively Caring for the Environment An Integration of Behaviorism and
Humanism. Retrieved from Sage Journals:
http://journals.sagepub.com/doi/10.1177/0013916595272004.
Haigh, M. J. (2006). Promoting Environmental Education for Sustainable Development: The
Value of Links between Higher Education and Non-Governmental Organizations
(NGOs). Journal of Geography in Higher Education, 327-349.
34
Kapur. R. (2016). Natural Resources and Environmental Issues. Journal of Ecosystem &
Ecography, 1-4.
Karl Pillemer et al. ( 2017). Applying Within-Family Differences Approaches to Enhance
Understanding of the Complexity of Intergenerational Relations. The Journals of
Gerontology: Series B,, 40–53.
Maik AdomBent et al. (2014). Flexural Behavior of Self-Compacting Concrete Beams
Strengthened with Steel Fiber Reinforcement. ResearchGate.
Raman Mariyappan. (2017). Sustainable development practices of hilly terrains development
in Penang Island. Ph.D Thesis. Universiti Utara Malaysia.
Raman Mariyappan, and Tuan Pah Rokiah Syed Hussain (2017). The effects of moral values of
public, private sector and non-governmental organizations in managing the highlands
developments in Malaysia. Journal of Humanities, Language, Culture and Business
(HLCB) Vol. 1: no. 3 (2017) page 100-107, eISSN: 01268147
Raman Mariyappan, Mogan Periasamy & Hamidi Ismail. (2017). Relationship between health
care measures and individual background during haze disaster. Journal of Humanities,
Language, Culture and Business (HLCB). Vol. 1(2). pp 100-107. eISSN: 01268147
Raman Mariyappan, and Tuan Pah Rokiah Syed Hussain (2016). The Paradigm Shift of
Managing Hilly Terrains Developments in Malaysia. International Journal of Humanities
and Social Science Invention ISSN (Online): 2319 – 7722, ISSN (Print): 2319 – 7714,
Vol. 5 (10). Pp.54-58
Raman Mariyappan, & Hussain, T. (2016). Public, Private Sector and NGO‘s Motivating
(Inspiration) Factor Managing Highlands Developments in Malaysia. Imperial Journal of
Interdisciplinary Research, 2(12). pp. 1233-1237. e-ISSN: 2454-1362
Raman Mariyappan. (2015). International Politics and Environmental Policies. In. Knocks
Tapiwa Zengeni & Mohd Azizuddin Mohd Sani. (Eds.) International Relations. pp. 213-
215. Pearson. ISBN 978-967-349-345-5
Raman Mariyappan, Tn Pah Rokiah, Hamidi Ismail. (2014). Taburan Hujan dan Kerakusan
Aktiviti Pembalakan Sebagai Pemacu Keterancaman Penduduk di Pedalaman Kedah.
In. Mohd Hairy Ibrahim. (Eds.) Cabaran Perubahan Iklim Terhadap Manusia di Malaysia.
pp. 1-16. Penerbit Universiti Pendidikan Sultan Idris.
Raman Mariyappan, Tn Pah Rokiah, Hamidi Ismail. (2013). Property Development and
Environmental Consequences at Kubang Pasu District of Northern Corridor Economic
Region. In. Narmah Samat, Ruslan Rainis, Syarifah Rohayah Syeikh Dawood, Wan
Ruslan and Zullyyadini A. Rahman (Eds.) Selected Issues on Health and Environment.
Raman Mariyappan. (2017). Field Base Teaching: A Malaysian Experience. Journal of
Educational and Social Research, 121-127.
Raman Mariyappan. (2016). The Paradigm Shift of Managing Hilly Terrains Developments in.
International Journal of Humanities, 54-58.
Rappe, B. B. (2007). Identifying the motivations of environmental volunteers. Journal of
Environmental Planning and Management, 503-516.
Rebecca Nesbit, R. K. (2017). The Limits and Possibilities of Volunteering: A Framework for
Explaining the Scope of Volunteer Involvement in Public and Nonprofit Organizations.
Retrieved from wiley online library:
https://onlinelibrary.wiley.com/doi/abs/10.1111/puar.12894.
Yao, K. (2015). Who Gives? The Determinants of Charitable. Retrieved from Wharton Research
Scholars: https://repository.upenn.edu/wharton_research_scholars/126/.
35
-GP05-
Urban Green Space And Sustainable Cities
Raman Mariyappan1and Arua Devi Varatharajoo2

2 School of Government, Universiti Utara Malaysia, aruna.sara@yahoo.com
Abstract
In Malaysia, the open space defined as any land whether enclosed or not reserved or
reserved to be specified in whole or in part as a public garden, public parks, sports fields and
recreation areas, dining areas, wind areas, walking areas or as a public place It is also generally
referred to as recreational areas and public parks for the same function. The demand and need
for green spaces especially related leisure activities force the government provide a recreation
area in parallel with the economy development. The provision of open spaces and public parks
next to neighborhood must be developed and made available in every locality and with at least a
Local garden of state capital to achieve the vision of Malaysia National Park set in the National
Landscape Policy. Rapid urban development has raised the issue of the ability of green areas
and open space to accommodate the increasing population. The adequacy of the provision of
green spaces and leisure in Malaysia becoming increasingly serious public park in Malaysia
showed only able to accommodate the needs of social recreation for 6.81 people, while 9.15
million Malaysians who are residents of the city. This situation is further complicated when the
needs of urban land use accommodates another use of the land which has more economic
impact than for the purpose of open space and green. This leads to limited land use issues
adequacy and accessibility of the public to the open spaces and green in the city to be serious
which shows that about 15.09 million Malaysians categorized as urban dwellers Thus, people in
this city definitely need green areas and open space for recreational purposes. Furthermore,
recreational parks that are supposed to meet the satisfaction of the public, including women,
children, the elderly and disabled to the concept of inclusivity in sustainable development can be
applied. Hopefully this study can motivate the urban planners to plan friendly and sustainable
cities with emphasizes on green space.
Key Words: Green space, Sustainable cities, Urban Development
1. INTRODUCTION
Biodiversity of urban green spaces is well recognized for the provision of variety of
ecosystem services to humanity. Hence green spaces are recognized as one of the most
popular resources of the urban ecosystems today. The increasing urbanization and human
population growth during recent decades have resulted significant loss of habitats in the urban
landscape (Mckinney, 2002) and accompanied by many environmental problems, such as a
reduction of green spaces and ecosystem deterioration (Lee et al., 2005). In urban areas, the
importance of urban green spaces is well highlighted as remnant habitats with high value for
biodiversity and because some of rare and endangered species with significant conservation
value may present in these habitats. Urban green space includes everything in cities that has
the vegetation. Collectively it is sometimes referred to as ‗Green Infrastructure‘, encompassing
the entire working landscape in cities that serve roles such as improving air quality, flood
protection and pollution control (Girling and Kellett, 2005). Some of the many benefits of urban
36
green spaces are; air and water purification, mitigation of the impact of environmental pollution,
carbon sequestration, regulation of microclimate, habitat for urban wildlife, recreational, spiritual
and therapeutic value as well as social integration (Miller, 1997; Milton, 2002; Hague and
Siegel, 2002). Hence, green space improves the environmental quality of life, urban tourism,
active and passive recreations and many other urban ecological functions (Kaplan and Kaplan,
1989; Randall et al., 2003). At present, several studies have pointed to urban green spaces as a
resource in promoting public health and providing valuable ecosystem services to urban
dwellers (Maas et al., 2006; Alver, 2006; Jim and Chen, 2008; Rafiee et al., 2009; James et al.,
2009). Monitoring land use changes in the urban environment is an important issue in planning
and management and remote sensing and geographic information systems are considered as
the most efficient techniquesfor this type of studies. Using these modern tools, a range of recent
studies have focuses on monitoring urban growth pattern, land use and land cover changes,
urban green space patterns, and biodiversity conservation in urban areas (for e.g. Herold et al.,
2003; Jim and Chen, 2003; Bauer et al., 2003; Yuan et al., 2005; Jim and Chen, 2006a, b;
Jensen and Im, 2007; Johari, 2007; Kazmierczak and James, 2008; Faryadi and Taheri, 2009;
Rafiee et al., 2009; James et al., 2009; Chen et al., 2009). Considering the fact that urbanization
is having enormous impact on the environment at local, regional and global scale (Turner et al.,
1990) the trend of studying different aspects of urban green spaces is gaining momentum
among urban researchers. Conservation of biological diversity and ecosystem services in urban
environment necessitate valuable ecological information which could be incorporated into urban
green space planning and management.
Therefore, there is a continuing need to promote such initiatives for sustainable
development of urban landscapes. Gill et al. (2007) emphasized that the urban green spaces
can play a central role in both climate-proofing cities and in reducing the impacts of cities on
climate. Presently, as rapid urbanization is causing losses of even more urban green space
across the globe, this may have therefore important implications for future changes in the
Earth‘s climate. Hence, urban green spaces need to be preserved and promoted for future
generation as they provide key ecological services.
2. THE PUZZLE
Cities are comprised of more than just buildings and people. The most ―liveable‖ cities –
and some of the world‘s most famous cities – are as known for their open space as they are for
their culture. Hyde Park in London, Central Park in New York, the Bukit Timah Nature Preserve
in Singapore, Phoenix Park in Dublin… all are attractions in their own right for inhabitants and
visitors alike.Open space in urban environments provides many advantages: formal and
informal sport and recreation, preservation of natural environments, provision of green space
and even urban storm water management. Thus green space must be a key consideration in
urban planning if the health of a city and its people are both considered important. A new,
broader view of parks has also recently been emerging. This new view focuses on how
policymakers, practitioners, and the public can begin to think about parks as valuable
contributors to larger urban policy objectives, such as job opportunities, youth development,
public health, and community building.As the world‘s cities continue to grow, continuing to value
green space in cities is vital: but is also a challenge, particularly in developing nations where
there is pressure for space, resources and development.
There are numerous health benefits associated with access to public open space and
parks. Access to vegetated areas such as parks, open spaces, and playgrounds has been
associated with better perceived general health, reduced stress levels, reduced depression and
more. According to the World Health Organization (2017), physical inactivity is a major public
health risk. In Australia, nearly half of all Australians do not meet even the 30 minute daily
37
physical activity recommendations. One study found that people who use public open spaces
are three times more likely to achieve recommended levels of physical activity than those who
do not use the spaces. Users and potential users prefer nearby, attractive, and larger parks and
open spaces (Wolf, 2008). Thus, improving access to public open space has the potential to
increase levels of physical activity, and to have mental health benefits and reduce healthcare
and other costs.
Urban parks also contribute environmental benefits. A network of parks and open spaces that
include protected natural lands, ecological reserves, wetlands, and other green areas is critical
to providing healthy habitats for humans, wildlife and plants in these densely built places.
Natural landscapes are vital to preserving regional ecosystems amid growing cities. Parks also
help create human and energy efficient cities that can help slow global warming. Linear parks
and open spaces make compact living attractive and viable. Trail networks link individual parks,
making them easier to bike and walk. Old rail lines can be transformed into greenways, and
gardens planted on rooftops maximize limited space and curtail greenhouse gas emissions.
Every tree helps fight global warming by reducing the amount of greenhouse gases in the
atmosphere and help cool cities. In the US, an evaluation of the largest 85 cities in the country
(population of 57.2 million) found the health savings from parks was an estimated $3.08 billion.
The environmental savings are significant as well. Trees and vegetation in urban parks offer
lower cost, natural solutions for addressing storm water runoff and air pollution. One major city,
Philadelphia, experienced $16 million in annual public cost savings as a result of storm water
management and air pollution reduction, according to a 2008 report by the Trust for Public Land
Center for City Park Excellence.
Cities are hubs for ideas, commerce, culture, science, productivity, social development
and much more. Cities enabled people to advance socially and economically (United Nation,
2017). However, many challenges exist to maintaining cities in a way that continues to create
jobs and prosperity while not straining land and resources. Common urban challenges include
congestion, lack of funds to provide basic services, a shortage of adequate housing and
declining infrastructure. The challenges cities face can be overcome in ways that allow them to
continue to thrive and grow, while improving resource use and reducing pollution and poverty.
The future we want includes cities of opportunities for all, with access to basic services, energy,
housing, transportation and more. In Sustainable Development Goal (SDG), the importance of
inclusive, safe, resilient and sustainable cities is goal of United Nation. One of the important
goals is by 2030, provide universal access to safe, inclusive and accessible, green and public
spaces, in particular for women and children, older persons and persons with disabilities (United
Nation, 2017).
Green space also promotes physical activity, psychological well-being, and the general
public health of urban residents. Access to green space is therefore increasingly recognized as
an environmental justice issue. Strategies to increase the supply of urban green space,
especially in park-poor neighbourhoods must be implemented (Jennifer R. Wolch, Jason Byrne,
Joshua P. Newell, 2014). A city with high-quality and generous green spaces epitomizes good
planning and management, a healthy environment for humans, vegetation and wildlife
populations (Jim, 2004), and has a positive association with the perceived general health of
residents (Jolanda et al, 2006). Study by Agnes E. van den Berg, Jolanda Maas, Robert A.
Verheij, Peter P. Groenewegen (2010) show that green space can attenuate negative health
impacts of stressful life events. Their study show that the relationships of stressful life events
with number of health complaints and perceived general health were significantly moderated by
amount of green space in a 3-km radius. Respondents with a high amount of green space in a
3-km radius were less affected by experiencing a stressful life event than respondents with a
low amount of green space in this radius. The same pattern was observed for perceived mental
health, although it was marginally significant. The moderating effects of green space were found
38
only for green space within 3 km, and not for green space within 1 km of residents' homes,
presumably because the 3-km indicator is more affected by the presence of larger areas of
green space, that are supposed to sustain deeper forms of restoration. These results support
the notion that green space can provide a buffer against the negative health impact of stressful
life events. Thus, people in this city definitely need green areas and open space for recreational
purposes. Furthermore, recreational parks that are supposed to meet the satisfaction of the
public, including women, children, the elderly and disabled to the concept of inclusivity in
sustainable development can be applied. Hopefully this study can motivate the urban planners
to plan friendly and sustainable cities with emphasizes on green space.
3. BACK GROUND READINGS
At present, with the increase in the proportion of global urban population, cities are also
expanding spatially and resulting in loss of urban green spaces. Particularly the expansion of
residential and commercial land uses towards the periphery of urban areas has been
recognized as the main factor in influencing the urban ecosystems (Yuan et al., 2005). The
negative environmental impacts of urban growth have been demonstrated in developed and
developing countries (Chiesura, 2004; Colding, 2007; Theobald et al., 2000; Tzoulas et al.,
2007). Therefore the need of establishing sustainable equilibrium between ecological, social
and economic functions of the urban ecosystems has been debated in different forum and
continues towards achieving sustainable urban landscapes. In Malaysia, urban population in
2000 was more than 57% of the total population and is projected to reach 70% of the total by
2020 (Department of Statistics, Malaysia 2000, Salleh, 2000). The trends of rapid urbanization
are evident in cities such as Kuala Lumpur and Georgetown, Penang with high population
density. This increase in urban population in due course will result in a transformation of the
physical appearance of many cities in Malaysia (Ghazali, 1999).
The need of careful planning and monitoring of urban growth by local and federal
authorities of Malaysia has also highlighted by Samat (2006), who pointed out that the changes
in land use can generate local, regional or global impact on biodiversity, landscape or living
environment. In general some comprehensive studies addresses the issues of urban
development, sustainable urban landscapes and urban planning and conservation in Malaysia
(e.g. Goh, 1991, 2002; Ghani, 2000; Salleh, 2000; Jenkins and King, 2003; Omar, 2003;
Abdullah, 2003; Omar, 2003; Tahir and Roe, 2006; Lee et al., 2008). In order to guide
economists and urban planners in making a decision pertaining to urban development, Osman
et al. (2008) developed a framework of understanding urban sprawl and its financial cost in
Malaysia. Other researchers applied different approaches to analyze the relationship between
urban growth and the impacts on urban environment. Some studies focuses on application of
geospatial tools to develop decision support framework for urban environment (Rainis and
Noresah, 2004; Noresah, 2006; Samat, 2007; Noresah and Rainis, 2009). And more recently,
Tan et al. (2009) used an integrated approach of remote sensing to evaluate urban expansion
and determine land use changes. Results of this study illustrated that Landsat multitemporal
image could provide an accurate map and detailed descriptions of land cover changes and
these findings can be efficiently used for decision-making in land management and policy
making. However, studies on urban green spaces have not received much attention so far. Few
studies have been carried out in this area (e.g. Johari, 2007; Hussein, 2006; Mazlina and Ismail,
2007, 2008), however comprehensive studies are still to be conducted in order to achieve
sustainable urban landscapes. According to Salleh and Ishak (2002), rapid economic growth
and widespread urbanization is deteriorating the Malaysian cities and air and noise pollutions
are becoming serious problems in many urban areas.
39
Cities need energy, materials, water and nutrients to provide sustenance and shelter to its
citizens, to produce goods and services, to grow and to eliminate waste and pollution (Kennedy,
Cuddihy& Engel-Yan, 2007). And, in the same way that an animal‘s metabolism is the result of
cooperation between the brain, organs and enzymes, urban metabolism is facilitated by the
city‘s governance policies, its infrastructure, and its citizens. More and more of the world‘s
people are moving to cities, which must expand at a rapid rate to accommodate the influx
(Kötter&Friesecke, 2011). Bigger cities demand more food, water and fuel which in turn causes
an increase in emissions, refuse and wastewater production (Kennedy, Cuddihy&EngelYan,
2007). Unfortunately, this means that while urban systems depend on ecosystem services
(Millennium Ecosystem Assessment, 2005) to thrive, they also threaten those same ecosystems
through resource-use, land encroachment and pollution. In fact, the modern urban metabolic
cycle drives environmental change on a local-to-global scale, affecting land-use and cover,
biodiversity, hydrosystems, biogeochemical cycles and climate (Grimm et al., 2008). Many of
these environmental consequences lead to new large-scale problems that impact on economic
activity and public health. Population density increases, socio-economic disparities may be
exacerbated and infrastructure problems could arise (Kötter&Friesecke, 2011). As such,
researchers emphasize the value of understanding efficient urban metabolism in the context of
sustainable city planning (Chrysoulakis, de Castro & Moors, 2014).
Finally, an integrated approach to urban governance that extends past urban limits to the
surrounding area is essential to promote a sustainable dynamic relationship between humans
and their environment, ensuring that both quality of life and eco-friendly businesses are
promoted, which also sustains economic prosperity in the long run. The European Environment
Agency (EEA) uses the ‗DPSIR‘ (Driving forces, Pressures, States, Impacts, and Responses)
framework (Gabrielsen& Bosch, 2003) to structure and classify environmental indicators along
the causal chain from socio-economic causes to political and societal responses. However, this
approach has its limits when it comes to representing the complex interplay between
environmental, socio-economic and governance factors — for example, discrepancies have
been found in the definition of DPSIR‘s information categories (Gari et al., 2015; Cooper, 2012).
It cannot therefore be deemed suitable to provide the base structure for sustainability indicators.
A widely accepted Venn diagram, depicting environmental, social and economic aspects of
sustainability (see Figure 1, adapted from Tanguay, 2009) illustrates the necessary integration.
Other depictions might set these elements in concentric circles; economic inside social inside
environmental. Yet others (Adams, 2006) would emphasize that the environmental elements
need to expand in order to match the size of the other two circles. All, however, show that the
practical realisation of sustainability can only happen in the overlap — the dynamic — between
the 3 fundamental elements.
4. DISCUSSIONS
Open spaces are places that affect users and their environment. Place is a sociable and
lively space in character (Child, 2004). Open spaces are public realms that come in many
shapes, sizes and uses. Studies on place making often take a broader approach in discussing
the significance of place through research on a single space as a subject, for example, streets
(Jacobs, 1961; Appleyard, 1980; Nursidah, 2012), squares (Child, 2004), parks and open
spaces (Ward Thompson, 2002). Some researchers extend the concept and understanding of
place making in bigger areas such as riversides and seafronts (e.g. Moughtin, 2003, Nurul
Syala et al., 2012). These researches have a common aim that is to assist designers, planners,
developers, government and the public understand the meaning and functions of open space as
a public realm. This paper offers insights into the ways that public realm, i.e. open space can
enrich people‘s lives and sense of self. Therefore, it explores one of the salient parameters of
40
good public place making— diversity. In specific, it focuses on experiences of diversity by users
in a historic public open space in two colonial towns in Malaysia. The dimensions of diversity of
are determined for both public open spaces.
In Malaysia, the open space defined as' any land whether enclosed or not reserved or
reserved to be specified in whole or in part as a public garden, public parks, sports fields and
recreation areas, dining areas, wind areas, walking areas or as a public place '(Town and
Country Planning Department, 2000). It is also generally referred to as recreational areas and
public parks for the same function. (Mazifah, Azahar and Kadir, 2014). The demand and need
for green spaces especially related leisure activities force the government provide a recreation
area in parallel with the economy development. According Mazifah, Azahar and Kadir (2014),
the provision of open spaces dan public parks next to neighbourhood must be developed and
made available in every locality and with at least a Local garden of state capital to achieve the
vision of Malaysia National Park set in the National Landscape Policy. Rapid urban
development has raised the issue of the ability of green areas and open space to accommodate
the increasing population. The adequacy of the provision of green spaces and leisure in
Malaysia becoming increasingly serious public park in Malaysia showed only able to
accommodate the needs of social recreation for 6.81 people, while 9.15 million Malaysians who
are residents of the city (Mazifah, Azahar and Kadir, 2014). This situation is further complicated
when the needs of urban land use accommodates another use of the land which has more
economic impact than for the purpose of open space and green. This leads to limited land use
issues adequacy and accessibility of the public to the open spaces and green in the city to be
serious which shows that about 15.09 million Malaysians categorized as urban dwellers
(Mazifah, Azahar and Kadir, 2014).
Evidence suggests that environmental aesthetics may be closely associated with place
attachment, or emotional bonds to a location (Lewicka, 2011). This link can be facilitated
through the perceived quality of green spaces, which can positively relate to sense of
community (Francis, J., Giles-Corti, B., Wood, L., Knuiman, M., 2012) and community
attachment among urban residents (Arnberger, A.; Eder, R., 2012). For example, a cross-
sectional study in Denver, Colorado explored the role of neighborhood gardens on
neighbourhood attachment and discovered that community and home gardens contributed to
greater neighborhood attachment (Comstock, N.; Dickinson, L.M.; Marshall, J.A.; Soobader,
M.J.; Turbin, M.S.; Buchenau, M.; Litt, J.S., 2010). Green spaces may also enhance sense of
place and place attachment by increasing neighbourhood satisfaction. Florida et al. (J. Environ,
2016) used survey data to examine the influence of aesthetic beauty on community satisfaction
across the U.S. and found a significant positive relationship between attractive physical settings
(e.g., trails, outdoor parks, and playgrounds) and community satisfaction. A study in College
Station, Texas, also noted that characteristics of vegetation (e.g., canopy cover, tree patch size,
and shape) can increase neighbourhood satisfaction (Lee, S.-W., Ellis, C.D., Kweon, B.-S.,
Hong, S.-K., 2008). Along similar lines, other studies have observed a favourable link between
coverage of green spaces and social indicators such as neighbourhood satisfaction in Flint,
Michigan (Alaimo, K., Reischl, T.M., Allen, J.O., 2010). Baltimore, MD (Holtan, M.T.; Dieterlen,
S.L.; Sullivan, W.C., 2015) and central Ohio. On the contrary, a study in California found that big
trees and yard space did not significantly contribute to neighbourhood satisfaction (Lovejoy, K.;
Handy, S.; Mokhtarian, P., 2010). Thus, the influence of nature and vegetation on
neighbourhood satisfaction can demonstrate mixed results. More research is needed to
understand mechanisms driving these relationships. In addition to sense of place and
community satisfaction, cultural services from urban green space can demonstrate more
tangible impacts on the neighbourhood and built environment. As research highlights the
negative health effects of ―food deserts‖ in disadvantaged communities, access to nutritious and
affordable foods has become an increasingly important health promotion tool across urban
landscapes (Walker, R.E.; Keane, C.R.; Burke, J.G., 2010). The ecosystem services provided
41
by urban green space create opportunities for urban gardening (Comstock, N., Dickinson, L.M.,
Marshall, J.A., Soobader, M.J., Turbin, M.S., Buchenau, M., Litt, J.S., 2010) and foraging
(McLain, R.J.; Hurley, P.T.; Emery, M.R.; Poe, M.R., 2014) that contribute to healthy lifestyles.
For example, a study in Denver, CO, found that community gardeners consumed significantly
more fruits and vegetable daily than their non-gardening counterparts (Litt, J.S., Soobader, M.-
J., Turbin, M.S., Hale, J.W., Buchenau, M., Marshall, J.A., 2011). A similar study in Denver
showed that interactions with urban gardens not only increased healthy food intake, but also
strengthened residents‘ neighbourhood attachment and participation in other types of health
behaviors(Comstock, N., Dickinson, L.M., Marshall, J.A., Soobader, M.J., Turbin, M.S.,
Buchenau, M., Litt, J.S., 2010).
5. CONCLUSION
Thus, urban green areas have a vital role to play in the sustainability of towns and cities
as they are considered as important parts of natural life support system. The authors also
suggested that government must make urban greening mandatory in all development projects
and advocated for using local agenda 21 to incorporate sustainable development into local town
planning, including tree planting. Urban green space studies have great significance in the near
future in accommodating the increasing urban population. Therefore, more studies should be
focused on urban green spaces of Malaysian cities. Also getting green space information
quickly and accurately can provide a foundation for urban environment, green space system
planning and all-level of decision making. Considering the fact that the understanding of
importance of urban green space for obtaining social and ecological sustainability in Malaysian‘s
urban landscapes is essential; such studies therefore would have implications to improve urban
environmental quality for people by supporting biodiversity conservation and preserving urban
green space resources.
REFERENCES
Adams. (2006). Innovation management measurement: A review. Retrieved from

https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1468-2370.2006.00119.x.
Alaimo, K., Reischl, T., & Allen, J. (2010). Community gardening, neighborhood meetings, and
social capital. J. Community Psychol.
Al., M. e. (2006). Green space, urbanity, and health: how strong is the relation? Retrieved from
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2566234/.
Arnberger, A., & Eder, R. (2012). The influence of green space on community attachment of
urban and suburban residents. In Urban For. Urban Green.
Comstock, N., Dickinson, L., Marshall, J., Soobader, M., Turbin, M., Buchenau, M., et al. (2010).
Neighborhood attachment and its correlates: Exploring neighborhood conditions,
collective efficacy, and gardening J. Environ. Psychol,30, 435–442.
Department of Statistic. (2000). Retrieved from Department of Statistics Malaysia Official
Portal.: https://www.dosm.gov.my/v1/.
Department, T. a. (2000). Act 172 Town And Country. Retrieved from Laws Of Malaysia:
http://www.pht.org.my/legislation/Town_and_Country_Planning_Act.pdf.
Florida, R., Mellander, C., & Stolarick, K. (2010). The role of perceived aesthetic beauty in
community. In Beautiful places. Reg. Stud. 45, 33–48.
Francis, J., Giles-Corti, B., Wood, L., & Knuiman, M. (2012). Creating sense of community: The
role of public space. J. Environ. Psychol, 32, 401–409.
42
Ghazali. (1999). Understanding Muslim Theology in the Works of Shaykh . Retrieved from
http://web.usm.my/kajh/vol20_1_2013/KAJH%2020%201%20Art%203%20(33-50).pdf.
Holtan, M., Dieterlen, S., & Sullivan, W. (2015). Tree canopy and social capital in. In m.
baltimore, Social life under cover, 47, 502–525.
Hussein. (2006). Barrier-free park design for the disabled persons: a case study of the KLCC
Park. Journal of Design and the Built Environment .
Jennifer R. Wolch, J. B. (2014). Urban green space, public health, and environmental
justice:The challenge of making cities „just green enough‟. Retrieved from Landscape
and Urban Planning: http://ced.berkeley.edu/downloads/research/LUP.parks.pdf
Johari. (2007). Assessing the ecological quality of urban. Postgraduate Conference 2007.
Institute of Geography.
Kellett, G. a. (2005). Skinny Streets and Green Neighborhoods. In Design for Environment and
Community (p. 192).
Koh, H., Piotrowski, J., Kumanyika, S., & Fielding, J. (2011). Healthy People a 2020 vision for
the social determinants approach, 38, 551–557.
Kuo, F., & Taylor, A. A. (2004). potential natural treatment for attention deficit/hyperactivity
disorder: Evidenc from a national study. Am. J. Public Health .
Lee, P.-L., Lan, W., & Lee, C. (2005). Physical activity related to depression and predicted
mortality risk. Results from the Americans‟ changing lives study, 678–690.
Lewicka, M. (2011). Place attachment: How far have we come in the last 40 years? J. Environ.
Psychol,31, 207-230.
Lee, S.-W., Ellis, C., Kweon, B.-S., & Hong, S.-K. (2008). Relationship between landscape
structure and neighborhood satisfaction in urbanized areas.
Litt, J., Soobader, M.-J., Turbin, M., Hale, J., Buchenau, M., & Marshall, J. (2011). The influence
of social involvement, neighborhood aesthetics, and community garden participation on
fruit and vegetable. In A. J.. Public Health.
Lovejoy, K., Handy, S., & Mokhtarian, P. (2010). An evaluation of contributing characteristics in
eight California neighborhoods. In Neighborhood satisfaction in suburban vs. traditional
environments (p. 97).
Mazifah, A. a. (2014). Focusing on environmental management. The process of negotiations
towards acceptance of the montreal protocol in Malaysia.
Mazlina M, I. S. (2014). Green infrastructure as network of social spaces for well-being of urban
residents: a review. Proceedings of International Conference on Built Environment in
Developing. Universiti Sains Malaysia.
Mckinney. (2002). Urbanization, Biodiversity, and Conservation: The impacts of urbanization on
native species are poorly studied, but educating a highly urbanized human population
about these impacts can greatly improve species conservation in all ecosystems.
BioScience.
Miller. (1997). Psychology and Social Change. Retrieved from Participatory Action
Research:https://spssi.onlinelibrary.wiley.com/doi/abs/10.1111/j.1540-
4560.1997.tb02454.x.
Nation, U. ( 2017). Sustainable Development Goals Report 2017. Retrieved from
https://www.un.org/development/desa/publications/sdg-report-2017.html.
Osman. et al. (2008). Potential of the indigenous desert grasses of the Arabian Peninsula for
forage production in a water-scarce region. Retrieved from
http://dx.doi.org/10.1111/j.1365-2494.2008.00656.x.
43

Vol. 5 (10). Pp.54-58
215. Pearson. ISBN 978-967-349-345-5
Samat. (2006). Penerokaan Teknologi Melalui Seni Dan Warisan Dalam Kearifan Tempatan .
Universiti Sains Malaysia. Osman et al. (2008). Potential of the indigenous desert
grasses of the Arabian Peninsula for forage production in a water-scarce region.
Retrieved from http://dx.doi.org/10.1111/j.1365-2494.2008.00656.x
U.S. Department of Health and Human Services (DHHS).
-GP06-
Housing Industry and Sustainable Development
Raman Mariyappan1 and Rani Ramanad2

1 School of Government, Universiti Utara Malaysia, Senior Lecturer, raman@uum.edu.my
2 School of Government, Universiti Utara Malaysia, raniramanad@yahoo.com
Abstract:
Housing industry must work and comply with the needs to protect and sustain the
environment. Sustainable construction, which has been dubbed „green construction‟, describes
the responsibility of the construction industry in attaining sustainability. The term sustainability
has been adopted as a panacea for change and developmentSustainable construction is a
process whereby, over time, sustainability is achieved. The concept of sustainability must be
applied into construction industry to influence the manner in which a project shall be conducted
to strike a balance between conserving the environment and maintaining prosperity in
developmentAttaining sustainability does not mean the eradication of adverse impact, which is
44
an impossible vision at present, but rather the reduction of it to a certain reasonable level. The
movement for „greener‟ construction, the concept of sustainability in building and construction
has initially focused on issues of limited resources especially energy, and on how to reduce
impacts on the natural environment with emphasis on technical issues such as materials,
building components, construction technologies and energy related design concepts. The
appreciation of the significance of non-technical issues (soft issues) has grown, giving
recognition to economic and social sustainability concerns as well as cultural heritage of the
built environment as equally important. Presently, the concept of sustainable construction
governs three main pillars: environmental protection, social well-being and economic prosperity.
Environmental protection concerns on the built environment and the natural environment. The
built environment refers to the activities within the construction project itself, which may, if not
handled effectively, have a serious adverse impact on the environment. Environmental
sustainability is also concerned with the extraction of natural resources. Although builders have
little influence over the extraction of natural resources, they can help discourage this activity by
demanding less non-renewable natural resources, more recycled materials, and efficient use of
energy and mineral. Social well-being concerns with the benefits of the workers and the future
users. Basically, this aspect is concerned with human feelings: security, satisfaction, safety and
comfort, and human contributions: skills, health, knowledge and motivation. Finally, the
economic sustainability is concerned with the micro and macro-economic benefit. Micro-
economic focuses on the factors or activities which could lead to monetary gains from the
construction while macro-economic relates to the advantages gained by the public and
government from the project success. Construction practitioners worldwide are beginning to
appreciate sustainability and acknowledge the advantages of building sustainable. For example,
the concept of green building costs lower than conventional method and saves energy as
demonstrated. The approach of sustainable construction will enable the construction players to
be more responsible to the environmental protection needs without neglecting the social and
economic needs in striving for better living.
Key Words: Housing Industry, Sustainable Development, Green Construction
1. INTRODUCTION
Buildings and structures enabled mankind to meet their social needs for shelter, to meet
economic needs for investment and to satisfy corporate objectives. However, the satisfaction of
these needs usually comes with a high price i.e. an irreversible damage to our environment.
This lead to a growing realization around the world to alter or improve our conventional way of
development into a more responsible approach which can satisfy our needs for development
without harming the world we live in. The opportunity for improvement arrived when a new
philosophy called ‗sustainable development‘ was introduced in 1987 in Brundtland Report. Since
that, many progressive world events had taken place to increase the awareness on environment
and sustainability agendas such as Rio Earth Summit 1992, Maastricht Treaty 1992, Kyoto
Conference on Global Warming 1997, Johannesburg Earth Summit 2002 and Washington Earth
Observation Summit 2003 (N. Zainul Abidin, 2005). The ideas and strategies initiated by these
world events have prompted positive actions and plans by many countries to implement and
absorb this philosophy within their industries.
Subset to this philosophy is sustainable construction, which described the responsibility of
the construction industry to attain sustainability. Through sustainable construction concept, the
construction industry can contribute in a positive and proactive manner towards environmental
protection. Delivering sustainable construction requires action from all engaged in constructing
and maintaining the structure or building including those providing design, consulting and
45
construction services. It requires willingness to explore new territory in construction approach

and prepare to adopt new products, ideas and practices (G. Ofori, C. Briffett, G. Gang and M.
Ranasinghe, 2000). As global interest on sustainability has steadily blooming, Malaysia should
not fell short in its attitude on sustainability and sustainable construction. Malaysia needs to
demonstrate that it can abide by this new interest and can compete in the global market. This
research delves into the actions undertaken by the Malaysian government, non-government
organizations and construction players in promoting sustainability in construction. Through
extensive literature review, this research will discuss the commitment of the Malaysian
government on sustainability agenda and the progress so far in the construction industry. This
research will also discuss the findings from a survey conducted to investigate the awareness of
the developers regarding this issue and whether they have absorbed the concept of sustainable
construction in their current practices.
2. THE PUZZLE
The housing industry faces various challenges due to demand and supply factors. The
industry also needs to accommodate changes according to development of new technology.
Meanwhile Construction Industry Development Board of Malaysia has guidelines for the
organization members. The sustainable development guidelines practices for developers are
not specifically spelled out. Although the relevant federal ministry or agencies has rules and
regulations as well as guidelines to be monitored by the developers during construction of any
buildings, there are no specific guidelines for sustainable development practices. Construction
industry must inevitably change its historic methods of operating with little regard for
environmental impacts to a new mode that makes environmental concerns a centerpiece of its
efforts. Previously, the concern on environment is relatively a small part of most of construction
development. However, with the growing awareness on environmental protection due to the
depletion of nonrenewable resources, global warming and extremity of destruction to ecology
and biodiversity impact, this issue have gain wider attention by the construction practitioners
worldwide. Many efforts are being directed to build sustainably in construction world. The
direction of the industry is now shifting from developing with environmental concern as a small
part of the process into having the development process being integrated within the wider
context of environmental agenda. So, the housing industry needs to rectify and address the
pressing issues related sustainable development.
3. BACKGROUND READING
Housing industry must work and comply with the needs to protect and sustain the
environment. Sustainable construction, which has been dubbed ‗green construction‘, describes
the responsibility of the construction industry in attaining sustainability. The term sustainability
has been adopted as a panacea for change and development (C. Hayles. 2004). Sustainable
construction is a process whereby, over time, sustainability is achieved. The concept of
sustainability must be applied into construction industry to influence the manner in which a
project shall be conducted to strike a balance between conserving the environment and
maintaining prosperity in development (G. Ofori, 1992). Attaining sustainability does not mean
the eradication of adverse impact, which is an impossible vision at present, but rather the
reduction of it to a certain reasonable level. The movement for ‗greener‘ construction by N.M.
Das Gandhi, V. Selladurai and P. Santh, (2006) the concept of sustainability in building and
construction has initially focused on issues of limited resources especially energy, and on how
to reduce impacts on the natural environment with emphasis on technical issues such as
46
materials, building components, construction technologies and energy related design concepts.
The appreciation of the significance of non-technical issues (soft issues) has grown, giving
recognition to economic and social sustainability concerns as well as cultural heritage of the
built environment as equally important. Presently, the concept of sustainable construction
governs three main pillars: environmental protection, social well-being and economic prosperity.
Environmental protection concerns on the built environment and the natural environment.
The built environment refers to the activities within the construction project itself, which may, if
not handled effectively, have a serious adverse impact on the environment. Environmental
sustainability is also concerned with the extraction of natural resources. Although builders have
little influence over the extraction of natural resources, they can help discourage this activity by
demanding less non-renewable natural resources, more recycled materials, and efficient use of
energy and mineral resources (B. Addis and R. Talbot, 2001). Social well-being concerns with
the benefits of the workers and the future users. Basically, this aspect is concerned with human
feelings: security, satisfaction, safety and comfort (P.L. Lombardi 2001), and human
contributions: skills, health, knowledge and motivation (S. Parkin 2000). Finally, the economic
sustainability is concerned with the micro and macro-economic benefit. Micro-economic focuses
on the factors or activities which could lead to monetary gains from the construction while
macro-economic relates to the advantages gained by the public and government from the
project success. Construction practitioners worldwide are beginning to appreciate sustainability
and acknowledge the advantages of building sustainable. For example, the concept of green
building costs lower than conventional method and saves energy as demonstrated by Hydes
and Creech (K. Hydes and L. Creech 2000). This was further supported by Heerwagen (J.
Heerwagen 2000), [11], Bartlett and Howard E. Bartlett and N. Howard 2000) and (Pettifer E.
Bartlett and N. Howard, 2000), who added that sustainable buildings will contribute positively to
better quality of life, work efficiency and healthy work environment. Yates (2001) explored
sustainability the business benefits of sustainability and concluded that the benefits are diverse
and potentially very significant. The approach of sustainable construction will enable the
construction players to be more responsible to the environmental protection needs without
neglecting the social and economic needs in striving for better living.
As a developing country, Malaysia realised that the construction industry plays a
significant role in its economic growth. Over the last 20 years, the industry has been consistently
contributing between 3% - 5% of the national GDP (Construction Industry Development Board
(CIDB). However, the industry is not without weaknesses. Challenges have been in the areas of
productivity, quality, safety, technology and unproductive practices. The government is now
striving to upgrade the country, including its construction industry, by committing towards Vision
2020, which calls for a comprehensive quantum leap towards a knowledge based society. The
book ‗Malaysia‘s Vision 2020‘ published in 1993 defined national ambitions and future
opportunities for us and to consider long-term strategies to assist the achievement of national
goals. One of the basic visions that emerged is for the country to be ecologically sustainable.
This basic vision has become an impetus towards sustainability agenda in the country. The
issue of sustainable development has emerged as one of the top issues in the Eight Malaysia
Plan (2001 – 2005). According to the plan, the government gave high priority to research and
development as one of their strategy for sustainable development. Section 19 of the Plan was
devoted to integrate environmental consideration into development planning. During that period,
concerted efforts were expected to intensify in order to improve energy efficiency, forestry,
waste and environmental management. The Construction Industry Development Board
Malaysia (CIBD), which is a corporate established with the main function of developing,
improving and expanding the Malaysian construction industry, has identified the environment
and other sustainability-related issues as one of the top issues of the construction industry.
CIDB calls upon the researchers and construction practitioners to reassess the process of
construction to develop good construction planning and management to safeguard the
47
environment. To initiate research in this field, they have formed many focus groups in research
and development. One of the focus group focuses on environment and sustainability, which is
presently involved in research in waste minimization, environmental management plan, and
water management and construction hazard identification. Other institutions in Malaysia such as
INSPEN (National Institution of Valuation, Malaysia) and MASTIC (Malaysian Science and
Technology Information Centre) (Under Ministry of Science, Technology and Innovation) are
among the leading institutions for research and development and they have also identified
sustainability.
4. DISCUSSION
The development process cantered on two philosophies, first, aiming for profit through
economic approach or sustainopreneurship that prioritizes the development of society for the
sake of well-being and at the same time trying to maintain the social responsibilities (Robinson,
2004). Second, technology-oriented thinking in assisting the development of economic and
social areas through the ethnocentrism approach introduced by O'Riordan in 1972 (O'Riordan
1972; 1981). However, this technology-related thinking has been used as early as 1959 by Hays
(Hays, 1959). So, definitely the housing industry is profit orientated and the ultimate
achievement of the industry is to maximise the profit with minimise the cost. On the other hand
the house buyers want the most desired house with minimum cost and maximum satisfaction.
The literature of the study points out that implementation sustainable development practices
(inequalities, affordable and comfortable) might fulfil the developer‘s intention and the house
buyer‘s demand.
Further literature investigations suggest that implementation is about ppublic policy
implementation consists of organized activities by government directed toward the-achievement
of goals and objectives articulated in authorized policy statements. Implementation inspires little
interest among the general public, the media, the elected officials, and even students of public
policy. In particular, the electronic media (television and radio) fails to cover the nitty-gritty of
organization-building required for successful implementation. Political leaders regard this as the
province of the executive branch. The president or governor has not gone to the travail of being
elected so he or she can tend to the tedious details of administrative agencies. Other existing
agencies, public and private, may take a keen interest, however, for new programs represent
competition for resources and turf wars. Academics studying public policy consider
implementation the most neglected area of study and claim that implementation considerations
are sorely needed for social policy, in particular, to work. Yet the accumulated body of available
research remains slim, mostly case studies done in isolation from theory. Implementation also
about persuading the developers to comply on the sustainable development practices for the
betterment of the industry in the future.
According to Abd. Hamid Kadir Pakir, Amin Akhavan Tabassi, Mahyuddin Ramli, Abu
Hassan Abu Bakar and Kamand Mohammadzadeh Roufechaei (2012) the construction industry,
particularly the housing sector, can play a crucial role on sustainable development in both
developed and developing countries. Many researchers have discussed on different aspects of
sustainability, particularly in the construction industry. Accordingly, a variety of definitions and
interpretations on housing and sustainability can be found throughout the literature. For
instance, Maliene and Malys (2009) consider the housing as a key issue for delivering healthy
and attractive to the community. They emphasize on well available, high-quality, economic,
ecological, aesthetical design, comfortable and cozy aspects of sustainable housing to better
suit the needs of a person. Furthermore, they consider the sustainable housing as a housing
planned in a clever way. According to them, sustainable housing should be able to create high-
quality in technical and supply level, economic opportunity to cover purchase and exploitation
48
expenses for greater number of house-holds, ecological aspects in energy saving, ecological
building materials, and comfortable and cosy as the social–psychological aspect.
5. CONCLUSION
The inclusion of sustainable development practices in the housing industry is inevitable.

Various studies and publications by reputable institutions and world bodies time after time
emphasise on the incorporation of the sustainable development practices in the housing for the
betterment of the industry for a better future. This is very essential as the industry is facing
numerous issues related to material scarcity and efficient energy management through
sustainable practices. Hopefully the housing will adopt the sustainable practices in near future.
REFERENCES
Abd. Hamid Kadir Pakir, Amin Akhavan Tabassi, Mahyuddin Ramli, Abu Hassan Abu Bakar
and Kamand Mohammadzadeh Roufechaei. (2012). Sustainable housing development
and leadership: A review. Retrieved from
https://www.researchgate.net/publication/287540690_Sustainable_housing_development_and_l
eadership_A_review.
Abd Rahim Md Nor. (2009). Statistical methods in research. Petaling Jaya: Pearson
Malaysia.
B. Addis and R. Talbot. (2001). Incorporating sustainable construction into pfi projects: An
analysis of financial incentives and associated risks:Conference: Proceedings of the
20th Annual ARCOM Conference, 1-3 September.
Bartlett, E., Howard, N. (2000). Informing the decision makers on the cost and value of green
building, Building Research & Information, 28(5/6), pp. 315–324.
Casadesus & de Castro. (2005). Supply Chain Management Practices, Integration and Quality
Management: A Case Study Analysis in Thessaly. Conference Paper.
C. Alalouch and Mohamed S. Saleh. (2017).Towards Sustainable Construction in Oman:
Challenges & Opportunities. Retrieved from
https://www.researchgate.net/publication/283172564_Towards_Sustainable_Constru
tion_in_Oman_Challenges_Opportunities.
C. Hayles. (2004). ―The Role of Value Management in the Construction of Sustainable
Communities‖: The Value Manager [Online], Vol. 10, no. 1, Available:
http://www.hkivm.com.hk/publications/04/TVM2004- 1.pdf.
Chales, B. (2009). NGO networks in Central Asia and global civil society: Potentials and
limitations. Central Asian Survey, Vol. 28(1), 43-58.
Choguill, C. L. (2007). The Search for Policies to Support Sustainable Housing. Habitat
International, 31, 143-149.
Choguill. (1999). Sustainable Human Settlements: Some Second Thoughts. In: A.F. Foo and
Belinda Yuen (Eds.). Sustainable Cities in the 21st Century. Singapore: Singapore
University Press.
Donella H. Meadows, Dennis L. Meadows, Jorgen Randers William W. Behrens III. (1972). The
Limits to Growth. Universe Books.
Felipe Encinas, Carlos Aguirre and Carlos Marmolejo-Duarte. (2018). Sustainability
49
Attributes in Real Estate Development: Private Perspectives on Advancing Energy

Regulation_in_a_Liberalized_Market._Retrieved
from https://doi.org/10.3390/su10010146.
F I Zaidi, E M A Zawawi, R M Nordin and E M Ahnuar. (2018). An empirical analysis of
strategy implementation process and performance of construction companies. Retrieved
from
https://www.researchgate.net/publication/323674554_An_empirical_analysis_of_strateg
y_implementation_process_and_performance_of_construction_companies.
Garret Hardin. (1968). Science: Tragedy of the Commons: Vol 162, pp.1243-1248.
Bethany Hubbard. (2012). The Ecologist January 1972: A Blueprint For Survival.
Conference on the Human Environment. Stockholm.
Goebel. (2007). Sustainable urban development? Low-cost housing challenges in South
Africa. Retrieved from
https://www.researchgate.net/publication/223624955_Sustainable_urban_development_
Low-cost_housing_challenges_in_South_Africa.
G Ofori, C Briffett, G Gang, and M Ranasinghe. (2000). Impact of ISO 14000 on
construction enterprises in Singapore: Construction Management and Economics Vol.
18, no. 8, pp. 935-947.
Hydes, K. and Creech, L. (2000). Reducing Mechanical Equipment Cost. London: Routledge
Lts. pp: 403-407.
James Krieger and Donna L. Higgins. (2002). Housing and Health: Time Again for Public
Health Action. Retrieved fromhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC1447157/.
Jepson. (2007). Social Indicators and Measurements of Vulnerability for Gulf Coast Fishing
Communities. Retrieved from
https://onlinelibrary.wiley.com/doi/abs/10.1525/napa.2007.28.1.57.
J. Heerwagen. (2000). Green Buildings, Organizational Success, and Occupant Productivity.
Ph.D. London, UK.
Jose, G.-R., Luis, R.-L. and Vikas, K. (2015). A conceptual framework for the
implementation of quality management systems. Total Quality Management & Business
Excellence, 26 (11-12). pp. 1298-1310.
Katiman Rostam and Asmah Ahamad. (2006). Penilaian & Pengurusan Sumber Alam.
Bangi: Penerbit UKM.
Malaysia. (2018). Eight Malaysia Plan 2001 – 2005. Kuala Lumpur: Percetakan Nasional
Malaysia.
Maliene and Malys. (2009). Urban regeneration for sustainable communities: A case study.
Retrieved fromhttps://www.tandfonline.com/doi/pdf/10.3846/1392-8619.2009.15.49-59.
Marash, Berman & Flying. (2004). A conceptual framework for the implementation of
quality management systems. Total Quality Management and Business
Excellence 26(11). pp 1-13.
Mario L. Raposo et. al. (2014). Strategy and strategic management concepts: are they
recognised by management students.Retrieved from
https://www.researchgate.net/publication/304542769_Strategy_and_strategic_managem
ent_concepts_are_they_recognised_by_management_students.
Mehdi Yadollahi and Laily Hj. Paim (2009). The Level of Managerial Functions Practiced by
the Head of household and Family Economic Status in Kerman, Iran, Life Science
Journal, Volume 8, Issue 1, 2011.
Morgan, J. & Talbot, R. (2001). Sustainable Social Housing for No Extra Cost? IN Williams,
K., Burton, E. & Jenks, M. (Eds.) Achieving Sustainable Urban Form, London and
New York: Spon Press, pp. 319-328.
Nazirah Zainul Abidin. (2005). Delivering sustainability through value management:
50
Concept and performance overview. Engineering, Construction and Architectural

Management, Vol. 12 Issue: 2, pp.168-180.
N.M. Das Gandhi, V. Selladurai and P. Santh. (2006). Key Initiatives in Corporate Social
Responsibility. Formal-Cooperation-for-Developing-Sustainability.
P.L. Lombardi. (2001). Responsibilities toward the coming generation: Forming a new creed.
Urban Design Studies, 7, 89-102.
Rachel Carson. (1962). Silent Spring: The classic that launched the environmental movement:
Houghton Mifflin Company.
Vol. 5 (10). Pp.54-58
215. Pearson. ISBN 978-967-349-345-5
Ruper J. Boumgartner. (2011).Critical perspectives of sustainable development research and
practice. Journal of Cleaner Production. Vol 19 (8), 783-786.
Sadasivam Karuppannan and Alpana Sivam. (2014). Sustainable Development and Housing
Affordability.Retrieved from
https://www.researchgate.net/publication/255606423_Sustainable_Development_and_H
ousing_Affordability.
S H a Hamid, S a Mahayuddin and S Z H Syed Jamaludin. (2017). Enablers and challenges ofa
sustainable housing industry in Malaysia. Retrieved
fromhttps://www.researchgate.net/publication/234091315_Enablers_and_challenges_of_
a_sustainable_housing_industry_in_Malaysia.
S. Parkin. (2000). Proceedings of the Institution of civil Engineers-Civil Engineering:Sustainable
development: the concept and the practical challenge, Vol. 138(6), pp. 3-8.
Wendell. (2005). Foundations of future studies: Human Sciences for a New Era. New
Brunswick: Transaction Publishers.
Yates. (2001). The Art of Memory. Retrieved from https://www.amazon.com/Art-Memory-
51
Frances-Yates-Paperback/dp/B00I8YLSEM.
-GP07-
Green Ict: A Curse or Advantage to the Humankind?
Raman Mariyappan 1, Zainal Md. Zan2 and Muttamah Sathivelu3

2 School of Government, Universiti Utara Malaysia, zainal@uum.edu.my
3 Ghazali Shafie Graduate School of Government, Universiti Utara Malaysia,
mutammah_sathivelu@gsgsg.uum.edu.my
Abstract
In the advent of the digital era, awareness of the society on the sustainable development
practices in a country is crucial in maintaining a harmony between developments and sustaining
the environment. With the country‟s five years plan focussing on ICT‟s development throughout
the nation, there rises the question as to „be the aspects of green ICT incorporated in these
planning‟.There is evidence to show that ICT sector is one of the main contributors of e-waste,
let alone the detrimental effects of greenhouse gases (GHG) produced by each of the products.
It is undeniable too that the advancement in this sector puts on an overwhelming pressure on
the energy grid.However, ICT has a dual role: as an enabler of change with a significant role to
minimise the natural resources and contributor of the adverse effects. Education is a necessary
tool to bring about the awareness on these adverse effects of ICT and fully reap the benefits of
ICT contribution. Though much has been known on the awareness among undergraduate
students in the universities, limited knowledge is available on the awareness among the
teachers in schools. With the country‟s ICT initiative it was reported that by August 2006, 97% of
schools around Malaysia have been equipped with ICT Infrastructures. The PPSMI reversal
policy and the rate of obsolity ofthis equipment‟s however saw the hoarding of ICT equipment‟s
in schools around the nation. Conclusively, this paperconsiders the state of ICT in education
and how the adverse effects or sustainability is not the core concern among teachers.
Key Words: Green ICT, sustainable development, education
1. INTRODUCTION
Information and Communications Technology (ICT) has evolved from simple information
sharing and communication tools into a very complicated yet easily available means of verbal
and nonverbal communication tools. Governments across the globe have recognized the
positive impact of ICT has on the social and economic development of its public. Hence, many
governments have started to invest heavily on ICT to develop the nation‘s human capital
thereby making them capable of addressing the demands of the digital and information age.
(Shadiya Mohamed Saleh Baqutayan, et.al, 2016)
2. THE PUZZLE
52
Teachers as much as university students around the world form a huge segment of ICT
users. According to Boccalettiet al., 2008, university students are part of the group responsible
for the 2% global carbon emission attributed to computing activities.In today‘s higher education
context, virtually every aspect of learning and scholarshipis influenced or shaped by ICT, and
students will spend most of their adult lives in a technology-driven world. As such, they must be
equipped with the knowledge to use ICT effectively (Tyler, 2005), as well as to use it in
responsible and eco-friendly ways. It must be emphasized that ICT literacy should be
complemented with environmental literacy in relation to computer use.Much research informs us
about the development of students‘ in higher education institutions on ICT literacy over the
years – how they have moved from being digital immigrants to digital natives (Jones et al.,
2005), but there is little information available to tell us about their environmental literacy in
relation to ICT use. As in the case of teachers, knowledge and awareness on green ICT is still
at large unavailable.
The current ICT initiatives that have been rolled out in the ICT in Education Policy are
SchoolNet, Computer Lab, EduWebTV, Teaching Mathematics and Science in English (PPSMI)
and Access Centre. In the 9th Malaysian Plan (2006-2010), the government allocated RM 2.3
billion to upgrade all ICT related infrastructures in schools around the nation. Meanwhile it was
reported that by August 2006, 97% of schools around Malaysia have been equipped with ICT
Infrastructures. With the inception of PPSMI in 2003, the Malaysian Education Ministry allocated
the total of 97,000 units of laptop and 70,000 units of LCD projectors to schools all over
Malaysia. (Jailani et.al, 2003). With all these tremendous efforts taken by the Malaysian
government in mapping the ICT literacy and digital progress across the nation, research on
integrating ICT in education has bloomed dramatically. Authorities and researchers are deeply
concerned about the incorporation and implementation of ICT in education.
With the much evolving education system which requires teachers to be at par with the
advancements globally, to ―chalk and talk‖ is an out-dated method. In order to feed the students
with knowledge of this 21st century, teachers have to use ICT to modulate a better learning
environment. Idrus and Salleh (2017) reported that the usage of ICT in teaching and learning is
inevitable that computers are no longer an exclusive domain of the privileged few. Moreover,
with the rate of obsolescence of ICT devices and the PPSMI policy reversal by the later
administration, all the out dated ICT equipment‘s would have been abandoned in some places.
Neither the ministry nor any studies could deliver exactly what happened to these obsolete and
unused ICT devices. These obsolete and unused devices only add up to the e-waste. As per
current estimates, e-waste is growing almost three times the rate of municipal solid waste
globally (Samara Koon, M.B., 2014).
Efforts to educate the young generation on green ICT and its contribution to sustainable
development through educational programmes in schools and universities are already under
way in the U.S., Hong Kong, India, parts of Europe, and the U.K. (Murugesan, 2013).
Educational institutions – from elementary schools to universities – in Hong Kong, Macao and
mainland China have incorporated environmental protection and green concepts into their
course syllabi, focusing on fundamental green issues such as non-renewable energy sources
and materials, and climate change among other things. Malaysia is lagging far behind in this
sense (Ahmad,et.al., 2013).. Among Malaysians, some consciousness does exist on the need
to go green, but unfortunately it has not translated into actual initiatives, plans or efforts to
increase knowledge and awareness in it (Raj, 2008). Looking at the general lack of knowledge
and practices in environmental sustainability, a very recent study in Malaysia has called for an
investigation into the state of awareness and knowledge on sustaining a green environment
among Malaysians (Afrozet al., 2013). Moreover no literatures on awareness or adoption of
green ICT among teachers could be located. Most studies emphasizes on integration of ICT in
teaching and learning process.
53
3. BACKGROUND READING
Due to the significant growth in the sector of ICT and the ever evolving technology, the
obsolescence rate of these ICT devices is becoming a huge problem and challenge to the
environment. These appliances that have become obsolete which are called e-waste need
proper handling for a sustainable development. Improper handling of the e-waste can cause
harm to the environment and human health due to its toxic components. ICT infrastructures
along with computers consist toxic materials such as lead, chromium and mercury which are
harmful if effused into waterways and air (Mosharrof Husain Masud and Noreha Abdul Malik,
2013). On the other end usage of the ICT equipment‘s consumes large amount of energy which
burdens the electricity grid, and the usage of that energy can cause substantial emissions of
greenhouse gases, but there has been little attempt to measure or to estimate the total energy
consumption or carbon footprint caused by the usage of ICT equipment. However, Murugesan
(2008) reported that a personal computer in use every year generates a ton of CO2.
Greenhouse gases (GHG) emission is a major contributor to global warming. GHG
emissions consist of different gases, such as carbon, methane etc., among which carbon
accounts for approximately 70%. An important measure of GHG emissions is the concept of
―carbon footprint,‖ According to Gartner (2008), the Information and Communication Technology
(ICT) sector accounts for 2% of the overall carbon footprint. Carbon Footprint is defined as the
total amount of carbon and its equivalents present in GHG emissions. Widening carbon footprint
is a growing concern across the world as the emissions from different products such as power
stations, vehicles and electronic devices are increasing in number and polluting the
environment, leading to harmful effects on the human health. Though the number is small, the
tremendous growth in the usage of ICT products is expected to push this percentage higher.
Specifically, it is currently reported as 0.86 billion tons (2%) and is expected to grow to 4% in
2020, especially in developing countries. The Brundtland Report published the in 1987 by World
Commission on Environment and Development (United Nation, 2012), has a set of guiding
principles which warrants any development must consider the future generation. This report
brought about the visionary development paradigm among governments, businesses and the
civil society in harness sustainable development. Though the concept of sustainable
development did not work well as the implementation was difficult as reported in Brundtland
Report (United Nation, 2012), tremendous awareness has spread across the globe since
decades ago.
Meanwhile a study by Peter, J. and Hopkinson, L (2009) showed that ICT applications
could reduce global CO2 equivalent emissions in 2020 by 15% and avoid approximately 5 tons
of CO2 emissions for each ton that they generate through production to disposal. Energy
consumption of these ICT infrastructures could be reduced by making them more intelligent.
Online file sharing, online teaching, digital archive management, video conferencing, distance
learning, e-governments, e-management are some of the ways suggested to reduce the carbon
emission. In addition, intelligent devices like sensors, automated system could be used to
control the electrical and electronic devices efficiently.
4. DISCUSSION
Yamagiwa, M. and Uehara, M. (2017) purported that green ICT could be a burden to
organizations. As it is predicted that the number of devices required to process the exploding
amount of information will increase. This will be a burden to the power grids as well due to the
gravity of power supply needed to run the devices. Eventually there will be an increase in the
CO2 emissions. On the other end, demand and consumption of materials such as metals will
increase with the up rise of demand for ICT equipment‘s. Moreover, the life span of these ICT
54
equipment‘s are shortened in order to provide a competitive and lower price for consumers. This
means the ICT equipment‘s become idle or obsolete in short period of time and need to be
disposed and recycled. Considering the amount of energy that need to be used for disposal and
recycling the obsolete devices, there is bound to be an increase in CO2 emission. This concept
was also suggested by Murugesan (2008) in a milder connotation, ―Green IT also strives to
achieve economic viability, addressing energy efficiency and the total cost of ownership, which
includes the cost of disposal and recycling.‖ According to Herman H., Shalaby B. R., Bundgen
R.(2010), hardly anything that has benefits lack its other side. Green ICT has its disadvantages
in the form of costs needed to train personnel, acquisition of new hardware, and software to
implement Green ICT. The policies in implementing green ICT may in some cases limit the
organisation‘s strategic alternatives. Employment of new ideas and approaches can invite
newer security risks.
However, without proper perspicacious, it would be wrong to underestimate the green ICT
practices. Different kind of green ICT practices pursue different goals such as improving
environmental awareness, promoting a sustainable economy, or saving energy in buildings and
utilities. (LundfallK,et al.(2015)). Reducing costs is regarded as the second major reason to
adopt green ICT practices after reducing power consumption (Murugesan, 2008). Franklin
Wabwoba et al. (2013), stresses that green ICT has been used to attain sustainability. In order
for ICT to be applied to minimise its adverse effects and maximise its positive impact and
ensure achievement of sustainable resources utilization, ICT personnel must be aware of how
to employ green ICT practices.In the education sector, awareness of the green ICT among
teachers will bring about tremendous change towards sustainable development of the nation.
Studies show that in countries where environmental education has been included in the
curriculum at all levels such as in United States of America, pro-environmental attitudes are
embraced by all who goes through the system.(Hamid, Ghafoor and Shah ,2012). Furthermore,
they stated, when people are made aware of green ICT, they are more likely to implement it.
Lack of awareness often results in hindering a new approach being implemented and
organizations fail to retrieve the oppurtunities that can gained with its adoption and
implementation (OgunyemiA.a. and Johnston K.A.,2012).
5. CONCLUSION
Considering the lack of research on green ICT practices in the education sector in
Malaysia, there is a lot of room for recommendations and implementations. Awareness is the
key to deploy and implement the green ICT practices, without which organizations will not be
able to reap the benefits for better a sustainable development and move forward towards the
county‘s 2020 vision.
REFERENCES
Afroz, R., M.M. Masud, R. Akhtar and J.B. Duasa, 2013. Survey and analysis of public
knowledge, awareness and willingness to pay in Kuala Lumpur, Malaysia: A case study
on household WEEE management. Journal of Cleaner Production (in press). Available
from http://dx.doi.org/10.1016/j.jclepro.2013.02.004.
Batlegang, B., 2012. Green computing: students, campus computing and the environment: a
case for Botswana. Journal of Information Systems and Communication, 3(1): 256-260.
Boccaletti, S. and D. Moro, 2000. AgBioForum, Consumer willingness-to-pay for GM food
products in Italy, 3(4): 259-267. Available from http://www.agbioforum.org.
55
Dookhitram, K., J. Narsoo, M.S. Sunhaloo, A. Sukhoo and M. Soobron, 2012. Green computing:
an awareness survey among university of technology, mauritius students. Conference
Proceeding of International Conference on Higher Education and
Economic_Development,_Mauritius._Available_from
http://tec.intnet.mu/pdf%20downloads/confpaper/ confpaper091224.pdf.
Davis, F. D. 1989. Perceived usefulness, perceived ease of use, and user acceptance of
information technology. MIS Quartely, 13 (3), 319-340.
Hamid S. A. R., Ghafoor, H. A. and Shah T. Z. 2012. Analysis of Attitude towards Green
Purchase: Pakistan in Context. International Journal of Business and Social Science,
3(6), 112-115.
Herman H., Shalaby B. R., &Bundgen R. (2010). The greeing of Business. Frankfurt: Am Main:
International GmgH.
Idrus H, and Salleh R, 2017. Idrus, Hairuzila& Salleh, Rohani. (2008). Perceived Self-Efficacy
Of Malaysian Esl Engineering And Technology Students On Their Speaking Ability And
Its Pedagogical Implications. The English Teacher. XXXVII, 61-75.
Jailani Md Yunos, SulaimanYamin ,Baharum Muhammad , Ahmad Esa, ZurinaYasak and
Anizam Mohamed Yusof (2003).Peranan Multimedia Dan Guru DalamPengajaranSains,
Matematik Dan TeknikalDalam Bahasa Inggeris.UniversitiTun Hussein Onn Malaysia.
Jones, A. Snyder, A., & Lo Bianco, J (2005). Using ICT in Adult Literacy Education: Guidelines
for reform. Literacy & Numeracy Studies 14(2), 17-32
Kementerian Pelajaran Malaysia. 2012.
FaktaRingkasPengurusanPeralatanTeknologidanPerkhidmatanAduandanAset ICT. BTP:
KPM.
Laroche, M., M.A. Tomiuk, J. Bergeron and G. Barbaro-Forleo, 2002. Cultural differences in
environmental knowledge, attitudes, and behaviours of Canadian Consumers. Canadian
Journal of Administrative Services, 19(3): 267-283.
Lundfall, Karl & Grosso, Paola & Lago, Patricia &Procaccianti, Giuseppe. (2015). The Green
Practitioner: A decision-making tool for green ICT. 10.2991/ict4s-env-15.2015.9.
McDougall, G.H.G., 1993. The green movement in Canada: implications for marketing strategy.
Journal of International Consumer Marketing, 15(3): 69-87.
Masud, Mosharrof Hussain and Abdul Malik, Noreha (2014) An investigation of the adoption of
green ICT in IIUM communities towards sustainable environment. Science International
(Lahore), 26 (4). pp. 1417-1421.
Murugesan, S., 2008. Harnessing green IT: principles and practices. IEEE IT Professional,
10(1): 24-33.
Murugesan, S., 2013. How green is your IT? Computing now [online]. Available from
http://www.computer.org/portal/web/computingnow/archive/april2013.
Nlyte Software, 2010. 62% of Uk businesses blame consumers for green it ignorance, when
more than half don‘t know the environmental impact of their own data centre. Available
from http://www.nlyte.com/nlyte-software-press-releases/62-of-uk-businesses-blame-
consumers-for-green-it-ignorance-when-more-than-half-dont-know-the-environmental-
impact-of-their-own-data-centre.
Ogunyemi A. A. & Johnston K. A. (2012). Exploring the roles of people, governance and
technology in organizational readiness for emerging technologies. The African Journal of
Information Systems, 4 (3), 100-119
Pearce, J.M., 2001. The use of self-directed learning to promote active citizenship in sts
classes. Bulletin of Science, Technology & Society, 21(4): 312-321.
Peter J. and Hopkinson.L, 2009. Sustainable ICT in Further and Higher Education A Report for
the Joint Information Services Committee (JISC). Higher Education Environmental
Performance Improvement Project, University of Bradford.
56
Raman M. 2010. Environmental Policy and Management In The Context Of Security And
Economic Development In Malaysia. In The Uum International Conference On
Governance 2014 Proceeding. 853
Raman Mariyappan, Tuan PahRokiah Syed Hussain. 2016. Public, Private Sector and NGO‘s
Motivating (Inspiration) Factor Managing Highlands Developments in Malaysia.Imperial
Journal of Interdisciplinary Research.2:12
Raman Mariyappan, and Tuan PahRokiah Syed Hussain (2017). The effects of moral values of
Raman Mariyappan, MoganPeriasamy& Hamidi Ismail. (2017). Relationship between health
Raman Mariyappan, and Tuan PahRokiah Syed Hussain (2016). The Paradigm Shift of
Vol. 5 (10). Pp.54-58
TapiwaZengeni& Mohd Azizuddin Mohd Sani. (Eds.) International Relations. pp. 213-
215. Pearson. ISBN 978-967-349-345-5
Raman Mariyappan, Tn PahRokiah, Hamidi Ismail. (2014).
TaburanHujandanKerakusanAktivitiPembalakanSebagaiPemacuKeterancamanPendudu
k di Pedalaman Kedah. In. Mohd Hairy Ibrahim. (Eds.)
CabaranPerubahanIklimTerhadapManusia di Malaysia. pp. 1-16. PenerbitUniversiti
Pendidikan Sultan Idris.
Raman Mariyappan, Tn PahRokiah, Hamidi Ismail. (2013). Property Development and
Region. In. NarmahSamat, Ruslan Rainis, SyarifahRohayahSyeikh Dawood, Wan
pp. 75-91. PenerbitUniversiti Pendidikan Sultan Idris.
Rogers, E.M., 2003. Diffusion of innovations 5th Edn., New York: Free Press.
Samarakoon, M. B. (2014). A Review of Electrical and Electronic Waste Management in Sri
Lanka
Shadiya Mohamed Salleh Baqutayan, Sharizal Abdul Shatar, HusniAlhan Md. Salimun, Norihan
Abu Hassan, 2016.Towards the Sustainable Development by 2020: Malaysia
Perspective on Economic Growth and Wellbeing. American Journal of Trade Policy. 3:2
M. Yamagiwa and M. Uehara, "Energy-Aware Volunteer Computing Using Solar Photovoltaics
and Older Models of Single Board Computers," 2017 31st International Conference on
Advanced Information Networking and Applications Workshops (WAINA), Taipei,
Taiwan, 2017, pp. 427-432.
Malaysia, 2006. 9th Malaysia Plan.Economic Planning Unit, Prime Minister‘s Department.
Wabwoba F, Wanyembi W. D, Omuterema S. &Omieno K. K. (2013). Green ICT Readiness
Model for Developing Economies: Case of Kenya International Journal of Advanced
Computer Science and Applications (IJACSA), 4(1), 51-65
Walter Pauk (2010) Textbook comprehension: The concept of awareness, Reading
World, 19:2, 185-186.
57
Margaret K. Yaure (1973). Concepts of Awareness.Journal of ThoughtVol. 8, No. 4, pp. 259-

269.
-GP08-
Pilihan Raya Umum Ke 14: Calon Penentu Kemenangan Di Kedah?
Zawiyah Mohd Zain

Pusat Pengajian Kerajaan, Universiti Utara Malaysia, zmzain@uum.edu.my
Abstrak
Sebagai sebuah negara demokrasi, pilihan raya adalah platform utama untuk memilih
pemimpin di Malaysia. Pilihan raya umumyang terkini diadakan pada Mei 2018 genap lima
tahun selepas pembentukan kerajaan pada Mei 2013. Dalam sesuatu pilihan raya antara faktor
penting yang menyumbang kepada kemenangan sesebuah parti ialah pemilihan calon, isu
semasa dan juga kempen. Kertas ini membincangkan tentang isu calon pada PRU ke-14
dengan memberi fokus kepada negeri Kedah. Kedah antara negeri yang menjadi tumpuan pada
PRU ke-14 disebabkan bekas Perdana Menteri iaitu Tun Mahathir Mohamad kembali semula
diarena politik dengan menjadi calon parti pembangkang di Parlimen Langkawi. Pada PRU ke-
12 negeri Kedah berjaya ditawan oleh pembangkang dengan diketuai oleh PAS. Pada PRU ke-
13 Kedah kembali semula pada Barisan Nasional. Persoalannya bagaimana dengan PRU ke-
14? Apakah isu calon mempengaruhi keputusan tersebut? Persoalan inilah yang dibincangkan
dalam kertas ini. Kajian ini menggunakan analisis kandungan dan juga pemerhatian di
lapangan. Kertas ini mengandaikan isu calon dapat mempengaruhi keputusan pilihan raya
umum ke-14 di negeri Kedah.
Kata Kunci: Calon, Demokrasi, PartiPolitik , Pilihan Raya Umum
1. PENGENALAN
Bermula pada pilihan raya umum ke-12 pada tahun 2008, Barisan Nasional (BN) parti
yang memerintah negara sejak merdeka menghadapi cabaran yang getir dalam persaingan
politik. Pada pilihan raya tersebut parti-parti pembangkang telah bersepakat dalam perletakan
calon untuk bertanding. Hasilnya mereka berjaya menggugat kedudukan BN di parlimen.
Berikutan itu, parti pembangkang telah bekerjasama melalui gabungan yang dikenali sebagai
Pakatan Rakyat (PR) dalam persediaan menjelang pilihan raya umum ke-13.
Pada pilihan raya ke-13 pencapaian BN semakin merosot. Pilihan raya umum ke-14pada
9 Mei 2018pula menyaksikan BN kecundang di tangan pembangkang yang bertanding atas
gabungan Pakatan Harapan (PH). PH Berjaya membentuk kerajaan apabila mendapat
kemenangan majoriti mudah di Parlimen, Manakala BN hanya mendapat 79 kerusi daripada
222 kerusi yang ditandingi. Bagi peringkat negeri pulak BN dapat membentuk kerajaan di dua
negeri sahaja iaitu Perlis dan Pahang (di Sarawak BN mendapat mandat melalui pilihan raya
negeri pada tahun 2016).
Persoalannya apakah yang menyumbang kepada kemenangan Pakatan Harapan?
Apakah calon memainkan perana penting? Setakat ini terdapat banyak kajian yang dilakukan
tentang pilihan raya umum di Malaysia. Namun tidak banyak kajian yang dilakukan tentang isu
58
calon khususnya di negeri Kedah. Tujuan kertas ini adalah untuk menganalisis sejauh mana
faktor calon boleh mempengaruhi keputusan pilihan raya umum khususnya bagi negeri Kedah.
2. SOROTAN KARYA
Terdapat pelbagai kajian yang dilakukan berhubung pilihan raya umum (PRU)di Malaysia
misalnya kajian sarjana seperti Marzuki Mohamad (2004), Liow (2005), Abdul Rashid Moten
(2006) dan Kim Hui lim & Wai Mun Har (2008) tentang pilihan raya umum ke-11. Dalam kajian
mereka antara faktor yang menyumbang kepada kemenangan besar BN pada PRU ke-11 ialah
pembaharuan dan perubahan dalam pentadbiran dan dasar yang di bawa oleh Abdullah
Badawi. Abdullah telah berjanji untuk memerangi rasuah dalam perkhidmatan awam,
mengurangkan projek mega dan pembaziran wang negara.
Walaupun BN menang besar pada PRU ke 11, tetapi pencapaian tersebut tidak
berterusan. Pada PRU ke-12 telah berlaku tsunami politik yang membawa kepada kegagalan
BN mendapat kemenangan majoriti dua pertiga di Parlimen dan juga tewas lima negeri kepada
pembangkang. Terdapat pelbagai kajian yang menilai apakah faktor yang membawa kepada
tsunami politik. Antara sarjana yang mengkaji tentang PRU 2008 ialah Maznah Mohamad
(2008), Chin & Wong Chin Huat (2009) dan Abdul Rashid Moten (2009). Kajian mereka
mendapati kemerosotan BN disebabkan beberapa perkara pertama, kegagalan Tun Abdullah
menunaikan janji PRU 2004 dan gagal menangani isu kos sara hidup. Kedua, kelemahan
kepimpinan Tun Abdullah dalam menangani isu-isu agama. Ketiga, faktor Anwar Ibrahim yang
berjaya membina keyakinan rakyat pelbagai kaum kepada kepimpinan parti pembangkang.
Akhir sekali kempen intensif pihak pembangkang melalui Internet.
Mohd Hamdan dan Mahat Jamal (2014) meneliti tentang PRU ke-13 khususnya di Sabah.
Menurut mereka sebab utama kekalahan parti-parti pembangkang di Sabah ialah tidak ada
kesepaduan sebenar danjuga berlaku percanggahan objektif antara PR peringkat kebangsaan
dengan dua parti pembangknag tempatan iaitu SAPP dan STAR. Selain itu, PR juga merasakan
parti mereka lebih tinggi daripada SAPP dan STAR dan bertindak menentukan segala
persetujuan antara mereka.
Secara umumnya kajian-kajian di atas berhubung pilihan raya umum adalah menjurus
kepada faktor kemenangan atau kekalahan sesebuah parti politik dalam pilihan raya umum iaitu
PRU ke-11, 12 dan juga 13. Kebanyakan kajian mendapati faktor yang mendominasi
kemerosotan atau kekalahan sesebuah parti adalah disebabkan ketidakpuasan rakyat sama
ada berkaiatan isu nasional atau isu dalaman parti. Manakala artikel ini memberi tumpuan
kepada PRU ke-14 khususnya di negeri Kedah bertujuan menganalisis adakah calon menjadi
faktor penentu kemenangan PH di Kedah.
3. HASIL KAJIAN DAN PERBINCANGAN
3.1. Pilihan raya umum ke 14
Pilihan raya umum ke 14 diadakan pada 9 Mei 2018, setelah genap lima tahun
pembentukan kerajaan selepas PRU ke-13. Pada pilihan raya tersebut menyaksikan
persaingan politik yang sengit antara BN dan parti pembangkang terutamanya daripada
gabungan pembangkang yang membentuk PH dan bertanding atas satu logo iaitu PKR
khususnya di Semenanjung Malaysia. Walaupun pada pilihan raya tersebut PH bertanding atas
logo PKR, tetapi rakyat tahu bahawa mereka terdiri daripada PKR, Amanah, DAP dan Bersatu.
PH juga mendapat sokongan daripada parti Warisan di Sabah.
59
Pada pilihan raya tersebut terdapat beberapa parti yang bertanding antaranyaBN, PH,
Warisan, dan PAS1. BN menghadapi cabaran sengit daripada PH yang diterajui bekas Perdana
Menteri Tun Mahathir Mohamad. Keputusan rasmi pilihan raya yang diumumkan pada 10 Mei
menunjukkan BN parti kerajaan yang memerintah negara selama 61 tahun telah tewas dan
gagal membentuk kerajaan. PH dan Warisan berjaya mendapat 121 kerusi Parlimen dan boleh
membentuk kerajaan dengan majoriti mudah. Manakala BN mendapat 79 kerusi dan PAS
hanya 18 kerusi.
Berdasarkan perbincangan di atas menunjukkan PH berjaya memerintah Malaysia buat
pertama kalinya setelah 61 tahun BN memerintah. PH juga dapat membentuk kerajaan di lapan
negeri iaitu Kedah, Perak, Pulau Pinang, Melaka, Negeri Sembilan, Selangor, Johor dan Sabah.
Manakala negeri Kelantan dan Terengganu dibawah kerajaan PAS.
Persoalannya apakah faktor yang menyumbang kemenangan PH tersebut? Faktor utama
yang membawa kepada kejatuhan BN dan kemenangan PH adalah ketidakakuran rakyat
terhadap dasar-dasar dan tindak tanduk kerajaan BN. Antara isu yang menyebabkan rakyat
tidak akur ialah pertama, pelaksanaan cukai barangan dan perkhidmatan (GST). GST yang
mula dilkasanakan pada tahun 2015 telah menyebabkan kenaikan harga barangan dan
menimbulkan kegusaran di kalangan rakyat yang terpaksa berhadapan dungan kos sara hidup
yang semakin meningkat.
Kedua, Salah guna kuasa dan rasuah. Isu yang paling dominan ialah skandal IMDB yang
mula diperkatakan umum sejak tahun 2015. Ketiga, pemimpin yang sombong dan tidak
professional dalam melayani kehendak rakyat. Keempat, faktor kesatuan pembangkang yang
membentuk gabungan PH pada September 2015 yang terdiri daripda PKR, DAP, PAN
(Saravanamuttu, 2016). Menjelang PRU ke 14, PH di lihat semakin mantap apabila mempunyai
gabungan empat parti utama iaitu PKR, DAP, PAN dan Bersatu, serta mendapat sokongan
daripada parti Warisan di Sabah. PH semakin mendapat kepercayaan rakyat apabila mereka
menampilkan Tun Mahathir sebagai calon Perdana Menteri.
Huraian di atas menunjukkan terdapat gabungan beberapa faktor yang menyumbang
kepada kemenangan PH pada PRU ke 14. Persoalannya bagaimana pula dengan pencapaian
PH di negeri Kedah? Adakah faktor yang sama, atau ada faktor lain? Perkara ini dibincangkan
di bahagian seterusnya.
3.2. Pilhan Raya UMUM Ke- 14 (Negeri Kedah)
Kedah merupakan antara negeri yang mempunyai majoriti penduduk Melayu yang agak
banyak selain negeri Kelantan dan Terengganu. Seperti di Kelantan dan Terenggan Parti PAS
dapat diterima dengan baik di Kedah terutamanya di kawasan luar bandar. Pun begitu, sejak
PRU pertama PAS agak sukar untuk memenangi kerusi DUN secara majotiti dan seterusnya
membentuk kerajaan di Kedah. Misalnya pada tahun 1998 isu reformasi yang membawa
kepada kemenangan PAS di Terengganu pada PRU1999 tidak merebak ke Kedah. Namun, 10
tahun berikutnya iaitu pada PRU ke-12 PAS dan PR telah membuat kejutan di Kedah apabila
tsunami politik telah sampai ke Kedah. Pada pilihan raya tersebut daripada 15 kerusi Parlimen
yang dipertandingkan PAS dan PR mendapat 11 kerusi. Bagi DUN pula PAS dan PR mendapat
21 kerusi daripada 36 kerusi yang dipertandingkan lalu membentuk kerajaan yang diketuai oleh
PAS.
Seterusnya, pada PRU ke-13 BN telah mengatur strategi awal untuk merampas kembali
Kedah daripada PAS dan PR. Terdapat pelbagai taktik yang digunakan antaranya
mengenengahkan calon pilihan, membongkar kelemahan pentadbiran kerajaan PAS selama
lebih kurang lima tahun dan juga menyogok dengan isu pembangunan. Paling menarik adalah
1
Di Sabah dan Sarawak tidak semua calon PH bertanding atas lambang PKR, calon dari parti DAP bertanding atas
logo mereka sendiri.
60
berkaitan isu calon, ini kerana BN telah mengenengahkan Mukhriz Mahathir sebagai calon yang
bertanding dan calon Menteri Besar (MB) pada PRU tersebut. Mukhriz Mahathir dilihat sebagai
calon yang berpengaruh dan disenangi ramai kerana beliau merupakan anak bekas PM iaitu
Tun Mahtahir yang memerintah Malaysia selama 22 tahun. Mahathir anak kelahiran Kedah
yang menyandang kerusi Parlimen Kubang Pasu mempunyai pengaruh yang kuat khususnya di
negeri Kedah. Strategi BN mengumumkan calon MB iaitu Mukhriz telah diterima oleh
masyarakat Kedah. Hasilnya pada PRU ke-13 BN dapat merampas kembali Kedah dan Mukhriz
dilantik sebagai MB. Umumnya, hal ini menunjukkan bahawa calon memainkan peranan
penting dalam menentukan kejayaan dalam pilihan raya.
Walau pun BN berjaya menawan kembali Kedah, tapi setelah beberapa tahun BN
mengalami pergolakan politik. Hal ini telah membawa kepada perlucutan jawatan Mukhriz
sebagai MB dan diganti dengan Pengerusi UMNO Kedah iaitu Ahmad Bashah. Pergolakan
politik tersebut akhirnya telah membawa Mukhriz mengikut jejak langkah bapanya yang keluar
daripada UMNO. Mukhriz telah mengangotai parti baru iaitu Bersatu bersama Tun Mahathir.
Merujuk kepada PRU ke-14 pula terdapat tiga parti utama yang bertanding di peringkat
parlimen dan DUN iatu BN, PH, DAP, Warisan dan PAS. Di peringkat parlimen ramai yang
menjangkakan BN akan menghadapi cabaran yang sengit namun tidak ramai yang meramal
kejatuhan BN. Manakala di peringkat negeri pula PH telah meletakkan harapan untuk menawan
beberapa negeri seperti Johor, Negeri Sembilan dan Melaka. Bagi negeri Kedah pula, sebelum
PRU ke-14 berlangsung penganalisis telah membuat ramalan dengan melihat kepada kekuatan
PAS yang akan memberi saingan sengit kepada BN dan PKR. PH mencalonkan calon yang
disenangi rakyat kedah iaitu Tun Mahathir Mohamad (Parlimen Langkawi) dan Mukhriz
Mahathir (Parlimen Jerlun, DUN Jitra). Kedua dua calon tersebut dianggap berpengaruh bukan
sahaja di kawasan yang mereka tandingi tetapi di negeri Kedah amnya.
Keputusan pilihan raya umum ke-14 di kedah menunjukkan PH mendapat 10 kerusi
parlimen, manakala PAS 3 kerusi dan BN 2 kerusi. Bagi kerusi DUN keputusan PRU ke-14
jugamemihak kepada PH apabila mereka berjaya memnangi 18 kerusi daripada 36 kerusi. PAS
mendapat 15 dan BN hanya 3 kerusi. Mukhriz yang bertanding di DUN dan Parlimen telah
menang di kedua-dua kerusi tersebut. Beliau mendapat 18852 undi di DUN Jitra dengan
majoritikemenangan sebanyak 10849 undi, dan bagi parlimen Jerlun beliau menang dengan
18695 undi dengan majoriti undi 5866. Manakala Tun Mahathir menang di kerusi parlimen
Langkawi dengan mendapat 18954 undi dan majoriti 8893 undi.
Melihat kepada senario politik di Kedah sebelum ini ramai yang menjangka PAS boleh
menang sekiranya rakyat menolak BN di Kedah. Namun begitu, PAS akhirnya tewas di tangan
PH. Faktor penolakan rakyat kepada BN secara umumnya telah dibincangkan di atas, jadi apa
pula faktor penerimaan rakyat Kedah kepada PH berbanding dengan PAS, sedangkan PAS
pernah mendapat tempat di hati rakyat Kedah pada PRU ke-12.
Merujuk kepada keputusan di atas satu faktor utama yang tidak boleh dinafikan yang
menyumbang kepada kemenangan PH di negeri Kedah adalah faktor calon. Ini kerana Tun
Mahathir yang telah di turunkan kembali sebagi calon di parlimen Langkawi dan beliau juga
adalah calon Perdana menteri PH. Selain itu, Mukhriz yang pernah menjadi MB kedah telah di
calonkan semula oleh PH di DUN Jitra dan Parlimen Jerlun.
Tun Mahathir yang pernah memerintah menjadi PM Malaysia selama 22 tahun adalah
berasal dari Kedah. Beliau di senangi di negeri kelahirannya apatah lagi di Langkawi yang
mana banyak pembangunan di Langkawi adalah jasa beliau. Selain itu, beliau juga mempunyai
pengaruh yang kuat apabila berjaya mengemudi PH dan membolehkan PH bertanding atas
logo yang sama iaitu PKR. Bagi Mukhriz pula, beliau memang di terima di Kedah, pertama
kerana beliau merupakan anak Tun Mahathir, Kedua, beliau pernah mentadbir Kedah sebelum
ini dan menunjukkan rekod pentadbiran yang baik. Ketiga, keperibadian beliau sendiri yang
boleh diterima dengan baik oleh rakyat negeri Kedah selain faktor umur yang masih muda.
61
PAS pula, tidak mendapat kepercayaan rakyat kerana beberapa isu. Pertama, kerana
mereka tidak lagi bersama pakatan pembangkang. Dalam keadaan masyarakat yang marah
kepada BN, mereka megharapkan semua pembangkang bekerjasama untuk menumbangkan
BN, jadi apabila PAS tidak lagi bersama gabungan pembangkang rakyat tidak lagi menyokong
PAS kerana sedar PAS tidak boleh membentuk kerajaan secara sendiri. Kedua, pergolakan
politik dalaman yang membawa kepada penubuhan parti serpihan PAS yang baru iaitu Parti
Amanah Negara (PAN). Akhir sekali, kepimpinan PAS yang membawa PAS untuk lebih mesra
BN, sedangkan rakyat kebanyakannya membenci BN disebabkan kemarahan berkaitan isu kos
sara hidup yang semakin tinggi, rasuah dan salah guna kuasa. Secara umumnya, kemenangan
PH di Kedah adalah disumbang oleh faktor calon, namun faktor nasional yang dibincangkan di
atas juga turut membantuiaitu isu GST, IMDB, salah guna kuasa, pemimpin dan lain-lain.
4. KESIMPULAN
Pilihan raya umum ke-14 menunjukkan proses demokrasi di Malaysia semakin matang. Ini
kerana rakyat telah berani memberi mandat untuk menukar satu-satunya parti iatu BN yang
memerintah Malaysia sejak 6 dekad yang lalu. Jika dilihat dari segi faktor kemenangan PH ia
disumbang oleh pelbagai faktor seperti isu ekonomi, rasuah, salah guna kuasa dan juga faktor
calon. Bagi keputusan pilihan raya di negeri Kedah calon merupakan faktor utama di samping
isu-isu peringkat nasional. Hal ini kerana PH Kedah mempunyai dua calon utama yang popular
dan diterima rakyat iaitu Tun Mahathir Mohamad dan Mukhriz Mahathir. Kemenangan PH juga
telah membuka kepada kewujudan sistem dua parti di Malaysia yang telah diperkatakan sejak
PRU 2008 lagi. Selain itu, ia juga telah membawa Malaysia ke era baru.
RUJUKAN
Abdul Rashid Moten & Tunku Mohar Mokhtar. (2006). The 2004 general elections in Malaysia: a
mandate to rule. Asian Survey 46(2): 319-340.
Abdul Rashid Moten. (2009). 2004 and 2008 general elections in Malaysia: towards a
multicultural, bi-party political system? Asian Journal of Political Science 17(2): 173-194.
Chin, James & Wong, Chin Huat. (2009). Malaysia‘s electoral upheaval. Journal of
Democracy 20(3): 71-85.
Keputusan Pilihan Raya Umum ke-14: Kedah (2018) www.utusan.com.my [4 Jun 2018)
Kim, Hui Lim & Wai, Mun Har. (2008). Ad Baculum, Islamic state and Malaysian Chinese
politics: a rhetorical study of selected political advertisements in the local Chinese
media during the 11th Malaysian general election campaign. Journal of Politics and Law
1(1): 25-39. www.ccsenet.org/journal.html [28 April 2010].
Liow, Joseph. (2005). The politics behind Malaysia's eleventh general election. Asian Survey
45(6): 907-930. htttp://www.jstor.org/stable/4497139 [28 April 2010].
Marzuki Mohamad. (2004). Malaysia's 2004 general elections: spectacular victory,
continuing tensions. Kasarinlan: Philippine Journal of Third World studies 19(2):
25-53.
Maznah Mohamad. (2008). Malaysia-democracy and the end of ethnic politics? Australian
Journal of International Affairs 62(4): 441-459.
Mohd Hamdan dan Mahat Jamal. (2014). Pilihan raya umum Malaysia ke-13: faktor-faktor
penentuan kemenangan di Sabah. Jurnal Komunikasi Borneo, Vol 1: 55-76.
Portal Rasmi Suruhanjaya Pilihan Raya Malaysia (SPR). (2018) www.spr.gov.my [24 Mei
2018]
62
Saravanamuttu, J. (2016). Power sharing in a divided nation: mediated communalism and new
politics in six decades of Malaysia‟s elections. Singapura:ISEAS
-GP09-
RASUAH: MEMUPUK KESEDARAN DIKALANGAN KANAK-KANAK DAN BELIA
MALAYSIA
Azlin Namili Mohd. Ali @ Ramli

Pusat Pengajian Undang-undang, Kolej Undang-undang, Kerajaan dan Pengajian
Antarabangsa
azlin@uum.edu.my
Abstrak
Rasuah adalah satu dari masalah undang-undang disebabkan tiada kawalan ke atas kuasa
dan pelaksaan kuasa oleh seseorang. Walaupun terdapat undang-undang untuk menangani
rasuah tetapi ianya tidak memadai untuk menghapuskan rasuah. Seseorang perasuah
mempunyai cara yang tersendiri untuk mengatasi peruntukan perundangan dan mengelak
keadilan. Undang-undang sahaja tidak berkesan untuk mengatur kehidupan manusia,
seringkali kerajaan menubuhkan agensi-agensi penyiasatan, penguatkuasaandan adjukatif
yang memainkan peranan yang besar dalam menentukan pelaksanaan undang-undang
yang berkesan. Malah terdapat keperluan juga untuk meluaskan kepada pelbagai sektor
masyarakat bagi menangani rasuah dengan cara-cara yang tersendiri. Jika golongan belia
diseluruh dunia dididik mengikut etika yang baik dan ‗anti rasuah‘, ia akan membawa agen
perubahan yang besar kepada dunia di masa akan datang. Kertas kerja ini bertujuan untuk
melihat kepada cara-cara yang dapat digunapakai untuk memupuk kesedaran kanak-kanak
dan belia dalam menangani rasuah secara berkesan seperti menambahkan satu kurikulum
khas berkaitan rasuah serta menggalakkan penyertaan mereka secara langsung atau tidak
langsung dalam program berkaitan anti-rasuah.
PENGENALAN
Rasuah adalah penyalahgunaan kuasa yang telah diamanahkan untuk kegunaan peribadi. Ia
boleh dibahagikan mengikut peringkat tertentu. Rasuah besar adalah yang dilakukan oleh
peringkat tinggi kerajaan dengan cara memutarbelitkan dasar negara bagi membolehkan
pemimpin mendapat manfaat dan mengorbankan kepentingan rakyat. Rasuah kecil pula adalah
penyalahgunaan kuasa oleh pegawai awam peringkat rendah dan menengah dalam interaksi
mereka dengan rakyat biasa yang mennggunakan barang atau perkhidmatan asas seperti di
hospital, sekolah, jabatan polis dan agensi-agensi lain. Manakala rasuah politik adalah
bilamana ahli politik menyalahgunakan kedudukan mereka untuk mempertahankan kuasa,
status dan kekayaan mereka dengan memanipulasi dasar, institusi dan prosedur yang
berkenaan dengan peruntukan sumber dan pembiayaan (International Transparency, n.d.)
Indeks persepsi rasuah untuk negara Malaysia menunjukkan kemerosotan bermula pada tahun
2015hingga 2017 dimana Malaysia berada ditangga ke 62. Terdapat beberapa isu yang
menyebabkan kejatuhan Malaysia dalam Indeks Tanggapan Rasuah (CPI) 2017 iaituskandal
1MDB, kes SRC International Sdn Bhd, derma RM2.6 bilion, skandal Felda dan skandal air
63
Sabah serta keputusan mahkamah terhadap Naib Presiden PKR Rafizi Ramli. Isu-isu tersebut
menyebabkan orang awam, pelabur dan komuniti peniaga hilang kepercayaan kepada sistem di
Malaysia.Presiden International Transparency Malaysia, Datuk Akhbar Satar menyatakan
Malaysia sedang berhadapan dengan krisis integriti dimana meningkatnya kes rasuah oleh
golongan berkuasa yang berprofil tinggi dan golongan muda. Contohnya, tangkapan oleh
Suruhanjaya Pencegahan Rasuah Malaysia sejak 2015 hingga 2017 lalu menunjukkan 54%
mereka yang terlibat berumur antara 20 hingga 40 tahun (Tong, 2018).
Kajian Persepsi Keberkesanan Tindakan Pencegahan Rasuah yang dibuat Suruhanjaya

Pencegahan Rasuah Malaysia tahun 2016 menunjukkan 16 peratus daripada 1,000 orang
mahasiswa sanggup menerima rasuah jika mempunyai peluang dan kuasa.18.2 peratus pelajar
pula bersedia memberi rasuah agar mereka tidak dikenakan sebarang tindakan (Astro Awani,
2017). Kajian yang dibuat oleh Institusi Integrasi Malaysia terhadap pelajar tiga universiti awam
pula mendapati (a) 35.8 peratus pelajar menyatakan menerima hadiah dalam bentuk
barangan,wang tunai atau perkhidmatan sebagai balasan melakukan kerja bukanlah satu
bentuk korupsi; (b) lebih daripada 37 peratus pelajar menyatakan tidak salah membuat tuntutan
tambahan semasa kerja luar pejabat walaupun penginapan sudah disediakan;(c) lebih 20
peratus pelajar pula merasakan melantik ahli keluarga dalam jawatan di syarikat atau jabatan
boleh diterima (Mahavera, 2017); (d) 37.3 peratus pula berpendapat membuat tuntutan palsu
bagi tugas luar seperti bil penginapan walaupun pihak penganjur sudah menyediakannya
adalah tidak salah; (e)28.1 peratus pelajar menganggap tidak salah mengambil harta dan
barangan pejabat seperti, alat tulis,―thumb drive‖dakwat mesin pencetak dan lain-lain untuk
kegunaan peribadi (―1hingga 3 pelajar universiti tak kisah rasuah‖, 2017).
Satu kajian yang dibuat oleh pelajar universiti mengenai kesanggupan memberi rasuah oleh
pelajar universiti dalam kes kesalahan lalulintas mendapati pegangan moral boleh
mengurangkan kesanggupan untuk memberi rasuah. Rasuah diberikan untuk menjimatkan
masa dan wang serta polisi anti-rasuah untuk meningkatkan denda bagi mengurangkan rasuah
berkemungkinan tidak berkesan(Lim,Tong dan Woon, 2009)
Punca rasuah di Malaysia masih tidak dapat dikenalpasti sama ada disebabkan didikan, sistem
persekolahan, ekonomi negara atau kepimpinan negara. Namun satu tindakan yang drastik
perlu dilakukan bagi membendung rasuah. Tindakan itu perlu dimulakan dari peringkat awal
iaitu kanak-kanak lagi belia lagi.
CADANGAN
(a)Sukatan pelajaran sekolah rendah dan menengah boleh memasukkan kurikulum baharu
berkaitan rasuah dan kesan negatifnya kepada segenap lapisan masyarakat dari pelbagai
aspek ekonomi, sosial dan moral. Pelajar perlu didedahkan dengan budaya anti-rasuah dan
ditekankan mengapa rasuah tidak boleh dijadikan cara hidup. Pelajar perlu ditanam dengan
nilai dan integriti yang baik di peringkat persekolahan lagi bagi memberi kesedaran awal
berkaitan rasuah.Korea dan Hong Kong adalah antara negara yang memperkenalkan kurikulum
anti-rasuah kepada pelajarnya di sekolah rendah, menengah dan universiti (Sharma,1996).
Malaysia memasukkan satu mukasurat pembelajaran berkaitan rasuah di dalamsubjek moral
untuk pelajar bukan islam dan subjek pengetahuan islam untuk pelajar islam, serta pelajar
tingkatan enam dalam subjek pengajian perniagaan. Pelajar sekolah juga diperkenalkan
dengan ―The Anti-corruption Hero Program‖ sebagai ko-kurikulum diseluruh negara sepanjang
tahun 2017 dimana beberapa modul dalam bentuk latihan dan bengkel(Thematic compilation of
relevant information submitted by Malaysia, n.d.). Di peringkat universiti pula, tiada kurikulum
64
mengenai rasuah yang perlu diambil oleh semua pelajar. Timbalan Menteri di Jabatan Perdana
Menteri pernah menyarankan diwujudkan modul anti-rasuah di institusi pengajian
tinggi(Hasnan,2017). Ianya adalah saranan yang baik yang perlu dipertimbangkan dengan
mengambilkira bebanan pelajar institusi pengajian tinggi yang sedia ada. Namun SPRM telah
mengambil inisiatif mendekati pelajar-pelajar institusi pengajian tinggi dan menggalakkan
mereka menubuhkan Sekretariat Pencegahan Rasuah di institusi masing-masing bagi
membantu meningkatkan kesedaran generasi muda mengenai rasuah (Pendekatan anti rasuah
di IPT oleh SPRM, 2015).
Penyampaian sukatan berkaitan rasuah boleh dibuat dalam berbagai bentuk seperti kartun,
teater, drama, permainan, sukan dan sebagainya. Kartun dan komik telah berjaya digunakan
untuk meningkatkan kesedaran mengenai rasuah kepada kanak-kanak dan belia terutamanya
yang tidak suka membaca buku-buku ilmiah. Ia juga dapat memberi kefahaman kepada
komuniti merentasi garis ethnik. Contohnya, kerajaan kepulauan Solomon telah mengadakan
program bersiri anti-rasuah yang merangkumi rasuah, penyalahgunaan wang, penyalahgunaan
kuasa, dalam bentuk komik yang terdapat pada suratkhabar-suratkhabar utama di kepulauan
tersebut (Solomon Times Online, 2009).
Teater dan drama adalah cara yang berkesan untuk komuniti berkongsi pengalaman dan
menyampaikan pandangan mereka terhadap isu-isu yang kompleks seperti rasuah tetapi dalam
ruang yang selamat. Contohnya sebelum pilihanraya 2012 di Papua New Guinea, sekitar lapan
puluh orang pelajar yang menyaksikan pementasan drama berkaitan cabaran pilihanraya telah
di tanya selepas pementasan drama tersebut menyatakan mereka faham mesej dan maksud
disebalik pementasan drama itu yang cuba disampaikan oleh penganjur(Transparency
International, 2011).
Permainan dan sukan boleh dijadikan alat pendidikan yang berkesan walaupun untuk topik
yang serius seperti rasuah. Ia menambahkan pengetahuan, sikap dan nilai, dan boleh
menggalakkan kerja berpasukan dan kolektivisme. Permainan dalam bentuk ―papan permainan‖
adalah murah di mana pemain mendapat ilmu pada waktu permainan sedang berlangsung
sambil menggalakkan kerjasama antara mereka. Permainan menghilangkan kebosanan
pelajar.Amnesty Internationaltelah mencipta permainan papan mudah untuk mendidik belia
mengenai hak asasi manusia di mana pemainmenjadi kumpulan pelarian yang merancang
melarikan diri mereka untuk mendapat kebebasan. Peralatan yang diperlukan hanyalah
cetakanbermain kad pada kertas A3, jam tangan, krayon dan pen(Amnesty International UK,
2015).
(b)Penyertaan kanak-kanak dan belia Malaysia secara langsung atau tidak langsung dalam
program-program pencegahan rasuah perlu dititikberatkan. Contohnya, belia boleh memainkan
peranan dengan membuat satu pasukan dan membuat rancangan untuk mengesan
perbelanjaan kerajaan di kampung, bandar, negeri atau negara untuk mengetahui sejauh mana
projek yang dijanjikan telah dilakukan. Mereka harus mengenalpasti perbelanjaan apa yang
harus dipantau dan memerhati perbelanjaan kerajaan iaitu bagaimana dan di mana wang itu
dialirkan dan mengesan jika berlakunya rasuah. Penemuan yang didapati boleh dikongsikan
dengan penduduk setempat dan juga rakyat seluruhnya. Ini kerana rakyat bergantung kepada
kerajaan untuk barangan dan perkhidmatan asas. Malah mereka membayar perkara tersebut
melalui berbagai cukai yang dikenakan. Jika pentadbir di pejabat kerajaan merasakan tiada
sesiapa memerhati atau memantau apa yang dilakukan, maka keinginan untuk mencuri wang
kerajaan yang banyak akan semakin membara. Contohnya di Kenya, setiap ahli parlimen
menerima US1 juta setahun untuk tujuan pembangunan. Organisasi masyarakat yang
65
menamakan diri mereka sebagai MUHURI telah menjalankan audit terhadap perbelanjaan
kerajaan, melatih aktivis masyarakat yang terdiri dari beliauntuk membuat pemantauan,
memeriksa tapak projek dan membuat susulan terhadap penjawat awam yang berkenaan telah
mendapati terdapat penyelewengan dan nepotism dalam pemberian biasiswa(Muslims for
Human Rights (MUHURI) - Kenya, 2011).
Malah di negara Filipina, satu juta pengakap lelaki dan perempuan telah mengira buku teks dan
menjalankan pemeriksaan kualiti di negara tersebut. Program kerjasama antara agensi
kerajaan dan bukan kerajaan ini untuk membantu ketelusan jangka panjang disekolah seluruh
negara dan Jabatan pendidikan membenarkan akses kepada maklumat belanjawan, kontrak
dan pemeriksaan. Program ini telah mengurangkan rasuah dalam proses pengedaran buku teks
dimana kesannya harga buku teks boleh dikurangkan sebanyak 40 peratus dan penjimatan
US1.4 juta (The World Bank, n.d.)
(c) Kanak-kanak dan belia pada abad ini tidak boleh dipisahkan dengan teknologi. Mereka
dikatakan sebagai generasi teknologi yang cekap dan banyak menghabiskan masa dengan
teknologi. Mereka boleh menggunakan kemudahan teknologi untuk mengesan rasuah dengan
cepat. Contohnya di India, rakyatnya boleh melaporkan pengalaman mereka berkaitan rasuah
di www.ipaidabribe.com. Banyak laporan diterima yang mana antaranya menyebabkan
penangkapan dan sabitan kesalahan( I paid a bribe, n.d.) Walaubagaimanapun, Malaysia
menghadkan maklumat kepada rakyatnya mengenai perbelanjaan negara. Open budget survey
2017 menunjukkan pencapaian Malaysia hanyalah 46/100 berkaitan ketelusan Malaysia dalam
memberi maklumat yang mencukupi mengenai perbelanjaan negara untuk membolehkan rakyat
terlibat dalam perbincangan perbelanjaan negara. Mungkin kerajaan yang baru dibentuk di
Malaysia harus menambah maklumat secara komprehensif mengenai liabiliti kerajaan termasuk
tanggunggan luar jangka dan di masa hadapan serta kemapanan kewangan kerajaan dalam
jangka panjang dan menambahbaik maklumat secara terperinci mengenai perbelanjaan
sebenar sektor-sektor kerajaan.Mungkin juga perlu digubal satu akta seperti Enakmen
Kebebasan Maklumat negeri Selangor 2011 yang memberi peluang kepada rakyat untuk
mengakses maklumat yang dibuat oleh jabatan-jabatan kerajaan bagi kepentingan awam.Malah
peluang untuk rakyat terlibat dalam proses belanjawan adalah sedikit sahaja iaitu 22/100.Maka
kerajaan harus mengambil langkah-langkah untuk mendengar maklumat dari sebahagian
masyarakat yang lemah dan tidak diwakili mengenai perbelanjaan tahunan; menyediakan
platform untuk masyarakat boleh memberi pandangan dan mewujudkan mekanisme rasmi
untuk rakyat membantu institusi audit dan mengambil bahagian dalam penyiasatan tersebut.
KESIMPULAN
Generasi kanak-kanak dan belia adalah pewaris negara. Golongan kanak-kanak dan belia
adalah melebihi 70 peratus dari rakyat Malaysia (Jabatan Statistik Negara, 2015). Sebagai
pemimpin negara di masa depan yang akan menentukan kemajuan negara Malaysia, mereka
haruslah bebas dari rasuah kerana ia perosak bangsa dan negara. Rasuah menyebabkan
pemerintahan negara menjadi lemah dan kucarkacir. Ia juga boleh menghakis kepercayaan
awam kepada pemimpin negara. Semua ini akan mengakibatkan pengabaian kepentingan
masyarakat, kemerosotan ekonomi yang akhirnya akan menghancurkan pemerintahan
sesebuah negara. Oleh itu rasuah patut dibendung dari awal iaitu dengan menanam anti-rasuah
dalam diri kanak-kanak dan belia supaya bila mereka menjadi pemimpin kelak, pemerintahan
bersih dari rasuah. Mereka patut didedahkan dengan kesan negatif rasuah melalui pelbagai
cara pendidikan dan digalakkan untuk menyertai program-program yang berkaitan anti-rasuah.
66
Rujukan
Amnesty International UK, (2015). Resources.Diperolehi

darihttps://www.amnesty.org.uk/resources/activity-great-escape
Astro Awani,(2017, Mei 6). Semakin ramai pelajar universiti sanggup beri, terima rasuah –KP
SPRM. Diperolehi dari http://www.astroawani.com/berita-malaysia/semakin-ramai-pelajar-
universiti-sanggup-beri-terima-rasuah-kp-sprm-141805
Education in primary and secondary schools on anti-corruption in the Republic of Korea, (2017),
Diperolehi dari
https://www.unodc.org/documents/treaties/UNCAC/WorkingGroups/workinggroup4/2017-
August-21-23/Contributions_NV/RepublicOfKorea_EN.pdf
1 dalam 3 pelajar universiti tak kisah rasuah, menurut kajian, (2017, Julai 19).FMT
News.Diperolehi dari http://www.freemalaysiatoday.com/category/bahasa/2017/07/19/1-dalam-
3-pelajar-universiti-tak-kisah-rasuah-menurut-kajian/
Hasna, H.A.,(2017, November 12), Belanja makan sebab tandatangan kehadiran IPT adalah
rasuah.Diperolehi dari http://www.astroawani.com/berita-malaysia/belanja-makan-sebab-
tandatangan-kehadiran-di-ipt-adalah-rasuah-16024
I paid a bribe, (n.d.). Diperolehi dari http://www.ipaidabribe.com/#gsc.tab=0
Muslims for Human Rights (MUHURI) - Kenya, (n.d.) International Budget

Partnership.Diperolehi dari https://www.internationalbudget.org/wp-content/uploads/Profile-of-
MUHURI-Kenya-2011.pdf
Jabatan Statistik Negara, (n.d.) taburan penduduk mengikut umur. Diperolehi dari
http://www.rurallink.gov.my/wp-content/uploads/2015/05/1-DATA-ASAS-MALAYSIA1.pdf
Lim, H.Y., Tong. T.P.Y dan Woon, M.V, (2009). Kesanggupan Memberi Rasuah Dikalangan
Pelajar Universiti: Kes Kesalahan Lalulintas. Diperolehi
darihttp://www.myjurnal.my/filebank/published_article/16290/433.pdf
Mahavera, S., (2017). Budaya rasuah bermula sejak di kampus universiti. The Malaysian
Insight. Diperolehi dari https://www.themalaysianinsight.com/bahasa/s/8046/
Pendekatan anti rasuah di IPT oleh SPRM, (2015, November 24), FMT News. Diperolehi dari
http://www.freemalaysiatoday.com/category/bahasa/2015/11/24/pendekatan-anti-rasuah-di-ipt-
oleh-sprm/
Solomon Times Online, (2009, Disember 7). Anti-corruption Comic Hits the Streets of Honiara,.
http://www.solomontimes.com/news/anticorruption-comic-hits-the-streets-of-honiara/4733
The World Bank, Government and Public Sector Managemant, Textbook Count in Phillipines.
Diperolehi dari
http://web.worldbank.org/WBSITE/EXTERNAL/TOPICS/EXTPUBLICSECTORANDGOVERNAN
CE/0,,contentMDK:23265513~pagePK:148956~piPK:216618~theSitePK:286305,00.html
67
Thematic Compilation Of Relevant Information Submitted By Malaysia, (n.d.) Diperolehi dari

https://www.unodc.org/documents/corruption/WG-Prevention/Art_13_Awareness-
raising_measures_and_Education/Malaysia.pdf
Tong, G., (2018, Februari 22), Indeks rasuah: 1MDB, Felda punca Malaysia merosot. Diperolehi
dari
https://www.malaysiakini.com/news/413094
Transparency International, What is corruption. Diperolehi dari

https://www.transparency.org/what-is-corruption
Transparency International, (2011, May 31). Laporan tahunan 2010. Diperolehi dari
https://issuu.com/transparencyinternational/docs/annual_report_2010/66
Sharma, Y., (1996). HONG KONG- EDUCATION: Anti-corruption Classes on the Curriculum.
Diperolehi dari http://www.ipsnews.net/1996/12/hong-kong-education-anti-corruption-classes-
on-the-curriculum/
-GP10-
Whistleblowing Policy in Education: Malaysian Perspective
Azlin Namili bt. Mohd. Ali @ Ramli1

1 College of Law, Government and International Studies, Universiti Utara Malaysia.
Email: azlin@uum.edu.my
Abstract
The aim of this paper is to observe whether the education sectors in Malaysia has whistle
blowing policies as compare to other countries in the world. This is an exploratory study and it
highlighted the good concept of whistleblower laws that should exist in whistleblowing policy.
From observation, it can be said that education sectors in Malaysia still do not have the formal
whistleblowing policy even though situations shows that it is needed in order to safeguard the
interest of the education sectors and also the public. However, some education institution might
have self-regulated policies on how complaint on wrongdoing in institution concerned can be
made to a person in charge from that institution.
Key Words: Whistleblowing Policy, Education Sector, Malaysia.
1. INTRODUCTION
Whistleblowing is the disclosure by a person about mismanagement, corruption, illegality or

wrongdoing of someone in an organization to those in authority or to the public (Pointon &
Phuoc, 2012). The person who makes the disclosure is called as whistleblower who is usually
an employee in a private enterprise or government agency. Sometime, a whistleblower can be
person outside the organization. Cases of alleged wrongdoing are usually exposed in business
68
organizations and management professionals. In consequences, the society demand for higher
ethical standards of management.
As for education sectors, universities were urged to include some business ethics instruction in
the graduate and undergraduate business curriculum (Pizzolatto & Bevill, 1996). Most studies
discovered that business students are ethically less sensitive than management practitioners
(Collins, 2000), and when they become managers, little change occurs in their ethical
perspectives (Salter, Guffey, & McMillan, 2001). In England, the disclosure of wrongdoing are
usually made in connection about ―unfair recruitment practices‖, ―academic research quality‖,
―financial malpractice‖ and the ―competency‖ of a governing body (Morgan, 2014a). Higher
Education Funding Council for England received 21 cases on whistleblowing approaches
between October 2011 and March 2014. The UK Public Concern at Work (PCaW), a
whistleblowing charity, says education is the fastest raising sector of whistleblowing, with the
number of calls rising from 78 in the first half of 2011 to 112 in the first half of 2012, a 44%
increased from the previous year . The PCaW carried out an analysis of 100 calls relating to
secondary and primary schools between March 2011 and June 2012, and found six were
directly related to fraud and exam malpractice. Other categories of call were on about
safeguarding, children's health and physical abuse. In 2011, a group of teachers had revealed
to exam boards and other agencies regarding alleged misconduct in GCSE and BTec courses
at Kingsdale foundation school, an academy in Southwark, South London. Allegations from 13
teachers and nine pupils on cheating of six academic subjects and 10 qualifications lead to an
investigation. The claims included teachers writing answers for pupils, teachers answering
questions in exams and inventing or increasing pupils' coursework grades (Mansell, 2012).
The effect of these wrongdoings will tarnished the name of schools and universities. Five
University of Tennessee sexual assault allegations against student-athletes have publicly
tarnished three of Tennessee's most prominent universities in recent months.
1.1. WHISTLEBLOWER EDUCATION POLICY FROM UK PERSPECTIVE
Acts were passed to give protections to whistleblower. The Public Interest Disclosure Act
1998, which amended the Employment Rights Act 1996, established a degree of legal
protection for whistleblowers, meaning that they would win an employment tribunal claim for
unfair dismissal if they were sacked for blowing the whistle. Apart from acts, an organization
ought to develop formal whistleblowing policies in order to create the necessary conditions for
the effective management of whistleblowing.
Most universities in England have whistleblowing policies, however many fail to reflect
2013 amendments to legislation, which indicate that a whistleblower must believe that he is
acting not for personal gain but for the ―public interest‖ to qualify as a public interest disclosure.
But the change in legislations also removed the conditions for whistleblowers to be acting in
―good faith‖. Two-thirds of universities are using out-of-date whistleblowing procedures, ignoring
new laws that potentially extend protections to more of those who highlight wrongdoing
(Morgan, 2014b). The effect of the revised legislation is that a whistleblower would not be
protected under the legislation if his allegation about the school is for his own personal gain as
this would come under the school grievance procedure. In order to get protection for
whistleblowing the wrongdoing made by staff of the education institutions, a whistleblower need
69
to prove that (i) he have a reasonable ground to belief of the wrongdoing; (ii) he blow the
whistle in the interest of the public and (iii) the wrongdoing has been brought to the attention of
the school.
The effective whistleblowing policies should provide standard guidelines whereby
organizations may respond to the ethical or moral concerns of their employees. It must have a
clear statement that employees who are conscious of possible wrongdoing in the organization
have a duty to disclose the wrongdoing to appropriate parties within the organization. A specific
individuals or groups are designated as complaint recipients must be outside the chain of
command. There is a guarantee that employees who disclose the wrongdoing in good faith will
be protected from adverse employment consequences. Lastly, the organization must establish a
fair and impartial investigation process.Commitment from top management and adequate
communication to employees is necessary in order for the policies to succed (Barnett, 1992).
2. MALAYSIA PERSPECTIVE
Whistleblower Protection Act 2010 has been passed in Parliament in 2010 to combat corruption
and wrongdoings and promote good governance. It encouraged and facilitates disclosures of
improper conduct in the public or the private sector. The law covers any member of the private
and public sectors who discloses wrongdoings. Among the disclosures covered is violation of
laws and ethical standards, illegality, mismanagement, gross wastage and danger to public
health or safety. To protect the whistleblower, his identity will be kept secret and not exposed to
anyone including during courts proceedings. No civil, criminal or disciplinary action will be taken
against him. These protections will also be provided to those who has close relation to him. A
whistleblower who becomes victim of detrimental action in reprisal for disclosing improper
conduct can apply for remedy that are damages or compensation, injunction or any relief
decided by court.
In order to get protection, a whistleblower must make the disclosure to the enforcement agency
such as Malaysian Anti-Corruption Commission, Royal Malaysian Custom, Malaysian
Immigration Department, Road Transport Department Malaysia and Royal Malaysia Police. The
disclosure of information cannot be done to public and the information disclosed is not
specifically protected under any written law. It means that information protected under certain
acts such as Financial Services Act 2013 and Official Secret Act 1972 is not protected by
Whistleblower Protection Act 2010 (WPA, 2010). With so many limitation imposed by WPA 2010
and in order to encourage internal self- regulation, some of Malaysia big companies such as
Companies Commission of Malaysia (CCM), PLUS Malaysia Berhad, PETRONAS and Tenaga
Nasional Berhad has come up with their own whistleblower policy.
Some universities especially private universities have whistleblowing policy. SEGi University
and Colleges, Many universities and schools in Malaysia still do not have the formal
whistleblowing policies. It might be that the reporting method to the higher rank officer is done
informally. There is no standard guideline issued by the organizations to be followed by a
whistleblower. This might discourage a person from disclosing misconduct in the organization or
he does not know who the appropriate person to receive the report. A controversial incident
happened at SK Seri Pristana in Sungai Buloh, Selangor. One of a parent had uploaded
pictures showing the non-Muslim students eating in the shower room during recess in the
70
fasting month. Her daughter was harassed and three other non-muslim students transferred out
of the school because their parents are worried that the students would also be harassed (The
Star Online, 2013). If the parent report it through the right channel, the consequence would not
be damaging.
A study on final year accountancy students‘ show that majority of the students are taking
a moderate approach in their willingness to blow the whistle. The researcher suggests the
importance to motivate and encourage the students about ethics education and it should be
reflected in their work after graduation. Apart from that, the ethic values should be incorporated
in the accounting courses and organized ethics related programs to enhance the ethical
behaviour of students. Further, universities can help the students to improve their professional
commitment and to act ethically in their profession (Mustapha & Siaw, 2012).
3. CONCLUSION
Education profession needs to consider the role of whistleblowing. Although it is not the
only method of detection of misconduct, it might be the first step and effective technique to curb
misconduct. Universities and schools should have whistleblowing policies and procedures that
are clear, effective and accessible at all times. People will not be confidence to report their
concerns if there is no policy at all or the policy is hidden from view. Policies and procedures
should be carefully worded as they may have significant practical and legal implications. It
should be clear that misconduct are reported internally and assurance those who make a
disclosure will be protected against retaliation.
REFERENCES
Barnett, T. (1992). Why your company should have a whistleblowing policy, Sam Advanced
Management Journal, Autumn, 1992, 37-42.
Collins, D. (2000). The quest to improve the human condition: The first 1500 articles published
in Journal of Business Ethics, Journal of Business Ethics,26(1), 1–73.
Ho, S., & Tarmizi, J. S. (2013). Three students leave SK Seri Pritana. Retrieved from
http://www.thestar.com.my/News/Nation/2013/08/28/Three-students-leave-SK-
SeriPristana/
Mansell, W. (2012). Teacher who blow the whistle, Retrieved from
http://www.theguardian.com/education/2012/dec/10/teachers-whistleblowing-exam-
cheating-schools.
Mustapha, M., & Siaw, L. S., (2012). Will final year accountancy students whistle blow? A
Malaysian case, International Journal of Trade, Economics and Finance, 5(3), 327-331.
Morgan, J. (2014a). Whistleblowers report malpractice and fraud in sector. Retrieved from
http://www.timeshighereducation.co.uk/news/whistleblowers-report-malpractice-and-
fraud-in-sector/2014862.article.
Morgan, J. (2014b). Whistleblowing: Are you protected? Retrieved from
http://www.timeshighereducation.co.uk/news/whistleblowing-are-you-
protected/2013635.art icle.
71
Pointon, L.D.,& Phuoc, J.C. (2012). Whistleblower Protection Law, cases & commentary. Le
Singapore: LexisNexis.
Pizzolatto, A. B.,& Bevill, S. (1996). Business ethics: A classroom priority? Journal of Business
Ethics, 15(2), 153–158.
Rennie, S.C.,&Crosby, J.R. (2002). Students perceptions of whistleblowing: Implications for self
regulation. A questionnaire and focus group survey, Medical Education, 36, 173-179.
Salter, S. B., Guffey, D.M.,& McMillan, J.J. (2001). Truth, consequences and culture: A
comparative examination of cheating and attitudes about cheating among U.S. and U.K.
students, Journalof Business Ethics,31(1), 37–50.
Wadhwani, A. (2015). Sexual assault allegations tarnish TN universities.Retrieved from

http://www.tennessean.com/story/news/2015/02/14/sexual-assault-allegations-tarnish-tn-
universities/23427137/.
-GP11-
Nature of Appointment of Personal Representatives to the Deceased Estate in West
Malaysia
Nor Azlina binti Mohd Noor 1 and Ahmad Shamsul bin Abd. Aziz2
1 School of Law, Universiti Utara Malaysia.
Email: norazlyna@uum.edu.my
2 School of Law, Universiti Utara Malaysia.
Email: sham@uum.edu.my
Abstract
Administration of deceased estate in Malaysia is governed by three different backgrounds of
administrative bodies. They are the Civil High Court, Small Estates Distribution Section under
the Department of Director General of Lands and Mines, and Public Trust Corporation. The law
operates via the assistances of personal representatives. Despite of the organizational
differences, each and every administrative bodies mandated the appointment of personal
representatives before the deceased‟s estate can be dealt with. This paper aims to discuss the
legal position of appointment of personal representatives of the deceased‟s estate. This paper
analyses the legal provision relating to the estate administration particularly the Probate and
Administration Act 1959. This paper concludes that there are several methods of appointment of
personal representatives recognized by the court. There is no objective test in the appointment
as the letter of representation will be granted by the court based on circumstances of each and
every case.
Key Words:Personal representatives, appointment, deceased‘s estate, estate administration.
72
1. INTRODUCTION
In Malaysia, a person may die testate or intestate. The former means that the person died
leaving a will and the latter means that the person died without leaving any testamentary
document resulted to the operation of law of intestacy to Non-Muslim under Distribution Act
1958 and law of faraid to the Muslim. When a person dies, all assets under his name will be
frozen and cannot be transacted. The consequences are that, from legal perspective, the
deceased assets can only be transacted when his personal representatives applying for letters
of representations from the Civil High Court (Bahari, 2014). The need is well manifested by the
legal requirement to produce a declaration under oath before the extraction of letter of probate
or letter of administration is granted by the Civil High Court. Once the letter of representation is
granted to the personal representative either in common forms or solemn form, he accordingly
takes over the deceased‘s right as the owner of the property and may proceed with the duties
for the administration of the deceased estate (Zakaria, 2013; Halim & Noor, 2016).
The appointment of personal representatives in Malaysia is governed by Probate and

Administration Act 1959. The term ‗personal representative is defined by Section 2 of the
Probate and Administration Act 1959 as ‗the executor, original or by representation, or
administrator for the time being of a deceased person, and as regards any liability for the
payment of death duties includes any person who takes possession of or intermeddles with the
property of a deceased person without the authority of the personal representatives or the
Court.‘ The term personal representatives are used to refer generally to both executor and
administrator if not specifically distinguished by any specific statutes (Noor, 2017). A widely
accepted notion is that the two categories of personal representative can be distinguished
based on the nature of their appointment (Noor & Halim, 2013).
Executor is normally appointed by the deceased in the event of testacy by naming a person in
his last will to administer the deceased estate and be granted with grants of probate as provided
in Form 163(a), Order 71 (35) of Rules of Court 2012. Administrator on the other hand, is a
person appointed by the Court in the event of intestacy where the deceased died without
leaving any will or other testamentary document and in this occasion will be granted with letters
of administration as provided in Form 163 (b), Ordinance 71 (35) of Rules of Court 2012. They
may also be appointed in several occasions such as absence of testamentary executor; or legal
incapability of testamentary executor to act as such, or testamentary executor renounce his
appointment; or the executor predeceased the testator; or all the executors die before obtaining
probate or before having administered all the estate of the deceased; or the executors
appointed by any will do not appear and extract probate (Probate and Administration Act 1959,
Section 16). The appointment usually made based on the personal qualities of the person such
as the knowledge of the deceased‘s family and affairs, trustworthiness, business acumen and
general common sense (Parker, Oakley, &Mellow, 2003).
2. NATURE OF APPOINTMENT
The law is silent on the requirement to choose a right personal representative in estate
administration. There is no hard and fast rule pertaining to the requirement of law in choosing a
personal representative to manage the deceased person‘s estates. In case of testacy, the
73
testator has liberty to choose any persons he wished to act as his representatives and named
them in his will. In the case of intestacy, the usual approach that been taken by the court is the
person must be of a capable and willing person. With the exclusion of a minor under Section 20
of Probate and Administration Act 1959 and lunatic under Section 21 of Probate and
Administration Act 1959, any other person can be appointed as personal representative. In
other words, any person who is an infant or unsound mind would not be entitled to letter of
representations, with or without the will annexed due to his minority or lunatic condition.
Even though the appointment is made by the Court, the family members or the legal
beneficiaries still has right to apply for revocation of the grant and applied for a replacement. A
person need to show his willingness to act as personal representatives of the deceased estate.
In Lee Pak Yin v Liew Siew Yin [1940] MLJ 80, it was held that where an executor is willing to
act, a strong case must be made out to justify the dispossessions of his office and that the court
will not dispossess an executor on a slight ground. A strong indication of unwillingness to act on
the part of personal representative is one of the ground where the court will revoke the grant of
the letter of representation. The unwillingness can be evinced through improper administration
of deceased estate. To convince the court to interfere, there allegation must be very strong. In
the case of Fazil Rahman v ARS Nachiappa Chettiar [1963] 29 MLJ 309, it was held that in the
absence of allegation that the estate was not properly administered, and the estate appeared to
be insolvent, there was no sufficient cause to revoke the grant. Likewise, in the case of Tan Kay
Seng v Tan Kay Choon & Anor [1990] 1 MLJ 51, the court dismissed the application on the
ground that the applicant in the absence of evidence that there was undue and improper
administration of the estate in total disregard of the interest of beneficiaries failed to show that
there is sufficient cause to revoke letter of administration.
The court also formulated a test of fitness in determining the request to be personal
representatives. The court will take into deliberation not only on the applicant‘s character,
financial position or ineptitude for business, the interest in the estate, but also to any personal
objectionable by other persons entitled to share in the estate. (Martyn & Caddick, 2008). Other
ground of fitness is a physical incapacity of a person due to any unhealthy condition by reason
of mental disorder or mental or physical ill-health, attitude and demeanor of the applicant (Noor
& Halim, 2016). In Re Lim Lean Hin [1992] 1 CLJ 707 the court held that an executor had
become unfit to carry on his executorship duties by reason of undergoing a brain surgery. Whilst
in Estate of Ngau Ken Lock (deceased) (Ngau Voon Kiat, petitioner) [2002] 4 MLJ 74, the court
held that failure to collaborate with other personal representative in administering the
deceased‘s estate also disclosed that the person was not fit to become a personal
representative.
Furthermore, the court articulated an objective test of due and proper administration of the
estate and the interests of the beneficiaries in Damayanti Kantilal Doshi & Ors v Jigarlal Kantial
Doshi & Ors [1998] 4 MLJ 268. The test has been affirmed in later case such as Re Khoo Boo
Gong, decd Khoo Theng Seong v Teoh Chooi Ghim & Ors [1981] 2 MLJ 68. This was later
followed by the case of Ligar Fernandez v Eric Claude Cooke [2002] 5 MLJ 177 where it was
held that in applying objective test, all that is needed is to raise a strong suspicion of the
personal representative‘s inaction, want of diligence and honesty, or a conflict of interest
situation or inability to act in order to get any relief from the court (Halim, 2012). Any assertion
74
made on that ground must be verifiable. In Guindarajoo a/l Vegadason v Satgunasingam a/l
Balasingam [2010] 4 MLJ 842 the court held that a sufficient cause may be satisfied in a case
where a person is not only need to contend that he retains a particular property which has been
encompassed in the estate administration, but he must also be able to prove his claim.
3. METHOD OF APPOINTMENT
The law recognised two methods of appointment of personal representative‘s namely express
and implied appointment as follows:
3.1. Express Appointment

The express appointment usually been made by a testator in his testamentary document. In the
case a person dying leaving a will, the appointment is expressly made by the operation of law.
The power to manage the deceased‘s estate originated from the letter of representation granted
by the relevant administrative bodies. Administration of deceased estate in Malaysia is
governed by three different administrative bodies. They are the Civil High Court, Small Estates
Distribution Section under the Department of Director General of Lands and Mines, and Public
Trust Corporation known as Amanah Raya Berhad (ARB). Despite of the organizational
differences, each and every background mandated the appointment of personal representatives
to deal with the deceased estates. The types of orders granted by the administrative bodies are
as stated in the following Table 1.
Table 1 Types of Order
Administrative Order Statutory Provision

bodies
Civil High Court Letter of Probate  Section 3, Probate and Administration Act
1959
Letter of  Section 17-28, Probate and Administration
Administration Act 1959
Small Estate Letter of  Section 13(4), Small Estate Distribution Act

Distribution Section Administration (Form 1955
F)  Regulation 7(1), Small Estate Distribution
Regulation
3.2. Implied Appointment

A mere supposition of the executorship does not make a person as a personal representative of
the deceased‘s estate. This principle was established in the case of Gan Chiew Heang and Ors
V Universal Trustee (M) Bhd and Anor [2010] MLJU 1286. In this case, the court held that a
mere assuming the directorship of the deceased's company per se namely holding out as an
executor of the estate in particular in the various communications between him and some other
75
parties including the income tax office, did not automatically make a person as an executor of
the estate. However, the law may predispose several circumstances to constitute an implied
appointment of personal representatives to the deceased estate.
Firstly, a person may become an executor by representation if he is the executor of the will of a
testator who was himself the sole executor or sole surviving executor of another testator‘s will.
This chain of representation is broken either by an intestacy or failure of the testator to appoint
an executor or failure to obtain probate, but it is not broken by a temporary grant of
administration if probate is subsequently granted. Every person in the chain of representation to
a testator hold the same rights in respect of the estate of that testator as the original executor
would have if living and will be answerable as he was the original executor to the extent to
which the estate of that testator has come to his hands (Probate and Administration Act 1959,
section 14).
Secondly, the appointment of personal representatives can be implied from the wording of the
testator in his testamentary document. In other words, a person may become an executor or
personal representative even though he is not expressly referred to as such in the will. It may
happen in the case where the will provides for a named individual to carry out certain duties and
responsibilities as executor relating to an estate such as proving the will, calling in the assets of
the deceased and paying out to the creditors of the deceased.
Thirdly, the law also recognized an appointment of personal representatives by implication such
as by the way trusteeship. A person may be considered as an executor if he has been
appointed to be a trustee of certain deceased estate or a trustee to deceased‘s children‘s fund.
In the case of Re Russell‟s Goods, Re Laird‟s Goods [1891-92] P 380, the court held that a
person who has been nominated as trustee to carry out deceased‘s will and for the due
execution of his will to be an executor to the deceased‘s estate. In Re Lush‟s Good (1888-90)
13-15 PD 20, the court also agreed to held that a person is a personal representative to the
deceased‘s estate when he was named as trustee and directed by the deceased to collect his
property as stated in the will and after paying the funeral and other expenses to distribute the
residue and remainder of his property according to the will.
Lastly, the appointment of personal representatives can be implied from the conduct of the
parties such as possessing or intermeddles with the property of a deceased person as regards
any obligation in the estate administration (Civil Law Act 1956, section 2). This category of
personal representative is a person who is not being an appointed by the court. The person
intermeddles in the affairs of the deceased‘s estate and so takes on, by implication, the
responsibilities and liabilities of an executor. The person is also known as executor de son tort
under the law. Advertising for claims against the estate, paying the deceased‘s debts, carrying
on the deceased‘s business are all activities which have been accepted as falling within the
definition of intermeddling (Section 65 of the Probate and Administration Act 1959).
76
4. Effect of Appointment
Once granted with the letter of representation, the appointment of personal representatives
become official. The personal representative is assumed to steps into the dead‘s man shoes,
where he is vested with enormous powers to enable him to manage and preserve the deceased
estate accordingly. The personal representative power over the deceased‘s estate is equivalent
to what ‗an absolute owner would have.‘ Except as restricted by a will or an order in a formal
proceeding, a personal representative must act ‗for the benefit of the interested persons‘.
However, a personal representative‘s power is not accompanied by vesting of title. The
delegation of power without title serves to ease the succession of assets which are not
possessed by the personal representative.
Sindhu (2005) had clearly stated the main duties of personal representatives which are to
collect all debts due to the estate, to pay all the debts and satisfy all the liabilities of the estate,
to convert unauthorized investments into authorized ones and to distribute the remainder of the
estate according to deceased‘s will or rules of intestacy. Section 44 of Probate and
Administration Act 1959, provides that the personal representative can be allowed by the Court
to utilize the estate deceased to pay for the deceased testamentary expenses other reasonable
expenses incurred by them and it includes the proper funeral expenses and all reasonable
expenses of subsequent religious ceremonies suitable to the station in life of the deceased. The
amount of expenses must be reasonable in nature and in accordance with the social status of
the deceased.
There is no clear distinction between the administrator and executor when comes to their
powers, rights duties and obligations. If the executor has the power to enter into a contract, the
administrator also has such power. In such a case, it is interesting to note that much is said on
the right of the executor to carry on with the deceased‘s affairs subject to the validations of their
actions by extraction of probate and provisions of will and no such right on the administrator
(Raman, 2012).
5. Conclusion
As a conclusion, there are several methods of appointment of personal representatives
recognized by the court. Even though, the law is silent on the requirement to choose a right
personal representative in estate administration, the court formulated a test of fitness in
determining the application to be personal representatives. There is no objective test in the
appointment as the letter of representation will be granted by court based on circumstances of
each and every case.
REFERENCES
Bahari, A. (2014). Islamic estate retirement and waqf planning. Kuala Lumpur: IBFIM.
77
Halim, A. H. (2012). Administration of estates in Malaysia: Law and procedure. Kuala Lumpur:
Sweet & Maxwell Asia.
Halim,A.H.,&Noor, N.A.M. (2016). Fiduciaries in the administration of the deceased's estate:

The two distinct capacities of personal representatives and trustees. Current Law
Journal, 8, i-x.
Martyn, J. R., & Caddick, N. (2008). Williams, Mortimer and Sunnucks on executor,
administrator and probate. London: Sweet & Maxwell.
Noor, N. A. M. (2017). Legal protection of estate beneficiaries against personal representatives

in Malaysia. (Doctor of Philosophy in Law), International Islamic University Malaysia.
(Unpublished).
Noor, N.A.M.,&Halim, A. H.(2013). Regulating the conduct of personal representatives in the

deceased's estate administration: Malaysian legal perspective, in International Academic
Conference on Social Sciences (IACSS 2013), Istanbul.
Parker, D.B., Oakley, A.J.,&Mellows, A.R. (2003). Parker & Mellows: The modern law of trusts.
London: Sweet & Maxwell.
Raman, G. (2012). Probate and administration in Singapore and Malaysia. Appendices to the
probate and administration in Singapore and Malaysia. Kuala Lumpur: LexisNexis.
Sidhu, M. S. (2005). The Law of Wills probate administration & succession in Malaysia and
Singapore (With cases and commentaries) (2 ed.). Kuala Lumpur: International Law
Book Services.
Zakaria, A. (Ed). (2013). Malaysian civil procedure. Subang Jaya: Sweet & Maxwell Asia.
-GP12-
Pemantauan Aspek Halal Rumah Sembelihan Ayam di Malaysia:
Integriti Agensi Penguatkuasa
Anis Shuhaiza Binti Md Salleh1, Fariza Binti Romli2 danKhuzaimah Binti Mat Salleh 3
1 Pusat Pengajian Undang-Undang (SOL), UUM COLGIS, Universiti Utara Malaysia, Kedah.
Emel:shuhaiza@uum.edu.my
Emel:arfariza@uum.edu.my
Emel:khuzai@uum.edu.my
Abstrak
Selain isu perundangan, cabaran yang wujud dalam pemantauan halal rumah sembelihan ayam
di Malaysia adalah melibatkan soal integriti agensi penguatkuasa. Integriti agensi penguatkuasa
78
merupakan isu penting dalam memastikan sesuatu polisi kerajaan dan undang-undang dapat
direalisasikan dengan berkesan. Ini adalah kerana dalam menguatkuasakan undang-undang
dan memastikan standad halal Malaysia dipatuhi, pegawai-pegawai dan agensi penguatkuasa
perlu turun padang memeriksa dan membuat keputusan yang adakalanya menggunakan
budibicara. Dengan memilih beberapa contoh agensi penguatkuasa tertentu sahaja, artikel ini
mengupas peranan agensi berkenaan yang terlibat dalam pemantauan aspek halal rumah
sembelihan ayam di Malaysia serta membincangkan permasalahan yang dihadapi. Kajian ini
mendapati bahawa pentingnya wujud konsistensi dalam menginterpretasi dan penguatkuasaan
sesuatu undang-undang berkaitan halal bagi rumah sembelihan ini supaya integriti pihak agensi
penguatkuasa tidak tercalar dan diremehkan oleh pihak industri serta logo halal yang
dikeluarkan tidak dipertikaikan masyarakat. Komitmen yang tinggi terhadap tugasan dan sistem
sokongan yang baik juga merupakan aspek penting mengekalkan integriti agensi penguatkuasa
rumah sembelihan.
Kata Kunci:Rumah Sembelihan Ayam, Industri Halal, Agensi Penguatkuasa, Integriti
1. PENGENALAN
Secara umumnya, menurut kamus dewan integriti boleh ditakrifkan sebagai kejujuran,
keadaan sempurna dan utuh serta tindakan mempertahankan nama baik daripada sebarang
bentuk penyelewengan. Integriti boleh difahami sebagai nadi utama kepada pencapaian hasil
kerja berkualiti yang dipertanggungjawabkan kepada seseorang individu atau organisasi
dengan berlandaskan ciri-ciri kerja bersepadu dan menyeluruh. (Megat Ayop dan Abd. Halim,
2016) Ia merangkumi integriti individu dan juga organisasi. Dalam aspek pemantauan dan
penguatkuasaan halal rumah sembelihan ayam di Malaysia, integriti agensi penguatkuasa amat
penting memandangkan pegawai-pegawai dan pihak penguatkuasa perlu turun pandang
berurusan dengan pemain-pemain industri. Pemantauan dan penguatkusaan bukan hanya
tertumpu kepada pemenuhan kehendak dokumentasi dan teori semata-mata. Dalam
menjalankan tugas sedemikian, pegawai-pegawai dan pihak penguatkuasa adakalanya
terdedah kepada keadaan yang menuntut integriti yang tinggi seperti kesungguhan dan
penelitian bagi memastikan sembelihan-sembelihan yang dilakukan oleh pihak industri itu
adalah halal menurut kacamata agama Islam. Selain itu, cabaran-cabaran lain yang turut
menuntut integriti tinggi pihak penguatkuasa adalah seperti cabaran habuan yang dijanjikan
serta cabaran ancaman terhadap keselamatan diri dan harta benda pegawai-pegawai tertentu
yang terlibat. Ini adalah kerana kebiasaanya bagi memantau rumah sembelihan, pegawai-
pegawai tertentu sahaja yang akan ke premis atau rumah sembelihan bertemu pihak operator
atau pemilik rumah sembelihan. Terdapat beberapa agensi kerajaan yang terlibat dalam
pemantauan dan pengurusan industri halal di Malaysia termasuklah pemantauan rumah
sembelihan ayam.
Jabatan Kemajuan Islam Malaysia (JAKIM) merupakan agensi kerajaan yang

bertanggungjawab dengan urusan produk halal di Malaysia. Bidangkuasa JAKIM adalah
tertumpu kepada pensijilan halal dan pematuhan kepada standard halal. Ini termasuklah
menjalankan pemantauan ke rumah-rumah sembelihan bagi tujuan mendapat pensijilan halal
bagi produk sembelihan. Eksekutif halal yang dilantik oleh rumah sembelihan perlu
bekerjasama dengan JAKIM bagi memastikan aspek-aspek halal dipatuhi. Selain JAKIM,
Jabatan Perkhidmatan Veterinar (JPV) di bawah Kementerian Pertanian dan Industri Asas Tani
turut memainkan peranan di dalam pensijilan halal di Malaysia. Peranan JPV lebih menjurus
79
kepada memastikan daging termasuklah daging ayam yang import adalah menepati standard
halal negara. Ini kerana, telah menjadi syarat bahawa rumah sembelihan di luar negara perlu
mendapat pengiktirafan untuk mengimport daging ke Malaysia. Rumah sembelihan di luar
negara akan dilawati oleh beberapa pegawai dari Malaysia bertujuan untuk memastikan tempat
sembelihan, prosedur penyembelihan, binatang disembelih, penyembelih, makanan haiwan
ternakan menepati standard negara Malaysia.
Justeru, wakil daripada JPV adalah salah seorang dari pegawai yang dihantar mewakili
kerajaan Malaysia di samping pegawai daripada JAKIM. Manakala bagi penguatkuasaan di
Malaysia, JPV turut berperananan sebagai wakil jawatankuasa dalam memastikan rumah
sembelihan yang berskala besar mempunyai sijil berkaitan Hazard Analysis and Critical
Control Point (HACCP) dan Amalan Pengilangan Baik (GMP) bagi industri makanan.
HACCP diwujudkan bagi memberi pengiktirafan rasmi kepada industri yang mengamalkan
elemen-elemen HACCP sekaligus memenuhi kehendak-kehendak keselamatan makanan dan
kehendak pengguna manakala GMP telah diwujudkan bagi membantu industri untuk mencapai
piawai pengeluaran makanan yang lebih tinggi bagi memenuhi kehendak-kehendak
keselamatan makanan dan kehendak negara. Seterusnya, Pihak Berkuasa Tempatan (PBT)
juga merupakan agensi penguatkuasa penting memantau rumah sembelihan. PBT berperanan
mengeluarkan lesen bagi membenarkan sesebuah rumah sembelihan beroperasi setelah
peraturan-peraturan dari jabatan sokongan yang berkaitan dipatuhi.
2. UNDANG-UNDANG MALAYSIA BERKAITAN RUMAH SEMBELIHAN AYAM HALAL
Selain mematuhi sembelihan cara Islam, antara perkara penting bagi rumah sembelihan
ayam memperolehi sijil halal, sesebuah rumah sembelihan itu perlu memenuhi beberapa
piawaian ditetapkan seperti aspek kebersihan, pengurusan aliran air takungan, pengolahan
kumbahan serta keadaan bangunan. Bagi memenuhi keperluan itu, pelbagai garis panduan dan
undang-undang yang dikuatkuasakan oleh pelbagai agensi perlu dipatuhi. Dalam konteks
rumah sembelihan, antara undang-undang yang perlu dipatuhi adalah seperti:
i. MS1500:2009 Makanan Halal - Pengeluaran, Penyediaan, Pengendalian dan

Penyimpanan- Garis Panduan Umum (Semakan Kedua);
ii. Malaysia Protocol for Halal Meat and Poultry Production;
iii. Akta Makanan 1983 (Akta 281), Peraturan-Peraturan Makanan 1985 dan
Peraturan-Peraturan Kebersihan Makanan 2009;
iv. Animal Rules 1962, Akta Binatang 1953(semakan 2006), Akta Rumah
Penyembelihan (Penswastaan) 1993 atau Ordinance Sabah Slaughterhouse
Rules 2004 atau Veterinary Public Health Ordinance,1999(Sarawak);
v. Akta Kerajaan Tempatan 1976 (Akta 171);
80
vi. Undang-Undang Kecil Pihak Berkuasa Tempatan (PBT); (mengandungi Garis

Panduan Pusat Penyembelihan Ayam, Itik dan lain-lain Unggas di kawasan
Pihak Berkuasa Tempatan).
vii. Keputusan Jawatankuasa Fatwa Majlis Kebangsaan bagi Hal Ehwal Agama
Islam atau Fatwa yang diwartakan oleh negeri; dan lain-lain peraturan dan garis
panduan lain yang berkaitan.
Banyak undang-undang dan peraturan yang terlibat dalam pengurusan industri halal di
Malaysia kerana ia melibatkan banyak agensi kerajaan dan setiap agensi mempunyai syarat
atau peraturan sendiri bagi memastikan keberkesanan dan kejayaan dalam industri terbabit.
Sebagai contoh, kewujudan undang-undang dan Garis Panduan Pusat Penyembelihan Ayam,
Itik dan lain-lain Unggas di kawasan Pihak Berkuasa Tempatan merupakan satu kaedah
kawalselia kerajaan melalui Kementerian Kesejahteraan Bandar, Perumahan dan Kerajaan
Tempatan untuk memastikan aktiviti sembelihan ayam, itik dan lain-lain unggas dilakukan di
tempat atau premis yang dibenarkan sahaja. Ini termasuklah pusat sembelihan yang dimiliki
oleh PBT atau persendirian yang dilesenkan oleh PBT.
Garis Panduan ini bertujuan membendung sebarang wabak dan jangkitan kesan dari
aktiviti sembelihan dan sisa buangan pepejal seperti bulu, lemak, kepala termasuk bangkai dan
lain-lain keluaran pepejal unggasyang tidak terkawal di samping memastikan aspek halal
dipatuhi oleh pengusaha. Bagi tujuan kebersihan dan pematuhan piawaian berkenaan alam
sekitar, setiap pusat perlulah terlebih dahulu mendapat ulasan kesesuaian tapak dari Jabatan
Alam Sekitar dan Pejabat Kesihatan Daerah. Garis Panduan turut menetapkan lokasi sesuai
bagi pembinaan pusat sembelihan mestilah di mana ia perlulah di zon industri dengan
penetapan bahawa aktiviti penyembelihan yang kurang dari 500 ekor sehari dikategorikan
sebagai pusat yang berskala kecil, 501- 5000 ekor adalah sederhana manakala lebih dari 5000
ekor sehari adalah besar. Ia juga hendaklah sekurang-kurangnya 100 meter radius dari muka
sauk loji rawatan air dan punca pencemaran seperti tapak pelupusan sampah. Untuk tujuan
pemantauan halal oleh JAKIM, pusat sembelihan perlu mendapatkan lesen untuk aktiviti
penyembelihan terlebih dahulu di samping memperolehi sijil halal untuk bekalan kepada orang
Islam dan mendapatkan Sijil Sembelihan dari Jabatan Agama Islam Negeri.
3. PERMASALAHAN BERKAITAN RUMAH SEMBELIHAN AYAM DI MALAYSIA
Kegagalan operator atau rumah sembelihan mematuhi undang-undang yang dinyatakan

di atas boleh menyebabkan pemilik rumah sembelihan didenda, diarahkan tutup atau lesen
perniagaan digantung mahupun dibatalkan.(Noor Hidayah, 2016) Selain itu, sekiranya
sesebuah operator atau rumah sembelihan yang beroperasi secara sah sekalipun, masalah
akan berlaku sekiranya pihak industri tersebut gagal memastikan peraturan yang telah
ditetapkan dipatuhi secara berterusan. Dalam hal ini, pemantauan berkala dan berterusan
daripada pihak berwajib adalah perlu. Adalah menjadi kesukaran sekiranya masalah seperti bau
busuk dan kebersihan rumah sembelihan ayam untuk dihapuskan dalam masa yang singkat
dan mudah memandangkan apabila sesebuah syarikat atau rumah sembelihan itu telah
81
dibenarkan beroperasi ia melibatkan kelulusan daripada pelbagai agensi antaranya seperti

pihak berkuasa tempatan (PBT), Jabatan Alam Sekitar (JAS), bomba, Jabatan Keselamatan
dan Kesihatan Pekerjaan (JKKP) dan Jabatan Kesihatan.(Opat Rattanachot, 2014).
Selain daripada kompaun atau denda yang dikeluarkan JAS, pertemuan dan
perbincangan yang diadakan antara pihak-pihak terlibat akan memakan masa yang agak lama
untuk sebarang tindakan diambil memandangkan pelbagai aspek perlu diteliti, diperbaiki dan
dipatuhi sebelum arahan penutupan dibuat. Syarikat atau rumah sembelihan terlebih dahulu
perlu diberikan notis dan tempoh untuk mematuhi arahan notis tersebut. Sekiranya pelbagai
tindakan telah dikenakan oleh pihak berwajib namun mereka masih ingkar, barulah arahan
penutupan akan dikeluarkan memandangkan penutupan akan memberi kesan kepada para
pekerja dan ekonomi kerajaan negeri. Apabila arahan penutupan dikeluarkan, rumah
sembelihan tersebut tidak dibenarkan beroperasi dan kes mereka akan dibawa ke mahkamah
untuk tindakan. Oleh itu, amatlah penting sebelum sesebuah syarikat atau rumah sembelihan
itu dibenarkan beroperasi aspek lokasi dan pematuhan undang-undang berkenaan diberi
penekanan dan penelitian. (Mohd. Hussairy, 2014).
Seterusnya, menurut laporan oleh kedahnews.com pada 29 Jun 2016, isu penggunaan
logo halal palsu dan penggunaan plastik pembungkus yang memaparkan logo halal tamat
tempoh oleh operator rumah sembelihan ayam atau tiada pengesahan halal secara sah
bertujuan menarik pelanggan merupakan penemuan-penemuan JAKIM ketika operasi
pemantauan dijalankan. Cabaran yang dihadapi pihak penguatkuasa JAKIM adalah
penguatkuasaan undang-undang hanya boleh dijalankan ke atas syarikat yang menggunakan
logo halal JAKIM tanpa kebenaran. Sebaliknya, jika logo halal itu tidak menggunakan nama
JAKIM, tindakan boleh dilakukan oleh Kementerian Perdagangan dalam Negeri, Koperasi dan
Kepenggunaan (KPDNKK) di bawah Akta Perihal Dagangan 2011 dan perundangan-
perundangan subsidiarinya seperti Perintah Perihal Dagangan (Takrif Halal) 2011, Perintah
Perihal Dagangan (Perakuan Dan Penandaan Halal) 2011.
Akta Perihal Dagangan 2011 (APD 2011) bertujuan untuk menggalakkan amalan
perdagangan yang baik dengan melarang perihal dagangan palsu dan pernyataan,
pengendalian dan amalan palsu atau mengelirukan berhubungan dengan pembekalan barang-
barang dan perkhidmatan serta untuk mengadakan peruntukan bagi perkara-perkara yang
berkaitan atau bersampingan dengannya. Ini termasuklah penggunaan logo halal palsu.
Namun, peruntukan undang-undang sedia ada berkaitan bidangkuasa JAKIM sebagai badan
pemantau dan penguatkuasa, hanya membenarkan JAKIM menarik balik pensijilan halal
tersebut tanpa ada bidang kuasa untuk mendakwa di mahkamah. Sebarang pendakwaan akan
dijalankan oleh KPDNKK sedangkan kebanyakan pemantauan dan penguatkuasaan
dilaksanakan oleh JAKIM.(Marliana, 2015) Antara dilema dan cabaran besar yang dihadapi
adalah berkenaan fungsi JAKIM memandangkan ia hanya terbatas untuk mengesahkan
kesalahan dalam isu halal di samping menjadi saksi bagi kes-kes seumpama. Manakala
KPDNKK mempunyai kuasa menyita, mengkompaun dan mendakwa pemilik mana-mana
syarikat sekiranya terbukti kesalahan yang dilakukan.
82
4. ISU INTEGRITI AGENSI PENGUATKUASA
Walaupun agensi penguatkuasa menghadapi beberapa cabaran dalam

menguatkuasakan undang-undang seperti perbincangan di atas, hakikatnya, pihak industri juga
turut menghadapi kesulitan yang melibatkan integriti agensi penguatkuasa. Melalui temubual
bersemuka dengan seorang Pengarah Syarikat yang membekalkan ayam sembelihan halal,
beliau menyatakan adalah menjadi satu kesukaran kepada pihak industri dalam mematuhi
undang-undang yang berkaitan rumah sembelihan sekiranya pihak penguatkuasa tidak
konsisten dalam menguatkuasakan peruntukan undang-undang yang ada terutamanya apabila
ia melibatkan interpretasi dan budi bicara. Pemantauan dan penguatkuasaan berkala yang
dilakukan oleh pihak penguatkuasa dengan pegawai yang berbeza adakalanya menyebabkan
kesukaran dari aspek pematuhan undang-undang apabila wujud pandangan atau arahan
berbeza dari seorang pegawai dengan pegawai yang lain mengenai sesuatu aspek yang sama
pada masa yang berbeza.
Akibatnya, pihak industri dilihat sebagai gagal memenuhi peruntukan undang-undang

dan terpaksa melakukan penambahbaikan dan pengubahsuaian seperti yang dikehendaki dari
semasa ke semasa. Sebagai contoh, pemantauan pegawai JAKIM terhadap tempoh sedar
semula ayam setelah melalui proses stunning sebelum disembelih. Stunning ialah tindakan
yang membuatkan haiwan pengsan atau tidak sedar sebelum disembelih dengan menggunakan
beberapa kaedah seperti direct blow to a skull using a club, electrical stunning, free bullet fired
from a pistol into the skull dan carbon dioxide stunning.(Mahabub Alam, 2018) Terdapat
perbezaan tafsiran mengenai tempoh tersebut membuatkan keputusan atau arahan yang
berbeza dikeluarkan oleh mereka. Pihak penguatkuasa yang menjadikan alasan bahawa
sesuatu tindakan atau arahan dibuat adalah berdasarkan undang-undang semata-mata tanpa
memperhalusi apakah undang-undang tersebut juga menimbulkan kekeliruan dan menjadikan
pihak pusat penyembelihan berada dalam ―grey zone‖ berkenaan sesuatu aspek.
Dalam hal ini, isu integriti pegawai-pegawai berkaitan dalam menjalankan tugas dan
menginterpretasikan undang-undang boleh dipersoalkan. Oleh itu, adalah amat penting
wujudnya konsistensi dalam menginterpretasi dan penguatkuasaan sesuatu undang-undang
berkaitan halal bagi rumah sembelihan ini. Melalui temubual yang dijalankan, seorang Pengurus
Kilang yang membekalkan ayam halal menyatakan bahawa krisis dalaman sesuatu organisasi
juga turut memberi kesan kepada pihak industri. Sebagai contoh, masalah perlantikan baru
jawatan tertinggi dalam agensi penguatkuasa mengakibatkan pihak industri terpaksa menunggu
untuk satu tempoh yang lama untuk sesuatu urusan tertunggak diselesaikan dan mereka
dikehendaki mengemukan semula dokumen-dokumen di samping beberapa dokumen baru
sebelum ia dapat diselesaikan. Selain itu, isu kelewatan pemprosesan lesen untuk rumah
sembelihan juga merupakan isu integriti pihak penguatkuasa. Memandangkan sebelum lesen
boleh dikeluarkan, pelbagai peraturan dari jabatan teknikal perlu dipatuhi dan dokumen
sokongan perlu dilampirkan oleh pemohon seperti peraturan dari Jabatan Bomba dan
Penyelamat, Jabatan Alam Sekitar, Jabatan Kesihatan dan Keselamatan Pekerja, Jabatan
Agama Islam Negeri dan PBT. Hasil temubual mendapati ketiadaan sistem yang
mengkoordinasi antara satu sama lain menimbulkan kesulitan kepada pemohon dalam
mematuhi setiap kehendak agensi berkaitan selain kelemahan sistem pemprosesan
83
permohonan di Majlis Pembandaran itu sendiri menyebabkan permohonan lesen adakalanya

memakan masa yang panjang.
5. PENUTUP
Hakikatnya, dalam menjalankan tugas memantau dan menguatkuasa undang-undang,

adakalanya pegawai-pegawai terlibat berhadapan dengan cabaran habuan yang diberikan yang
berbentuk apa-apa faedah atau material. Habuan ini diberi sama ada setelah diminta sendiri
oleh mereka yang terlibat dengan penguatkuasaan atau tanpa diminta. Ini adalah bagi
memastikan proses pemantauan dan penguatkuasaan berlansung tanpa sebarang masalah
atau kesalahan kepada pihak industri. Memandangkan industri yang terlibat adalah industri
makanan yang memerlukan produktiviti berterusan, gangguan kepada urusan penyembelihan
ayam akan menjejaskan kuantiti pengeluaran ayam dan seterusnya menyebabkan kerugian
kepada industri. Dalam hal sedemikian, agensi penguatkuasa perlu terus komited dan tidak
tunduk terhadap sebarang tekanan daripada pihak industri atau tidak mengambil kesempatan
ke atas pihak industri bagi mengekalkan kredibiliti dan integriti agensi penguatkuasa. Di
samping pihak agensi penguatkuasa amatlah dituntut untuk meningkatkan sistem perkhidmatan
dan sistem sokongan yang lebih baik kepada para pelanggan seperti kecekapan sistem
pengfailan, pemprosesan permohonan, koordinasi antara agensi, pengetahuan dan kemahiran
dalam tugasan mereka. Para pegawai dan kakitangan agensi penguatkuasa juga perlu sentiasa
mengamalkan sifat amanah dan telus dalam menguatkuasakan undang-undang serta menjauhi
rasuah atau habuan dalam apa jua bentuk sekalipun.
RUJUKAN
http://prpm.dbp.gov.my, akses pada 18 April 2018.
http://fsq.moh.gov.my/v5/ms/skim-pensijilan-hazard-analysis-and-critical-control-point-haccp-
online/,akses pada 20 April 2018.
http://www.moa.gov.my/web/guest/gmp, akses pada 20 April 2018.
http://www.kedahnews.com/2016/06/2-pusat-sembelih-ayam-di-sg-petani.html, 2 Pusat
Sembelih Ayam Di Sg Petani Gagal Patuhi Standard Halal, Rabu, 29 Jun 2016, akses
pada 23 Ogos 2016.
http://www.kpdnkk.gov.my/index.php/my/2014-09-30-03-01-11/penguatkuasaan-halal, akses
pada 23 Ogos 2016.
Mahabub Alam, Methods of slaughtering, processing & postmortem changes and ageing of
meat, akses pada 20 April 2018 di http://www.slideshare.net/mahabubcvasu/methods-of-
slaughtering-processing-postmortem-changes-of-meat
84
Marliana binti Abdullah, et al, Isu Dan Cabaran Pensijilan Halal: Satu Kajian Perbandingan
Antara Malaysia Dan Thailand, World Academic and Research Congress 2015 (World-
AR 2015), Ar-Rahim Hall, YARSI University, Jakarta, Indonesia, 9th – 10th December
2015.
Megat Ayop & Abd. Halim, 2016, Kepentingan budaya integriti dan etika kerja dalam organisasi
di Malaysia: Suatu tinjauan umum, akses pada 20 April 2018 di
http://www.ukm.my/geografia/images/upload/13x.geografia-jul16-Megat-
edam%20(1).pdf.
Mohd. Hussairy Sidek, Bantah bina pusat sembelih ayam: Hasrat penduduk mahu miliki rumah
mampu milik tidak kesampaian, 24 Disember 2015,
http://www.utusan.com.my/berita/wilayah/selangor/bantah-bina-pusat-sembelih-ayam-
1.172114.
Noor Hidayah Tanzizi, Sijil halal premis penyembelihan ayam di Lumut digantung,
http://www.bharian.com.my/node/119077, Khamis, 28 Januari 2016. Lihat juga MUIP
Kesan Banyak Pusat Sembelih Tidak Tepati Syarat,
http://www.malaysiandigest.com/bahasa-malaysia/588584-muip-kesan-banyak-pusat-
sembelih-tidak-tepati-syarat.html, Khamis, 07 Januari 2016
Opat Rattanachot, Tertekan bau busuk pusat sembelih ayam, 02 Disember 2014,
http://www.utusan.com.my/berita/wilayah/kedah/tertekan-bau-busuk-pusat-sembelih-
ayam-1.31473
Temubual bersemuka dengan Encik Vincent Leong, Pengarah, Jimat Jaya Sdn. Bhd. Sg. Petani
(JJSBSP) pada 20 Jun 2016, 11 pagi.
Temubual melalui telefon dengan Encik Azizul Mat Rashib, Pengurus Kilang, Jimat Jaya Sdn.
Bhd. Sg. Petani (JJSBSP) pada 22 Jun 2016.
-GP13-
Implementation of Mandatory Reporting by Neighbour on Child Abuse
RoosNiza Mohd Shariff1

1 School of Law, UUM COLGIS, Universiti Utara Malaysia, Kedah.
Email: roosniza@uum.edu.my
Abstract
Mandatory reporting law has been proposed and imposed as a way of monitoring and curbing
cases of child abuse on grounds that these cases might remain hidden, thus the victims suffer
continuously and the perpetrators were not ceased from abusing. The objective of this paper is
to discuss whether being the closest party to child abuse incident obligating neighbour to report
such incident. The paper aims for the best medium of informed decisions in ensuring the safety
of children whilst protecting neighbour who is stomped under a legal duty to report. Methodology
used is librarian legal search with review on binding precedent decisions and discussions on
85
reported cases. The provisions in the Malaysian Child Act 2001 relating to the child welfare are
discussed in concluding whether the „neighbour principle rule‟ enunciated at law was widely
accepted in regards of mandatory reporting. It is concluded that it is prudent that reporting
practices is acknowledged in considering legal and policy frameworks that are best suited to
identify and respond to cases. Nonetheless, the rise of legal duty of care on neighbour ought to
be studied in all aspects before adjudicating reporting child abuse as mandatory on neighbour.
Key Words:Child Abuse, Mandatory Reporting, Neighbour Principle, Legal Framework.
1. INTRODUCTION
Mandatory reporting law was first created to respond to the problem presented by the fact that
severe child maltreatment is a largely hidden phenomenon taking place in the family sphere,
which even when it comes to the attention of professionals tends to be ignored. Abuse and
neglect is most frequently inflicted on infants who are pre-verbal, and other young children who
cannot resist, represent themselves, resolve the situation or disclose the experience (Mathews,
2012). A comprehensive child welfare system requires the development of a clear continuum of
prevention, early intervention, quick response services and appropriate actions from the
authorities when children experienced abuse and neglect. This is difficult to achieve in a real
world where not everybody is willing to inform abuse cases for fear of intruding in someone
else‘s private life or mainly due to their ignorance of other people‘s plight. One of the medium
suggested to overcome this is the introduction of mandatory reporting law on child abuse. Such
law have not been introduced in Malaysia. It is debatable as to whether the mandatory reporting
law should be imposed onto neighbours, as the closest party to the victim. If mandatory
reporting is imposed on neighbour, it then became a neighbour‘s legal duty of care to report
child abuse thus exposed the neighbour to legal consequences.
2. child abuse
A child may be harmed in any families, schools or neighbourhoods at any time. The World
Health Organization (WHO) defines child abuse as all forms of physical and/or emotional ill-
treatment, sexual abuse or negligent treatment or other exploitation resulting in actual or
potential harm to the child‘s health, survival, development or dignity. The United Nation
Convention on the Rights of the Child 1989 (UNCRC) defines a child as every human being
below the age of 18 years unless under the law applicable under the child majority is attained
earlier (Report, 1999).
The number of child abuse cases in Malaysia has increased significantly despite the
enforcement of the Child Act 2001 (Act 611) and its corollary policies: the National Policy for
Children (NPC) 2009 and the National Child Protection Policy (NCPP) 2009. Child abuse is a
serious ongoing problem in Malaysia without effective solutions (Jamhirah Abdullah, Mizan
Hitam, Wahabuddin Raées, Garoot Suleiman Eissa,& Nabila Huda Ibrahim, 2017).
The actual number of child abuse cases in the country has been unknown as reporting is
uncommon. As a result, the Malaysia authorities are faced with the challenge of tracking child
abuse cases (Noremy, Zulkarnain, Kelvin, Adanan,&Sarah, 2012).
86
3. MANDATORY REPORTING OF CHILD ABUSE

Is neighbour mandated to report child abuse? Should it be made mandatory for neighbour to
notify the authorities? Mandatory reporting is a term used to describe the legislative requirement
imposed on selected classes of people to report suspected cases of child abuse to government
or authorities. Multitudes criterias should be taken into consideration if mandatory reporting by
neighbours is to be enacted. The laws may not be the same towards different types of
occupations and levels of societies. The main differences concern who has to report, and what
types of abuse have to be reported. There are also other differences, such as the state of mind
that activates the reporting duty such as confirmed state about the abused, or only belief so, or
a suspicion on reasonable grounds or merely having a concern. The groups of people
mandated to notify cases of suspected child abuse range from persons in a limited number of
occupations. The occupations most commonly named as mandated reporters are those who
deal frequently with children in the course of their work: teachers, doctors, nurses, police and
psychologists. Notwithstanding Article 19 of the UNCRC which recommends a broad outline for
child abuse identification, reporting, investigation, monitoring, treatment, follow-up and
prevention, many were reluctant to disclose child abuse because of taboos, mistrust of
authorities or insecurity issues.
The Malaysian Child Act 2001 (Act 611) protected children in Malaysia. This 2001 Act which
came into force on August 1, 2002 is a Malaysian law which served to consolidate the Juvenile
Courts Act 1947 [Act 90], the Women and Girls Protection Act 1973 [Act 106], and the Child
Protection Act 1991 [Act 468]. It was enacted partially in order to fulfil Malaysia's obligations
under the United Nations Convention on the Rights of the Child (UNCRC) 1989. The provisions
in the Malaysian Child Act 2001 are to promote the right of a child and the welfare of the child
abuse victim. It does not cover the legal duty of care on neighbour to report child abuse nor
does it protects the reporters of such cases. Although reporting child abuse is mainly for the
benefit of children, nothing in the Act provides protection for the whistle blower. Mandatory
reporting imposed on neighbour unwittingly opens grounds for other legal boundaries such as
protection from legal liabilities, legal immunities, categories of reporting, social boundaries,
ethical boundaries and personal law.
4. LEGAL DUTY OF CARE AND THE NEIGHBOUR PRINCIPLE

Legal duty of care can be defined as an obligation, recognised by law, to avoid conduct with
unreasonable risk of danger to others. For instance, the law imposes a legal duty on teachers
and schools to take care of the safety and wellbeing of students in their care. This duty of care
arises where a recognised teacher-student relationship exists. It means that every teacher and
school authority owes a duty of care to take reasonable care to ensure that their acts or
omissions do not cause reasonably foreseeable injury to their students. However, there is no
clear-cut rule to establish when a duty of care is owed between individuals. This includes
neighbour, the closest party to an abused incident at home.
Legal duty of care is a matter of law and can be denied on public policy grounds (such as unfair
or unjust that duty of care should exist in certain circumstances). Unlike teachers and schools,
87
where duty of care arises where a recognised teacher-student relationship exists, a neighbour‘s
duty of care to another neighbour does not exist merely due to a recognised neighbour-to-
neighbour relationship. Establishing when a duty of care is owed between individuals is based
on preceding judgment of Donoghue v Stevenson case, where the court ruled two important
factors giving rise to a duty of care. The first is reasonable foreseeability and the second, the
element of proximity. If the wrongdoer knows, or should have known, that their acts or
omissions may cause injury or impairment of legal rights of another person who is not in a
position to protect their own interests, there is a relationship of proximity giving rise to a duty of
care. In law, a neighbour‘s duty of care only means that a neighbour has an obligation to ensure
that their acts or omissions do not cause reasonably foreseeable injury to their neighbour. In
simple words, a neighbour does not owe legal duty of care to another neighbour in terms of
reporting child abuse.
Even during school hours, the court was of the view that while the school had a duty to guard
against behaviour that presented serious risk to physical safety of students, this duty could not
be extended to protection from normal student behaviour. Thus in the case of Australian Capital
Territory Schools Authority v El Sheik, the schools authority was not held liable for serious
injuries sustained by a 15-year-old student in a play fight, as the teacher provided a standard of
care of an ordinary reasonable teacher. The same rule applied in Trustees of the Roman
Catholic Church for the Diocese of Canberra and Goulburn v Hadba, when a student who was
injured at the hands of another pupil while playing on a flying fox during recess hours in school
was not allowed to recover damages for her injury because she failed to establish that constant
supervision would have prevented the injury to her. The court held that the teacher acted
reasonably and any system to be inculcated in view of duty of care must not retard the
development of responsibility in children.
If a legal duty of care is grounded on neighbour to report child abuse, will neighbour be liable in
negligence for failing to report? As to date, Malaysia does not make it a mandatory reporting
due to the crossing of ethical and legal expositions. Nevertheless, inculcating certain elements
of legal responsibility onto neighbour towards curbing the abuses and helping the victims
stresses the importance of inculcating legal duty of care on neighbour. Decided in Caparo
Industries plc v Dickman, the neighbour principle was effectively absorbed into a wider tripartite
test based on foreseeability, proximity and considerations of fairness and justice. Thus
subsequent decisions in McFarlane v Tayside Health Board, JD v East Berkshire Community
NHS Trust and others and Vowles v Evans and Welsh Rugby Union Ltd, have confirmed that it
is necessary to determine the question of duty of care not only by reference to the neighbour
principle but also by considering the nature of the relationship between the parties and whether
in all the circumstances it is fair, just and reasonable to impose a duty of care.
5. LEGAL PROTECTION TO NEIGHBOUR WHO REPORTS

It is coherent to imprint that legal duty of care need to be inculcated to create awareness and
sense of responsibility within the standard of reasonableness but not to put burden on
neighbour. As to date, no legal protections are provided to neighbour who reports. In order to
88
impose legal duty of care to report child abuse case, protections should be inculcated as well to
neighbour who reports. As stressed by the Child Family Community Australia (2016), legislation
should protect the reporter's identity from disclosure. In addition, the legislation provides that the
reporter should not be liable in any civil, criminal or administrative proceeding if the report is
made in good faith. Whether it is mandatory or voluntary, reporters should receive the legal
protections regarding confidentiality and immunity from legal liability.
6. conclusion
On issues of reporting, many would agreed that we need to report and adjudicate reporting child
abuse as paramount agenda. Nonetheless, it is equally important for the neighbours to be made
aware of the appropriate extent of their responsibility. A well-intended bona fide neighbour might
be accused of encroaching another neighbour‘s territory when investigating (before reporting) a
child abuse case. Confronting child abuse situation can be quite daunting tasks. Hence,
mandated reporters make a substantial contribution to child protection and family welfare. The
intricate principle of legal duty of care and mandatory reporting issues should be settled.
Balancing between care and protection on children and the rights of neighbours, it is necessary
to determine the nature of the relationship between the parties and whether in all the
circumstances it is fair, just and reasonable to impose mandatory reporting law on neighbour.
Law and society need to work together in identifying, monitoring and addressing child abuse
incident to uplift common barriers in the matter.
REFERENCES
Australian Capital Territory Schools Authority v El Sheik [2000] FCA 931
Caparo Industries plc v Dickman [1990] 2 AC 605
Child Act 2001 (Act 611). ILBS: Kuala Lumpur
Child Protection Act 1991 [Act 468]. ILBS: Kuala Lumpur
Child Family Community Australia. (2016). Mandatory reporting of child abuse and
neglect.https://aifs.gov.au/cfca/publications/mandatory-reporting-child-abuse-and-
neglect. Retrieved 12 January 2018.
Donoghue v Stevenson (1932) AC 562
Jamhirah Abdullah, Mizan Hitam, Wahabuddin Raées, Garoot Suleiman Eissa & Nabila Huda
Ibrahim. (2017). Underreporting of Child Abuse Cases in Malaysia: Society‘s Role in
Prevention of Child Abuse. World Applied Sciences Journal. 35 (11): 2507-2512, IDOSI
Publications.
JD v East Berkshire Community Health NHS Trust and others: HL 21 Apr 2005, [2003] EWCA
Civ 1151
89
Juvenile Courts Act 1947 [Act 90]. ILBS: Kuala Lumpur
MacFarlane and Another v Tayside Health Board [2000] 2 AC 59
Mathews, B. (2012). Exploring the contested role of mandatory reporting laws in the
identification of severe child abuse and neglect. Current Legal Issues: Law and
Childhood Studies. Oxford: Oxford University Press, Vol 14. 302–38.
National Child Protection Policy (NCPP) 2009.
National Policy for Children (NPC) 2009
Noremy, M.A., A.H. Zulkarnain, F. Kelvin, M.J. Adanan and W.M.H. Sarah. (2012). Physical
Child Abuse: What Are the External Factors? Asian Social Science. 8(9): 83-93.
Report. (1999). World Health Organization Definition of Child Abuse. Taken from the Report on
the Consultation on Child Abuse Prevention. Geneva, March 29-31, 1999. World Health
Organization, Social Change and Mental Health, Violence and Injury Prevention.
Trustees of the Roman Catholic Church for the Diocese of Canberra and Goulburn v Hadba
[2005] HCA 31 (15 June 2005)
United Nation Convention on the Rights of the Child. (UNCRC) (1989).
Vowles v Evans & the Welsh Rugby Union Limited EWCA Civ 318, [2003]
WHO stands for the World Health Organization which is a specialised agency of the United
Nations that is concerned with international public health. It was established on 7 April
1948, headquartered in Geneva, Switzerland. Chronicle of the World Health
Organization. 1 (1–2): 6–11. 1947. Archived from the original (PDF) on 9 August 2007.
Women and Girls Protection Act 1973 [Act 106]. ILBS: Kuala Lumpur
-GP14-
Halatuju Hubungan Diplomatik Malaysia-Indonesia Dalam Konteks Pengurusan
Pekerja Asing
Farah Nuraishah Ab Malek Zaki1, Mohd Na’eim Ajis2 dan Mohd Fitri Abdul Rahman3
1 Pusat Pengajian Kerajaan, Universiti Utara Malaysia, Kedah.
Emel:farah_nuraishah@gsgsg.uum.edu.my
Emel: naeim@uum.edu.my
Emel: mohdfitri@uum.edu.my
Abstrak
Hubungan Diplomatik antara Malaysia dan Indonesia telah berlangsung sejak Malaysia
meraih kemerdekaan pada tahun 1957. Namun hubungan kerjasama kedua-dua negara
berkaitan pekerja asing telah berlaku sejak tahun 1980-an selepas Malaysia melaksanakan
90
Dasar Ekonomi Baru. Kertas ini akan memberikan gambaran tentang hubungan diplomatik
kedua-dua negara berkaitan hal ehwal pengurusan pekerja asing ini dimana telah dimulai
dengan Perjanjian Medan 1984 dan diikuti oleh beberapa MOU sebagai panduan dan salah
satu usaha diplomasi antara kedua-dua negara dalam pengurusan pekerja asing. Kertas ini
juga akan memberikan gambaran mengenai latarbelakang migrasi pekerja asing di Malaysia
dan usaha-usaha dalam menguruskan isu berkaitan tenaga kerja Indonesia di Malaysia. Selain
itu, kertas ini menjangkakan bahawa Indonesia akan terus menjadi populasi terbesar dalam
penghantaran tenaga kerja ke Malaysia melalui beberapa faktor seperti statistik populasi
semasa, faktor geografi dan keserumpunan, faktor rehiring program di Malaysia, pelan nasional
Indonesia serta faktor sokongan rangkaian sosial.
Kata Kunci:Diplomasi, Migrasi, Pengurusan Pekerja Asing, Tenaga Kerja Indonesia.
1.0 Pengenalan
Hubungan diplomatik yang tersusun antara sesebuah negara dengan negara lain akan
menghasilkan hubungan kerjasama yang baik dari segi hubungan sosial, budaya, agama,
ekonomi, serta politik (Salmah Jan, Hashim dan Rozita, 2014). Kedua-dua negara yang
berkongsi sempadan haruslah menjaga tingkah laku serta mengamalkan penyelesaian secara
rasional kerana pertikaian yang melibatkan kawasan sempadan cenderung untuk memberi
impak besar dari segi diplomasi dan keselamatan negara masing-masing (Ruhanas, 2009).
Kertas ini lebih menumpukan perbahasan di antara hubungan diplomatik Malaysia dan
Indonesia khasnya dalam konteks pengurusan pekerja asing.
Hubungan Malaysia dan Indonesia telah mengalami pelbagai konflik yang dikategorikan
sebagai high politic dan low politic. High politic adalah pertikaian seperti Konfrontasi dan
perebutan wilayah. Malaysia dan Indonesia pernah menghadapi masalah perebutan wilayah
iaitu Ambalat. Konflik low politics pula adalah terdiri dari konflik berkaitan dengan tenaga kerja
Indonesia (TKI), penyeludupan dan tuntutan hak budaya (Tonny, 2013). Isu mengenai TKI
adalah satu isu yang sering diperkatakan kerana melibatkan banyak aspek. Rakyat Indonesia
memerlukan pekerjaan manakala Malaysia pula memerlukan tenaga kerja. Kebergantungan ini
menyebabkan TKI semakin ramai membanjiri tanah Malaysia. Ia bermula pada tahun 1970-an
apabila Dasar Ekonomi Baru dilancarkan. Kekurangan tenaga buruh menyebabkan Malaysia
terpaksa membuka peluang kepada tenaga kerja asing yang mana majoriti pekerja asing
tersebut adalah rakyat dari Indonesia (Lin, 2006; Robertson Jr, 2008). Secara tidak langsung
kehadiran TKI menyelesaikan masalah kekurangan tenaga kerja di Malaysia manakala
Malaysia membantu menyumbang dalam ekonomi domestik Indonesia dari segi penghantaran
wang (International Labour Organization, 2015).
1.1. Latarbelakang Migrasi Tenaga Kerja Indonesia ke Malaysia

Pada tahun 2013, Malaysia merupakan salah sebuah destinasi tumpuan bagi migrasi
terutamanya dalam konteks pekerjaan. Malaysia tersenarai sebagai negara sepuluh teratas
dalam Rantau Asia Pasifik yang menerima kedatangan migran antarabangsa dan negara kedua
tertinggi di dalam Rantau Asia Tenggara (Pertubuhan Bangsa-Bangsa Bersatu, 2013). Faktor
kedatangan migran antarabangsa tersebut adalah disebabkan oleh kedudukan geografi,
kestabilan politik serta ekonomi Malaysia yang pesat membangun (Mohd Na‘eim, 2015).
Sebahagian besar migran antarabangsa yang bermigrasi ke Malaysia adalah merupakan
tenaga kerja. Kemasukan tenaga kerja asing ke Malaysia dilihat pesat sekitar tahun 1980-1990
ekoran Dasar Ekonomi Baru yang diperkenalkan pada tahun 1970 (Zainal, 1978). Dalam
91
keseluruhan 15 negara yang mengeluarkan tenaga buruh dalam pelbagai sektor di Malaysia,
Indonesia merupakan pengeluar terbesar penghantaran tenaga buruh tersebut (Devadason &
Meng, 2014; Maryam, 2015). Sehingga Jun 2017, Malaysia telah menerima pekerja asing
seramai 1, 781, 598 orang di mana majoriti daripada itu adalah daripada pekerja Indonesia
(782, 870 pekerja) diikuti oleh pekerja dari Nepal (405, 898), Bangladesh (221, 089), Myanmar
(127, 705), India (114, 455), Pakistan (59, 281), Filipina (56, 153), Vietnam (29, 039), China (15,
399), Thailand (12, 603), Sri Lanka (5, 964), Kemboja (5, 103) dan Laos (39) (Aina, 2017).
Menurut Asgar, (2012), kemasukan tenaga kerja Indonesia ke Malaysia bukanlah satu
perkara baru kerana ianya telah bermula pada abad ke-19 sejak zaman Hindia Belanda lagi
iaitu sekitar tahun 1887 secara tradisional untuk bekerja sebagai buruh. Walaubagaimanapun,
penghijrahan pertama orang Indonesia ke Tanah Melayu sebelum era penjajahan adalah sukar
untuk diketahui dan ditentukan kerana tiada rekod-rekod butiran penghijrahan mereka
sehinggalah era penjajahan berlaku (Kunaseelan, 1996). Ketika itu, masyarakat Jawa adalah
merupakan migran ketiga terbesar yang dibawa masuk ke Malaysia selepas India dan Cina
sebagai tenaga kerja sementara dan juga penduduk tetap (Syed, 2014). Pergerakan
kemasukan tenaga kerja Jawa ini kemudiannya meningkat sekitar tahun 1930. Pada tahun
1947, masyarakat Indonesia mencatatkan 307, 150 jumlah orang di Tanah Melayu dan
meningkat kepada 2, 427, 834 pada tahun 1957. Walaubagaimanapun, jumlah tersebut
mengalami pasang surut ekoran daripada kesan perang dunia serta konfrontasi antara
Indonesia dan Malaysia (Asgar, 2012; Syed, 2014; Maryam, 2015). Namun, sekitar tahun 1970-
an jumlah migrasi tenaga kerja asing Indonesia di Malaysia kembali meningkat disebabkan
permodenan yang berlaku dengan pelaksaan DEB yang memerlukan sejumlah besar pekerja
asing untuk mengisi kekosongan pekerjaan dalam beberapa sektor (Liow, 2004; Maryam,
2015). Pada sekitar tahun 1980 jumlah pekerja asing Indonesia telah mencecah purata
sebanyak 50,000 orang. Sekitar tahun 1990 pengambilan pekerja asing Indonesia masih
berlaku untuk mengisi kekosongan dalam sektor pembinaan, perladangan serta sektor domestik
disebabkan oleh masalah kekurangan buruh (Liow, 2004).
Pekerja asing Indonesia yang memasuki Malaysia terbahagi kepada dua keadaan iaitu
secara berdokumen dan tidak berdokumen. Walaubagaimanapun jumlah pekerja asing secara
tidak berdokumen adalah melebihi kemasukan secara berdokumen. Akan tetapi jumlah pekerja
asing secara tidak berdokumen tersebut tidak dapat dipastikan (Siti Melinda, Nurul Nadia,
Shaharuddin, Mazlan dan Mohammad Nor, 2015). Kemasukan pekerja migran secara beramai-
ramai khususnya pekerja dari Indonesia telah mewujudkan beberapa sentimen negatif di antara
kedua-dua negara terutama berkaitan isu pendatang asing tanpa izin (PATI) (Azizah, 2012). Hal
ini berikutan dengan kurangnya pemahaman mengenai keadaan sebenar yang berlaku telah
menyebabkan rakyat Malaysia merasa terancam dengan kebanjiran tenaga kerja asing
terutama mereka yang tidak berdokumen iaitu dari segi persaingan ekonomi, masalah sosial
dan ancaman keselamatan (Mohd Na‘eim, 2015). Manakala rakyat di Indonesia beranggapan
rakyatnya yang berada di Malaysia sebagai tenaga kerja adalah menjadi mangsa dari segi
kekerasan, perlindungan, kebajikan dan penggajian.
1.2. Isu dan Masalah Berkaitan Pekerja Asing Indonesia
92
Walaupun terdapat beberapa usaha diplomasi di antara kedua-dua negara, isu pekerja
asing ini tidak berhenti menimbulkan beberapa permasalahan yang menggugat hubungan dua
hala kedua-dua negara. Menurut Elias (2013), isu pekerja asing tidak pernah selesai kerana
ianya adalah isu yang kompleks. Rakyat Indonesia juga menggesa Pemerintah Indonesia
supaya memandang serius dalam menangani isu pekerja asing dari sekecil-kecil isu berkaitan
bayaran gaji sehingga isu hukuman mati rakyatnya di luar negera (Ratih, 2015). Kemarahan
berkaitan pekerja asing ini turut ditonjolkan oleh presiden Indonesia sendiri apabila beliau
menyatakan keinginan untuk menghentikan penghantaran TKI sebagai pembantu rumah atas
sebab menjaga maruah Indonesia (Reevany, Suyatno & Ismail, 2016). Antara isu-isu berkaitan
pekerja asing adalah seperti isu pendatang asing tanpa izin (PATI), isu penderaan, isu
perlidungan dan kebajikan, isu pemberian gaji minimum serta isu ancaman terhadap warga
tempatan (Azizah, 2005; Brettner-Litherland, 2016).
Ruhanas (2009) menyatakan apabila jumlah TKI semakin ramai di Malaysia,

ketegangan bukan hanya dirasai oleh Malaysia namun juga di pihak Indonesia kerana isu-isu
yang terjadi ke atas TKI. Antaranya adalah perlakuan kekerasan oleh majikan Malaysia ke atas
TKI seperti kes penderaan terhadap Nirmala Bonat pada tahun 2004 dan terkini Adelina Lisao
(2018) (Siti Melinda, Nurliyana, Nurul Nadia, Shaharuddin, Mazlan & Mohammad Nor, 2015).
The Indonesian Institute (2010) melaporkan bahawa pada tahun 2005, sebanyak 39 kes telah
dilaporkan mengenai perlakuan kekerasan terhadap TKI dan meningkat kepada 45 kes pada
tahun berikutnya. Warga Indonesia juga menunjukkan kekesalan terhadap layanan yang
diberikan oleh warga Malaysia terhadap TKI. Kemudian ia ditambah lagi dengan laporan oleh
Duta Besar Indonesia yang mengeluarkan laporan mengenai 354 TKI berhadapan dengan
hukuman mati di Malaysia sehingga tahun 2010, namun hukuman majikan yang melakukan
kekerasan terhadap TKI adalah tidak setimpal. Bagi menunjukkan sokongan protes oleh rakyat
Indonesia, pada tahun 2009 kerajaan Indonesia membeku rakyatnya menerima pekerjaan
sebagai pembantu rumah di Malaysia (Elias, 2013) namun pembekuan tersebut ditakrik balik
pada November 2011 setelah satu persepakatan tercapai di antara kerajaan Malaysia dan
Indonesia (Siti Melinda, Nurliyana, Nurul Nadia, Shaharuddin, Mazlan dan Mohammad Nor,
2015).
Terdapat juga beberapa kes rusuhan yang dilakukan oleh TKI di Malaysia iaitu seperti 1)
Pada tahun 2001, sekumpulan pekerja asing Indonesia telah melakukan rusuhan di tempat
perlindungan pendatang asing tanpa izin disebabkan ketidakpuasan hati terhadap tindakan
kerajaan Malaysia menghantar anggaran 2000 pekerja asing tanpa izin dan yang sedang
menunggu proses penempatan pulang ke Indonesia, 2) Pada tahun 2002, seramai 400 orang
pekerja asing Indonesia telah melakukan rusuhan dan mencetuskan pergaduhan dengan
anggota polis kerana menunjukkan bantahan terhadap kes penangkapan 16 orang pekerja
asing Indonesia yang bekerja si kilang tekstil Cyberjaya atas tuduhan pengedaran ubat
terlarang, 3) Pada tahun 2002 juga satu rusuhan juga telah dilakukan oleh 70 orang pekerja
asing Indonesia dengan merosakkan beberapa warung, kedai runcit dan kenderaan (Asgar,
2012). Isu-isu kecil lain yang berkaitan dengan TKI mengeruhkan lagi keadaan. Antaranya
adalah penggelaran warga Indonesia sebagai ‗Indon‘ dilihat sebagai satu penghinaan terhadap
mereka. Pandangan stereotaip sesetengah warga Malaysia terhadap warga Indonesia sebagai
93
pelaku jenayah dan penyumbang kegiatan sosial yang tidak sihat juga mengguris perasaan
warga Indonesia dan menyemarakkan lagi api kemarahan mereka.
1.3. Antara Usaha dan Kerjasama antara Kedua-Dua Negara dalam Membendung Masalah
Berkaitan Pekerja Asing
1.3.1. Perjanjian Medan 1984
Perjanjian Medan adalah sebuah perjanjian yang telah ditandatangani pada tahun 1984
oleh Malaysia dan Indonesia sebagai sebuah inisiatif saluran formal dan undang-undang dalam
proses pengambilan pekerja asing. Melalui perjanjian tersebut, Indonesia seterusnya bersetuju
untuk memberikan bekalan tenaga kerja dalam enam sektor pekerjaan terutama dalam sektor
pertanian dan pembantu rumah (Mohd Na‘eim, Mohamad Nasir, Azman, von Feigenblatt, Md.
Shukri & Mohamad Faisol, 2010; Devadason & Meng, 2014). Selepas Malaysia dan Indonesia
menandatangani Perjanjian Medan ini, ianya diikuti oleh beberapa negara lain lagi seperti
Bangladesh, Filipina, Sri Lanka, Thailand dan Vietnam (Niny Khor & Devashish Mitra, 2013;
Devadason & Meng, 2014). Walaubagaimanapun, objektif Perjanjian Medan dilihat tidak
mencapai matlamat sebenar apabila Malaysia mula dibanjiri oleh pekerja asing tanpa izin
(PATI). Hal tersebut kerana dipengaruhi oleh peningkatan permintaan majikan terhadap buruh
tidak mahir dengan kadar kos yang lebih rendah (Kanapathy, 2006).
1.3.2. MoU antara Malaysia dan Indonesia Berkaitan Pekerja Asing
Memorandum Persefahaman (MoU) berkaitan pekerja asing adalah merupakan satu

perjanjian dua hala atau perjanjian kerjasama antara negara pengantar dan penerima untuk
mengawal dan memantau pengambilan pekerja asing (Handayani, 2014). Tujuan utama MoU
ini adalah untuk mewujudkan rangka kerja sebagai panduan dalam memudahkan pengambilan
dan pemilihan pekerja dari negara-negara sumber (Maryam, 2015). Malaysia telah
menandatangani perjanjian MoU berkaitan pekerja asing dengan beberapa negara sumber
seperti Indonesia, Bangladesh, China, Pakistan, Sri Lanka, Thailand dan Vietnam. Terdapat tiga
elemen asas dalam MoU iaitu tanggungjawab majikan, tanggungjawab kerajaan negara sumber
atau agensi pengambila pekerja asing berlesen negara sumber, serta tanggungjawab pekerja
(Dairiam, 2006).
Pada Mei 2004 Malaysia dan Indonesia telah mengadakan usahasama menandatangani
Memorandum Persefahaman (MoU) bagi menggariskan prosedur yang perlu diikuti oleh warga
Indonesia untuk bekerja di Malaysia (Lin, 2006). Memorandum pada 2004 ini adalah langkah
awal bagi Malaysia dan Indonesia bagi mengurangkan bilangan kemasukan PATI. Walaupun
memorandum ini bertujuan mengekang kemasukan PATI, namun ia dilihat sebagai pelanggaran
hak pekerja asing (Syamsul, 2008) kerana MoU ini tidak mengambil kira hak-hak pekerja
domestik (Go, 2007; Handayani, 2014; Ahmad Agus & Devi, 2016).
94
Disebabkan MoU 2004 dilihat sebagai pelanggaran hak pekerja asing, satu pindaan
telah dibuat melalui MoU 2006. MoU 2006 antara Malaysia dan Indonesia telah ditandatangani
pada 13 May 2006 di Bali Indonesia. MoU 2006 ini adalah untuk memperkuatkan mekanisme
perjanjian dan pengambilan pekerja domestik Indonesia di Malaysia. MoU 2006 ini telah
menggariskan beberapa panduan untuk melayakkan warga Indonesia untuk bekerja di Malaysia
sebagai pekerja domestik kerana MoU 2004 telah mengabaikan kepetingan pekerja domestik.
Antara yang digariskan adalah seseorang pekerja domestik itu haruslah memenuhi prosedur
imigrasi Malaysia dan pekerja domestik perlu mengikut setiap undang-undang, peraturan-
peraturan, polisi-polisi yang telah ditetapkan oleh kerajaan Malaysia. Selain itu, pekerja
domestik haruslah mempunyai kelayakan umur, pengetahuan mengenai budaya, kemampuan
berkomunikasi, dan mempunyai kesihatan dan mental yang baik sebelum dibenarkan menjadi
seorang pekerja domestik di Malaysia (apmigration.ilo.org). Walaubagaimanapun, MoU 2006 ini
dilihat masih belum mencapai kesan yang signifikan dengan keperluan perlindungan TKI di
Malaysia terutama kepada pekerja domestik dimana MOU tersebut mempunyai beberapa
kelemahan seperti tiada syarat standard minimum untuk sesuatu pekerjaan, pekerja tidak boleh
menyertai kesatuan sekerja, pekerja tidak boleh menyimpan passport sendiri dan tidak
mengambil kira hak pekerja domestik (Malahayati, 2015). Pada tahun 2011 pula, satu lagi
pindaan telah dilakukan oleh kedua-dua negara Melalui Protokol Pindan MoU 2011. Protokol
Pindaan tersebut, menyatakan pekerja Indonesia diberikan hak untuk menyimpan passport
sendiri. Selain dari itu, memorandum ini juga membincangkan tentang hak untuk mendapatkan
satu hari cuti, gaji minimum dan cara dibayar gaji hendaklah melalui bank. Kedua-dua negara
telah memberikan respon yang positif dengan pindaan ini (Devi & Ahmad Agus, 2016).
Selain itu, berdasarkan rentetan daripada isu-isu berkaitan TKI ini, beberapa usaha telah
dilakukan oleh kedua-dua pihak namun ianya masih tidak menemui penyelesaian. Usaha-usaha
tersebut adalah seperti kerajaan Indonesia merancang untuk menggunakan panduan
pengurusan pekerja asing melalui UN Convention on Protection on Migrant Workers and their
Families (1990), Convention on Elimination of Discrimination Against Women dan beberapa
konvensyen ILO yang berkaitan pekerja asing namun ianya tidak dipersetujui oleh kerajaan
Malaysia kerana kuatiri dasar tersebut akan memberi kebebasan terhadap TKI. Selain itu, pada
tahun 2002 Tun Ahmad Badawi mengumumkan Akta Imigresen 1154 sebagai satu usaha
pemulangan warganegara Indonesia secara tidak rasmi. Namun usaha tersebut tidak dapat
kerjasama yang padu daripada Indonesia. Tun Mahathir juga pernah melaksanakan dasar ‗Hire
Indonesian Last‘ namun dasar tersebut mendapat protes yang hebat daripada majikan sendiri
atas faktor kebergantungan terhadap TKI dalam sektor-sektor tertentu (Abdul Bari, 2014).
1.4. Jangkaan Tenaga Kerja Indonesia Sebagai Populasi Terbesar di Malaysia Pada Masa
Hadapan
Segala konflik dan masalah berkaitan pekerja asing ini haruslah diselesaikan dengan
rasional dan sebaik mungkin untuk memelihara hubungan yang bergantungan dan bekerjasama
antara kedua-dua nya. Hal ini berikutan Indonesia berkemungkinan besar masih menjadi
negara terbesar dalam penghantaran pekerja asing ke Malaysia berdasarkan beberapa faktor.
95
Antaranya adalah melalui faktor statistik pekerja asing di Malaysia. Dari awal pengambilan
pekerja asing di Malaysia, pekerja dari Indonesia telah menunjukkan jumlah terbesar jika
dibandingkan dengan negara lain walaupun terdapat penurunan dalam beberapa tahun. Pada
tahun 2013, dicatatkan seramai 1,189,235 pekerja Indonesia bekerja di Malaysia iaitu 1,157,735
orang dalam sektor formal dan 215,809 orang dalam sektor tidak formal (Maryam, 2015).
Bidang tenaga kerja di Kedutaan Besar Republik Indonesia (KBRI) Kuala Lumpur juga telah
mengeluarkan data rasmi 2014 iaitu seramai 1, 309, 480 warga Indonesia telah berdaftar
sebagai pekerja asing di Malaysia sehingga Disember 2014 (Mat Jizal, Rahmah & Ishak, 2015).
Terkini, sehingga Jun 2017 mencatatkan jumlah pekerja Indonesia di Malaysia mengalami
peningkatan kepada 1, 781, 598 pekerja (Aina, 2017).
Selain itu, kerajaan Indonesia juga telah melaksanakan beberapa program seperti
Repelita VI (1994-1999) dan PJPT (1994-2018) yang bertujuan untuk menjadikan program
penghantaran pekerja ke negara luar sebagai pelan tenaga kerja nasional. Ianya adalah salah
satu usaha untuk meningkatkan hasil pertukaran asing kerajaan (Hugo, 1995; Silvey, 2006).
Walaupun Indonesia menyasarkan beberapa negara lain seperti Arab Saudi, Singapura dan
Hong Kong sebagai negara tumpuan penghantaran tenaga kerja, namun Malaysia memiliki
kelebihan dari segi geografi serta ciri-ciri keserumpunan yang dipunyai oleh kedua-dua negara.
Program Rehiring juga adalah merupakan salah satu faktor yang menyokong jangkaan
Indonesia sebagai tenaga kerja asing terbesar di Malaysia pada masa akan datang. Program
tersebut adalah sebuah program yang dilaksanakan oleh kerajaan Malaysia pada 15 Februari
2016 untuk memberi peluang kepada PATI di Malaysia untuk mendapatkan permit kerja
berdasarkan syarat-syarat yang dibenarkan. PATI yang layak untuk mengikuti program ini
adalah PATI yang mempunyai majikan sahaja. Program ini adalah berdasarkan permintaan
yang dilakukan oleh majikan untuk mengisi peluang pekerjaan terhadap sektor-sektor tertentu.
Rehiring Program ini adalah sebuah alternatif kerajaan Malaysia bagi tujuan pemantauan dan
memenuhi keperluan senario keselamatan semasa pekerja asing (Jabatan Imigresen Malaysia).
Seterusnya, faktor rangkaian sosial juga adalah merupakan salah satu faktor penting
yang mempengaruhi kepada penghijrahan tenaga kerja Indonesia ke Malaysia yang terdiri
daripada keluarga, rakan, sanak saudara, atau ejen. Faktor rangkaian sosial ini boleh
menyumbang kepada beberapa bentuk seperti pengangkutan, tempat tinggal, pekerjaan serta
dokumentasi bagi memudahkan dan menggalakkan perjalanan tenaga kerja Indonesia untuk
bermigrasi ke Malaysia (Mohd Na‘eim, 2015). Tambahan pula kedatangan warga Indonesia di
Malaysia telah lama terjadi iaitu sejak era penjajahan lagi. Oleh itu, boleh disimpulkan bahawa
rangkaian sosial masyarakat Indonesia di Malaysia adalah agak kukuh dan boleh melancarkan
perjalanan migrasi TKI ke Malaysia dalam bentuk kewangan atau bukan kewangan sama ada
sebelum, semasa dan selepas bermigrasi.
Kemasukan TKI ke Malaysia akan terus berlaku juga adalah disokong melalui faktor
keserumpunan, faktor sejarah dan jarak persempadanan yang berhampiran antara kedua-dua
negara ini. Weiner (1985) menyatakan sesebuah negara itu juga cenderung untuk menerima
imigran dari sesebuah negara atas sebab mempunyai hubungan sejarah tertentu. Selain itu,
sesebuah negara cenderung untuk menawarkan kemasukan terbuka kepada pendatang asing
96
yang memiliki pertalian etnik yang rapat. Sebagai contoh, negara India sedia menerima
masyarakat yang beragama Hindu dari Pakistan dan Bangladesh, Republik China menerima
pelarian dari Vietnam kerana ciri-ciri kesamaan etnik cina dan Israel mengakui Yahudi dari
seluruh dunia di bawah Undang-Undang Pengembalian (Weiner, 1985). Menurut Rohani dan
Zulkifli (2010), hubungan Malaysia dan Indonesia adalah sebuah hubungan tradisi berdasarkan
nilai yang sama dipunyai oleh kedua-dua negara seperti rumpun bangsa, budaya serta agama.
Selain itu, persamaan dalam penggunaan bahasa melayu oleh kedua-dua negara juga memberi
kelebihan migran TKI memilih Malaysia sebagai negara tujuan. Walaupun keadaan pasang
surut dalam hubungan Malaysia dan Indonesia sering sahaja berlaku, namun faktor serumpun
telah menunjukkan peranannya sebagai penyatuan hubungan.
2. KESIMPULAN
Daripada kajian ini maka dapat disimpulkan bahawa hubungan kerjasama antara
Malaysia dan Indonesia berkenaan dengan hal ehwal pekerja asing telah lama terbentuk sejak
termaktubnya Perjanjian Medan 1984 dan diikuti oleh beberapa MOU. Walaupun setiap
perjanjian dan MOU telah diterima baik oleh kedua-dua negara, namun pelaksanaannya
haruslah dipantau untuk mencapai matlamat sebenar. Hal ini kerana isu-isu berkaitan pekerja
asing masih lagi berlaku dan boleh mengundang kepada pasang surut hubungan antara kedua-
dua negara sedangkan pelbagai usaha yang telah dilakukan oleh kerajaan kedua-dua negara
termasuklah usaha diplomasi. Oleh itu, pertikaian dan salah faham mengenai TKI harus
diselesaikan melalui pendekatan diplomasi yang bijak kerana kedua-dua negara adalah saling
bergantungan. Buktinya, pada tahun 2016, TKI masih merupakan kumpulan terbesar di dalam
carta pekerja asing di Malaysia dengan bilangan seramai 1.9 juta orang dan diikuti pada tahun
2017 iaitu seramai 1, 781, 598 TKI merupakan pemegang permit secara sah (The Jakarta Post,
2016). Selain itu, Perdana Menteri ke empat Malaysia Tun Mahathir juga turut menyatakan
tentang kebergantungan sektor pekerjaan di Malaysia terhadap TKI.
―…Sementara kita perlu kepada pekerja daripada Indonesia, kita juga sedar
bahawa ini menyebabkan pengaliran wang Malaysia ke luar negeri. Itu tidak
menyumbang kepada pertumbuhan ekonomi negara. Kita tidak dapat tahan
pengaliran ke luar negeri ini kerana memang pun mereka datang bekerja
disini untuk mendapat pendapatan dan untuk hantar balik kepada keluarga
mereka di sana. Tetapi jumlah sekarang sudah menjadi begitu besar sampai
berbillion ringgit yang mengalir keluar. Namun demikian kita tidak dapat nak
hentikan kerana kita masih perlu kepada pekerja asing di Malaysia. Yang kita
cuba ialah supaya diurus segala-galanya dengan baik…‖ (Abdul Bari, 2014)
RUJUKAN
97
Abdul Bari Azed. (2014). Kemasukan Tenaga Kerja Indonesia ke Malaysia Semasa
Pemerintahan Tun Dr. Mahathir Bin Mohamad dan Kini.Tesis PhD. Universiti Utara
Malaysia, Kedah, Malaysia.
Ahmad Agus Ramdlany & Devi Rahayu. (2016). Studi Moratorium Sebagai Upaya Perlindungan
Pengiriman TKI Berdasarkan UU Nomor 39 Tahun 2004 di Madura. Rechtidee 11(2),
226-244.
Aina Nasa. (2017, July 27). More than 1.7 million foreign workers in Malaysia; majority from
Indonesia. New Straits Times. Diakses pada 2018, Oktober 9 daripada
https://www.nst.com.my/news/nation/2017/07/261418/more-17-million-foreign-workers-
malaysia-majority-indonesia.
Athukorala, P. & Devadason, E. S. (2011). The Impact of Foreign Labour on Host Country
Wages: The Experiences of a Southern Host Malaysia.
Ayieko, L., A. (2016). Assessment of How Migration promotes Diplomatic Relations in Kenya.
Research Project, Idis University of Nairobi, 1-66.
Azizah Kassim. (2005). Cross-border movement of foreign workers in Malaysia: a comparative

analysis.
Azizah Kassim. (2012). Dasar Pekerja Asing di Malaysia, Perlunya Anjakan Paradigma.
Universiti Kebangsaan Malaysia, Selangor. Malaysia
Bixby, Asgar (2012) Isu Regulasi dan Masalah Pelaksanaan dalam Pengiriman Tenaga Kerja
Indonesia ke Malaysia: Perspektif Indonesia (2002-2011). PhD. thesis, Universiti Utara
Malaysia.
Brettner-Litherland, I. (2016). Foreign Domestic Workers in Malaysia: A comparative study of

the situation of migrant domestic workers from Cambodia, Indonesia and the Philippines.
Master Thesis. Universitätslehrgang.
Dairiam, G. (2006). Country Case Study on Bilateral Labour Agreement-Malaysia. Diakses

daripada www.jil.go.jp/foreign/event/ko_work/documents/2006sopemi/casestudy3.pdf
pada 14 Mei 2017.
Devadason, E. S., & Meng, C. W. (2014). Policies and laws regulating migrant workers in
Malaysia: A critical appraisal. Journal of Contemporary Asia, 44(1), 19-35.
Elias, J. (2013). Foreign Policy and the Domestic Worker: The Malaysia-Indonesia Domestic
Worker Dispute. International Feminist Journal of Politics, 15(3).
Go, S.P. (2007). Asian Labor Migration: The Role of Bilateral Labor and Similar Agreements.
Regional Informal Workshop on labor Migratin in Southeast Asia. Manila, Philippine.
Hagen-Zanker, J. (2008). Why Do People Migrate? A Review of the Theoretical

Literature. Working Paper. Maastricht: Maastricht Graduate School of Governance.
98
Handayani, P. (2014). Perjanjian Bilateral Indonesia dengan Malaysia Terhadap Tenaga Kerja
Indonesia (TKI). Lex Jurnalica, 11(1), 30-35.
Hugo, G. (1995). International labor migration and the family: some observations from
Indonesia. Asian and Pacific Migration Journal, 4(2-3), 273-301.
Kanapathy, V. (2006). Migrant workers in Malaysia: An Overview. Conference Proceedings.

Workshop on an East Asian Cooperation Framework for Migrant Labour, Kuala Lumpur,
Malaysia, December 6-7, 2006.
Kunaseelan Muniandy. (1996). Hubungan Malaysia-Indonesia 1957-1970. Dewan Bahasa dan

Pustaka.
Lin, M. (2006). Indonesian Labor Migrants in Malaysia: A Study from China (ICS Working
Paperno. 2006-11) diakses daripada
http://cmsad.um.edu.my/images/ics/workingpaper/2006-11.pdf, 2017, Mac 12.
Liow, J. C. (2004, September). Malaysia‘s Approach to Its illegal Indonesian Migrant Labour
Problem: Securitization, Politics or Catharsis?‘. In IDSS-Ford Workshop on non-
traditional security in Asia, Singapore (1-35).
Malahayati. (2015). Legal Protection on Indonesian Domestic Workers in Malaysia: From

Actors‘ View. Journal of Law, Policy and Globalization, 43, 75-85.
Maryam Fauziyah. (2015). Indonesian Diplomacy Towards Malaysia on Indonesian Migrant

Workers Faced Death Penalty (2010-2013). Thesis Sarjana Muda. Universitas Islam
Negeri Syarif Hidayatullah Jakarta.
Mat Jizal, Rahmah Ismail & Ishak Yussof. (2015). Penentu Migrasi Tanpa Izin Tenaga Kerja
Indonesia di Malaysia. Prosiding Kebangsaan Ekonomi Malaysia ke-10, Melaka,
Malaysia
Mohd Na‘eim Ajis. (2015). Pembuatan dan Pentadbiran Dasar Pekerja Asing di Malaysia Tesis
PhD. Universiti Sains Malaysia, Pulau Pinang, Malaysia.
Mohd Na‘eim Ajis, Mohamad Nasir Saludin, Azman Ismail, von Feigenblatt, O. F., Md. Shukri
Shuib & Mohamad Faisol Keling (2010). Managing Foreign Workers in Southeast Asian
Countries. Journal of Asia Pacific Studies, 1(3), 481-505.
Niny Khor & Devashish Mitra. (2013). Trade and Employment in Asia, Oxford, UK: Routledge,
hlm. 250-251.
Pertubuhan Bangsa-Bangsa Bersatu. (2005). The International Convention on Migrant Workers

and its Committee. (Fact Sheet No. 24). Diakses daripada
www.ohchr.org/Documents/Publications/FactSheet24rev.1en.pdf, pada April, 25, 2017.
Ratih Probosiwi. (2015). Analisis Undang-Undang Perlindungan Tenaga Kerja Indonesia di Luat
Negeri. KAWISTARA, 5(2), 99-220.
99
Reevany Bustami, Suyatno & Ismail Suardi Wekke. (2016). Migrants in Nusantara: Indonesian
and Malaysian Perspectives. Journal of Nusantara Studies, 1(2), 63-74.
Rohani Ab Ghani. & Zulhilmi Paidi. (2010). The Role of the United States and The ―Asian
Solution‖ Approach in the Malaysia-Indonesia Confrontation (1963-1966). Journal of
International Studies, 9, 1 – 16.
Ruhanas Harun. (2009), Peningkatan Keselamatan Bersama Melalui Kerjasama Duahala

Malaysia dan Negara-Negara Jiran. JEBAT, 36, 16-40
Salmah Jan Noor Muhammad, Hashim Musa & Rozita Che Rodi. (2014). Pembentukan Ilmu
Diplomatik Melayu dalam Menjalin Hubungan antara Kerajaan. Kertas Kerja. Diakses
daripada http://myrepositori.pnm.gov.my/handle/123456789/1633 pada 2017, Mac 13.
Silvey, R. (2006). Consuming the transnational family: Indonesian migrant domestic workers to
Saudi Arabia. Global networks, 6(1), 23-40.
Siti Melinda Haris, Nurliyana Mohd Shazali, Nurul Nadia Abu Hassan, Shaharuddin Badaruddin,
Mazlan Che Soh & Mohammad Nor Othman. (2015). Journal of Administrative Science,
12(2), 1-17
Syamsul Ardiansyah. (2008). ―Memorandum of Misunderstanding‖: Policy Brief on Bilateral

Labor Agreement of Indonesian. Indonesia: Institute for National and Democratic Studies
(INDIES)
Syed Abdul Razak. (2014). Indonesian Labour Migration to Sabah: Changes, Trends and
Impacts Tesis PhD. University of Adelaide, Australia.
-GP15-
Importance of Organizational Culture of Openness Communication and Employee
Participation and Organizational Performance
Ahmed Usman 1 andLawal Musa Batsari 2

1 Department of Public Administration Umaru Musa Yar‘adua University Katsina.
Email: ahmed_usman@gsgsg.uum.edu.my
2 Department of Public Administration Umaru Musa Yar‘adua University Katsina.
Abstract
Create a high-performance culture in the complex background, it is an essential to have
effective system for managing individual, group or team and organizational performance at a
large. the current research intent to establish the approach for managing organizational
members performance in a complex setup towards drive the improve public service delivery
culture and develop workforce capability. Since the organizational performance has become
the interest of both private and public organization and a key essential factor of development.
The research used to determine the relationship of two variables or more. the population in
100
question is the employees who work in public service sector in Nigerian to engaged in the
service delivery. The unit of analysis were selected public organization with the sample of 200
plus 40 bases on Salkind suggestion. The total number of sample used in this study were 195
respondents. The total number of returned and excluded questionnaire is 185 and the total of 45
which are not returned. The study used the Smart PLS for confirmatory factor analysis structural
model and measurement modelling hypothesis of the variables relationship. The result findings
indicated that opening communication has positive effect on organizational performance, it
revealed that proper communication at work enhance organizational performance. the result
shows result on participation has positive effect to organizational performance in the public-
sector organization in the context of Nigerian. In general, these findings supported that the
influence of organizational culture of employee participation and openness communication can
effective and efficient employee in to engage positively to organizational performance. the
methodological, theoretical, and practical implication are discussed for the future researcher.
Key Words:Organizational Culture, Employee Participation, Openness Communication,

Organizational Performance.
1. INTRODUCTION
For decades organizational culture has been an important field of study (e.g., Martin & Frost,
2011; Zheng, Yang, & McLean, 2010; Jones, 2010). Academic and Practitioner are also aware
the important of understanding culture in an organization for enhance employee performance
(Alvesson, 2012; Easterby-Smith & Lyles, 2011; Martin & Frost, 2011), because mostly
employee spends more time in an organization, this organization‘s most affects lives and
comfortably of their personal spirits. Evidence from study in North America on a high
performance in groups have discovered that given most consign and understand organizational
culture is a very important component that influence employee performance (Tesluk et al, 1997).
Further, added that culture could be a proper way of understanding activities at work place and
easy the employee to interact with one another for the organizational success. Organizational
culture is a structure that differentiates from one organization to another by give coherence
confidence and rationalizes for the organizational member to another. Furthermore,
organizational culture is the basic need of association accomplishes tasks in a group and also
influence the feeling, courage, motivating member to enhance performance in a group (Martin,
2003). Watson et al. (2006) highlighted that for past decade attention has given to encourage of
create culture within the organization for motivating the interaction among the organizational
members. In rebuilding on social science studies particularly in organizations since the 1960s,
has been suggested that more emphases should be given to culture in organization (Schein,
1996). In the same point, studies on social sciences described organizational culture as value,
attitude, beliefs and observable behavior and action which explain how work is to be done best
on the expected performance (Robbins, Judge, Millett, & Boyle, 2013; Jiacheng, & Francesco,
2010; Tsai, 2011; Schein, 2010). Similarly, is a process of providing wide understanding,
101
interaction with one another for attaining organizational objectives and teaching organizational
member how to act for high job performance (Alvesson, 2012).
2. theoretical foundation
The adaptation theory emphasizes that an organization must be ready to accept, interpret, and
translate influence from the environment into internal norms that help to achieve overall
organizational goals. Basically, several organizations acknowledged importance of it.
Adaptability seem to be more useful construct maturity. Adaptability central of development
process for the employee in an organization, (Ford & Lerner, 1992) emphases that adaptability
and motivation can easily improve the employee performance, and also require the effective
performance. Kanfer & Ackerman, (1989) describe adaptability as a type of training that need to
prove for the employee for improve the performance and comply with organizational culture, or
types of performance orientation provide. Hence, the studies recommend that organization
should learn to adapt to chance implant awareness in the organization for practice of behaviour.
Dension, (1989) suggested that most likely there are some aspect that can have impact on
organization effectiveness. The ability to perceive the respond to external environment, the
ability to respond to internal activates, and the reaction of both internal and external
environment activities.
3. conceptual framework
Below is the frame work of the paper, indicated the relationship between the independent
variable of organizational culture (employee participation and openness communication) and
dependent variable of employee performance.
Organizational Culture
Employee participation Organizational performance
Openness
Communication
102
Figure 1: Conceptual framework
3. pilot study
A study by Saunders, Lewis and Thronhill (2011), emphasis and recommended that before
engaging in to final data collection is appropriate and useful to conduct a pilot study. This pilot
testing study is vital to develop of valid and recommended scale that be to use (Supino & Borer,
2012). Testing pilot instruments is one of the important in any survey research for ensure
appropriate or accuracy and consistency of the responses (Hair et al., 2007). Similarly, Gay, Mill
and Airasian (2011) pointed out that a pilot test given a researcher an opportunity of information
about suggesting and deficiencies for improvement, unclear, omission or irrelevant items to be
revised. Additionally, the pilot study testing in very significant that improves the format of the
questionnaire and content of the study (Creswell, 2013).
Based on the suggested prior studies, traditionally consisting of 15 to 30 elements, was adopted
in a current research for testing the pilot study, (Malhotra & Galletta, 1999).Furthermore, the
pilot instrument was conducted on October 2017 among the 30 administrative authorized
personnel of 13 ministries of Kaduna state. The researcher was distributed questionnaire and
collected personally. Only 20 questionnaires were returned from the respondents, which
represented a 75% responses rate. The instrument was used the Statistical Package for Social
Science (SPSS) for the Cronbach‘s alpha. The Cronbach‘s alpha is being mention as a common
statistical test to use in the determining reliability estimate (Hair et al., 2010; Sekaran & Bougie,
2010; Zikmund et al., 2013). Hair et al. (1998) stressed that the Cronbach‘s alpha value is
between 0.60 or above showed internal consistency. In the other hand, Nunally (1978)
recommended that the Cronbach‘s alpha value of 0.70 or above highlighted as a strong internal
consistency of instrument. Similarly, Tuckman (1999) highlighted that the Cronbach‘s alpha
value between the range of 0.50 or above is suitable at the level of attitude assessment. Based
on the above discussion, the current study presented all the instruments in the table 3.9 below.
Table 1 Summary of Reliability Test for Pilot Test

Constructs No of items Cronbach Alpha
Openness Communication 8 0.848
Employee Participation 9 0.883
Organizational Performance 12 0.869
103
4. conclusion
This study has given great attention to theory and its implications for the problem of ethnic
group work culture in Nigeria. As demonstrated in this study, Nigeria is a multi-ethnic country.
The ethnic groups in Nigeria constitute a big threat to the country‘s unity. This is because of
conflicts and wars between different ethnic groups. The different ethnic groups in Nigeria are
both commensurable and incommensurable at various levels, which became sprouted
challenge to organizational performance in the context. Appreciation of organizational culture
that can shape the behavior of organizational member to fill sense of unselect in respected of
the differences of ethnic group work culture is a significant importance to organizational
performance. Since there is no human society that is conflict-free, because there are human
beings, there are most misunderstanding. Therefore, the current study has contributed on the
importance of organization culture of openness communication and employee participation and
organizational performance for helps the managers to performs their duties, mostly in the
heterogenous settings.
REFERENCES
Al-Neshmi, M. M. A. (2011). The Interactive Effect of Communication Satisfaction and Cultural

Dimensions on Organizational Commitment: A Case of Four Universities in
Yemen (Doctoral dissertation, Universiti Utara Malaysia).
Aluko, M. A. O. (2003). The impact of culture on organizational performance in selected textile

firms in Nigeria. Nordic Journal of African Studies, 12(2), 164-179.
Alvesson, M. (2012). Understanding organizational culture. Sage.
Barata, P. C., Gucciardi, E., Ahmad, F., & Stewart, D. E. (2006). Cross-cultural perspectives on
research participation and informed consent. Social Science & Medicine, 62(2), 479-490.
Bardus, M., Blake, H., Lloyd, S., & Suzanne Suggs, L. (2014). Reasons for participating and not
participating in a e-health workplace physical activity intervention: A qualitative
analysis. International Journal of Workplace Health Management, 7(4), 229-246.
Bond, G. R., & Drake, R. E. (2014). Making the case for IPS supported
employment. Administration and Policy in Mental Health and Mental Health Services
Research, 41(1), 69-73.
Brown, S., & Morrison, A. M. (2003). Expanding volunteer vacation participation an exploratory
study on the mini-mission concept. Tourism Recreation Research, 28(3), 73-82.
Denison, D. R., & Mishra, A. K. (1989, August). Organizational culture and organizational
effectiveness: A theory and some preliminary empirical evidence. In Academy of
Management Proceedings (Vol. 1989, No. 1, pp. 168-172). Academy of Management.
104
Easterby-Smith, M., & Lyles, M. A. (Eds.). (2011). Handbook of organizational learning and
knowledge management. John Wiley & Sons.
Emamgholizadeh, S., Borghei, S., & Zarei Matien, H. (2011). Study of the relation between
employees' participation in organizational decisions making and empowerment in
mazanderan. Iranian Journal of Management Studies,2(2), 77-95.
Ertürk, A. (2008). A trust-based approach to promote employees' openness to organizational

change in Turkey. International Journal of Manpower, 29(5), 462-483.
Falcione, R. L., & Downs Adrian, A. (1997). Communication practices in public

administration. Public Administration and Public Policy,63, 717-746.
Ford, D. H., & Lerner, R. M. (1992). Developmental systems theory: An integrative approach.
Sage Publications, Inc.
Fullan, M. (2014). Leading in a culture of change personal action guide and workbook. John
Wiley & Sons.
Gelders, D., Bouckaert, G., & Van Ruler, B. (2007). Communication management in the public
sector: Consequences for public communication about policy intentions. Government
Information Quarterly, 24(2), 326-337.
Heskett, J. L., & Kotter, J. P. (1992). Corporate culture and performance.Business Review, 2,
83-93.
Hofstede, G. (1980). Motivation, leadership, and organization: Do American theories apply

abroad? Organizational Dynamics, 9(1), 42-63.
Hung, R. Y. Y., Yang, B., Lien, B. Y. H., McLean, G. N., & Kuo, Y. M. (2010). Dynamic
capability: Impact of process alignment and organizational learning culture on
performance. Journal of World Business, 45(3), 285-294.
Jiacheng, W., Lu, L., & Francesco, C. A. (2010). A cognitive model of intra-organizational
knowledge-sharing motivations in the view of cross-culture. International Journal of
Information Management, 30(3), 220-230.
Joensson, T. (2008). A multidimensional approach to employee participation and the

association with social identification in organizations. Employee Relations, 30(6), 594-
607.
Jones, I. (2010). The human factor: Inside the CIA's dysfunctional intelligence culture.
Encounter Books.
Kanfer, R., Ackerman, P. L., & Sternberg, R. J. (1989). Dynamics of skill acquisition: Building a
bridge between intelligence and motivation. Advances in The Psychology of Human
Intelligence, 5, 83-134.
105
Kuipers, B. S., Higgs, M., Kickert, W., Tummers, L., Grandia, J., & Van der Voet, J. (2014). The
management of change in public organizations: A literature review. Public
Administration, 92(1), 1-20.
Levine, R. E., & Gaw, A. C. (1995). Culture-bound syndromes. Psychiatric Clinics of North
America.
Madlock, P. E. (2008). The link between leadership style, communicator competence, and
employee satisfaction. Journal of Business Communication, 45(1), 61-78.
Markus, H. R., & Kitayama, S. (2010). Cultures and selves A cycle of mutual
constitution. Perspectives on Psychological Science, 5(4), 420-430.
Martin, F. (2003). Situating sexualities: Queer representation in Taiwanese fiction, film and
public culture (Vol. 1). Hong Kong University Press.
Martin, J., & Frost, P. (2011). The organizational culture war games.Sociology of Organizations:
Structures and Relationships, 315.
Myers, K. K., & Sadaghiani, K. (2010). Millennials in the workplace: A communication

perspective on millennials‘ organizational relationships and performance. Journal of
Business and Psychology, 25(2), 225-238.
Nöhammer, E., Stummer, H., & Schusterschitz, C. (2011). Improving employee well-being
through worksite health promotion? The employees‘ perspective. Journal of Public
Health, 19(2), 121-129.
Okoh, L., Ojoh, J., & Nosegbe, B. (2008). Managing Organizational ineffectiveness: The
managerial challenges. International Journal of Labour and Organizational
Psychology, 2, 1.
Omar, M. F., Salam, R. A., Rashid, N. A. A., & Abdullah, R. (2004, April). Multiple sequence
alignment using genetic algorithm and simulated annealing. In Information and
Communication Technologies: From Theory to Applications, 2004. Proceedings. 2004
International Conference on (pp. 455-456). IEEE.
Robbins, S., Judge, T. A., Millett, B., & Boyle, M. (2013). Organisational behaviour. Pearson
Higher Education AU.
Ross, C. E., & Mirowsky, J. (2013). The sense of personal control: Social structural causes and
emotional consequences. In Handbook of the sociology of mental health (pp. 379-402).
Springer Netherlands.
Schein, E. H. (1990). Organizational culture (Vol. 45, No. 2, p. 109). American Psychological
Association.
Schein, E. H. (1996). Culture: The missing concept in organization studies.Administrative

Science Quarterly, 229-240.
106
Schein, E. H. (2010). Organizational culture and leadership (Vol. 2). John Wiley & Sons.
Schur, L., Kruse, D., Blasi, J., & Blanck, P. (2009). Is disability disabling in all workplaces?
Workplace disparities and corporate culture. Industrial Relations: A Journal of Economy
and Society, 48(3), 381-410.
Seth-Smith, H. M., Harris, S. R., Skilton, R. J., Radebe, F. M., Golparian, D., Shipitsyna, E.,. &
Parmar, S. (2013). Whole-genome sequences of Chlamydia trachomatis directly from
clinical samples without culture.Genome Research, 23(5), 855-866.
Shim, M. (2010). Factors influencing child welfare employee's turnover: Focusing on

organizational culture and climate. Children and Youth Services Review, 32(6), 847-856.
Summers, J., & Hyman, J. (2005). Employee participation and company performance: A review
of the literature. Joseph Rowntree Foundation.
Tesluk, P. E., Farr, J. L., & Klein, S. R. (1997). Influences of organizational culture and climate
on individual creativity. The Journal of Creative Behavior,31(1), 27-41.
Tsai, Y. (2011). Relationship between organizational culture, leadership behavior and job
satisfaction. BMC Health Services Research, 11(1), 1.
Watson, M. B. (2006). Career counselling theory, culture and constructivism.Career

Counselling: Constructivist Approaches, 45-56.
Willard-Grace, R., Hessler, D., Rogers, E., Dubé, K., Bodenheimer, T., & Grumbach, K. (2014).
Team structure and culture are associated with lower burnout in primary care. The
Journal of the American Board of Family Medicine, 27(2), 229-238.
Yao, P. L., Lin, Y. C., Sawhney, P., & Richburg, J. H. (2007). Transcriptional regulation of FasL
expression and participation of sTNF-α in response to sertoli cell injury. Journal of
Biological Chemistry, 282(8), 5420-5431.
Zheng, W., Yang, B., & McLean, G. N. (2010). Linking organizational culture, structure, strategy,
and organizational effectiveness: Mediating role of knowledge management. Journal of
Business research, 63(7), 763-771.
-GP16-
Gelagat Usahawan Halal Terhadap Perkhidmatan Tadbir Urus Hab Halal Jabatan Hal
Ehwal Agama Islam Pulau Pinang (JHEAIPP): Analisis Perspektif Integriti
Siti Syuhadah Mohamad1

1 Jabatan Pengurusan Awam, Pusat Pengajian Kerajaan, Universiti Utara Malaysia.
Email: syuhadah@uum.edu.my
107
Abstrak
Pasaran industri halal yang semakin meluas didorong oleh permintaan tinggi termasuk
dari masyarakat bukan Islam. Selari dengan jumlah pasaran yang luas, permintaan terhadap
perkhidmatan sijil halal turut meningkat. Bagi memenuhi permintaan usahawan yang kian
meningkat untuk memiliki pensijilan halal, pihak tadbir urus dan usahawan terikat dengan aspek
integriti dalam memberikan perkhidmatan berkaitan aktiviti halal. Analisis dan tinjauan kajian
lepas menunjukkan terdapat hubungan yang signifikan antara pihak usahawan dan pihak tadbir
urus hab halal. Kedua-dua pihak dilihat memainkan peranan penting dalam memperkasa aspek
integriti dalam industri halal. Oleh itu, kajian ini cuba mengenal pasti dan menganalisis tahap
integriti pihak tadbir urus JHEAIPP daripada perspektif usahawan. Bagi memenuhi objektif,
kaedah analisis kandungan dan statistik deskriptif digunakan untuk menganalisis data. Hasil
kajian mendapati pihak tadbir urus hab halal JHEAIPP berada di tahap yang baik dalam
memenuhi aspek integriti. Tahap integriti yang baik mampu meletakkan Malaysia selangkah ke
hadapan dalam industri halal.
Kata Kunci:Gelagat Usahawan, Integriti, Tadbir Urus Baik.
1. PENGENALAN
Industri halal kini sering mendapat perhatian pelbagai pihak termasuk daripada kalangan
negara bukan Islam. Permintaan yang tinggi dalam kalangan pengguna Islam dan bukan Islam
terhadap produk halal telah menjadikan pasaran produk halal produk halal semakin meningkat.
Tidak ketinggalan, perkembangan positif industri halal di Malaysia adalah selari dengan
perkembangan sektor ini di peringkat antarabangsa. Menurut Jamil Bidin, jumlah pasaran
produk halal dunia dianggarkan sebanyak USD 2.3 trilion (RM 7.44 trilion). Jumlah ini tidak
termasuk sektor perbankan (Ahmad Farizal Hajat, 2013 dan MIHAS; 2015). Kesedaran
terhadap manfaat produk halal secara tidak langsung telah mempengaruhi trend produk halal
yang semakin meningkat. Jumlah pasaran produk halal dijangka akan terus meningkat dan
mencecah sehingga USD 2.5 trilion (RM 9.24 trilion) menjelang tahun 2018 (Mohd Zaky
Zainuddin, 2015). Berdasarkan statistik MITI (2015), daripada jumlah pasaran halal dunia,
Malaysia telah mengeksport sebanyak RM 32.8 bilion produk halal pada tahun 2013 (MITI,
2014), 37.7 bilion pada tahun 2014 (Hafiz Ithnin, 2015) 39.4 bilion pada tahun 2015 dan jumlah
ini meningkat kepada 42.2b pada 2016 (Hafiz Ithnin, 2017).
Selari dengan perkembangan industri halal negara yang memberangsangkan, bilangan

usahawan yang menceburi industri halal turut menunjukkan peningkatan setiap tahun
(HDC,2014). Dalam industri halal, pihak usahawan produk halal dan pihak tadbir urus hab halal
merupakan antara komponen penting bagi merancakkan perkembangan sektor ini. Kertas kerja
ini bertujuan meneliti aspek tadbir urus baik integriti. Aspek integriti diteliti kerana melibatkan
aspek makanan yang menjadi kewajipan kepada pengguna Islam dalam memakan makanan
yang halal.
Bagi meneliti isu ini, skop kajian difokuskan kepada negeri Pulau Pinang. Justifikasi
pemilihan Pulau Pinang berikutan ia merupakan antara yang terawal dalam proses
penyeragaman pensijilan halal. Pulau Pinang turut merupakan antara negeri yang paling
progresif di Malaysia dalam industri halal (PIHH, 2010). Dari sudut metodologi pula, bagi menilai
tahap integriti pihak tadbir urus, 100 orang responden dipilih dalam kalangan usahawan produk
halal di Pulau Pinang. Borang soal selidik dan temu bual dijalankan bagi mendapatkan
108
pandangan usahawan selaku pengguna perkhidmatan terhadap pihak tadbir urus hab halal.
Teknik analisis kandungan dan analisis deskriptif digunakan bagi menganalisis dapatan kajian.
2. PERKHIDMATAN TADBIR URUS HAB HALAL JABATAN HAL EHWAL AGAMA ISLAM
PULAU PINANG (JHEAIPP): ANALISIS PERSPEKTIF INTEGRITI
Dalam konteks industri halal di Malaysia, pasaran halal dikuasai oleh usahawan bukan
Islam sedangkan usahawan Islam hanya merupakan kumpulan minoriti. Walaupun produk halal
sinonim dengan masyarakat Islam tapi secara realitinya bilangan usahawan produk halal Islam
masih jauh ketinggalan. Berdasarkan perangkaan, menurut bekas Ketua Pengarah JAKIM, Wan
Mohamad Sheikh Abdul Aziz (2010) dalam kenyataannya pada Disember 2010 didapati
seramai 74.7 peratus pemegang sijil halal terdiri daripada usahawan bukan Islam. Namun pada
tahun 2012, Mashitah Ibrahim yang merujuk kepada statistik JAKIM menyatakan bilangan
pemegang pensijilan halal yang dimiliki oleh pengusaha bukan Islam iaitu menurun kepada 70
peratus berbanding 74.4 peratus pada 2010 daripada jumlah keseluruhan pemegang pensijilan
halal (Utusan Online, 10 Disember 2012). Bilangan ini menunjukkan terdapat peningkatan kecil
penglibatan usahawan Islam dalam industri halal.
Sebaliknya, pada tahun 2014, Ismail Sabri Yaakob dalam ucapannya menjelaskan
bahawa usahawan Islam yang menceburi industri halal adalah sebanyak 9.8 peratus sahaja.
Bilangan ini menunjukkan lebih 90.2 peratus penglibatan dalam industri halal didominasi oleh
pengusaha bukan Islam (Utusan Online, 7 Disember 2014). Namun demikian sejak
kebelakangan ini terdapat peningkatan positif bilangan pengusaha Islam. Bilangan usahawan
Islam sehingga Mei 2016 dianggarkan mengusai 28 peratus industri halal di Malaysia (Utusan
Online 28 Mei, 2016).
Dalam konteks negeri Pulau Pinang pula, statistik bilangan penduduk bukan Islam
secara relatifnya lebih tinggi berbanding penduduk Islam sehingga tahun 2017 (Jabatan
Perangkaan Malaysia,2018) . Selain itu, bilangan pemegang sijil halal juga dimonopoli oleh
syarikat bukan Islam. Statistik pemegang halal negeri Pulau Pinang memperlihatkan
peningkatan setiap tahun. Terdapat unjuran positif industri halal di Pulau Pinang iaitu dari hanya
55 buah syarikat pada tahun 2008 meningkat kepada 592 buah syarikat sehingga 2013 (Portal
Kerajaan Negeri Pulau Pinang). Walau bagaimanapun jumlah ini terus meningkat kepada 639
sehingga Mei 2014. Sehingga Mei 2017 jumlah keseluruhan pemegang sijil halal bagi Produk
Makanan sahaja terdapat 415 buah syarikat. Daripada 415 buah syarikat hanya 26.02 peratus
merupakan syarikat Islam manakala 73.98 peratus lagi merupakan pemegang sijil halal
daripada syarikat bukan Islam. Walaupun penduduk Islam di Pulau Pinang sebanyak 45.72
peratus iaitu hampir penduduk bukan Islam sebanyak 54.38 peratus tapi dari segi penguasaan
dalam industri halal masih jauh ketinggalan.
Statistik di peringkat negara dan negeri masing-masing menunjukkan bahawa

pengusaha bukan Islam lebih mendominasi dan lebih cenderung terhadap industri halal.
Berdasarkan kajian-kajian lepas, laporan media sering memaparkan aktiviti penyelewengan
terutamanya melibatkan pengusaha bukan Islam. Selari dengan jumlah pengusaha bukan Islam
yang tinggi, bilangan pengusaha yang menyalahgunakan pensijilan halal turut didominasi oleh
pengusaha bukan Islam. Penyalahgunaan pensijilan halal yang berlaku dalam kalangan
109
pengusaha bukan Islam juga turut menjadikan integriti pihak tadbir urus selaku pengeluar
pensijilan halal sering mendapat perhatian. Penyalahgunaan pensijilan halal dalam kalangan
usahawan menjadikan pihak tadbir urus sebagai sasaran dan menjadikan aspek integriti pihak
tadbir urus sering dipertikaikan.
Aspek integriti merupakan aspek penting dalam industri halal baik kepada pihak
usahawan mahupun pihak tadbir urus. Aspek integriti dalam kalangan pihak usahawan sering
diketengahkan oleh media. Oleh itu, kajian ini melihat aspek integriti pihak tadbir urus selaku
penyedia perkhidmatan dalam industri halal dari perspektif pihak usahawan produk halal.
Menurut Pelan Integriti Nasional(PIN) yang diperkenalkan pada tahun 2004, integriti bermaksud
ialah kualiti unggul yang wujud secara keseluruhan dan padu pada individu dan organisasi.
Daripada perspektif penjawat awam integriti membawa maksud melaksanakan amanah dan
kuasa yang dipertanggungjawabkan menurut kepentingan umum menurut Unit Pemodenan
Tadbiran dan Perancangan Pengurusan Malaysia (MAMPU) yang dipetik dari Pelan Integrasi
Nasional (MAMPU, 2015).
Pendefinisian yang dikemukakan memperlihatkan aspek integriti merupakan aspek yang

penting terutama kepada organisasi terutama industri halal. Oleh itu, bahagian ini bertujuan
menganalisis respons usahawan terhadap aspek integriti pihak tadbir urus hab halal JHEAIPP.
Terdapat 5 skala digunakan bagi menilai tahap integriti pihak tadbir urus.
Jadual 1.1: Skala Kajian
Maksud Skala Tafsiran Persepsi
Sangat Tidak Setuju 1 Persepsi negatif
Tidak Setuju 2
Antara Setuju dan Tidak Setuju 3 Persepsi tidak pasti
Setuju 4 Persepsi positif
Sangat Setuju 5
Berdasarkan jadual 1.1 terdapat 5 skala digunakan. Skala 1 dan 2 mewakili tafsiran
negatif responden terhadap kepatuhan pihak tadbir urus terhadap piagam pelanggan. Skala 3
tidak pasti manakala skala 4 dan 5 persepsi positif terhadap pihak tadbir urus hab halal. Bagi
nilai pula, tahap bagi min ditentukan seperti Jadual 1.2
Jadual 1.2 Jadual Nilai Min
Nilai Min Tafsiran Persepsi
110
1.00 hingga 2.33 Rendah
2.34 hingga 3.67 Sederhana
3.68 hingga 5.00 Tinggi
Sumber: Misnan Jamal(2008)
Jadual 1.2 menjelaskan hubungan antara nilai min dan tafsiran persepsi responden.
Bagi nilai min 1.00 hingga 2.33 tafsiran persepsi berada di tahap yang rendah. Diikuti dengan
nilai min 2.34 hingga 3.67 dengan tafsiran persepsi yang sederhana. Bagi tafsiran persepsi
yang tinggi dan baik nilai min adalah antara 2.68 hingga 5.00. Penilaian respons usahawan
produk halal di Pulau Pinang terhadap pihak tadbir urus hab halal JHEAIPP mengandungi 9
item yang meliputi aspek integriti. Analisis ke atas item-item seperti Jadual 1.3.
Hasil penemuan berdasarkan respons 100 usahawan produk halal di Pulau Pinang,
responden meletakkan keseluruhan nilai min bagi ciri tadbir urus integriti adalah 4.13. Jika
diteliti item-item dalam soal selidik, didapati kesemua sembilan item berkaitan integriti
mempunyai nilai yang tinggi melebihi nilai skor min 4. Respons usahawan terhadap pihak tadbir
urus tadbir urus berdasarkan ciri tadbir urus baik memperlihatkan maklum balas positif dari
aspek integriti. Respons usahawan yang positif secara tidak langsung mempamerkan
keyakinan yang tinggi pihak usahawan selaku pengguna perkhidmatan terhadap nilai integriti
pihak tadbir urus hab halal JHEAIPP adalah baik.
Memandangkan produk halal melibatkan aspek makanan yang menjadi kewajipan

kepada pengguna Islam khususnya, secara tidak langsung menjadikan aspek integriti sebagai
keutamaan kepada pihak tadbir urus hab halal JHEAIPP. Aspek integriti dalam kalangan tadbir
urus merupakan agenda penting bagi menjaga kualiti perkhidmatan yang diberikan. Bagi
memperkasa aspek integriti pihak Halal Development Corporation (HDC) telah menyediakan
Pelan Induk Industri Halal yang antaranya bertujuan menjadikan Malaysia sebagai pusat
rujukan integriti halal serta meningkatkan aktiviti pengeluaran dan dagangan makanan halal.
Selain itu, respons positif dan keyakinan yang tinggi usahawan produk halal terhadap
tahap integriti pihak tadbir urus dilihat selari dengan kajian Baharudin Che Pa, Siti Arni Basir &
Shukeri Mohamed (2010) yang mendapati tanggungjawab utama penubuhan HDC adalah untuk
memandu pembangunan piawaian halal, prosedur audit dan pensijilan dengan tujuan untuk
menjamin integriti halal. Namun tugas tersebut telah dikembalikan kepada JAKIM dan JAIN.
Oleh itu, pihak tadbir urus hab halal JAKIM dan JAIN seperti JHEAIPP seharusnya
mengekalkan aspek integriti yang baik bagi menjaga keyakinan pengguna produk halal.
Jadual 1.3 Nilai Min Bagi Ciri Tadbir Urus Baik Integriti
111
Selain itu, aspek integriti sering dikaitkan dengan penjawat awam. Pandangan positif
Pernyataan: Maklum Maklum Maklum Min Interpretasi
Balas Balas Balas
Sepanjang berurusan dengan Negatif tidak Positif
pihak tadbir urus, saya dapati (%) pasti
pihak tadbir urus unit halal (%)
JHEAIPP:- (%)
Mengutamakan kepentingan 6 6 88 4.00 Tinggi

organisasi melebihi kepentingan
peribadi
Patuh mengikut segala peraturan 2 7 91 4.13 Tinggi
Memahami akibat yang akan Tinggi

ditanggung sekiranya saya
melakukan sesuatu kesalahan 2 7 91 4.13
Menjalankan sesuatu tugas tanpa 6 0 94 4.13 Tinggi

mengharapkan ganjaran
Tidak menggunakan kemudahan 0 4 96 4.22 Tinggi

rasmi kuasa untuk tujuan peribadi
Bersungguh-sungguh membantu 5 5 90 4.10 Tinggi

usahawan produk halal
Menjaga kualiti perkhidmatan yang 0 11 89 4.16 Tinggi

diberikan
Menjaga nama baik organisasi 0 10 90 4.16 Tinggi
Mengutamakan kepentingan awam 2 6 92 4.11 Tinggi

daripada kepentingan organisasi
pihak usahawan terhadap tahap integriti pihak tadbir urus hab halal JHEAPP dilihat sesuatu
yang memberi perspektif baru kepada penjawat awam yang sering dikaitkan dengan tahap
integriti yang kurang memuaskan seperti yang ditemukan dalam kajian Zaharah Hassan, Abu
Daud Silong & Nazri Muslim (2009). Namun dari perspektif halal, tiada kompromi daripada
aspek kerana memberi impak yang besar memandangkan ia melibatkan pemakanan halal.
Penemuan kajian Mohamad Noorizzuddin Nooh et.al. (2007), Mohani Abdul et.al. (2009)
dan Zulkifli Dahalan (2008) mendapati label halal merupakan faktor utama yang mempengaruhi
pilihan pengguna. Penemuan ini selari dengan dapatan responden bahawa pengguna produk
dan faktor agama merupakan faktor utama yang mempengaruhi penglibatan usahawan dalam
112
industri halal. Dapatan Norhabibah Che Harun (2011), Golnaz Rezai (2008) dan Burhan Adnan
(2008) pula bersependapat menyatakan faktor keyakinan kepada produk makanan berlogo
halal adalah berdasarkan faktor keselamatan makanan dan kesedaran kesihatan
mempengaruhi keyakinan pelanggan terhadap makanan berlogo halal. Oleh itu, dapat
dirumuskan bahawa pengguna yakin kepada pihak tadbir urus yang berintegriti mengeluarkan
pensijilan halal. Dalam memastikan keyakinan pengguna terhadap pensijilan halal yang
dikeluarkan, aspek integriti yang tinggi harus di perkasa oleh pihak tadbir urus hab halal.
Respons usahawan dalam menilai tahap integriti dipengaruhi oleh pelbagai faktor
dalaman dan luaran sepanjang berurusan dengan pihak tadbir urus hab halal JHEAIPP.
Pandangan positif usahawan terhadap pihak tadbir urus mempengaruhi gelagat sewaktu
berhadapan dengan pihak tadbir urus sekali gus mempengaruhi keyakinan dan penglibatan
pihak usahawan dalam industri halal. Dalam konteks respons terhadap pihak tadbir urus
terhadap tahap integriti, faktor pengaruh agama merupakan salah satu faktor yang
mempengaruhi respons usahawan dari segi demografi. 95 peratus responden menyatakan
bahawa faktor agama merupakan faktor utama penglibatan mereka dalam industri halal. Hal ini
menunjukkan usahawan selaku pengguna yakin dengan pensijilan halal yang dikeluarkan oleh
pihak tadbir urus kerana mematuhi piawaian dan mengikut kehendak syarak.
Selain itu, tahap integriti yang baik turut diperlihatkan daripada pihak usahawan produk
halal sama ada Islam dan bukan Islam. Hal ini dibuktikan apabila laporan dari Jamil Khir
Baharom, menyatakan bahawa kes penyelewengan pensijilan halal hampir sifar (Utusan Online,
2018). Secara tidak langsung laporan yang dikemukakan menunjukkan tahap kefahaman dan
integriti usahawan terutama bukan Islam semakin baik. Penemuan ini membawa
perkembangan positif kepada industri halal negara apabila kedua-dua pihak iaitu usahawan dan
pihak tadbir urus masing-masing mempamerkan tahap integriti yang tinggi.
3. KESIMPULAN
Ringkasnya, aspek integriti pihak tadbir urus mendapat respons yang positif daripada perspektif
usahawan. Hal ini menunjukkan tahap keyakinan yang tinggi usahawan produk halal terhadap
pihak tadbir urus dari aspek integriti. Item yang mendapat maklum balas negatif dan sederhana
hanya melibatkan bilangan kecil responden. Perhatian serius terhadap aspek yang mendapat
maklum balas negatif dan sederhana seharusnya diberikan oleh pihak tadbir urus bagi
memperkasa aspek integriti dalam perkhidmatan yang diberikan. Secara keseluruhannya
respons usahawan terhadap aspek integriti pihak tadbir urus hab halal mendapat respons positif
dengan nilai min yang tinggi. Respons positif secara tidak langsung menjelaskan bahawa
penyalahgunaan pensijilan halal dalam kalangan segelintir usahawan produk halal di Pulau
Pinang tidak menjejaskan tahap integriti pihak tadbir urus hab halal JHEAIPP. Respons
usahawan produk halal menunjukkan pihak usahawan mempunyai keyakinan yang tinggi
terhadap aspek integriti pihak tadbir urus sekali gus dapat mempengaruhi penglibatan pihak
usahawan yang menceburi industri halal untuk menceburi industri halal.
113
RUJUKAN
Ahmad Farizal Hajat. (2013, 19 September). Hab Halal Terbesar Dunia. Berita Harian Online. Di
akses dari http://www.bharian.com.my/articles/HabhalalTerbesardunia/Article/ pada 20
Oktober 2013.
Baharudin Che Pa, Siti Arni Basir, Raja Hisyamudin Raja Sulong, & Mohd. Zaidi Abd. Rahman.
(2008). Prinsip-prinsip Kualiti Usahawan Muslim. Kertas kerja dibentangkan di Seminar
Keusahawanan Islam II Peringkat Kebangsaan (SKIS 08), Jabatan Syariah dan
Pengurusan, Akademi Pengajian Islam,Universiti Malaya pada 15 Oktober 2008.
Burhan Adnan. (2000). Consumer Behavior and Religiosity of Muslim Community in Klang
Valley: Consumer Perception on Halal and Non Halal Product and Services. Disertasi
Sarjana Fakulti Perniagaan dan Perakaunan, Universiti Malaya, Kuala Lumpur. Tidak
diterbitkan.
Golnaz Rezai. (2008). Consumers‟ Confidence in Halal Labeled Manufactured Food in

Malaysia. Tesis Doktor Falsafah Fakulti Pertanian, Universiti Putra Malaysia.Tidak
diterbitkan.
Hafiz Ithnin. (2015, 16 Mac). Ekonomi Global Tak Menentu. Harian Metro Online. Diakses dari
http://www.hmetro.com.my/node/37227 pada 20 Mac 2015.
Hafiz Ithnin. (2017,16 Jun)·Eksport halal naik 7.1 peratus. Harian Metro Online. Diakses dari
https://www.pressreader.com/malaysia/harian-metro/20170616/282385514502468
pada 12 Mac 2018.
Halal Industry Development Corporation (HDC). (2014). Statistik Certified Halal. Diakses dari
http://www.hdcglobal. com/publisher/gwm_industry_statistics pada 20 Januari2015.
Jabatan Perangkaan Malaysia. (2017). Maklumat Asas Negeri Pulau Pinang2013. Diakses dari
https://www.penang.ekonomi/1.%20DEMOGRAFI%20&%20EKONOMI.pdf. Diakses
pada 25 Mei 2018.
MIHAS. (2015). Malaysia Aims to Energise the Halal Ecosystem Through the World Halal
Summit.
Diakses dari http://www.mihas.com.my/malaysia-aims-to-energise-the-halal-ecosystem

through-the-world-halal-summit/ pada 15 April 2015.
Misnan Jamal. (2008). Amalan Pengajaran Guru dalam Pengajaran dan Pembelajaran Tilawah
al-Quran Sekolah-Sekolah Menengah. Tesis Ijazah Doktor Falsafah, Fakulti Pendidikan,
Universiti Kebangsaan Malaysia, Bangi. Tidak diterbitkan.
Mohammad Noorizzuddin Nooh, Norhaziah Nawai, Nuradli Ridzwan Shah Mohd Dali, & Hartini
Mohammad. (2007). Halal branding: An exploratory research among consumers in
Malaysia. Kertas kerja dibentangkan di 3rd Uniten International Business Management
Conference 2007, Hotel Equotarial, Melaka pada 16-18 Disember.
114
Mohani Abdul, Hashanah Ismail, Haslina Hashim, & Juliana Johari.(2009). Consumer Decision
Making Process in Shopping for Halal Food in Malaysia. China-USA Business Review,
8(9), 40-47.
Mohd Zaky Zainuddin. (2015, 30 Mac). HCMS Urus Pensijilan Halal Atas Talian. Berita Harian
Online. Diakses dari http://www.bharian.com.my/ node/44277 pada 4 April 2015.
Norhabibah Che Harun. (2011). The Confidence Level of Purchasing Product with Halal Logo
Among Consumers. Tesis Sarjana Ijazah Sains (Pengurusan),UUM.Tidak diterbitkan.
PIHH. (2010). About PIHH. Introduction To Penang International Halal Hub. Diakses dari
http://www.halalpenang.com/about_pihh.php pada 24 April 2012.
Portal JHEAIPP (2017). Pemegang Sijil Halal Produk Makanan April 2018. Diakses dari
http://jaipp.penang.gov.my/index.php/halal diakses pada 22 Mei 2018.
Portal Kerajaan Negeri Pulau Pinang. (2014). 5th Penang International Halal Expo &
Conference 2014. Di akses dari http://www.penang.gov.my/index.php/2013-04-01-05-
24-51/koleksi-yab-km/2801-5th-penang-international-halal-expo-conference-2014 pada
5 September 2014.
Unit Pemodenan Tadbiran dan Perancangan Pengurusan Malaysia (MAMPU). (2015). Pelan
Integrasi MAMPU 2013-2015. Diakses dari
http://www.mampu.gov.my/documents/10228/11621/Pelan+Integriti+MAMPU+20132015
.pdf/05d5c649-dc58-44d4-810f-5b0ff2318bd3 pada 3 Jun 2014.
Utusan Online. (2014, 7 Disember). Hanya 28 Peratus Sijil Halal Milik Peniaga Islam.Utusan
Melayu (M) Bhd. Diakses dari http://www.utusan.com.my/berita/nasional/hanya-28-
peratus-sijil-halal-milik-peniaga-islam-1.335636 pada 1 Jun 2016.
Utusan Online. (2018, 19 Mac). Diakses dari http://www.utusan.com.my/berita/wilayah/kl-

putrajaya/kesalahan-sijil-halal-palsu-hampir-sifar-1.630473 pada 29 Mei 2018
-GP17-
Parodi: Suatu Ancaman Kepada Hak Pencipta?
Ahmad Shamsul Abd Aziz1 danNor Azlina Mohd Noor 2

Emel:sham@uum.edu.my
Emel:norazlyna@uum.edu.my
Abstrak
Parodi merupakan karya sastera atau seni yang dilindungi oleh undang-undang hak cipta. Ini
adalah kerana penghasilan suatu karya parodi bukanlah merupakan suatu pelanggaran kepada
hak cipta. Namun begitu, terdapat pandangan yang menyatakan bahawa perlindungan yang
diberikan kepada suatu parodi boleh menjejaskan karya asli penciptanya. Oleh itu, kertas kerja
ini akan membincangkan hak perlindungan parodi yang mengancam hak karya asli
115
penciptanya. Kertas kerja ini akan menganalisa Akta Hak Cipta 1987 dan undang-undang
berkaitan. Kertas kerja ini merumuskan bahawa walaupun parodi merupakan suatu
pengecualian kepada pelanggaran hak cipta yang bertujuan untuk menghiburkan dan bersifat
humor, namun penghasilannya juga adakalanya boleh menjejaskan karya asal pencipta. Oleh
itu, wujud keperluan untuk membuat penambahbaikan terhadap peruntukan undang-undang
berkaitan dengan hak pencipta asal terhadap suatu parodi di bawah undang-undang hak cipta
di Malaysia.
Kata Kunci:Parodi, Pelanggaran Hak Cipta, Karya Asal, Pencipta.
1. pengenalan
Parodi merupakan karya sastera atau seni yang meniru gaya pengarang atau pencipta
lain dengan cara yang melucukan atau menyindir (Noresah, 2010). Suatu parodi dilindungi oleh
undang-undang hak cipta. Menurut McCutcheon (2008), polisi utama suatu parodi dikecualikan
daripada pelanggaran undang-undang adalah kerana nilai kebebasan bersuara dan mengkritik
yang ada padanya untuk tujuan membangunkan masyarakat demokratik. Perkataan parodi
tidak ditafsirkan oleh akta yang mengawal hak cipta di Malaysia iaitu Akta Hak Cipta 1987.
Spence (1998) menyatakan bahawa karya parodi boleh dilihat dalam empat keadaan iaitu:
a) Hubungan antara parodi dan karya asal adalah berbeza. Terdapat beberapa jenis parodi
seperti parodi spesifik dibuat berdasarkan karya, parodi umum dibuat atas keseluruhan
tradisi artistik, gaya dan genre. Selain itu, ‗parodi sasaran‘ merujuk kepada kritikan ke
atas karya atau pengkarya dan ‗parodi senjata‘ pula melibatkan penggunaan karya ke
atas sesuatu yang agak berbeza.
b) Hubungan antara parodi dengan teknik-teknik lain seperti satira, ironi, olok-olok
(burlesque), karikatur dan ejekan (travesty). Penggunaannya seringkali bertukar antara
satu sama lain.
c) Kaedah bahan-bahan yang diparodikan. Beberapa perkataan dari sebuah sajak boleh
membina sebuah parodi.
d) Dalam konteks sosial di mana parodi ini muncul secara berleluasa. Parodi banyak
digunakan sebagai senjata di dalam perbahasan politik atau dalam dunia komersil
seperti dunia pengiklanan, untuk merangsang jualan.
Sebelum wujudnya Internet, karya yang diparodikan seperti sebuah lagu hanyalah boleh
didengar oleh sekelompok golongan tertentu dan mungkin tidak disiarkan di media massa
elektronik. Senario ini berubah dengan kemunculan Internet di mana masyarakat mudah
memuat naik video yang diparodikan sama ada filem atau lagu di laman-laman sosial seperti
Youtube dan disaksikan secara mudah oleh masyarakat di seluruh dunia.
2. Parodi di bawah Perundangan Hak Cipta

Parodi merupakan suatu dalihan kepada pelanggaran hak cipta. Ini bermakna,
penghasilan suatu karya parodi bukanlah merupakan suatu pelanggaran kepada hak cipta.
Dalihan parodi termaktub di bawah seksyen 13(2)(b) Akta Hak Cipta 1987 yang diletakkan
bersama dua lagi dalihan iaitu pastiche dan karikatur. Sehingga kini, dalihan parodi masih
belum diuji di mahkamah-mahkamah di Malaysia. Di United Kingdom, peruntukan berkaitan
parodi sebagai suatu pengecualian kepada pelanggaran hak cipta terletak di bawah seksyen
30A Copyright, Designs and Patents Act 1998 (CDPA 1988). Peruntukan ini digubal pada tahun
116
2014. Sebelum wujudnya peruntukan khusus mengenai parodi ini, kes-kes seperti Hansfstaengl
lwn. Empire Palace [1894] 3 Ch.109, 128 (mengenai lakaran hiburan berjudul ―Punch!‖ yang
mengambarkan Akademi DiRaja), Glyn lwn. Weston Feature Film Company [1916] 1 Ch. 261,
268 [filem ―Pimple‘s Three Weeks‖ yang diterbitkan bukanlah mengambil bahagian penting dari
novel ―Three Weeks.‖) dan Joy Music Limited lwn. Sunday Pictorial Newspapers (1920) Limited
[1960] 2 QB 60 (artikel dalam akhbar defendan yang bertajuk ―Rock-a-Phillip Rock! Rock! Yang
merupakan parodi kepada lagu terbitan plaintif berjudul ―Rock-a-Billy‖)menjelaskan bahawa
parodi bukan merupakan suatu pelanggaran kepada hak cipta kerana karya parodi membentuk
suatu karya hak cipta yang lain.
Namun, mahkamah di United Kingdom menerusi kes Schweppes Ltd. lwn Wellingtons
Ltd. [1984] FSR 210 memutuskan bahawa parodi dikatakan sebagai suatu pelanggaran hak
cipta jika sekiranya pembuat parodi mengambil sebahagian besar dari sebuah karya yang
dilindungi (merujuk kepada seksyen 16 CDPA 1988). Manakala, Hakim Paul Baker Q.C dalam
kes Willamson Music Ltd. lwn. Pearson Partnesrship Ltd. [1987] FSR 97 memutuskan bahawa
tiada pelanggaran hak cipta sekiranya hanya idea asal yang digunakan yang bukan melibatkan
sebahagian besar suatu karya tersebut.
Sebelum adanya perundangan khusus di bawah seksyen 30A CDPA 1988 yang
meletakkan parodi sebagai suatu dalihan kepada hak cipta, pelbagai perbincangan dibuat untuk
merealisasikannya. Deazley (2012) menyatakan bahawa ianya perlu berdasarkan hujah-hujah
berikut:
a) Meletakkan parodi sebagai suatu dalihan urusan yang wajar adalah tidak sesuai kerana
adanya syarat ―perakuan yang mencukupi‖ di bawah dalihan tersebut,
b) Teori dalihan kepentingan awam menyediakan beberapa skop untuk kegunaan parodi
bagi karya yang dilindungi hak cipta, walau bagaimanapun secara praktis kewujudan
seksyen 171(3) CDPA 1988 tidak memberi layanan kepada dalihan kepentingan awam
ini.
c) Parodi melibatkan kepentingan kebebasan bersuara yang luas maknanya, oleh itu ia
harus bermakna dan jelas untuk disesuaikan dalam rejim hak cipta.
Apa yang menariknya, perundangan di Amerika Syarikat tidak memperuntukkan parodi sebagai
suatu dalihan khusus kepada hak cipta. Parodi hanya merupakan salah satu kategori kegunaan
yang wajar sahaja sepertimana yang diputuskan dalam kes Campbell lwn. Acuff Rose Music
Inc. 114 S.Ct 1164 (1994) di mana ia merujuk kepada seksyen 107 Copyright Act 1976. Dua
perkara dalam parodi yang memenuhi kriteria kegunaan yang wajar ialah sifat karya suatu
parodi yang melibatkan penggunaan transformatif suatu karya serta penggunaan berlebihan
boleh menjejaskan pasaran karya asli (Spence, 1998). Pendapat Spence (1998) ini menyokong
pandangan awal yang dibuat oleh Gordon (1992) dan Posner (1992) di mana mereka
berpandangan bahawa parodi merupakan ancaman jenis sekunder kepada pasaran karya asli.
Walau bagaimanapun, dalam kes Elsemere Music, Inc. lwn. National Broadcasting Company,
Inc 482 F. Supp. 741, 747 (SDNY, 1980) hakim Goettel memutuskan bahawa lagu ―I Love New
York‖ yang diparodikan menjadi ―I Love Sodom‖ bukan sahaja tidak memberi kesan kepada nilai
karya berhak cipta dan parodi malahan ia tidak menjejaskan permintaan terhadap karya asal.
Perundangan di negara-negara di Eropah juga cenderung meletakkan parodi sebagai suatu
dalihan khusus kepada sebuah pelanggaran hak cipta sebagaimana yang diperuntukkan dalam
Directive 2001/29/EC (The Information Society Directive). Ini adalah kerana Artikel 5 (3)(k) telah
dengan jelas memperuntukkan parodi, karikatur dan pastiche sebagai suatu dalihan khusus
kepada sebuah pelanggaran hak cipta. Antara negara- negara Eropah yang meletakkan parodi
117
sebagai suatu dalihan khusus hak cipta termasuklah Armenia (Artikel 22(2)(j)(ii) Law on
Copyright and Related Rights 2006), Belgium (Artikel 22(1)(6) Copyright Law Consolidation)
1994, Croatia (Artikel 94 Copyright and Related Rights Act 2003), Perancis (Artikel L122-5 Law
on the Intellectual Property Code 1992), Lituania (Artikel 25 Law Amending the Law on
Copyright and Related Rights 2003), Luxembourg (Artikel 10(6) Law on Author‘s Rights,
Related Rights and Databases 2004), Malta (Seksyen 9(1)(s) Copyright Act 2000), Belanda
(Artikel 18(b) Copyright Act 1912), Romania (Artikel 35(b) Law No.8 of 14 March 1996 on
Copyright and Neighbouring Rights), Slovenia (Artikel 53(2) Copyright and Related Rights Act
(Consolidated Text) 1995, Sepanyol (Seksyen 39 Royal Legislative Decree 1/1996 (of 12 April
1996) : Revised Law on Intellectual Property (TRILP)) dan Switzerland (Artikel 11(3) Federal
Law on Copyright and Neighbouring Rights (Federal Copyright Law) 1992).
3. Hak Pencipta Karya Asal Terhadap Suatu Parodi

Menerusi perbincangan di atas, terdapat pandangan yang menyatakan bahawa suatu
parodi boleh menjejaskan karya asli. Menerusi laman sosial, lebih banyak video parodi
dihasilkan dan ianya tersebar secara meluas. Dalam kes Caner lwn. Autry No.6:14-CV-0004,
2014 WL2002835 (W.D.Va.May 14, 2014) kes ini membicarakan mengenai parodi yang berlaku
di Internet. Mahkamah memutuskan bahawa pengeposan suatu video parodi ke laman sosial
Youtube, undang-undang telah menetapkan bahawa kegunaan yang wajar melindungi suatu
penggunaan transformatif walaupun mungkin parodi atau kritikan itu akan menjejaskan pasaran
ke atas karya asal yang diparodikan itu.
Gordon (2002) menyatakan bahawa dalam keadaan pencipta yang merupakan
pemunya hak cipta enggan membenarkan karyanya diambil untuk tujuan parodi, pencipta
tersebut boleh menggunakan hak cipta sebagai senjata untuk suatu sekatan kepada suatu
parodi. Ini kerana, seorang pencipta sekiranya merupakan seorang pemunya hak cipta memiliki
hak terhadap karyanya dan sebarang penggunaan tanpa kebenaran adalah merupakan suatu
pelanggaran (Lai, 2015). Namun, kesukaran mungkin timbul kerana parodi secara jelas
dinyatakan dalam undang-undang bahawa ia merupakan pengecualian kepada pelanggaran
hak cipta.
Namun, dalam isu parodi, ia turut berkait rapat dengan hak moral. Hak cipta boleh
berpindah hak milik menerusi penyerahhakan,pemberian berwasiat atau dengan kuat kuasa
undang-undang seperti pemberian lesen sebagaimana yang termaktub di bawah seksyen 27
Akta Hak Cipta 1987 tetapi hak moral adalah berkekalan kepada pencipta selama-lamanya.
Parodi melibatkan suatu pengubahsuaian kepada karya asal. Peruntukan berkaitan hak moral
tidak membenarkan suatu pengubahsuaian, merosakkan atau mencacatkan dengan jelas suatu
karya asal menurut seksyen 25(2)(b)(i) Akta Hak Cipta 1987. Selain itu, Akta Hak Cipta 1987
juga tidak membenarkan suatu pengubahsuaian terhadap karya asal jika pelakuan tersebut
akan memudaratkan kehormatan atau reputasi pencipta sebagaimana menurut seksyen
25(2)(b)(ii) Akta Hak Cipta 1987. Sungguhpun karya parodi merupakan suatu dalihan kepada
pelanggaran undang-undang hak cipta, namun, sekiranya ia menimbulkan ancaman kepada
pencipta seperti merosakkan reputasi pencipta atau suatu karya telah diubahsuaian berlebihan-
lebihan, tindakan guaman boleh diambil oleh pencipta di bawah sekyen 25(5) Akta Hak Cipta
1987 sebagai suatu pelanggaran terhadap kewajipan statutori. Sekiranya pencipta telah pun
meninggal dunia, tindakan masih boleh diambil oleh wakilnya menurut seksyen 25(4) Akta Hak
Cipta 1987.
Penambahbaikan terhadap peruntukan undang-undang berkaitan dengan hak pencipta
asal terhadap suatu parodi di bawah undang-undang hak cipta di Malaysia boleh dibuat dengan
118
merujuk kepada CDPA 1988. Di bawah CDPA 1988, suatu parodi yang menjejaskan hak moral
boleh diambil tindakan di bawah seksyen 84(1) CDPA 1988 iaitu hak untuk membantah layanan
penghinaan dan di bawah seksyen 80(1) CDPA 1988 iaitu hak untuk membantah sifat palsu.
Menurut Weir (1994) suatu parodi itu hanya dikatakan melakukan pelanggaran kepada hak
moral pengkarya sekiranya parodi tersebut memberi ancaman kepada ―semangat‖ karya asal.
4. Kesimpulan
Suatu karya yang bersifat parodi secara umumnya bukanlah merupakan pelanggaran
kepada hak cipta. Perkara ini jelas termaktub di bawah perundangan hak cipta tempatan serta
di negara-negara lain. Boleh dirumuskan di sini bahawa terdapat dua keadaan dalam
perundangan yang berkaitan parodi ini di bawah undang-undang hak cipta iaitu pertamanya,
menerusi suatu peruntukan khusus seperti di Malaysia dan keduanya menerusi dalihan
kegunaan yang wajar/urusan yang wajar. Dalam erti kata lain, parodi merupakan suatu
pengecualian kepada pelanggaran hak cipta, namun sebagai pencipta, sekiranya penggunaan
suatu karya asal itu melakukan perubahan yang besar dan menjejaskan reputasinya, maka
tindakan undang-undang adalah dibenarkan untuk diambil menurut Akta Hak Cipta 1987. Suatu
karya jenis parodi ini sungguhpun bertujuan untuk menghiburkan dan bersifat humor, namun
penghasilannya juga adakalanya boleh menjejaskan pasaran karya asal.
RUJUKAN
Deazley, Ronan. ―Taking Forward the Gowers Review of Intellectual Property: Second Stage
Consultation on Copyright Exceptions – Submission on Behalf of the Intellectual
Property Foresight Forum,‖ capaian Ogos 11, 2012,
www.ipforesightforum.ac.uk/documents/IPFF_copyright%20consultation_march%20201
0.pdf
Gordon, Wendy J. ―Excuse and Justification in the law of Fair Use: Commodification and Market
Perspectives,‖ dalam Niva Elkin-Koren and Neil Weinstock Netanel: The
Commodification of Information, penyunting. Ruth Towse, 149-192. The Hague: Kluwer
Law International, 2002.
Lai, Amy. (2015) Copyright Law and It‘s Parody Defense: Multiple Legal Perspectives. Journal
of Intellectual Property and Entertainment Law 4, no 2 (2015): 311-336.
McCutcheon, Jani. (2008). The New Defence of parody or satire under Australian Copyright.
Intellectual Property Quarterly (2015): 1-22.
Noresah Baharom et.al. Kamus Dewan, Edisi ke-4, Kuala Lumpur: Dewan Bahasa dan Pustaka,
2010.
Posner, Richard A. ―When is Parody Fair Use?‖ Journal of Legal Studies 21, no.1(1992):67-78.
Spence, Michael. ―Intellectual Property and the Problem of Parody,‖ The Law Quarterly Review
114, (1998): 594-620.
119
Weir, Moana, ―The Parodist Nirvana: Droit Moral and Comparative Copyright Law,‖ Journal of
Copyright Society of Australia 11, no.4 (1994): 26.
-GP18-
Human Assets Possesion Among Coastal Fishermen in
Northern Peninsular Malaysia
Ahmad Zubir Ibrahim1

1 School of Government, UUM COLGIS, Universiti Utara Malaysia, Kedah.
Email: azubir@uum.edu.my
Abstract
This study aims to evaluate human assets possession among fishermen's in Northern
Peninsular Malaysia based on Sustainable Livelihood Analysis (SLA). This study adopts
quantitative study with stratified sampling method to selects a total of 400 respondents from
Kuala Kedah, Yan, Tanjung Dawai and Kuala Perlis, Malaysia, which consist of education,
experience, status of health, training and knowledge. The study found that, knowledge and
health condition possessed the moderate high value followed by training education head of
household and working experience This represents knowledge level among fisherman and
health condition would affect human assets in order to improve the livelihood among coastal
fisherman in Northern Malaysia. A number of recommendations have been highlighted to assist
the coastal fishermen in improving human asset capability.
Key Words:Human Assets, Fishermen, Sustainability Livelihood.
1. INTRODUCTION
The sustainable livelihoods approach (SLA) is one of the methods to enhance
understanding of the livelihoods of poor household. Sustainable development especially in
developing countries is closely related to improvement of living standards of the poor at the
grassroots level that can be measured quantitatively through increase in food, real income,
education, health, sanitation, water supply and indirectly associated with economic growth at the
national level. Barbier (1987) described the objectives of sustainable development aimed at
reducing absolute poverty by providing a more secured life and long lasting of the poor by
minimizing the extinction of resources, environmental pollution and social and cultural stability.
In the context of sustainable livelihood, components of asset is very crucial in
developing. These assets include tangible assets and resources as well as intangible assets
(claims and achievements). Most sustainability definitions emphasize on the preservation of the
lives on the capabilities to prevent, withstand and recover from stress or shock. Institute for
Development Studies (IDS) and the British Department for International Development (DFID)
(Krantz, 2001) have described a sustainable livelihood as,
A livelihood comprises the capabilities, assets (including both

material and social resources) and activities required for a
120
means of living. A livelihood is sustainable when it can cope

with and recover from stresses and shocks, maintain or
enhance its capabilities and assets, while not undermining the
natural resource base.
In order to achieve a sustainable livelihood, the poor in particular are exposed to

vulnerable situations. Basically, the concept of vulnerable to threat is used and always
synonymous with poverty. But the fact that this concept is different from poverty. Henninger
(1998) and Mcculloch (2003) described vulnerability and poverty is a layered concept but is not
synonymous with each other (Devereux et al. 2006), although the overlap between one another
and lead to food shortages. To ensure that individual livelihood is not affected, Lovendal&
Knowles (2005) emphasized that livelihood activities can be continued based on the quantity
and quality of assets that can be obtained. Scaramozzino (2006) described an asset refers to
the ability to feed themselves in the long term and maintain its use. These assets consist of
social assistance, financial assets, physical assets, natural and human assets. All of these
assets can be obtained through the services provided by the government or private sectors. In
addition, these assets also act as a risk management tool in which it will affect the amount of
food intake (Lovendal& Knowles ,2002).
Human assets one of part livelihood asset. This assets very important to build up identity
and confidence level among individual. Through human assets, individual can generate
opportunities to increase livelihood outcome. Department for International Development (2001)
assumes human assets as a combination of capabilities, skills and knowledge, and material
health which enable households and individuals to make livelihoods and attain secure livelihood
outcome (Krantz , 2001. Human asset entails a combination of abilities that endow the individual
or households or individual towards earning livelihoods accomplishment. Human assets
represents the skills, knowledge, and the ability to work as well as good health that together
enable people to pursue different livelihood strategies and achieve livelihood objectives
(Roberts and Yang, 2003). At the household level, human capital is a factor of the amount and
quality of labor available, and this varies according to household size, skill level, leadership
potential, and health status (Kollmair and Gamper, 2002).
In Malaysia, coastal fishermen communities are vulnerable group that easily exposed to
the out of bound risks such as the occurrence of economic recession, monsoon or tsunami
disaster. These factors contributes directly in achieving well being among fishermen who are
fully dependent on fishing activities as their main source of income and do not have sufficient
other livelihood assets. Lacking in livelihood assets ownership especially human assets, may
result in fishermen‘s households will be trapped in poverty. This trend also affects food security
especially in the pattern of monetary spending on food by this group. Lacking on human assets
will surely reduce the source of income and thus will reduce the amount of money spend for
food, well being and so on. Thus, this paper aim to analyze the level of human assets
possession among coastal fisherman in Northern Peninsular, Malaysia.
2. MATERIALS AND METHODS

2.1. Sampling and Data Collection
Data was collected using a structured questionnaire. The cross-sectional method is
applied to the sample by using stratified random sample which the data is collected to obtain
121
information. According to the statistics of Fisheries Department (2014) explains there are about
5,830 fishermen in Kedah (excluded Langkawi) and 2,117 fishermen in Perlis. From the statistic,
400 fishermen were randomly selected in this study as respondents with four main areas
namely Kuala Perlis (101 households), Kuala Kedah (100 households), Yan (100 households)
and Tanjung Dawai (99 households).
2.2. Development of Fisherman Integrated Human Assets Status Index
A specific Sustainable Livelihood Index (SLI) of agro-community household was

developed to identify potential households that are able to escape from poverty. The
Sustainable Livelihood concept has multidimensional aspects. It includes livelihood assets,
livelihood strategy, livelihood outcome, institutional involvement, and vulnerability context.
Therefore, it is important to select parameters, which are representative indicators of all these
sectors of human-life. With respect to assessing the potential of the coastal fisherman to escape
poverty. This study had identified 5 indicator for human assets.
Index was then constructed using Hahn et al. (2009). Indicators were identified and it is
assumed that each indictor had equal weight to the individual groups of livelihood assets and
outcomes. The indicators were then standardized following the procedure adopted in measuring
Life Expectancy in Human Development Reports (Hahn et al., 2009).
Index sd = Sd – Smin
Smax – Smin
Where, Sd was the original sub-component for community d, and Smin and Smax were the
minimum and maximum values, respectively, for each sub-component determined using data
from the same community surveyed. The household percentiles determined as 0 at minimum
level and 1 at maximum level.
3. results
3.1. Ownership of Livelihood Assets
Human assets: Based on this study, it show 8.5 percent of those who never attended school
among the vulnerability group and 25.75 percent respondents have successfully completed
secondary school education. A total of 26.75 percent respondents has received education at
primary school level only. The study found that respondents vulneralbility group have health
problems which accounted a high percentage of 34.25 percent. Most of the health problems
encountered among the respondents are diabetes, hypertension and heart problem. The
outcome of the survey showed most 73.5 percent of the respondents were found to be never
122
attended a training on any courses. Only 26.5 percent of respondent attended the training and
knowledge program organized.
Index of livelihood assets: Index of the livelihood assets was ascertained based on selected
indicator as a highest level of education Head of Household, working experience, skill,
Knowledge level, health condition and training attend . General scores were calculated by
means of a Composite Index on the basis of the standardized process of the above data.
Results are shown in the following (Figure 1). Of the five indicator in human assets, knowledge
and health condition possessed the moderate high value (0.57,0.59) and followed by training
(0.45), education Head of Household 0.42 and working experience (0.30). This represents
knowledge level among fisherman and health condition would affect human assets in order to
improve the livelihood among coastal fisherman in Northern Malaysia.
level of education
0.6
0.42
0.5
0.4
0.57 0.3
knowledge level 0.2 working experience
0.1 0.3
0
0.59
0.45 skill health condition
Figure 1: Human assets spider diagram for coastal fisherman in Northern Peninsular, Malaysia
4. conclusion and recommendations

Generally, the socio-economic of fishermen communities in Northern Peninsular
Malaysia to showed of persistent poverty among low income groups. They have moderate
situations to access household items, vehicles, electricity and water supply.
In human assets index, it shown that the Northern Peninsular Coastal Area had
moderate in human assets. To increase human asset among this group, fishermen must
actively participate in the capacity and self-efficacy programs organized by Ministry of
Agriculture and Agro Based of Malaysia (MoA) and Fisheries Development Authority of
Malaysia (LKIM) to improve productivity and income. Generally, it is arguable that the value of
the financial support scheme provided by MoA-LKIM is comprehensive because it covers a
variety of dimensions that comprise fundamental-use and investment. However, fishermen are
faced with low capacity building and self-efficacy problems. Therefore, fishermen need to take
the initiative to change attitudes by participating in self-efficacy building programs to increase
123
productivity and have the vision to distant themselves from the violent cycle of inter-generation
poverty by shifting their income to a higher level.
Strategies to increase livelihood among coastal fishermen generally, include providing
holistic support program for micro-enterprises including grants and cheap funding, linking rural
talent pool to employers in nearby clusters and cities, providing opportunities for business
ownership for capable rural entrepreneurs, increasing land productivity and yield through land
amalgamation, improving human capital productivity with rural agriculture and agro-based
industries and expanding the application of the agropolitan concept to other agriculture and
agro-based industries (Malaysia, 2011).
REFERENCES
Barbier, E.B.(1987). The concept of sustainable economic development, Environment

Conservation, 14(2), 101-110.
Department for International Development. (2001). Sustainable livelihoods guidance sheets.

www.livelihoods.org/info/info_guidanceSheets.html#6: DFID.
Devereux, S., Baulch, B., Phir, A.,& Wheeler, R.S. (2006).Vulnerability to chronic poverty and
malnutrition; A report for DFID Malawi. http://www.ids.ac.uk files/ Malawi Vulnerability
Report_Final.pdf.
Fisheries Department of Malaysia. (2014). Number Of Fishermen Working On Licensed

FishingVessels By Equipment Group and State, 2013. Retrieved from www.dof.gov.my
/dof2/resources/user_1/UploadFile/Penerbitan/Senarai Penerbitan /smpp /Table
1.12013pdf
Hahn, M. B, Riederer, A. M., Foster, S. O. (2009). The livelihood vulnerability index: A pragmatic
approach to assessing risks from climate variability and change—A case study in
Mozambique. Global Environmental Change, 19(1), 74–88.
Henniger, N. 1998. Mapping and geographic analysis of human welfare and poverty- review and
assessment, World Resources Institute, Washington: United State of America.
Krantz, L .2001. The sustainable livelihood approach to poverty reduction; an

introduction.Divison for policy and Socioenomic Analysis: Swedish International
Development Cooperation Agency. http://www.forestry. umn.edu/prod/groups
/cfans/@pub/@cfans /@forestry/ documents/ asset/ cfans_asset_202603.pdf.
Kollmair M., &Gamper, S.(2002). The sustainable livelihoods approach. input paper for
integrated training course of NCCR. North-South Aeschiried, Switerland.
http://sheltercentre.org /sites/default/files /SLA_Gamper_ Kollmair.pdf
Lovendal, C.R., & Knowles. M. (2005). Tomorrow‘s hunger: A framework for analyzing
vulnerability to food security, ESA working paper No.05-07:FAO.
ftp://ftp.fao.org/docrep/fao/008/af140e/af140e00.pdf.
Malaysia. (2011). Eleven Malaysia Planning (2016-2020).Putrajaya: Unit Perancang Ekonomi
124
Mcculloch, N. (2003).Vulnerability and choronic poverty in rural Sichuan.World Development,

31(3), 611-628.
Roberts, M. G., &Yang, G. A.(2003). The international progress of sustainable development

research: A comparison of vulnerability analysis and the sustainable livelihoods
approach. Advance in Earth Science, 22(1), 11–21.
Scaramozzino,P. (2006). Measuring vulnerability to food insecurity, ESA Working paper No.06-
12:FAO. ftp://ftp.fao.org/docrep/fao/009/ah630e/ah630e00.pdf
-GP19-
SISTEM HUBUNGAN INDUSTRI: PERBANDINGAN
DI SEKTOR AWAM DAN DI SEKTOR SWASTA
Saadon Awang
Kolej Undang-undang, Kerajaan dan Pengajian Antarabangsa
Universiti Utara Malaysia, Sintok, 06010 KEDAH
Email: saadon@uum.edu.my
Abstrak
Organisasi merupakan tempat di mana himpunan manusia akan berusaha bersama-
sama untuk mencapai matlamat tertentu. Jadi, di dalam sebuah organisasi akan wujudlah
berbagai bentuk interaksi manusia yang menjalankan berbagai aktiviti. Aktiviti-aktiviti manusia
dalam organisasi boleh wujud dalam bentuk menegak, mendatar atau berbagai hala.
Hubungan industri adalah satu bidang yang menjelaskan tentang interaksi manusia secara
menegak, membincangkan tentang hubungan di antara majikan dan pekerja dalam sebuah
organisasi pekerjaan. Organisasi pekerjaan pula beroperasi dalam persekitaran yang berbeza
di sektor awam dan di sektor swasta. Kertas ini membincangkan perbandingan sistem
hubungan industri yang beroperasi di dalam kedua-dua sektor berkenaan. Perbincangan
memberi penekanan kepada aspek-aspek persamaan dan perbezaan sistem hubungan industri
di kedua-dua persekitaran sektor berkenaan.
Kata kunci: hubungan industri, kesatuan sekerja, sektor awam, sektor swasta
PENDAHULUAN
Sesebuah organisasi adalah terdiri daripada kumpulan-kumpulan manusia yang

berusaha untuk mencapai matlamat masing-masing. Wujud berbagai bentuk hubungan di
kalangan manusia untuk mencapai matlamat tersebut. Hubungan-hubungan tersebut boleh
wujud secara menegak, mendatar atau berbagai hala (matriks). Hubungan industri adalah
bidang yang mengkaji hubungan yang wujud secara menegak di kalangan manusia dalam
organisasi, iaitu di antara majikan dan pihak pekerja.
Konsep hubungan di antara majikan dan pihak pekerja ini dinamakan hubungan industri
kerana mengambil sempena zaman di mana munculnya konsep-konsep, teori-teoridan gerakan
organisasi buruh untuk tujuan mengimbangikuasapemilik-pemilikindustri yang selalu menekan
125
golonganpekerja.Zamanitu dikenalisebagaizaman perindustrian, yang mewujudkan organisasi-

organisasi pekerjaan bentukbaru ( m o d e n ) , d a n m e n g u b a h hubungan sosial berbentuk
`tuan-hamba‘ (master-servant), kepada hubungan `majikan-pekerja‘ (employer-employee)
seperti yangdapat dilihat padahariini. Organisasi-organisasi bentuk l a m a ( tradisional)yang
telah mewujudkan ruang kepada golongan atasan untuk mengeksploitasi golongan bawahan
melalui pendekatan unilateral dan gaya kepimpinan autokratik telah diganti dengan
organisasi-organisasi pekerjaan bentuk baru yang menekankankepada perundingan dan
tawar menawar, serta wujudorganisasi formal dengan sistemgaji,upahdan faedah-faedah
pekerjaan yang lebih sistematik. Pekerja-pekerja turut memiliki kuasa tawar dalam
menentukan suasana dan peraturan-peraturan pekerjaan yang akan dilaksanakan oleh
organisasi ke atas mereka sepanjang melaksanakan proses kerja mereka.
Persekitaran di mana berlakunya perkembangan hubungan industri ini dikenali

sebagai sistem kapitalisme (capitalism). Organisasi-organisasi buruh atau ‗pertubuhan
berasaskan pekerjaan‘pula dikenali sebagai kesatuan-kesatuan sekerja(tradeunions).Olehyang
demikian,perbincangan mengenai bidang hubungan industry tidak akan dapat mengelak
daripada membincangkan tentang gerakan kesatuan-kesatuan sekerja, sama ada di pihak
majikan atau pekerja.
SISTEM HUBUNGAN INDUSTRI DAN KESATUAN SEKERJA
Wu Min Aun ( 1 9 9 5 : x v i i ) mendefinisikan hubunganindustri sebagai ‗satu subjek yang

berkaitan dengan hubungan di antara majikan atau kumpulan majikan dan kaki tangan, dan
kaedah-kaedah yang mereka gunakan dalam hubungan sesama mereka itu‘. Kesatuan sekerja
majikan atau kesatuan sekerja pekerja menjadi `satu ejen yang penting dalam sistem hubungan
industri‘. Clegg(1972:1) pula melihathubunganindustrisebagaibidangyang‗berkaitan dengan
tindakan-tindakan mogok, perundingan-perundingan di antara kesatuan-kesatuan sekerja dan
majikan-majikan, dan campur tangan kerajaan berkaitan tindakan-tindakan mogok dan
perundingan-perundingan‘, dan juga berkaitan `peraturan-peraturan untuk mentadbir
pekerjaan, atau peraturan-peraturan untuk mengatur tugas-tugas‘,yangsecara umumnya boleh
didefinisikan sebagai ‗satu bidang kajian berkaitan peraturan-peraturan kerja‘. Maimunah
Aminuddin (1992: 205) menambah bahawa hubungan industri adalah
bidangkajianyangtidakdapatdipisahkandaripadapenglibatan kesatuan sekerja.
Hubungan industri yang juga dikenali sebagai ‗hubungan buruh‘ (labour relations) atau
‗hubungan pekerja‘ (employee relations) biasanya akan wujud dan beroperasi dalam
persekitaran organisasi yang membenarkan wujud kesatuan (unionized environment). Bentuk
hubungan antara pekerja dan majikan dalam persekitaran organisasi tanpa berkesatuan (non-
unionized environment) pula wujud dalambentuk `hubunganmanusiadalamorganisasi‘. Maka,
kesatuan sekerja dianggap sebagai alat penghubung yang penting dalam sistem hubungan
industri. Ini disimpulkan dalam tiga perundangan berkaitan hubungan industri di Malaysia,
yang mendefinisikan kesatuan sekerja sebagai pertubuhan orang-orang yang bekerja dalam
pekerjaan yang sama, serta memainkan peranan mewakili dan terlibat dalam sebarang
bentuk aktiviti yang menghubungkan pihak pekerja dan pihak majikan dalam organisasi (Akta
Kesatuan Sekerja 1959, Akta Perhubungan Perusahaan 1967 dan Akta Kerja 1955).
Sebagai satu bidang kajian akademik, hubungan industri adalah satu bidang multi-
disiplin, iaitu bidang yang berdiri dengan sokongan disiplin-disiplin yang lain. Antaranya
adalah bidang ekonomi, sains politik, sosiologi, psikologi, di samping bidang-bidang yang ada
perbandingan tidak langsung seperti pengurusan sumber manusia, hubungan manusia dalam
126
organisasi, dan undang-undang. Oleh itu, kita akan mudah memahami tentang bidang
hubungan industri apabila kita mengkaji konsep dan teori bidang-bidang sokongannya itu.
SEKTOR AWAM DAN SEKTOR SWASTA
Sebelum dapat membincangkan perbandingan sistem hubungan industri di sektor awam

dan di sektor swasta, terlebih dahulu kita perlu memahami persekitaran di mana kedua-dua
sistem itu beroperasi. Sektorawammerupakan sektorkerajaandimanakerajaanmerupakan
majikan yang membayar gaji dan upah kepada mereka yang bekerja dalamsektorini.
Kakitangansektorkerajaandipanggilkakitangansektor awam.Dalamkonteksnegara,sektorawam
menjadipersekitaranbagi perkhidmatan awam melaksanakan segala dasar kerajaan. Sektor
awam melaksanakan fungsi untuk mencapai matlamat kesejahteraan sosialsesebuahnegara.
Sektor swasta pula merupakansektor bukankerajaan.Seseorangindividuatau

sekumpulanindividumengeluarkanmodal untukmewujudkan organisasi-organisasi dalam sektor
ini. Modal persendirian digunakan untuk membayarupahdangaji kakitangan yang bekerja
dengan mereka.Mereka yangbekerjadalamsektorini dinamakan kakitangan sector swasta.
Organisasi-organisasi swasta berfungsi untuk mencapaimatlamat keuntungan atas modal yang
dilaburkan.
PERBANDINGAN SISTEM HUBUNGAN INDUSTRI DI SEKTOR AWAM DAN SWASTA
Perbincangan tentang perbandingan sistem hubungan industri di sektor awam dan di

sektor swasta melibatkan huraian dari sudut persamaan dan perbezaan sistem di kedua-dua
sektor berkenaan.
a) PERSAMAAN
Beberapa persamaan tentang hubungan industri di sektor awam dan sektorswasta

adalah:
(i) Faktor keperluan manusia
Kedua-dua bentuk organisasi, sama adayangberoperasidi sektorawam atausektor swasta,

berfungsi menguruskan sumber manusia dan sumber bukan
manusiakearahmencapaimatlamatyangditetapkan. Maka, sumbermanusiamenjadi salahsatu
sumberdalam kedua-duabentukorganisasi. M anusiadalam mana-mana organisasi mempunyai
keinginan untuk memenuhi kehendak-kehendak fisiologikal, fizikaldan psikologikal. Olehitu,
Hirsh & Addison (1986:9), Jackson (1991:22) dan Rothman et.al.
( 1 9 9 3 : 4 ) m e n y i m p u l k a n b a h a w a sistemhubunganindustri i t u lebih merupakan
proses artikulasi bagi mencapai kesejahteraanhidupkhasnyadi tempat kerja, akan menjadi
medan perjuangan kumpulan-kumpulan di mana sahajaketidakpuasan berlaku, samaada
disektorawamataudisektor swasta.
(ii) Fokus kepada factor ekonomi
Faktor ekonomi dikaitkan dengan usaha mencapai kesejerahteraan hidup seseorang. Walau di
dalam sistem hubungan industrimana sekalipun, usaha untuk mencapai kesejahteraan hidup
akan menjadi fokus utamaprosesartikulasiitu dihalakan. Ini bersamaan dengan usaha ke arah
127
mencapai status ekonomi yang lebih baik dan sejahtera. Flanagan(1985:4)menjelaskan bahawa
kewujudan organisasi buruh yang berjuang untuk mencapai kesejahteraan ekonomi menjadi
satu ciri penting bagi organisasi pekerjaan walau dalam negara mana sistem itu beroperasi.
(iii) Persainganantarakumpulan
Hubunganindustrisecara umum mewujudkan persekitaran yang menonjolkanperjuangan

organisasi-organisasi berasaskan pekerjaan (seperti kesatuansekerja)untuk
mencapaimatlamat kumpulan tertentu. Dalam sistem sosial kumpulan-kumpulan ini
mungkinmewakilikelas-kelas tertentu,sepertikelasbawahan(pekerja)
dankelasatasan(pengurusan). Olehitu,persamaan yangwujuddalam sistemhubunganindustridi
sektorawamdan sektorswastaialah wujudnya perjuangankelas bawahanmenentangkelas
atasan,atau sekurang-kurangnya untuk mencapai persetujuan bersama di antara kelas-
kelastersebut.
(iv) Perjuanganyangsempit
Di dalamsistemhubunganindustrimana sekalipun,perjuangan pertubuhan-pertubuhan pekerja

menurut Niland et al. (1994:3), adalah bercorakperjuangansempit(parochial)kerana
tumpuanperjuangan kelompoktertentuadalahuntukmencapaimatlamatorganisasi atau sesebuah
negara tertentu sahaja. Jadi, satu persamaandarisegicorakperjuangankesatuan-kesatuan
sekerjasektor awamdansektorswasta a d a lahuntukmembelaahli-ahlidalampekerjaan
atauindustriyangsamaterlebihdahulu.
b) PERBEZAAN
Manakala perbezaan-perbezaan tentang hubungan industri di sektor awam dan sektorswasta

yang dapat dikenalpast adalah:
(i) Hasilpenawaran b er sam a danbukanhasilpenawaranbersama
Pendekatan sistemhubunganindustri untuk memenuhi faktor-faktorkesejahteraandi

tempatkerjabagisektorawamdansektor swastaadalahberbeza. Ayadurai (1998:11) dalam
kajiannya mengenaihubunganindustridiMalaysia mendapati wujud dua sistem hubungan
industri di Malaysia, satu di sektor swasta dan satu lagi di sektor awam. Di sektor swasta,
dikatakan ruang-ruang perundingan adalah lebih terbuka bagi pekerja-pekerja menuntut hak-
hak mereka. Ini kerana, dalamsuasanapersaingan,organisasi-organisasiakan bersainguntuk
menyediakan segala keperluan yang kompetitifbagimenarikatau mengekalkan tenaga
kerjamereka.Bolehdikatakankebanyakansyarat-syaratdan faedah-faedah pekerjaan ditentukan
melalui mekanisme perundinganyangtercatatdalamperjanjianbersama.
Manakala di sektor awam, ruang-ruang perundingan dikatakan agak sempitkeranasyarat-

syaratdan faedah-faedahpekerjaanadalahdikawal oleh
kerajaan.Kerajaanmewujudkanpekerjaanbesertasyarat-syarat pekerjaan melalui kuasa sah
(legitimate) dan dilindungi oleh undang- undang. Undang-undang inimemberi perlindungan
kepadakakitangan awammelaluiskim perkhidmatan,jaminanpekerjaandan persaraan
kakitangan.Olehitu, kakitanganawamtidakmempunyairuangyang luas
untukmembuattuntutankeranasegalayangdiperlukanadalahterjamin
danjelassepertiyangtermaktubdalamsyarat-syaratpekerjaan..
128
(ii) Penawaranduahaladanpenawaranpelbagaihala
Sistemhubunganindustridisektorswastadikatakanhanyamelibatkan
duapihak,iaitupihakatasandan pihakbawahandalamorganisasi.Pihak atasanadalahpihak
pengurusanyang terdiridaripadamajikan,Lembaga Pengarah(bagipihakpemegang-
pemegangsaham)dan pengurus- pengurusnya. Pihakbawahan pulaadalahpekerja-pekerja
yangterlibat dalamprosespengeluarandan penyeliaandalamorganisasi.Apabila
penawaranbersamadilakukandi antarapihakpekerjadanmajikan,ianya adalah berbentuk
penawaran duahalakerana hanya duapihak dalam organisasitersebutyang akan
membuatkeputusan.
Manakala sistemhubungan industri disektorawamadalahmelibatkan banyakpihakyang

terdiridaripadapihakkerajaan,kakitanganawamdan
orangawam.Inijelasdengankedudukanperkhidmatanawamitu sendiri
yangterletakdibawahpentadbiran kerajaan,dimanakerajaansebagai majikanbagi
sektorberkenaan. Pentadbiran kerajaan itu sendiri
melibatkantigakuasautamaiaitueksekutif,legislatifdan kehakiman,
manakalarakyatpulamenjadipembayarcukaidan penggunakepada perkhidmatan yangdisediakan
olehkerajaan. Olehitu, apabila sesuatu perundinganantarakakitanganawamdan
kerajaandiadakan,ia dikatakan sebagai perundinganpelbagai hala.
(iii) Persekitaranpasaran
Sektor swasta dikatakan beroperasi dalam persekitaran yang penuh persaingan, mengikut
sistemkapitalis yangberteraskanekonomipasaran. Mekanisme pasaran akan menentukan
segala faktor permintaan dan faktor penawaran yang terlibat. M a k a , sektor swasta perlu
sentiasa responsif kepada keadaan pasaran yang kompetitif, dan turut memandang
beratakankeadaan-keadaan pekerjaan untukmengelakkan wujudrasa ketidakpuasandi
kalanganpekerja. Salahsatu cara yang digunakan ialah dengan membenarkan pekerja
berbincangdengan majikanuntuk menentukansegalakehendakdan
keperluanuntukmenjaminkeselesaan dankesejahteraan ditempat kerja.
Persekitaranyangberbezawujuddi sektorawam.Kebanyakan perkhidmatan yangditawarkan

tidakberlakudalamsuasanapersaingan bebas pasaran,sebaliknyabersifatmonopoli. Ini
tidakbanyak memberipilihankepadapenggunasekiranyatidakberpuashati dengan perkhidmatan
yangdiberikan.
(iv) Statustindakanperusahaan
Tindakan-tindakanperusahaanmerupakansalahsatucara untuk
menyelesaikankonflikperusahaandi antarapekerjadanmajikan.Tindakanperusahaanmempunyai
kaitandenganpengiktirafankesatuan-kesatuansekerjaoleh majikan. Kebanyakanorganisasi
disektor swasta membenarkan pekerja-pekerja menubuhkan kesatuan dan mengiktiraf
kesatuan-kesatuan berkenaan, yang secara tidak langsung menjadikan tindakan perusahaan
yang mengikut prosedur yang betul menjadi sah.
Di sektor awam pula, status tindakan perusahaan adalah berbeza.

Sebagaimemenuhikonsepkebebasan mengorganisasikankesatuandalam
organisasisepertidipersetujuimelalui KonvensyenNo. 87
Tahun1948PertubuhanBuruhAntarabangsa(ILO),
129
kebanyakankerajaanmembenarkankakitanganawam untuk menubuhkan kesatuan-

kesatuansekerjadan mengiktirafkesatuan-kesatuanberkenaan. Bagaimanapun, sebagai sektor
kerajaan yang memikul tanggungjawab sosial,
kakitanganawamtidaklahmendapatsepenuhkebebasanuntuk melaksanakan tindakan-
tindakanperusahaansebagailangkah menyelesaikanpertikaiandengan kerajaan.Sektor
awammerupakan sistem yang melibatkan berbagai pihak dan tindakanmerekaadalahdi
bawahpemerhatian(scrutiny)orangawam, dan kerajaan biasanya mengeluarkan arahan-arahan
yangmenjadigarispanduan pelaksanaan dantatakelakuan kakitangan awam, termasuklah
berkaitan tindakan-tindakan perusahaan o l e h agensi-agensi awam.
(v) Konsepkedaulatankerajaan
Kerajaan sesebuah negarayang berdaulat berfungsi untuk melindungirakyatdan

mempertahankansempadannya.Olehitu, perkhidmatanawamsebagaiejen yang
melaksanakandasar-dasarkerajaan memikultanggungjawabdi
bawahkonsepkedaulatankerajaaninike arah mencapai matlamat kesejahteraan sosial dalam
sesebuah negara. Oleh yang demikian, kerajaan perlu mengawal perkhidmatan awam
supayatidakberlakukonflikdengankerajaanyang bolehmencemarkan
kedudukankerajaanpadapandanganpihaklain. Maka,adalahwajar mana-
manakerajaanmerekabentuk sistemhubunganindustridi sektorawamyangselarasdenganaspirasi
sesuatukerajaanyangmemerintahagar segalafungsikerajaandapat
dilaksanakansepertiyangdikehendaki.
Sektorswastapulamerupakansektorpersendiriandi manapelaksanaan fungsinyatidak

melibatkanpihak kerajaansecara langsung.Kedudukan sektorswastadalamsesebuahnegaratidak
disebutdalamperlembagaan, jadi kewujudanataulenyapnyamana-manaorganisasibukanlahhasil
keputusan oleh pihak kerajaan. Disebabkan individu mengeluarkan modal
persendirianuntukmenubuhkanorganisasi,faktor keuntungan dalambentukwang
menjadimatlamatutamasektorswasta.Organisasi sektorswastamemerlukankeuntunganke
atasmodaluntukmeneruskan hayat(survive)di
dalamsistemekonomi.Disebabkankeputusanorganisasi
swastaadalahkeputusanpihakpersendirian,ia kurangmemberipetunjuk kegagalan kerajaan yang
memerintah dari pandangan orang awam.
(vi) Konsepkedaulatanrakyat
Rakyat juga merupakan salah satu elemen yang membentuk sebuah negara.Bagi rakyatyang
sah,merekayang diperintahmelaluisistemdemokratik mempunyai suara dalam proses politik
dan turut terlibatdalamprosespembuatandasar-dasarnegara.Ini dilakukanmelalui wakil-
wakilyangmerekapilih untukmewakilimerekadi dewan perundangan.Dalamkeadaanini,
perkhidmatanawamyang melaksanakan fungsi kerajaan adalah sebenarnya melaksanakan
fungsi bagipihakrakyatyang memilihmereka.Konsepkedaulatanrakyatinilah yangmenyebabkan
sistemhubungan industrisektorawamtidakdapat dilaksanakansepertimanapengertian
konsepnya. A dalahtidakwajarkerajaanyang dipiliholehrakyatbolehmembuat
keputusantanpa merujukkepadamereka,sebaliknyamelaluikesatuan-
kesatuanyangmerupakandikalangankakitanganawamsahaja.
Sebaliknyadi sektorswasta,perananrakyat(orangawam)adalahsebagai pelangganatau

penggunasahaja,kecualimerekayangturutmemegang saham-sahamawam. Orangawamtidak
terlibatdalamprosespembuatan keputusan bagi organisasi-organisasiswasta.Syarat-syaratdan
faedah-faedah pekerjaan boleh ditentukan di antara majikan dan pekerja sahaja.
130
(vii) Bentuk pekerjaandisektorawam
Sektorawam didominasikanoleh pekerja-pekerja kolar putih. Jelasnya, saiz sektor awam yang
begitubesarmenyebabkanwujudketidakseimbangandarisegiperwakilan
berdasarkanjantina,mengikutwilayah,statuspekerjaandansebagainya.
Sebagaisektoryangberbentukmonopoli,kelompok-kelompok initidak
dapatmembuatpilihanuntukmenentukanorganisasiyang selaridengan
kepentinganmerekamelainkanteruskekaldan memendamperasaan masing-masing. Kepentingan
yangberbeza-beza initelah mewujudkan kumpulan-kumpulan
yangmembawahaluanperjuanganmasing-masing. Tambahanpula
dengankedudukangolonganprofesionalyang begitu hampirdan
turutterlibatdalamprosespembuatandasar-dasarkerajaan, telah menyebabkan mereka mendapat
kelebihan untuk menerimahabuanyanglebihbaikdarisegijaminankerjasepertiimbuhan
perkhidmatan, persekitaran kerjadanfaedah-faedah persaraan menyebabkan mereka tidak
mempunyai sebab yang kukuh untuk menyuarakan rasa
tidakpuashatiterhadapkerajaan.Kesemuafaktorini menyebabkan perjuangan kesatuan-kesatuan
sekerja di sektor awam menjadi agak lemah.
Sementara itu, sektor swasta yang lebih dikuasai pekerjaan berbentuk pengeluaran, yang
dapat dikaitkan dengan pekerjaan kolarbiru.Dalamsektoryang
beroperasiberasaskanpasarandan membenarkanpersaingan,pekerja-pekerja akanberusaha
mencapai apa yangterbaikbagi merekamelaluiperbandingandengankumpulan- kumpulanlain
dalamorganisasi,ataupundenganorganisasi-organisasilain dalam industri yang sama.
Tambahan pula, dalam sistem hubungan industri sektor swasta yang membenarkan
mekanisme perundingan bersamadantindakan-tindakan
perusahaandilakukan,parapekerjaakan menggunakanpeluangini
dengansepenuhnyauntukmencapaimatlamat perjuanganmereka.Faktor-faktorini
menyebabkanperjuangankesatuan- kesatuansekerjadi
sektorswastamenjadilebihaktifberbandingkesatuan- kesatuandisektorawam.
(viii) Faktorperundanganberkaitanpekerjaan
Kerajaansentiasa mengambil langkah-langkah untuk memastikan

kakitanganawammelaksanakantanggungjawabsepertiyangdiharapkan. Diantara langkah-
langkah yangdiambil ialah dengan memperkenalkan undang-undangdan
peraturanberkaitanpekerjaanyangselaridengan aspirasikerajaanyangmemerintah.Ini
termasuklahrekabentuksistem hubungan industri sektor awam yang boleh membantu
mencapai matlamatpelaksanaandasar-dasar kerajaan.
Sementaraitu, sektorswastatidakterlibatsecaralangsungdalamproses pelaksanaan dasar-dasar

kerajaan.Dariperspektif sektorswasta,segala undang-undangberkaitanpekerjaanadalahdibuat
berdasarkanhubungan kerajaan dengan rakyat, bukannya sebagai kawalan keatas kakitangan.
Sistem yang diamalkan adalah berbentuk sukarela bukanmandatori, yang memberikan
peluang kepada sistem dalam sektor ini untuk beroperasi dengan lebih bebas mengikut
konsep hubungan industriyangsebenarnya.
(ix) Persainganantarasektor
Kitatelah mengetahui bahawasektorawamadalah ejenyang melaksanakan segala dasar
kerajaan. Perkhidmatan awam merupakan
131
sektorkerajaanyangbertujuanmencapaimatlamatkesejahteraan sosial rakyat secaraumumnya.

Sektor swastapula merupakansektor persendirian yang mempunyai matlamat mencari
keuntungan material (dalam bentukwang).
Perbezaan matlamat ke arah kesejahteraan sosial dan keuntungan mewujudkan perbezaan
dari segi perjuangan di sektor awam dan sektor swasta .Ini turut mempengaruhi system
hubungan industribagi kedua-duasektor berkenaan.Sebabinilahjuga,dalamkebanyakan negara
wujud dua sistem hubungan industri sama ada secara nyata atau sebaliknya (explicit or
implicit) untuk memenuhi aspirasi kakitangan sector awam dan sektor swasta. Sistem
hubungan industri sector awam mungkin agak terikat bentuknya(structured)dan
direkabentuk(design)oleh kerajaan bagi tujuan menjadi agen yang bertanggungjawab
melaksanakan segala dasar awam. Sistem ini dilihat lebih dipengaruhi oleh idea unitaris
yang menekankan konsep hubungan industri melalui pendekatan unilateral. Sebaliknya, sistem
hubungan industri sektor swasta yang dipengaruhi oleh idea pluralis (Flanders, 1968)
yang lebih bebas menggunakan pendekatan bilateral.
Perbezaan matlamat di kedua-dua sektor ini secara tidak langsung mewujudkan suasana yang
bertentangan dari sudut pandangan dan perjuangan kedua-dua sektor.
Sektor awam membelanjakan wang awam untuk pembangunan ekonomi, sosialdan politik bagi
pihak kerajaan yang memerintah, manakala sektor swasta melaburkan modal persendirian
untuk menentukan hayatnya (survival) dalam persekitaran dimana ia beroperasi. Oleh itu,tidak
mustahil wujud rasa curiga mencurigai di antara satu sector terhadap sektor yang lain.
Mungkin tidak ada pihak yang sanggup melihat hanya satu pihakyang mendapat manfaat atau
hanya satu pihakyang menerimatuduhansebagaibersikapketerlaluan(militant) sedangkan isu-isu
yang diperjuangkan adalah untuk kebaikan bersama.
KESIMPULAN
Sektorawamdansektor swastamerupakan duapersekitaran dimana organisasi-

organisasibolehberoperasi.la jugamembolehkanberbagai proses di dalam organisasi itu
melaksanakan fungsinya. Salah satu daripadaprosesdalam organisasiialah
sistemhubunganindustriyang membincangkan
mengenaihubungandiantarapihakmajikandanpihak pekerja.
Perbincangan dalam kertas ini menunjukkan bahawa kedua-dua sector mempunyaidua

matlamat yang berbeza,satu untuk mencapai kesejahteraan sosial dan satu lagi untuk
mencapai keuntungan ke atas modal yang dilaburkan .Perbezaan matlamat ini telah
mewujudkan satu kerangka perbandingan sistem hubungan industri yang boleh dilihat dari
sudut persamaan dan perbezaan. Persamaan sistem hubungan industri di kedua-dua sector
lebih merupakan perbandingan suatu sistem secara umum dan bersifat
konseptual.Umpamanya dalam perbincangan,kita banyak menumpukan kepada konsep
manusia, pekerjaan, naluridankehendak secara umum yang dimiliki
olehseseorangmanusiasecarauniversal. Perbezaan sistem hubungan industridi kedua-dua
sektorpula merujuk perbandingan di antara sistem secara khusus dan bersifat praktikal.Di
dalam perbincangan kertas ini,telah diutarakan perbandingandari segi amalan dan kesan
perlaksanaan ke atas sistem di mana hubungan industri itu beroperasi.
Kesimpulannya, sistem hubungan industri seperti mana proses-proses lain dalam organisasi
132
juga dipengaruhi oleh persekitaran di mana ia beroperasi,sama ada secara umum atau secara
khusus. Pengaruh persekitaran ini boleh mewujudkan perbandingan sama ada secara
persamaan atau perbezaan.Perbandingan persekitaran sektor awam dan sektor swasta ini
membolehkan kita memahami tentang sistem dan proses hubungan industri yang berlaku
didalam dan diantara kedua sector berkenaan.
Rujukan
AktaKerja1955 (Akta 265).KualaLumpur:International Law Book

Services.
Akta Kesatuan Sekerja 1959 (Akta 262) & Peraturan- Peraturan.KualaLumpur:
InternationalLawBookServices.
Akta Perhubungan Perusahaan 1967 (Akta 177). Kuala Lumpur: InternationalLaw
BookServices.
Ayadurai, Dunston. (1985). The employer, the employee, and the law in
Malaysia. Singapore: Butterworths Publishers.
Clegg,H.A.(1972).The system of industrial relations in GreatBritain.Oxford: Basil
Blackwell.
Clegg,H.(1979). ThechangingsystemofindustrialrelationsinGreatBritain.
Oxford:Blackwell.
Flanagan,RobertJ.(1985).Economics of the employment relationships.Glenview,
IL:Scott,ForesmanandCo.
Flanders,A.(1968).Management and unions.London:Faberand Faber.
Hirsch,BarryT.,&Addison,JohnT.(1986).The economic analysis of unions:New
approachesandevidence.London:Unwin-HymanLtd.
Jackson, MichaelP.(1991).An introduction to industrial relations. NewYork:
Routledge,Chapman and Hall,Inc.
Pertubuhan Bangsa-bangsa Bersatu (United Nations). Konvensyen No. 87 Tahun1948
Pertubuhan Buruh Antarabangsa(ILO). New York: United Nations
MaimunahAminudin.(1992).Human resource management.KualaLumpur: Fajar
Bakti.
Niland,JohnR.,LansburyRussel.D.,&Verevis,Chrissie.(1994).Thefutureof
industrial Relations:globalchangeandchallenges.London:SagePublications
Rothman,M,Briscoe,DennisR.,&Roul,C.D.(1993).Industrialrelationsfor
multinationalcompanies.NewYork:WalterandGruyter.
WuMinAun.(1985).Undang-undangperhubunganburuhdiMalaysia.Petaling
Jaya,Selangor:HeinemannMalaysiaSdn.Bhd.
-GP20-
Keberkesanan Program Keusahawanan Dan Transformasi Nelayan Di Pulau
Langkawi, Kedah
Abdul Jabbar Bin Mohamad Yusuff1, Mohd. Nazaruddin Bin Yusoff2,

Za’im Bin Ahmad3, Azlizan Talib4
133
1,2,3,4
Kolej Undang-undang, Kerajaan dan Pengajian Antarabangsa, Universiti Utara Malaysia Sintok
Kedah.
1 2 3
abdul_jabbar@gsgsg.uum.edu.my, nazaruddin@uum.edu.my, zaim@uum.edu.my,
4
azlizan@uum.edu.my
Abstrak
Komuniti nelayan pesisir pantai adalah sebuah komuniti nelayan yang menjalankan aktiviti
penangkapan ikan di kawasan pinggir laut dan kurang 30 batu nautika dari pantai. Nelayan
pesisir pantai menjalankan aktiviti penangkapan ikan menggunakan bot-bot kecil atau sampan
serta peralatan menangkap ikan tradisional. Terdapat seramai 85,373 orang nelayan pesisir
pantai yang terdapat di Malaysia dan merupakan penyumbang terbesar hasil pendaratan ikan di
negara ini. Walaupun komuniti ini merupakan penyumbang terbesar hasil pendaratan ikan tetapi
mereka masih bergelut untuk mencapai kehidupan yang selesa disebabkan ketidakstabilan
pendapatan yang diperolehi dan ketidakmampuan mereka untuk menjana ekonomi ke tahap
yang lebih baik. Pihak kerajaan telah menyalurkan pelbagai jenis bantuan dan melaksanakan
berbagai program pembangunanbagi menyelesaikan permasalah komuniti ini. Tetapi program-
program pembangunan yang telah dilaksanakan seakan-akan tidak memberi impak yang benar-
benar merubah ekonomi mereka. Kajian akan melibatkan seramai 175 responden yang dipilih
secara rawak di kawasan Kuala Kedah bagi mengenalpasti keberkesanan program
pembangunan ekonomi kepada komuniti nelayan pesisir pantai di kawasan tersebut daripada
aspek persekitaran komuniti, sikap, gaya hidup dan pengurusan kewangan nelayan, peranan
agensi dan menilaistrategiperlaksanaanterhadap program
pembangunanekonominelayanpesisirpantai.Makakajianiniperludijalankansupayaperancangan
program-program
pembangunantransformasinelayandapatdilaksanakandenganlebihberkesandankomunitinelayan
pesisirmendapatmanfaatsepenuhnyadaripada program
dankedudukanekonomimerekalebihstabilsertamampumenjalanikehidupan yang lebihbaik.
Kata kunci: keberkesanan program, pembangunan, transformasi, nelayan pesisir pantai
1. PENGENALAN
Sektor perikanan berperanan dalam menyediakan sumber makanan (ikan), mewujudkan

peluang pekerjaan dan pendapatan bagi penduduk-penduduk tempatan yang tinggal di pesisir
pantai. Sektor ini juga turut memainkan peranan penting dalam pembangunan sosial dan
ekonomi Malaysia terutamanya kepada penduduk yang tinggal berhampiran pesisir pantai.
Aktiviti penangkapan ikan pesisir pantai adalah satu kegiatan sara diri serta menggunakan
kaedah tradisional. Nelayan tradisional adalah golongan nelayan yang hanya menggunakan
perahu dan bot-bot kecil manakala perkakasan menangkap ikan yang mudah serta ringkas.
Program pembangunankomunitinelayantelahbermulaselepaskerajaanmemperkenalkan
DEB pada 1970.MenurutMohammad Raduan Mohd Ariff, Mohammad Sharir, Ismail Ali, Mazlan
Majid & Hanafi Hussin (2011),pihakkerajaantelahterlibatdalammerencanadanmelaksanakan
program pembangunanperikanandariperingkatpengeluaran,
pendaratandanseterusnyahinggakeperingkatpemasaran. Sehingga kini kerajaan masih
membantu komuniti nelayan tiga kategori utama iaitu bantuan kewangan, kemudahan
infrastruktur nelayan dan program pembangunan dan transformasi nelayan yang memfokuskan
peningkatan pendapatan para nelayan.
134
Walaupun pelbagai usaha daripada kerajaan telah dilaksanakan, sektor perikanan

masih lagi tidak mampu menyaingi pencapaian kemajuan yang dikecapi sektor-sektor lain
seperti pertanian dan penternakan. Malahan golongan nelayan pesisir pantai masih bergelut
dengan isu ketidakstabilan pendapatan dan ketidakmampuan menjana pendapatan hasil
daripada projek-projek pembangunan yang telah dilaksanakan oleh kerajaan.
2. Pernyataan Masalah
Walaupun pelbagai inisiatif yang dijalankan oleh pihak kerajaan dalam membangunkan
komuniti nelayan pesisir pantai, didapati program-program pembangunan yang telah
dilaksanakan seakan-akan tidak memberi impak yang benar-benar merubah kehidupan mereka.
Ini telah menimbulkan seribu satu persoalan, mengapakah perkara ini berlaku? Adakah projek
pembangunan yang dilaksanakan kerajaan tidak sesuai? Adakah komuniti nelayan tidak mahu
berubah?
Sehingga kini, masih tiada kajian yang benar-benar mengaitkan impak program-program
pembangunan tersebut dengan melihat daripada sudut dimensi keperluan nelayan, kesesuaian
dan kebolehcapaian objektif program pembangunan nelayan. Melihat daripada perlunya kajian
berkaitan program pembangunan nelayan, pengkaji telah memilih satu program pembangunan
nelayan bagi dijadikan subjek kajian iaitu program agropreneur muda sangkar laut terbuka di
Langkawi, Kedah. Maka satu kajian berkaitan impak program-program pembangunan komuniti
nelayan pesisir pantai perlu dilaksanakan dengan memberikan tumpuan dari aspek kesesuaian
program, memenuhi keperluan nelayan, kebolehcapaian objektif program dan melihat tahap
keterlibatan nelayan dalam menjayakan program-program tersebut.
3. Objektif
Objektif kajian ini adalah untuk menganalisis sejauh manakah program keusahawanan dan
transformasi ekonomi nelayan berkesan kepada peserta di Pulau Langkawi, Kedah dengan :
a) Mengenal pasti keberkesanan program keusahawanan yang diterapkan kepada
golongan sasar di Pulau Langkawi, Kedah.
b) Meneliti perubahan ekonomi kepada golongan sasar.
c) Menyelidiki masalah-masalah yang dihadapi dalam perlaksanaan program
keusahawanan kepada golongan sasar.
4. Kepentingan Kajian
Kepentingan kajian ini adalah seperti berikut:
I. Kajian yang akan dilaksanakan akan mengupas lebih lanjut isu dan permasalahan
dikalangan nelayan dalam menceburi bidang ternakan ikan laut melalui kaedah ternakan
sangkar laut terbuka.
II. Kajian yang dijalankan akan menghasilkan penemuan secara jelas keperluan nelayan
pesisir pantai terhadap keperluan program pembangunan yang sesuai dilaksanakan
seiring dengan cara nelayan menjalani kehidupan mereka.
III. Hasil kajian ini akan membantu pihak kerajaan melakukan penambahbaikkan dalam
merancang dan melaksanakan program pembangunan yang melibatkan komuniti
nelayan pesisir pantai pada masa hadapan agar kesesuaian program yang dijalankan
dapat mencapai objektif program tersebut.
135
IV. Daripada hasil-hasil penemuan kajian juga akan turut menyumbang kepada
perkembangan ilmu pengetahuan berkaitan komuniti nelayan pesisir pantai serta
menjelaskan kesalahfahaman pihak kerajaan dalam memahami denyut nadi komuniti
nelayan dalam membantu mengubah kehidupan para nelayan ke tahap yang lebih baik.
5. Skop Kajian
Kajian yang akan dilaksanakan akan merangkumi isu dan masalah yang dihadapi serta
impak dari segi ekonomi kepada 12 orang peserta yang terpilih untuk menyertai program
agropreneur muda sangkar laut terbuka di Langkawi. Pengkaji hanya akan mengkaji para
peserta bagi program tersebut yang terlibat dengan ternakan ikan laut dalam sangkar laut
terbuka yang telah dijalankan di perairan Langkawi, Kedah. Pemilihan para peserta bagi kajian
ini adalah bertepatan dengan hasrat pengkaji yang ingin menjalankan kajian terhadap impak
ekonomi ke atas peserta setelah menerima bantuan seperti program pembangunan ini yang
menyasarkan peningkatan pendapatan kepada para peserta dan seterusnya mampu mengubah
kehidupan para peserta yang terlibat.
6. Komuniti Nelayan Pesisir Pantai
Komuniti nelayan pesisir pantai adalah satu komuniti yang sering menjadi perhatian para
pengkaji disebabkan pelbagai masalah dan cabaran-cabaran yang terpaksa diharungi bagi
memastikan kemandirian hidup mereka mampu diteruskan. Wan Hashim (1980) menafsirkan
nelayan pesisir pantai sebagai nelayan yang bergantung hidup kepada ekonomi menangkap
ikan sebagai sumber mata pencarian utama.
Nor Hayati dan Roslina (2013) membuktikan sikap kebergantungan inilah yang
menyebabkan keadaan hidup dan persekitaran mereka mempunyai kelainan berbanding
komuniti lain di Malaysia. Kebergantungan kepada aktiviti ekonomi seperti ini menyebabkan
komuniti nelayan pesisir pantai sukar memberi impak keuntungan yang tinggi secara berterusan
disebabkan gangguan oleh faktor ketidaktentuan hasil tangkapan yang diperolehi oleh nelayan
(Dara Aishah & Nor Hayati, 2014).
Selain bergantung sepenuhnya pada hasil tangkapan ikan sebagai sumber ekonomi,
penggunaan bot bersaiz kecil telah menyebabkan para nelayan ini terpaksa menjalankan aktiviti
perikanan yang bersifat tradisional dengan jarak kawasan tangkapan yang berhampiran pantai
serta berkedalaman cetek meyebabkan hasil tangkapan mereka menjadi rendah (Azlina Aziz,
2006). Manakala Mohd. Nazaruddin Yusoff, Alizan Talib & Rohana Yusof, (2016) pula
mengaitkan hasil tangkapan yang rendah akibat faktor cuaca, kekurangan modal dan teknologi,
kekurangan pengetahuan dalam pemasaran, kemahiran kerja serta motivasi untuk menjadi
nelayan usahawan yang menyebabkan pendapatan nelayan ini menjadi rendah.
Manakala daripada aspek sosiobudaya komuniti nelayan pesisir pantai, Nik Fuad, Mohd
Shaladdin dan Muhammad Najib (2007) mendapati pola pemikiran komuniti ini hanya berkisar
untuk aktiviti harian sahaja seperti bagaimana mereka boleh mendapat wang bagi perbelanjaan
makan dan minum serta beberapa perbelanjaan lain termasuk persekolahan anak. Walaupun
mereka memperoleh pendapatan harian yang lumayan, namun disebabkan oleh pemikiran
136
mereka yang tidak memandang jauh ke hadapan dan tiada perancangan masa depan
menyebabkan kehidupan mereka masih ditakuk lama dan tidak berubah.
6.1 Program-Program Pembangunan Nelayan
Dalam memastikan para nelayan di Malaysia tidak ketinggalan dalam arus kemodenan
negara, pihak kerajaan telah melaksana dan merancang pelbagai projek pembangunan bagi
memastikan komuniti nelayan tidak terpinggir dan pendapatan mereka juga meningkat seiring
dengan kenaikan kos sara hidup.
Menurut Dara Aisyah, Khatijah Omar & Noor Fadhiha Mokhtar (2014), ketiadaan
peningkatan kemahiran bagi para nelayan menjadi punca kepada kegagalan program tersebut.
Kenyataan ini disokong oleh Wan Mohd Zaifrun, Ibrahim dan Abdul Majid (2009) yang
mendapati program latihan anjuran DOF dan LKIM mempunyai kaitan yang sangat lemah dan
negatif dengan minat responden dalam kerjaya nelayan. Mohd Shaladdin Muda, Wan Abdul
Aziz Wan Mohd Amin dan Nik Wan Omar (2017) juga turut menyatakan faktor kursus dan
latihan dalam dimensi peranan kerajaan adalah faktor yang terpenting dalam meningkatkan
kualiti hidup nelayan.
7. Metod Kajian
Kajian yang akan dijalankan adalah satu kajian bagi mengenalpasti dengan lebih
mendalam terhadap keberkesanan program agropreneur muda yang telah dilaksanakan bagi
meningkatkan ekonomi para peserta dikalangan nelayan pesisir pantai di Pulau Langkawi,
Kedah. Disamping itu kajian ini cuba mngenalpasti impak dalam kalangan peserta-peserta yang
terlibat secara langsung dalam program pembangunan tersebut.
Untuk mencapai objektif-objektif kajian yang telah disasarkan, bab ini akan
membincangkan mengenai kaedah pengumpulan dan proses menganalisis data yang akan
dijalankan. Metod kajian adalah meliputi rekabentuk kajian, kaedah pengumpulan data dan
menganalisis data kaji selidik kajian yang telah diljalankan.
8. Kaedah Pengumpulan Data
Kaedah penyelidikan adalah merujuk kepada cara pengkaji mendapatkan maklumat,

data atau bukti bagi mencapai matlamat penyelidikan (Najib Ahmad Maruki, Che Su Mustafa
dan Iran Herman, 2010). Dalam mendapatkan data dan maklumat bagi kajian ini, pengkaji akan
menggunakan empat kaedah iaitu melalui kaedah pemerhatian, temubual, kajian perpustakaan
dan persampelan kajian.
8.1 Persampelan Kajian
Persampelan kajian adalah cara untuk memilih sebagai responden dan cara bagi
membuat pemilihan dalam kajian yan dijalankan. Adalah mustahil untuk mendapatkan data
pengukuran bagi semua unit/objek/elemen/responden yang menjadi bahan kajian (Najib Ahmad
Maruki, Che Su Mustafa dan Iran Herman, 2010).
137
Di Kuala Kedah, terdapat seramai 325 orang nelayan pesisisr pantai yang merupakan
keseluruhan populasi bagi kajian ini. Menurut Najib et al., 2010) , sekiranya saiz sampel terlalu
besar, ini akan menyukarkan kajian dilaksanakan kerana memerlukan masa yang panjang serta
kos tinggi. Manakala, sekiranya sampel yang diambil terlalu sedikit, ini akan menyebabkan
ketidaktepatan sampel dalam mewakili populasi dan memberi kesan kepada analisis statistik
yang akan dilaksanakan kemudian. Bagi memudahkan penentuan saiz sampel, pengkaji
merujuk Krejcie dan Morgan (1970) yang telah menyediakan jadual panduan saiz sampel
berdasarkan saiz populasi. Megikut jadual tersebut, daripada populasi 320, sampel yang
diperlukan adalah sebanyak 175 sampel bagi kajian ini.
9. Analisis Data
Hasiltemubualiniakandianalisismenggunakan program perisianNvivo 11. Data

disemakdanditranskripsidalambentuk manual (bentuktulisan) sehinggaterbentukkategori yang
dikehendaki.Penggunaansourceadalahuntukmengumpulsegala data yang
diperolehiselepaspengkodandilakukanbagitujuanmenganalisis data.Codesmelibatkan proses
mengenalpastipetikan-
petikandalamteksdanmenyimpanrujukankepadapetikanteksdalampengkalan data
mengikutkategorikajianberdasarkanobjektif yang dipanggilnodes. Lanjutanitu, tree
nodesdilakukanberdasarkankategoripenganalisisan yang
telahdibuatpengkodanolehjurukodsebeluminidandigunakanbagimemastikankategori yang
dipilihtidakbertindihantarasatusama lain berdasarkanpengkodan yang
telahdibuatdandalamkeadaanstabil. Selepassemuasourcedimasukkan di dalamtree
nodesmengikutkategorimasing-masing,
tindakanseterusnyaadalahuntukmendapatkankekerapankajianmenggunakanquires
untukmencarihasilkekerapansecarakuantitatifberdasarkansetiapobjektifkajian.Setelahdapatanka
jiandiperolehi, langkahseterusnyaadalahmenggunakanmodeluntukmenunjukkan model holistic
kajian yang akanmemperincikantemadan sub-sub temamengenaiisu-
isukajianberdasarkandapatandaritree nodes yang dihasilkan. Penganalisisan data
iniadalahbertujuanuntukmemperolehigambarankeseluruhankategorikajianbagimenjawabobjektif
yang dibentuk.Ianyaperluuntukmenghuraikansegala data yang diperolehi.
10. Kesimpulan
Sejak daripada zaman DEB dilancarkan sehinggalah dasar MEB dilaksanakan, pelbagai
jenis bantuan disalurkan kepada komuniti nelayanadaberbentukbantuankewangan, subsidi,
infrastrukturdan program
pembangunantranformasikomunitinelayanbagitujuanpeningkatanpendapatan. Akan tetapi
perlaksanaan program-program pembangunan kelihatan kurang memberi kesan kepada
kehidupan nelayan.
Kajian bagi mengenalpasti keberkesanan program keusahawanan dan transformasi

ekonomi peserta di kawasan tersebut daripada pengurusan kewangan, peranan agensi dan
menilaistrategiperlaksanaanterhadap program
pembangunantersebutperludilaksanakandalammemastikan program-program
pembangunandantransformasi yang dilaksanakanmampumemenuhiaspek kesesuaian program,
keperluan sebenar peserta dan kebolehcapaian objektif program yang tinggi.
138
RUJUKAN
Azlina Aziz. (2006). Faktor penentu hasil tangkapan nelayan pinggir pantai di Kuala
Kedah (Doctoral dissertation, Fakulti Ekonomi, Universiti Utara Malaysia).
Dara Aisyah Ali Puteh & Nor Hayati Saat (2014). Keberkesanan Bantuan Kerajaan Untuk
Meningkatkan Taraf Sosioekonomi Komuniti Nelayan: Kajian Kes Nelayan Muara Pantai
Timur. Universiti Malaysia Terengganu. Terengganu.
Dara Aisyah, Khatijah Omar & Noor Fadhiha Mokhtar (2014). Social welfare development
program among coastal community (SPKMP) in kuala Terengganu: a preliminary assessment
on the performance of the program.Universiti Malaysia Terengganu. Terengganu.
Mohammad Raduan Mohd Ariff,Mohammad Sharir, Ismail Ali, Mazlan Majid & Hanafi Hussin.
(2011). Perkembangan Perusahaan Perikanan Di Semenanjung Malaysia: Isu Dan Persoalan
(The Development Of Fishing Industry In Peninsula Malaysia: Issues And Questions). Jati -
Journal Of Southeast Asian Studies, 16, 265-299. Retrieved
from https://jice.um.edu.my/index.php/jati/article/view/6041
Mohd. Nazaruddin Yusoff, Azlizan Talib & Rohana Yusof. (2016). Kajian Kualiti Hidup
Masyarakat Nelayan Pesisir Pantai Negeri Kedah. Journal of Advanced Research in Social and
Behavioural Sciences 9, Issue 3 (2017) 21-35
Najib Ahmad Marzuki, Che Su Mustafa & Iran Herman (2010). Penyelidikan Sains Sosial. 5th
ed. Sintok: Pusat Pendidikan Profesional Dan Lanjutan (Pace), Universiti Utara Malaysia, p.51.
NikFuadNikMohdKamil, MohdShaladdinMudadan Muhammad NajibSuhaimi. (2007).

EkspedisiKomunitiNelayan Kuala Besut: IsudanPerspektifPenyelidikan. Kuala Terengganu:
PenerbitUniversiti Malaysia Terengganu.
Nor HayatiSa‘atdanRoslina Ismail.2013. Wacana Pembangunan KomunitiNelayanPesisirPantai

di PantaiTimur. In Ibrahim Mamat, et. al. (editors), Pembangunan
KomunitiNelayandanSumberPerikanan.PenerbitUniversiti Malaysia Terengganu.
Wan Mohd Zaifurin Wan Nawang @ Wan Ahmad, Ibrahim Mamat & Abdul Majid Mohd Isa.
(2009). Faktor peramal minat belia untuk menjadi nelayan: Satu kajian di Mukim Kuala Besut,
Terengganu. Jurnal Teknologi, 50 (E) Jun 2009, hlm. 29−52.
-GP21-
Kajian Kefahaman dan Kesedaran Konsep Bangunan Hijau.
Kajian Kes: Jabatan Pembangunan dan Penyelenggaraan, Universiti Utara
Malaysia
Ida Mazlinda Binti Tachmi, Mohd. Nazaruddin Bin Yusoff, Azlizan Talib,
Nur Soleha binti Muhammad Isnan
139
Abstrak
Kajian ini merupakan satu tinjauan awal yang dijalankan bertujuan untuk mengenalpasti tahap
kefahaman dan kesedaran pihak Jabatan Pembangunan dan Penyelenggaraan (JPP) terhadap
konsep Bangunan Hijau di Universiti Utara Malaysia. Seramai 50 orang responden yang terdiri
daripada enam unit utama telah dipilih iaitu Unit Kejuruteraan, Unit Arkitek,Unit Kejuruteraan
Mekanikal,Unit Kejuruteraan Elektrik&Elektronik,Unit Landskap serta Unit Kontrak dan Ukur
Bahan. Data bagi kajian ini telah diperolehi secara kuantitatif melalui kaedah soal selidik.
Analisis data seperti Ujian Kolerasi Pearson telah dijalankan ke atas data tersebut. Dapatan
kajian (Korelasi) menunjukkan bahawa nilai r(48) =0.06, p<0.05. Melalui hasil dapatan kajian
menunjukkan bahawa tidak terdapat hubungan yang signifikan di antara kefahaman para
pekerja JPP dengan kesedaran terhadap konsep Bangunani Hijau di Universiti Utara Malaysia.
Kajian ini perlu dijalankan agar konsep Bangunan Hijau ini tidak ketinggalan dari arus
pemodenan, kemajuan dan pembangunan dari pelbagai aspek terutama dari aspek
pembangunan ekomoni dan sosial
Kata Kunci: Kefahaman, Kesedaran, Bangunan Hijau
1. PENGENALAN
Alam sekitar atau persekitaran bermaksud faktor-faktor fizikal yang mengelilingi

kehidupan manusia. Isu alam sekitar merupakan masalah sosial yang sentiasa melanda
masyarakat dunia bermula dengan masalah pencemaran alam sekitar, perubahan iklim global,
serta kekurangan sumber semula jadi dunia yang dari masa ke masa mulai mengancam
kehidupan individu, masyarakat dan organisma hidup yang lain. (Karmilah Abdullah & Jamilah
Ahmad, 2014).
Menurut Mohd Nazaruddin Yusoff didalam bukunya yang bertajuk Pemanasan Global
dan Pembangunan Lestari Alam Bina, (2014) fenomena alam yang semakin nyata dan ketara
seperti perubahan iklim, pemanasan global, kemarau, dan jerebu merupakan isu utama yang
sering kali diperkatakan pada abad ke-21 ini. Permasalahan ini bukan hanya dari sudut saintifik,
malah menjangkaui aspek ekonomi, sosiologi, geopolitik, dan gaya hidup manusia. Tambahan
pula, pertambahan populasi penduduk dimana dianggarkan menjelang tahun 2050, manusia di
dunia akan mencecah 10 billion orang. Pertambahan ini secara tidak langsung akan memberi
kesan yang berlipat kali ganda kepada pertambahan sumber alam oleh manusia seperti air,
udara, bahan api, dan sumber alam yang lain. Kesannya wujud pelbagai implikasi negatif alam
seperti kesan rumah hijau.
Lantaran itu, usaha ke arah kelestarian telah mula diterapkan dalam kaedah pembinaan
bangunan berteraskan konsep hijau dengan kos efektif di samping pengaplikasian amalan
binaan secara efisien kepada persekitaran dengan menggunakan pelbagai sumber dan
teknologi-teknologi bersifat mesra alam. Menurut Kibert (2002), Bangunan Hijau merujuk
kepada piawaian amalan-amalan dan pertimbangan ekonomi merangkumi pembangunan kualiti
140
lestari, kecekapan tenaga, kualiti udara dalaman, pemuliharaan air dan sumber asli yang lain,
serta perancangan reka bentuk berkonsepkan produktiviti.Konsep Bangunan hijau selaras
dengan konsep persekitaran yang lebih bersih dan sihat. Proses pembinaan Bangunan Hijau
terbukti dapat mengurangkan impak terutama ke atas persekitaran, menjimatkan tenaga dan
serta pengeluaran sisa pepejal (Reffat, 2004).
Abdul Malek Abdul Rahman (2000), telah mendefinisikan Bangunan Hijau sebagai satu
konsep pendekatan yang bersepadu dan holistik dari segi lokasi, tempat, reka bentuk,
spesifikasi, pengunaan tenaga dan sumber-sumber ke arah mengurangkan kesan ke atas alam
sekeliling. Keadaan ini merujuk kepada bangunan yang selesa diduduki, tidak memberikan
kesan negatif kepada kesihatan penghuni dan kurang impaknya kepada alam sekeliling.
Kriteria reka bentuk Bangunan Hijau meliputi integrasi secara keseluruhan iaitu tapak
bangunan, reka bentuk bangunan, sampul bangunan (building envelope) serta sistem-sistem
kelengkapan keseluruhan bangunan yang dihubungkan dengan persekitaran semula jadi.
Hasilnya, bangunan akan menjadi lebih efisien, kos pembangunannya lebih efektif serta
memanfaatkan pengguna dari segi peningkatan produktiviti dan keselesaan.
2. PENYATAAN MASALAH
Kini, semakin hari dunia semakin mengalami pemanasan global yang kritikal.
Pembangunan yang dijalankan tanpa mengambil kira faktor alam sekitar akan memberi
implikasi yang besar pada masa akan datang. Pelbagai cara dan penekanan telah diberikan
terhadap kepentingan menjaga alam sekitar namun masih ada pihak yang mengabaikannya.
Secara umumnya, binaan bangunan hartanah adalah antara penyebab kepada

kemerosotan kualiti udara disekeliling yang merupakan penyumbang kepada kesan rumah hijau
dunia. Dianggarkan sebanyak 35 peratus gas karbon dioksida dibebaskan adalah daripada
bangunan manakala sebanyak 49 peratus gas sulphur dioksida, 25 peratus nitrus oksida dan 10
peratus lagi adalah daripada habuk pencemaran hasil aktiviti manusia.( Mohd Nazaruddin
Yusoff, 2014).
Di Universiti Utara Malaysia,dianggarkan mempunyai seramai 30,000 warga penduduk.

Corak populasi ini dilihat setanding dengan jumlah penduduk di sesebuah kawasan luar bandar
yang kecil. Jumlah ini juga dijangka akan terus meningkat pada masa hadapan. Pertambahan
warga kampus yang merangkumi para pekerja, pelajar dan pensyarah akan menyebabkan
permintaan terhadap kemudahan dan infrastruktur bangunan fizikal dan akemik akan turut
pesat membangun.Namun begitu, bagi meningkatkan tahap kefahamana dan kesedaran
masyarakat berkaitan konsep lestari ini masih lagi agak sukar. Secara purata, hanya 3 daripada
10 rakyat Malaysia yang prihatin berkaitan dengan isu-isu alam sekitar ini.
3. METODOLOGI KAJIAN
141
Kaedah yang digunakan bagi pengumpulan data dalam kajian ini menggunakan teknik
kuantitatif yang mengunakan intrumen borang soal selidik disamping kaedah tinjauan.
Populasi kajian ini secara keseluruhannya terdiri daripada9 unit yang merangkumi 250 orang
pekerja di Jabatan Pembangunan dan Penyelenggaraan (JPP) Universiti Utara Malaysia.
Manakala sampel kajian pula merangkumi 6 unit yang terdiri daripada 50 orang pekerja sahaja
menggunakan persampelan bertujuan (purposive sampling) iaitu hanya memilih kelompok
tertentu yang mempunya kaitan dengan bidang kajian. (Rujuk Jadual 1)
Jadual 1
Pekerja Populasi Sampel

Jabatan pembangunan dan 1. Unit Pentadbiran dan 1. Unit Kejuruteraan Awam
penyelenggaraan Universiti Kewangan 2. Unit Kejuruteraan Elektrik
utara malaysia 2. Unit Kejuruteraan Awam & Elektronik
3. Unit Kejuruteraan Elektrik 3. Unit Arkitek
& Elektronik 4. Unit Pertanian, Landskap
4. Unit Kejuruteraan & Perhutanan
Mekanikal 5. Unit Kontrak Dan Ukur
5. Unit Pengurusan Kontrak Bahan
dan Ukur Bahan 6. Unit Kejuruteraan
6. Unit Arkitek Mekanikal.
7. Unit Pertanian-Landskap-
Perhutanan
8. Unit Harta Benda dan
Kemudahan
9. Unit Taman dan Rekreasi
4. DAPATAN KAJIAN DAN ANALISIS KAJIAN
Dapatan kajian dalam penyelidikan ini merangkumi satu set borang soal selidik yang
mengandungi tiga bahagian utama (a) demografi kajian, (b) kesedaran dan (c) kefahaman
berkaitan Bangunan Hijau.
a) Ujian Korelasi Pearson
Jadual 2 Tahap Kefahaman Dan Kesedaran Terhadap Bangunan Hijau
kefahaman pekerja JPP P
Tahap
Kesedaran r 0.060 0.677
142
Berdasarkan Jadual 2 analisi dapatan kajian menunjukkan nilai r(48)=0.06,p>0.05. Ini

menunjukkan bahawa tidak terdapat hubungan yang signifikan di antara tahap kefahaman
pekerja JPP dengan tahap kesedaran berkaitan konsep Bangunan Hijau. Dengan ini, hipotesisi
kajian yang menunjukkan bahawa tidak terdapat hubungan yang signifikan dengan nilai H1
akan ditolak dan H0 diterima dalam kajian ini. Nilai r merujuk kepada jumlah responden yang
dipilih iaitu sebanyak 50 orang responden.
Konklusinya, kesemua indikator-indikator diatas adalah sangat penting dalam kajian ini.
Ia juga penting kerana memberi gambaran yang jelas tentang Konsep bangunan hijau yang
masih perlu diberikan penekanan dalam mewujudkan pembangunan mampan.
5. CADANGAN DAN KESIMPULAN
Di dalam usaha meningkatkan tahap kesedaran dan kefahaman dalam kalangan

pekerja di Jabatan Pembangunan dan Penyenggaraan (JPP) Universiti Utara Malaysia,
beberapa cadangan telah dipertimbangkan bagi membantu dan memberi inisiatif yang dapat
meningkatkan lagi kepekaan berkaitan pentingnya pembangunan lestari dan amalan hijau ini
dalam kehidupan.
1) Memperluaskan pendedahan maklumat dan promosi serta kempen berkaitan

konsep Lestari.
Pengurusan organisasi sewajarnya memberikan pendedahan tentang konsep Bangunan
Hijau kepada semua kakitangan yang berkhidmat. Hal ini demikian kerana, disebabkan
faktor perbezaan tahap pendidikan akan menimbulkan perbezaan pemahaman
berkaitan Konsep Bangunan Hijau. Oleh hal demikian, dengan adanya ilmu
pengetahuan serta kesedaran dalam masyarakat, seterusnya akan melahirkan individu
yang mempunyai amalan dan tingkahlaku yang lebih positif terhadap alam sekitar
(Kollmuss & Agyeman, 2002).Lantaran itu, pendedahan yang menyeluruh mampu
memberi kesedaran tentang kepentingan Konsep bangunan hijau khususnya dalam
kalangan kakitangan Jabatan Pembangunan dan Penyenggraan (JPP) Universiti Utara
Malaysia.
2) Penggunaan teknologi yang meluas.
Penggunaan alatTeknologi Hijau dalam pengaplikasian bangunan dapat meningkatkan

pengetahuan kakitangan JPP. Dalam dunia yang kian pesat membangun, menuntut
manusia untuk bergerak seiring agar tidak ketinggalan. Penggunaan alatan-alatan,
sistem-sistem dan sebagainya yang berteknologi tinggi mampu memberi pengetahuan
serta kesedaran yang tinggi khususnya pekerja atau kakitangan Jabatan Pembangunan
dan Penyenggaraan (JPP) Universiti Utara Malaysia. Sebagai contoh penggunaan
lampu, paip air, penghawa dingin, reka bentuk dan susunan bangunan dan sebagainya.
143
Secara keseluruhannya, dapat disimpulkan bahawa konsep bangunan hijau amat

penting untuk dititikberatkan kepada semua lapisan masyarakat bagi memelihara alam
semulajadi daripada musnah oleh sifat tidak bertanggungjawab manusia sendiri. Namun, dalam
merialisasikan konsep lestari dalam pembangunan bukanlah sesuatu yang mudah. Hal ini
kerana, tidak semua generasi bersifat terbuka dan berpeluang dalam mendekati serta
memahami konsep lestari itu sendiri. Oleh hal demikian, inisiatif ilmu pengetahuan dilihat
merupakan suatu penekanan yang sangat penting untuk diri seorang individu bagi memhamai
serta memberi kesedaran dengan lebih jelas tentang konsep bangunan lestari tersebut.
Disebabkan itu, pendidikan merupakan satu elemen yang paling utama dalam usaha untuk
mempergiatkan lagi serta meningkatkan kesedaran, pemahaman dan juga amalan para
kakitangan berkaitan konsep bangunan hijau ini khususnya di universiti utara Malaysia.
Walaupun konsep Bangunan Hijau tidak dapat dilaksanakan secara drastik dan berperingkat-
peringkat, namun kesedaran dalam menjaga keseimbangan ekosistem akan mewujudkan
masyarakat yang cintakan alam sekitar. Lantaran itu, menjadi tanggungjawab Jabatan
Pembangunan dan Penyenggaraan (JPP) Universiti Utara Malaysia untuk memelihara serta
memulihara alam sekitar khususnya di sekitar kampus Universiti Utara Malaysia yang
RUJUKAN
Abdul malek abdul Rahman, (2000). Keselesaan terma dalaman di Malaysia. Pulau Pinang:
University Sains Malaysia.
Jabatan Pembangunan dan Penyelenggaraan. Di akses pada September 20, 2018 daripada
http://jpp.uum.edu.my
Karmilah Abdullah & Jamilah Ahmad. (2014). Impak Pemerkasaan Teknologi Hijau Terhadap
Amalan Pengamal Perhubungan Awam Hijau Di Malaysia Green Technology
Corporation (Greentech Malaysia). 29-39.
Kibert, J. C., Sendzimir, J & Guy, G. B. (2002). Construction ecology: Nature as the basic for
green building, London: Spoon Press.
Mohd Nazaruddin Yusoff & Kamarudin Mohd Nor. (2014). Pemanasan Global dan
Pembangunan Lestari Alam Bina. Sintok:Universiti Utara Malaysia.
Reffat, R. (2004). Sustainable of building and environment. The second international
conference on development and environment. Egypt: Assiut University.
-GP22-
THE IMPACTS OF ETHICS EDUCATION ON FUTURE MANAGERS’ ETHICAL DECISIONS
Nor Azizah Zainal Abidin1ZurianaZahrin2

1, 2
Public Management,
School of Government, UUM COLGIS
Universiti Utara Malaysia, 06010 Sintok, Kedah, Malaysia.
E-mail:norazizah@uum.edu.my & z.zuriana@uum.edu.my
Abstract
144
The rise of unethical behaviour like commercial crimes has become an issue and started
gaining attention from the government, society and business. Education is seen by scholars as
one of the best solutions because it has the ability to produce a holistic result. By educating
young generations, who are our future leaders, it will help to awake the interests of people
towards building an ethical society. The government of Malaysia started the process of building
ethical society by directing all the public universities incorporating ethics education in their
curriculum. Universiti Utara Malaysia (UUM) is also committed in realising this agenda.
However, since the policy was implemented, there appears to be very minimal research that has
explored the effects of ethics education on future managers‟ ethical behaviour including in
making ethical decisions. Therefore, this paper aims to study the impact of ethics education on
future managers‟ ethical decisions. A total of 300 students who were in the second-year and
third-year studies from various academic programs have been chosen as respondents. From
the survey, 78% (n=234) of respondents completeda course on ethicswhile 22% (n=66) of
respondents will taking their ethics courses in the coming semester. This researchrevealed that
the majority of students recognised the importance of ethics and they found that learning ethics
was helpful in improving their ethical understanding and developing their personal ethical
values. However, practicing ethical values, including making ethical decisions were challenging
as students perceived they were living in unethical environment. The respondents indicated
that they were surrounded by unethical people, and for this reason, some of them disclosed that
they would rather silent than reveal about unethical actions.
Keywords:Ethics Experience, Students Perception, Ethics Education, Ethics Understanding
1. INTRODUCTION
In recent years, ethics has become a highly debated topic among governments,
businesses, and societies around the globe due to the increasing number of ethical scandals
involving professionals and executives. The collapse of big corporations such as Enron
Corporation, WorldCom, Arthur Anderson, Global Crossing and others has underscored the
importance of ethics in organisations (Davies, Moen & Dykstra, 2009). Malaysia is not
exceptional in this case. The increasing trend in commercial crimes being committed in this
country is worrying. Commercial crimes are also known as economic or business crimes
involving several types of crimes such as criminal breach of trust, cheating and misappropriation
of funds. For instance, in 2011, the number of commercial crime cases reported to the police
was stood up to a total of 22,033 involving losses of up to RM1.1 billion. In 2012 and 2013, the
number of cases went down to 18,386 and 16,661, but the total loss ballooned steadily to
RM1.619 billion and RM1.775 billion respectively (Gillbert, 2013). The rise of unethical
behaviour like commercial crimes has gained attention from governments because it could lead
a country to a bad economic crisis (Sedmak&Nastav, 2010).Improving moral behaviour is
challenging as it requires a holistic solution (Doost, 1999; Yin, Suhaiza& Fatima, 2014). In this
case, education is seen by scholars as one of the best solutions because it has the ability to
produce a holistic result (Kohlberg, 1981; Sakar, 2015). Educating young generations, who will
be managers in the future, will help to awake the interests of people towards building an ethical
society. The university is seen as one of the influential institutions which is able to helps
students develop moral and ethical standard that may not have gotten elsewhere (Dellaportas,
et.al, 2006). Hence, the paper aimed to explore how the university students who are our future
145
managers perceive the influence of ethics education on their ethical decision within the scope of
environment and professional identities. The paper proceeds by discussing the problem
statement, and methodology used in this study. The findings and discussion are presented
before providing the conclusion in the final section.
2. PROBLEM STATEMENT
The government of Malaysia believes that ethics has a very important and effective role
in developing the country. Therefore, ethics has been inserted as one of the important courses
in higher education system. The efforts started in 1990s, when the government directed local
universities to incorporate ethics education in their curriculum (MohdZabidi&Kamarudin, 1996).
The direction aligned with the Malaysian Vision 2020 that is to ensure the prevalence of high
moral values. After 20 years later, the efforts are still continued under the implementation of the
Malaysian soft skills, in which ethics has been identified as one of the important skills that
should be enhanced among universities‘ students.
Nevertheless, to the researchers‘ knowledge, there appears to be very minimal research
that has explored the effects of ethics education on students‘ ethical behaviour. UUM is
committed in employing ethics education in both curriculum and co-curriculum. UUM offers
nearly 40 academic programmes and ethics course has been inserted either as a core or
elective course for almost all the academic programmes. However, since the introduction of
ethics education in UUM, least is known about the effects of ethics education on the UUM
students. Therefore, this study aimed to learn how the UUM students perceived the influence of
ethics education on their ethical decisions.
3. METHODOLOGY
A total of343 questionnaires were distributed among UUM students who were in the
second-year and third-year studies from various academic programs. To ensure the participants
involved in this study not only completed their ethics course but also represented various
academic programs in UUM, two stages of sampling method namely stratified sampling and
simple random sampling techniques wereimplemented. However, only 300 completed
questionnaires were collectedwhich represented a return rate of 87.46%. In order to assess
respondents‘ ethical decisionsHypothetical Ethical Situations (HESs) questions were adopted as
the instrument in this study.The instrument was developed based on previous work of Low
(2009).
4. FINDINGS AND DISCUSSION
To study the impact of ethics education on future managers‘ ethical decisions,

information related to respondents‘ethics education was collected. Findings were discussed in
the following sections.
4.1 Levels of Learning Ethics
146
This section discusses the levels of learning ethics among respondents. It is important to
identify whether respondents were exposed to a formal ethics education before analysing their
ability in making ethical decisions. Table 1.1 shows78% of the respondents have completed a
course in ethics while 22% of respondents have not completed a course in ethics yet.
Respondents werealso asked about the comprehensiveness of content of ethics courses in their
programme structures. Majority of respondents (40.7% n=22), who have completedtheir ethics
courses revealed that they learned ethics as a course, meaning that the whole content of ethics
course is all related to ethics education. Meanwhile, the other group of respondents revealed
that in some bachelor programmes, the content of ethics courses was not comprehensive as it
covered only few subtopics in chapters (18.7%, n=56) and some of respondents found that
ethics education was discussed only in a chapter (18.7%, n=56). The respondents were also
required to indicate the status of ethics courses offered in their program. Table 1.1 shows that
most of the bachelor programmes have offered ethics course as a programme core (39.3%,
n=118) and followed by a university core (27%, n=81). The rest, 7% (n=21) and 4.7% (n=14) of
respondents‘ revealed that they have learned ethics as an elective and minor respectively.
Table 1.1
Ethics Education Backgrounds Have studiedethics education
The content of ethics courseis covered Yes No

in n % n %
subtopics in chapter 56 18.7 - -
a chapter in the course 56 18.7 - -
a course 122 40.7 - -
irrelevant - - 66 22.0
Total 234 78.0 66 22.0
Yes No
An ethics syllabus is offered as a
n % n %
university core 81 27.0 - -
programme core 118 39.3 - -
minor 14 4.7 - -
elective programme 21 7.0 - -
147
irrelevan - - 66 22.0
Total 234 78.0 66 22.0
Yes No
An ethics syllabus is offered during
n % n %
1st year 63 21.0 - -
2nd year 52 17.3 - -
3rd year 100 33.3 - -
4th year 19 6.3 - -
irrelevan - - 66 22.0
Total 234 78.0 66 22.0
Based on the findings, this study also found that the majority 33.3% (n=100) of respondents
have studied ethics during theirthird year study, and the rest of respondents, 21% (n=63) study
ethics in first year, 17.3% (n=52) in second year. Only 6.3% (n=9) during the final (4th) year.
4.2 Respondents’ Ethical Decision
This section studies on respondents‘ decisions on ethics using Hypothetical Ethical Situations
(HESs) instrumentwhich involving seven (7) ethical scenarios. Details of the findings are
presented in Table 1.2. In particular, Table 1.2, HES 1 depicts whether or not respondent would
cheat on their tutorial assignments by copying another student assignment. Copying other
students‘ assignments was wrong and this action would not be a permissible activity. Therefore,
students ought not to carry out this action. From the total, 50.7% of respondents refused to do
so. Unfortunately, 49.3% (148) of respondents prepared to act unethically and surprisingly the
answers are the highest scores of students who have studied ethics 39.3% (n=118). HES 1
results show the scores for ethical and unethical behaviours are almost balance indicating the
cheating culture exists in the university and students having difficulties to identify whether
copying other people works is ethical or not.
HES 2 aimed to access students‘ attitudes towards cheating. The question was asking
the respondents‘ willingness to report cheating to lecturers. From the question, it views egoism
of people in their natural state, selfish and motivated by self-preservation and self-gain. Table
1.2 shows a significant 83.0% (n=249) of respondents‘ refused to report and they chose to
silence about the act. Both category, have learnt (62.7%, n=188) and have not learn ethics
(20.7%, n=62) show the similar pattern of the decision. Only 17% (51) of respondent would
report about the copying activities.
148
In the HES 3, respondents were again asked about copying/cheating issue, but in this
situation the issue of copying/cheating involved an implication on students‘ grade. Respondents
were informed that they will get a higher grade by modifying other student‘s works. The
question aimed to evaluate whether students are willing to involve with cheating/copying if there
would be an implication on their grades. Surprisingly, HES 3 in Table 1.2 shows that 55.7%
(n=167) of respondents (involving 45.4% respondents who have studied ethics and 10.3% have
not taken the ethics education yet) were prepared to modify other people works if they would be
given a better grade. Meanwhile, 44.3% (133) refused to do so. This might suggest that
respondents might feel that it was acceptable to modify other people works because as it will
improve their grades. This finding contrasted with the findings of Low (2009). Low investigated
the perceptions of accounting students and graduates in New Zealand on the importance of
ethical education interventions in accountability education. Low specifically looked at the
legitimation of students ethical decisions through the interpretation of their ethical responses to
ethical situations and hypothetical case situations. The work of Low found that the accounting
students and graduates in New Zealand might feel that it was acceptable to copy or modify
other people works if there were less complicated consequences where grades might not be
implicated. The participants showed that they were unwilling to copy or modify if that
assignment had implication on their grades
In the HES 4, respondents were required to identify whether ethical or not if they signed
a class attendance on behalf of their friends who had other important tasks to be completed
during the class time. Table 1.2 shows that only 32.2% (97) of respondents indicated their
willingness to sign a class attendance on behalf of their friends. From the record, respondents‘
have learnt 24.3%, n=73) and have not learn ethics 8%, n=24) show the similar pattern of the
decision. Meanwhile, the majority of 67.7% (n=203) of respondents revealed that they will not
do so. In the view of researchers, respondents seemed to disclose that they knew the basic of
ethical principles but in practice, some people just choose not to apply their ethical knowledge
may be due to certain constrains. For instance, one may help his or her busy friend, who
actively involves with university‘s activities, by signing a class attendance for him or her, with the
intention to help the friend from facing bigger problem such as being barred from the final exam.
The next situation is a challenge about the decision of respondents regarding their future
work. HES 5 is a question about personal values and behaviour whether or not they would lie
about their abilities in their curriculum vitae (CV). HES 5 in Table 1.2 shows that the majority
88.7% (n=266) (involving 70.3% (n=211) respondents who have studied ethics and 18.3%
(n=55) of respondents have not taken the ethics education yet) were prepared to do the 'right
act' compared to a lower percentage 11.3% (n=34) of respondent desperate to claim the untruth
CV. HES 6 question looked at whether or not respondents would be prepared to distort the
truth in attempting to get a better salary offer from an employer. This situation might explain
how prepared individuals are to lie to gain more money in their lives. Based on Table 1.2, the
findings are more favourable for ―No‖ responses than ―Yes‖ in that a higher 75.7% (n=227) of
respondents (involving 61.7%, n=185 have studied ethics whilst 14%, n=42 respondents have
not taken the ethics education yet) were not prepared to lie about a rival firm offer, compared to
the 24.3% (n=73) of respondents who were prepared to lie about such an offer. If someone was
already prepared to lie to get a better salary offer from an employer, then one can only
149
speculate as to the extent to which that individual would be prepared to become involved in
unethical behaviour for self-gain.
The HES 7 question was designed to ask whether the respondents would become
involved in unethical creative financial practices and subsequently it was important that such a
direct question was asked. The seventh situation asked if respondents would creatively
manipulate financial information for ‗self-interest‘ reasons, that is, manipulate financial
information to allow for future personal gain through bonus payments for favourable future
results. From HES 7 in Table 1.2, the decision ―No‖ showed 87% (n=261) as the highest score,
which is involving 70.7%, n=212 of respondents who have studied ethics and 16.3%, n=49
respondents have not taken the ethics education yet. Those are would not manipulate the
results by creative write-downs to facilitate future performance. Contrary with 13% (n=39) of
respondents who were wanting to act inappropriately.
Table 1.2
Respondents‟ Decision on Hypothetical Ethical Situation
HES 1 Have studied
Respondent are unable to complete a ethics education Total

tutorial assignment but you have been
offered a copy answer of other students Yes No
from different tutorial groups. Would you
accept the offer? n % n % n %
Yes 118 39.3 30 10.0 148 49.3
No 116 38.7 36 12.0 152 50.7
Total 234 78.0 66 22.0 300 100.0
Have studied
HES 2
ethics education Total
You find there are other peers have a
copy of the assignment in their circles. Yes No
Would you choose to silently?
n % n % n %
Yes 188 62.7 62 20.7 250 83.3
No 46 15.3 4 1.3 50 16.7
Total 234 78.0 66 22.0 300 100.0
150
Have studied
HES 3
ethics education Total
A friend suggested you to modify other
students‟ assignments to get higher Yes No
marks. Would you accept the offer?
n % n % n %
Yes 136 45.3 31 10.3 167 55.7
No 98 32.7 35 11.7 133 44.3
Total 234 78.0 66 22.0 300 100.0
HES 4
Have studied ethics
You have been asked by your best education Total
friend to sign the class attendance on
behalf of him or her because he or she Yes No
was busy with extra-curricular activities.
Would you fulfilling the request? n % n % n %
Yes 73 24.3 24 8.0 97 32.3
No 161 53.7 42 14.0 203 67.7
Total 234 78.0 66 22.0 300 100.0
HES 5 Have studied ethics

education Total
You are applying for a job and consider
that your communication skills are not Yes No
promoted well in your C.V. By claiming
to have been a member of the school
debating team this aspect would look n % n % n %
better. Would you do this?
Yes 23 7.7 11 3.7 34 11.3
No 211 70.3 55 18.3 266 88.7
Total 234 78.0 66 22.0 300 100.0
HES 6
You receive a slightly disappointing Have studied ethics

salary offer from an accounting firm, but education Total
you have heard that they are negotiable.
Yes No
By claiming a better offer from a rival
151
firm you may be able to induce an

n % n % n %
increase in the offer. Would you do this?
Yes 49 16.3 24 8.0 73 24.3
No 185 61.7 42 14.0 227 75.7
Total 234 78.0 66 22.0 300 100.0
HES 7
You have been appointed as Manager

Have studied ethics
at a Government-linked companies
education Total
(GLCs) with high salary deals. The
appointment gives you the power to Yes No
manage the interests of the company.
You realise that the authority also gives
you the space to manipulate the
n % n % n %
company's financial information. Would
you do this?
Yes 22 7.3 17 5.7 39 13.0
No 212 70.7 49 16.3 261 87.0
Total 234 78.0 66 22.0 300 100.0
Based on the seven HESs indicators discussed earlier, it is the researchers‘ perceptions
that respondents had a moderate understanding of what is being ethical and unethical.
However, in certain circumstances, they were facing difficulties in deciding an action whether it
is ethical or not because the environment perceived some unethical actions as part of the
society culture. For this reason, some respondents felt that an ethical decision unable to be
performed and they perceived that they lived within unethical environment. Therefore, it is
researchers‘ conclusion that ethical decisions were influenced by individual ethical principles
and environmental influences.
4.3 The Impactof Ethics Education
This study also identifies the effects of learning ethics on respondents‘ personal ethical
development. The results indicated that majority of respondents agreed that the content of their
ethics courses was helpful in developing their personal ethics i.e. 73.6%, n=221 (agree and
strongly agree).
152
Table 1.3
The content of ethics syllabus is very effective to develop personal ethics
Have studied ethics education
Yes No
The content is very effective to develop
personal ethics
n % n %
Strongly disagree 6 2.0 - -
Disagree 7 2.3 - -
Agree 172 57.3 - -
Strongly agree 49 16.3 - -
Irrelevant - - 66 22.0
Total 234 78.0 66 22.0
This study also asked the respondents‘ opinion on the importance of ethics education on
their ethical personal beliefs and behaviours. Figure 1.1depicts that the respondents who have
studied ethics have a great influence to their beliefs and personal behaviours as the score show
from slightly 'not influence all of them' to high 'absolutely great'influence. In contrary,
respondents who have not taken any ethics education was unable to perceive the best benefit
of ethical education by scoring 'not influence all of them' as the best answer.
153
Figure 1.1. Respondents‘ (have studied vs not study) opinion on the importance of ethics
education on their ethical personal beliefs and behaviours.
It is true to say that ethics is one of the knowledge that can be learned. From the figure, it can
be deemed that ethics education is significant to develop student‘s ethical values. As a 20s and
30s young adults, the basic problem-solving strategies they use to deal with was associated
with the number of years of formal ethical education (Velasquez, Andre, Shanks & Meyer,
1987).
5.0 CONCLUSION
Based on discussions and findings presented, this study draws the following conclusion.
First, every individual has a set of values through which he/she looks at all things and also at
the world. Values, however, are not permanent and they will change through the socialisation
process undergone by individuals. Since individuals experienced different socialisation
processes, each individual has different values. This explains the result of HES questions on
why individual had different thoughts on what was considered as being ethical and unethical.
Second, ethics are sets of rules that govern the behaviour of a person, established by a group
or culture. Values lay the foundation of ethics and change from time to time according to the
changes in the environment. In the context of UUM students, UUM ethical environment was
created by rules and regulations established by the university. Ethical awareness was spread
out when students first registered with the university. Ethical understanding was developed
through a combination of formal (curriculum) and informal education (co-curriculum). The
research found that the respondents hold certain values, but they do believe in ethics and
moral. In fact, the respondents appreciated ethics education that they received during the
studies and they admitted that all the ethical values they learned during ethics lessons were
useful for them. Indeed, respondents indicated that the ethics lessons helped them to develop
their ethical understanding including building their professional values.
REFERENCES
Davies, Moen & Dykstra (2009). Faculty Perceptions Concerning the Ethics of Classroom
Management Practices. Journal of Academic and Business Ethics. 1 p. 56-68.
Dellaportas, D., Kanapathipillai, S., Khan, A., Leung, P. (2014). Ethics Education in the
Australian Accounting Education: A Longitudinal Study Examining Barriers and Enablers.
Accounting Education: An International Journal. Vol 23 (4), p.362-382,
doi:10.1080/09639284.930694
154
Doost, R. K. (1999). The missing link in accounting education. Managerial Auditing Journal,
14(3), p.93-114
Gillbert. J. (2013, April, 9). CCID director: Commercial cyber related crimes on the rise.
Retrieved 22 January 2016, from http://www.freemalaysiatoday.com/category/
business/2013/04/09/ccid-director -commercial-cyber-related-crimes-on-the-rise/
Kohlberg, L. (1981). Essays on Moral Development. Volume I: The Philosophy of Moral

Development (Vol. 1). New York: Harper & Row, Publishers, Inc.
Low, M. (2009). Ethical educational interventions: Perceptions of accounting students and

graduates and the legitimation of ‗ethical‘ actions. PhD Thesis, University of Waikato,
Hamilton, New Zealand.
MohdZabidi Abdul Rashid &Kamarudin Shariff (1996). Perceptions of unethical practices in

insurance industry. Retrieved 22 January 2016, from http://usm.my/aamj/1.1.1996/1-1-4.pdf
Sakar, M. C. (2015). Evaluation of Ethics Perceptions of Primary School Teachers. Procedia

Social and Behavioral Science, 116, p.2352-2356.doi.org/10.1016/j.sbspro.2014.01.571
Sedmak, S., &Nastav, B. (2010). Ethical environment and development of professional identity.
Paper presented at the 11th Social Responsibility, Professional Ethics, and, Management
Conference, Ankara Turkey, 24-27 November. Retrieved 20 January 2016, from
http://www.fm-kp.si/zalozba/ISBN/978-961-266-098-7/papers/MIC9100.pdf
-GP23-
KAJIAN KECENDERUNGAN PERKONGSIAN MAKLUMAT DI KALANGAN BELIA DI
MALAYSIA
SITI DARWINDA MOHAMED PERO

School of International Studies
darwinda@uum.edu.my
Abstrak
Penggunaan media sosial di kalangan belia sebagai medium jaringan sosial, komunikasi dan
informasi telah menjadi fenomena meluas di Malaysia dan juga di seluruh dunia. Saluran media
sosial seperti Facebook, Twitter, Skype, Youtube, MySpace, Blog, Wechat dan WhatsApp telah
menjadi media alternatif yang diminati berbanding dengan lain-lain media cetak dan elektronik
arus perdana khususnya dalam kalangan kelompok belia yang turut dikategorikan sebagai
"generasi Y". Hasil pemerhatian penulis mendapati tindak balas generasi belia terhadap isu
adalah berasaskan maklumat dan analisis media sosial yang kurang tepat. Lebih menyedihkan,
ramai juga yang memberi respon kepada isu secara jahil. Keadaan ini adalah amat
membimbangkan sekiranya tidak ditangani secara serius kerana dikhuatiri boleh memberi
implikasi buruk bukan sahaja kepada belia, tetapi juga kepada keselamatan dan masa depan
negara. Sehubungan itu, kajian diolah untuk mengkaji tentang kecendurangan perkongsian
maklumat di kalangan belia di Malaysia. Kajian ini diharap mampu memberikan gambaran yang
155
lebih komprehensif mengenai tingkah laku belia Malaysia dalam memberi tindak balas kepada
maklumat yang disebarkan melalui media sosial, tahap kepercayaan terhadap sesuatu isu yang
dikongsi dan kecenderungan perkongsian maklumat oleh belia menerusi media sosial.
Katakunci: Belia Malaysia; perkongsian maklumat; media sosial; keselamatan bukan

tradisional
1.0 PENGENALAN
Penggunaan media sosial di kalangan belia sebagai medium jaringan sosial, komunikasi
dan informasi telah menjadi fenomena meluas di Malaysia dan juga di seluruh dunia. Saluran
media sosial seperti Facebook, Twitter, Skype, Youtube, MySpace, Blog, Wechat dan
WhatsApp telah menjadi media alternatif yang diminati berbanding dengan lain-lain media cetak
dan elektronik arus perdana khususnya dalam kalangan kelompok belia yang turut
dikategorikan sebagai "generasi Y". Di Malaysia, belia 10 hingga 28 tahun adalah mewakili 11.4
juta orang atau sekitar 38 peratus dari jumlah penduduk di negara ini. Kadar keterdedahan dan
penggunaan media sosial ini telah disokong pula oleh kadar penembusan jalur lebar isi rumah
yang lebih tinggi dan penggunaan internet yang semakin bertambah di Malaysia. Kadar
penembusan jalur lebar yang tinggi ini secara tidak langsung membantu meningkatkan akses
terhadap penggunaan internet sebagai kunci kepada penggunaan media sosial.2
Oleh kerana media secara umumnya sering dikaitkan dengan informasi yang cepat,
jaringan yang lebih luas dan komunikasi yang lebih bersifat rentas sempadan, pendedahan
kepada media sosial sepatutnya menjadikan belia hari ini menjadi generasi yang
berpengetahuan luas, bijak dan matang. Dengan andaian ini, media sosial menjadi jambatan
kepada golongan belia untuk mengenali dunia global dengan lebih dekat, berinteraksi dalam
intensiti dan kekerapan yang lebih tinggi, menyediakan mekanisma untuk percambahan ilmu
dan pengetahuan dan meluas serta mewujudkan jaringan hubungan yang lebih baik antara satu
dengan yang lain. Namun, sejauh manakah kebenaran kenyataan ini?
Mutakhir ini, risiko perkongsian dan penyebaran maklumat tidak tepat atau palsu
semakin berleluasa. Kes-kes penyebaran maklumat seperti mengenai kenaikan harga minyak,
isu-isu politik, ekonomi, nilai matawang ringgit dan lain-lain adalah mewakili senarai maklumat
atau berita yang sering dikongsi menggunakan media sosial oleh segenap lapisan masyaraakt
termasuklah secara khusus golongan belia. Sebagai contoh, penyebaran gambar dan maklumat
palsu berhubung kejadian air pasang besar yang kononnya berlaku di Pantai Timur pada
penhujuung Januari 2016 bukan hanya menimbulkan keresahan orang awam, malah
menyusahkan pihak berkuasa. Beberapa keping gambar dan maklumat yang disebarkan di
laman sosial adalah palsu tidak menggambarkan fenomrna air pasang besar yang dikatakan
berlaku di Kelantan dan Terengganu. Pihak berkuasa telah mendapati bahawa gambar-gambar
yang telah dimuatnaik adalah gambar lama termasuk ketika kejadian bah kuning di Kelantan
pada Disember 2014. Kes tular video pada April 2016 yang menunjukkan seorang pemuda
sedang mengisi air zam zam ke dalam botol yang mana kononnya pemuda tersebut terlibat
dalam sindiket pengedaran air zam-zam palsu telah menyebabkan orang awam panik dan pihak
penguat kuasa iaitu Kementerian Perdagangan Dalam Negeri, Koperasi dan Kepenggunaan
(KPDNKK) Melaka dan Jabatan Agama Islam Melaka (JAIM) kelam kabut. Akibat sikap melulu
pengguna sosial yang telah berkongi maklumat berkenaan secara berleluasa dan meminta
2
Di Malaysia, bilangan pengguna internet yang aktif melebihi 20.1 juta dengan 16.8 juta daripadanya aktif dalam media social,
mengikut laporan Timbalan Menteri Komunikasi dan Multimedia Datuk Jailani Johari seperti dilaporkan oleh Bernama pada 28
Oktober 2016. Kadar penembusan jalur lebar telah mencapai 72.2 peratus, menunjukkan masyarakat di Malaysia telah menuju
ke arah gaya hidup digital.
156
pihak berkuasa mengambil tindakan, pihak berkuasa terpaksa membuat pemeriksaan mengejut
ke sebuah premis yang sebenarnya tidak wujud. Berita yang dikatakan berlaku di Melaka
sebenarnya berlaku di Makkah (Sinar Harian 2015). Sementara itu, di Alor Setar, seorang
pengusaha stesen minyak menjadi mangsa penularan maklumat palsu yang mengatakan
bahawa syarikat beliau akan memberikan minyak percuma kepada penunggang motosikal
daripada jam 12 tengah hari hingga 2 petang dan dari 4 petang ke enam petang (Sinar Harian
2016).
Lebih serius lagi, apabila isu-isu yang menyentuh tema keagamaan, etnik, mahupun
nilai pengangan masyarakat disebarkan sehingga mampu menimbulkan rasa benci dan
dendam di dalam masyarakat Malaysia yang berbilang bangsa. Menurut Timbalan Ketua
Pengarah (Perancangan) Jabatan Perpaduan Negara dan Integrasi Nasional, Kapli Emek
berkata, hasil tinjauan pihaknya mendapati kira-kira 75 peratus berita atau perkara diviralkan di
media sosial adalah palsu (Latib 2015). Tinjaun yang dilakukan juga mendapati kebanyakan isu
viral menerusi media sosial adalah berdasarkan maklumat yang telah ditokok tambah sehingga
menimbulkan keadaan negatif (Latib 2015). Keadaan ini, contohnya, telah memberikan cabaran
yang besar kepada usaha untuk mengukuhkan perpaduan masyarakat majmuk negara ini.
Pengarah Institut Kajian Etnik (KITA), Universiti Kebangsaan Malaysia (UKM), Profesor Ulung
Datuk Dr Shamsul Amri Baharuddin berkata walaupun ia telah menjadi alat yang berkesan
untuk berkongsi maklumat, media sosial juga telah disalahgunakan untuk menyebarkan fitnah
dan maklumat salah (Amir 2015).
Sehubungan itu, kajian ini secara khusus diolah untuk mengkaji tentang
kecenderungan perkongsian maklumat di kalangan belia di Malaysia. Kajian ini diharap mampu
memberikan gambaran yang lebih komprehensif mengenai tingkah laku belia Malaysia dalam
memberi tindak balas kepada maklumat yang disebarkan melalui media sosial, tahap
kepercayaan terhadap sesuatu isu yang dikongsi dan kecenderungan perkongsian maklumat
oleh belia menerusi media sosial.
2.0 KERANGKA KONSEP
Kertas kerja ini akan memfokuskan dua persoalan utama berkenaan belia dan media
sosial, iaitu, mengenal pasti tahap kepercayaan belia terhadap maklumat yang dipaparkan di
media sosial dan mengenal pasti bentuk dan jenis maklumat yang menjadi kegemaran belia di
media sosial. Kajian ini diolah berdasarkan Model Penerimaan Teknologi Sosial (STAM) yang
telah digunakan secara meluas untuk menerangkan tingkah laku pengguna sistem atau
teknologi baru (Lee & Paris 2013). Walaupun teori ini telah digunakan secara meluas di
kalangan negara membangun terutamanya dalam bidang pendidikan, pelancongan dan
perbankan, aplikasi teori ke atas pengguna media sosial negara-negara membangun masih
belum mencukupi. Kajian ini akan mengkaji sejauh mana tahap kepercayaan maklumat, bentuk
dan jenis maklumat, dan motivasi dalam berkongsi maklumat akan menentukan pola
kecenderungan perkongsian maklumat di kalangan belia Malaysia.
2.1 Tahap Kepercayaan Maklumat
Kepercayaan adalah satu faktor yang menggalakkan pengguna media sosial

untuk terlibat dalam perkongsian ilmu dan maklumat (Lee & Paris 2013). Kepercayaan di
sini diertikan dengan ―kebergantungan yang yakin terhadap watak, keupayaan, kekuatan
atau kebenaran berkaitan dengan seseorang atau sesuatu‖ (McKnight & Chervany
1996). Menurut Salehan dan Kim (2012, 1), kepercayaan dalam ruang linkup internet
sangat mempengaruhi kelakuan pengguna dalam perkongsian maklumat. Ini
termasuklah tahap kekerapan dan tahap kerahsian maklumat yang akan dikongsikan di
157
media sosial (Salehan & Kim 2012, 8). Internet adalah persekitaran yang penuh dengan
ketidakpastian dan melibatkan pelbagai jenis aktor, di mana pengguna dalam talian
sentiasa mengalami beberapa tahap risiko. Oleh itu, kepercayaan menjadi strategi untuk
menangani segala risiko dan ketidakpastian atas talian. Ini menjadikan tahap
kepercayaan maklumat sebagai pembolehubah penting dalam mengkaji tingkah laku
pengguna atas talian (Gefen 2000). Kajian Dwyer, Hiltz dan Passerini (2007) telah
membuktikan bahawa pengguna FaceBook mempunyai kepercayaan yang tinggi
terhadap media sosial dan ini seterusnya menjadikan pengguna FaceBook
mendedahkan lebih banyak maklumat peribadi berbanding MySpace. Justeru, analisa
berkenaan tahap kepercayaan maklumat sangat penting dalam usaha mengkaji
kencenderungan perkongsian maklumat di kalangan belia di Malaysia.
2.2 Bentuk dan Jenis Maklumat yang Menjadi Kegemaran Belia di Media Sosial
Menurut Ghaisani, Handaayani & Munajat (2017, 531) terdapat empat jenis
maklumat iaitu peribadi, sensasi, politik, dan kasual. Maklumat peribadi adalah
maklumat peribadi tentang seseorang dan biasanya sensitif, seperti maklumat kesihatan
tertentu atau butiran keluarga. Maklumat sensasi adalah maklumat yang dibincangkan
oleh kebanyakan pengguna dalam masa yang singkat dan menarik orang untuk
berkongsi maklumat tersebut kepada orang lain. Contoh maklumat sensasi adalah berita
atau gosip selebriti. Maklumat politik adalah berita kerajaan atau politik yang berkaitan,
sebagai contoh, berita pilihan raya presiden. Sebaliknya, maklumat kasual adalah
maklumat yang dikongsi dalam kumpulan rakan dan rakan sekerja yang dapat
meningkatkan perbincangan, seperti, cadangan kepada restoran atau tempat tertentu
untuk bercuti. Kajian berkenaan media sosial di kalangan belia Malaysia masih
memerlukan maklumat berkaitan bentuk dan jenis maklumat yang paling kerap dikongsi
sama peribadi, sensasi, politik dan kasual. Hasil dapatan daripada kajian sebegini
sangat penting bagi pihak kerajaan, korporat, swasta, pemimpin politik, pembuat dasar
dan sebagainya dalam usaha membangunkan negara bangsa dan bagi mencegah
ancaman siber yang mampu mengganggu gugat kestabilan politik dan keselamatan
negara.
2.3 Motivasi dalam Berkongsi Maklumat
Motivasi adalah keinginan untuk melakukan sesuatu atau semangat untuk

sesuatu tertentu. Motivasi dibahagikan kepada dua jenis, iaitu intrinsik dan extrinsik
Mahdikhani (2016, 53). Motivasi intrinsik adalah motivasi yang datang dari seseorang
dan diperoleh melalui keseronokan atau minat peribadi seseorang. Motivasi ekstrinsik
adalah motivasi yang datang dari faktor luar dan biasanya memberi tumpuan kepada
perkara-perkara seperti insentif dan ganjaran. Motivasi ekstrinsik mampu mempengaruhi
kelakuan seseorang dalam mencapai matlamat tertentu (Vallerand 1997). Terdapat dua
motivasi dalam berkongsi maklumat dalam talian, motivasi berpusatkan diri dan motivasi
yang berkaitan dengan masyarakat (Hsu & Lin 2008). Motivasi berpusatkan diri adalah
motivasi diri yang membawa keuntungan peribadi. Motivasi yang berkaitan dengan
masyarakat adalah motivasi untuk masyarakat yang membawa bantuan atau bantuan
tertentu kepada masyarakat. Terdapat dua jenis motivasi yang mencetuskan seseorang
dalam berkongsi maklumat atau pengetahuan. Motivasi sedemikian adalah keinginan
untuk memperoleh reputasi dan keinginan untuk membantu orang lain (altruisme). Hasil
dapatan daripada kajian ini akan membolehkan pihak-pihak yang terlibat bagi lebih
158
memahami faktor-faktor yang mempengaruhi kecenderungan belia dalam perkongsian

maklumat di media sosial.
3.0 KESIMPULAN
Kajian berkenaan kecenderungan perkongsian maklumat di kalangan belia Malaysia

adalah sangat memenuhi kehendak dan keperluan semasa dalam usaha membangunkan
negara bangsa yang maju dan harmoni. Ini kerana perkongsian maklumat yang salah atau
palsu mampu meletakkan negara dalam keadaan bahaya dan kucar kacir. Sesungguhnya salah
satu cabaran yang dihadapi oleh pihak kerajaan adalah berkaitan dengan tahap ketulenan atau
kesahihan sesuatu berita atau maklumat yang dibaca dan dikongsi dan seterusnya menjadi
tular di media sosial. Seterusnya, data yang akan diperoleh daripada kajian ini akan menjadi
satu sumber rujukan kepada pihak kerajaan bagi memperkenalkan dan melaksanakan dasar-
dasar berkaitan dengan media. Contohnya dalam mengenal pasti kaedah-kaedah atau medium
yang paling sesuai dalam berinteraksi dengan belia masa kini agar mereka menjadi anak
bangsa yang bertanggungjawab dan cakna dalam usaha membangunkan negara.
RUJUKAN
Amir, F (2008). Sikap netizen rosakkan konsep viral. Kosmo Online. Diakses di
http://www.kosmo.com.my/kosmo/content.asp?y=2016&dt=1012&pub=Kosmo&s
ec=Rencana_Utama&pg=ru_02.htm#ixzz4bjIZsFTR(13 Mac 2017).
McKnight, D. H. &Chervany, N. L. (1996). The Meanings of Trust. University of
Minnesota, http://misrc.umn.edu/wpaper/WorkingPapers/9604.pdf (14 Mac 2017).
Davis, F., Bagozzi, R., &Warshaw, P. (1989). User acceptance of computer technology:
A comparison of two theoretical models. Management Science, 35(8), 982–1002.
Gefen, D. (2000). ―E-Commerce: The role of familiarity and trust,‖ Omega-Int J Manage
Sci, 28, 725-737.
Ghaisani, AP., Handayani, PW., &Munajat, Q (2017). Users‘ motivation in sharing
information on social media, Procedia Computer Science, 124, 530-535.
Hsu C & Lin JC. (2008). Acceptance of blog usage: The roles of technology acceptance,
social influence and knowledge sharing motivation. Information & Management,
45(1):65-74.
Latib, S. (2015). 75% berita viral palsu, Utusan Malaysia (Online). Diakses di
http://www.utusan.com.my/berita/nasional/75-berita-viral-palsu-
1.150753#ixzz4aoIJZih0 (02/03/2017).
Lee, W. & Paris, CD., (2013). Knowledge sharing and social technology acceptance
model: Promoting local events and festivals through Facebook, Tourism
Analysis, 18, 1-13.
Mahdikhani, Z. (2016). An overview of motivation: The challenges and the importance
of motivation for second language acquisition. Journal For The Study Of English
Linguistics, 4(1), 53.
159
Sinar Harian (2015). Sindiket proses air zam zam palsu di Melaka tidak benar. Diakses
di http://www.sinarharian.com.my/nasional/sindiket-proses-air-zamzam-di-
melaka-tidak-benar-1.375992 (13/03/17).
Sinar Harian (2016). Mesej palsu petrol percuma. Diaksess di
http://www.sinarharian.com.my/edisi/utara/mesej-palsu-petrol-percuma-1.584111
(13/03/17).
Vallerand RJ., (1997). Toward A Hierarchical Model of Intrinsic and Extrinsic Motivation.
Advances In Experimental Social Psychology, 271-360.
-GP24-
Information Sources and its Relation to Formation of Malaysia Image
Noor Suhaila Yusof1 and Kamal Izzuwan Ramli2

1 School of Tourism, Hospitality and Event Management, UUM,nsuhaila@uum.edu.my
2 School of Tourism, Hospitality and Event Management, UUM, izzuwan@uum.edu.my
Abstract
The current aim of this paper is to identify the types of information sources which influence
the perceived image of Malaysia. Undoubtedly, „source of information‟ is an important factor in
forming the perceived image of a destination. This study measured the frequency of information
sources used and how this can influence image formation. Respondents includes visitors who
had been to Malaysia as well as non-visitors who live in the United Kingdom.The Internet was
found to be the most common source of information for higher education students, although it
did not influence their image formation of Malaysia.
KeyWords: Information Sources; Destination Image Formation; Malaysia Image
1. INTRODUCTION
The image of a destination is generally defined as the sum of the beliefs, ideas and
impressions that a person has of that destination, which is based on information processed from
a variety of sources over time, resulting in an internally accepted mental construct representing
the attributes of the destination (Crompton, 1979; Mackay and Fesenmaier, 2000). The image
constructs, as concluded by Baloglu and Brinberg (1997), consist of two components, cognitive
and affective. The cognitive involves perception and is concerned with belief or knowledge
about an object or destination. The affective is related to feelings or emotions about an object.
The images formed by different groups of tourists might differ. People‘s overall image of a
destination tends to be long lasting and hard to change, and even after real changes in a
destination, people will have difficulty in changing their pre-existing perceptions. However,
Baloglu and McCleary (1999) argued that the image of a destination may be altered after the
visitation. For instance, they stated that the image held by visitors and non-visitors showed a
significant difference, because visitors will change their perceptions after the visit. Actual
experience should be the most effective image modifier because people‘s personal experience
is the most credible information source (Sussman and Unel, 2000).
Destination images are derived from a wide spectrum of information sources (Echtner and
Ritchie, 1991). Fakeye and Crompton (1991) indicated that informative promotion providing
160
potential tourists with knowledge of a destination is regarded as a significant factor in the

destination selection process. Jenkins (1999) argued that there are many ways in which people
might form their image of a destination. For instance, a destination image can be formed
through the individual‘s direct experience, or by a blend of information sources (Baloglu, 2000).
In addition, the images which tourists form in their mind are developed after a multiple stage
process. It is important to distinguish which factors will influence the formation of tourists‘ image.
Therefore, the aim of this paper is to identify the types of information sources which influence
the image of Malaysia as perceived by higher education students living in the United Kingdom.
2. LITERATURE
2.1. The concept and components of destination image
Destination refers to a place which people may wish to visit for several reasons.
Destination image is defined as people‘s belief or knowledge about the destination‘s attributes; it
also includes an individual‘s feelings towards the destination (Martin and Rodriguez, 2008). The
ideas, belief, knowledge, feeling or attitude that an individual tourist has towards the place forms
an image perception (Bigne, Sanchez and Sanzhez, 2008). The concept of image is defined as
an individual‘s mental representation of knowledge (beliefs), feelings and global impression
about an object or destination (Baloglu and McCleary,1999). In addition, destination image is
based on the overall perception of a destination represented in the tourist‘s mind and feelings.
For this paper, destination image is defined as people‘s beliefs, impressions and knowledge
about a destination.
As discussed by several authors (such as Baloglu and McCleary, 1999; and Martin and
Rodriguez, 2008), destination image comprises two distinct components: perceptive/cognitive
and affective. Cognitive image is concerned with people‘s perceptions/beliefs or knowledge
about destinations, and affective image involves feelings about the destination. These are
defined as ―...the mental representation of a tourist destination that is formed on the basis of
individuals‘ belief about the place (cognitive), as well as their feelings toward it (affective
image)...‖ (Martin and Rodriguez, 2008, p. 274). Gartner (1993) stated that the type and amount
of external stimuli (information sources) that tourists have received or been exposed to will
influence the formation of the cognitive image component but not the affective component. In
addition, the affective image is influenced by different travel alternatives, evaluated through
individual perceptions of a place (Gartner, 1993).
Tourists will use the cognitive and affective image dimensions to form their impressions
and evaluate the considered destinations in order to decide which destination to visit. As
indicated by Baloglu (2000), the perceptual/cognitive evaluations are determined by the
variety/amounts of information sources used; types of information sources such as
advertisements, word of mouth and non-promotional material; and socio-psychological travel
motivations such as their knowledge about a place. The cognitive evaluation will later form the
affective image or feelings of a place. However, the affective image is influenced only by the
perceptual/cognitive evaluations. The perceptual/cognitive evaluations serve as intervening
variables and also mediate the relationship between affective evaluations and the variety of
types of information source and the motivation to travel to a particular destination (Baloglu,
2000). According to Baloglu and McCleary (1999), cognitive image significantly influences
affective evaluations of a destination; where cognitive evaluations positively influence affective
image evaluations of destinations. Both cognitive and affective evaluations influence the
tourists‘ intention to visit a destination, where cognitive evaluations are found to be more
influential on the intention to visit than are affective evaluations (Baloglu, 2000). For instance,
161
cognitive image particularly influences visit intention directly and indirectly through affect rather
than through affect only.
2.2. Destination image formation and influencing factors
There are several factors that could influence the tourist‘s image formation of a
destination. According to Beerli and Martin‘s (2004) model of destination image formation, the
types of information source and the tourist‘s personal factors could influence the perceived
image of a place (refer Figure 1). The primary source of information was formed through the
tourist‘s actual visit to the destination, and the intensity of the visit. Beerli and Martin (2004)
explained that primary information formed through tourist experience at a destination may vary
because it is based on perceptions from previous visits. The intensity of the visit or the extent of
an individual‘s interaction with the place may influence the individual‘s perceived image,
because they may be exposed to different dimensions of the destination by developing contacts
and relationships; and when they visit the place, they adopt different behavioural patterns
related to the intensity of interaction with the destination. Burgess (1978) argued that without
direct personal experience, the images of a place are formed by information provided by the
media and other secondary or external sources. According to Beerli and Martin (2004),
secondary information sources play an essential role in the formation of destination image
because organic and autonomous sources influence the tourist‘s cognitive evaluations.
According to Burgess (1978), the type, quality and quantity of information available to the
individual determine the type of image the person would be likely to develop. Gartner (1993)
stated that the type and amount of external stimuli (information sources) received will influence
the formation of the cognitive component of the image but not the affective component.
However, Beerli and Martin (2004) argued that the tourist‘s personal factors and the roles of
information sources will influence both the cognitive and affective images of the destination. The
results derived from cognitive and affective evaluations will later form the tourist‘s overall image
of a place.
With regard to the secondary information source, three types of information form the
image of a destination: induced, organic and autonomous (Beerli and Martin, 2004). Gunn
(1972) noted that induced images derive from the destination area and consist of traditional
forms of advertising and information received or requested from tour operators, wholesalers and
organisations which have a vested interest in the travel decision process but are not directly
associated with a particular area (Gartner, 1993). In addition, Beerli and Martin (2004) stated
that the induced sources formed through traditional marketing tools are intended to reach larger
numbers of people; these include television, brochures and information received or requested
from the tour operators or tourism marketing authorities who are responsible for promoting their
area to the potential visitors. Phelps (1986) found that the image of a place which has been
formed from induced sources of information significantly influences a visitor‘s perception of a
destination.
162
Figure 1: Model of the Formation of Destination Image (Source: Beerli and Martin, 2004)
3. METHODOLOGY
The study population comprised of higher education students living in Manchester, United
Kingdom. For the purpose of this study, two techniques were adopted to gather the target
respondents: purposive random sampling and the snowball technique. The purposive sampling
technique means obtaining information from a specific target group of people (Sekaran, 2005).
The questionnaire were developed based on the review from previous studies. A final valid
sample size of 256 were collected for this study.
4. RESULTS
4.1. Demographic profiles of respondents
This section outlines the profiles of respondents who participated in the study. Table 1
shows the diversity of respondents in terms of gender, age, ethnicity, frequency of travel, and
whether or not they have visited Malaysia. The purpose of presenting the demographics at this
stage is to show the diversity of the respondents. The statistics for gender indicated that the
respondents were fairly evenly distributed, with 43% male (110 students) and 57% female (146
students). In relation to age, the purpose was ensure data from different age groups to
represent real visitors‘ profiles, as students from different age groups travel abroad as tourists.
The age group of 20-22 was the highest percentage (37.9%) of respondents in the survey,
followed by the 23-25 year-olds (23.4%); the 17-19 age group comprised 20.3%, the 29-31
group10.5%, with the lowest percentage of respondents (7.8%) aged 26-28. Respondents for
this study were students from different ethnic groups. The largest ethnic group was ‗White‘ with
195 participants (76.2 %). Of the other groups were Asian or Asian British (7.0%), Black or
Black British (5.1%), Chinese (4.3%), Mixed (3.5%) and other (3.9%). As shown in Table 1,
43.8% of the total respondents travelled once a year and 42.2% two to three times, 7.8%
respondents travelled ‗more than three times‘ a year and a further 6.3% travelled ‗more
frequently‘ or not at all. Of the total respondents, 81.3% stated that they had not been to
Malaysia, leaving 18.7% who had. However, 62.9% of the overall students claimed that they
had heard about Malaysia.
Table 1 Profiles of respondents (n=256)
163
Frequency
%
(n)
Gender:
Male 110 43.0
Female 146 57.0
Age:
17 – 19 years old 52 20.3
20 – 22 years old 97 37.9
23 – 25 years old 60 23.4
26 – 28 years old 20 7.8
29 – 31 years old 27 10.5
Ethnicity:
White 195 76.2
Non-White
Mixed 9 3.5
Asian or Asian British 18 7.0
Black or Black British 13 5.1
Chinese 11 4.3
Other ethnic groups 10 3.9
Frequency of travel:
Once a year 112 43.8
4.2. Sources Two to three times a year 108 42.2 of
More than three times a year 20 7.8 information
about Other 16 6.3 Malaysia
Respondents who have been to Malaysia
48 18.8
Respondents who have not been to
208 81.3
Malaysia
Respondents who have heard about
Malaysia 161 62.9
Respondents who have not heard about 47 18.4
Malaysia
Participants who stated that they had heard about or had been to Malaysia were asked on
what types of information used in forming their image of the country. Since the participants were
given the chance to state more than one information source, the percentage of answers
varied.Figure 2 summarises the number and percentage of respondents who used various types
of information.
164
80
Percentage of information used

60 67%
40 (n=171)
36% 16% 16% 9% 30% 28% 10% 14% 7%
20
(n=93) (n=40) (n=40) (n=22) (n=76) (n=71) (n=26) (n=37) n=18)
0
Types of information
Internet Family and Friends

TV Show/Movies Special Package Offer
Articles in the newspaper Travel Agents and Tour Operators
Brochure Newspaper and Magazine
Advertisement Other
Figure 2: Types of information used to build an image of Malaysia
In general, all of the participants used all different types of source to seek information
about Malaysia. Based on the results of this study, the most popular source of information was
the Internet, which was used by 176 respondents representing 67% of the higher education
students. This was followed by those who gathered information from Family and Friends with
(36%). The remaining sources are detailed in Figure 2.
4.3. Sources of information used to form different images of Malaysia
Based on data from this study, it shows that different types of information source portray
several images of Malaysia to tourists. Table 2 shows the mean score for each image factor that
represents the types of information sources which influenced the formation of Malaysia image
attributes. In general, all of the six Malaysian image factors were found to be influenced mostly
by information received from the Special Package Offers, which had the highest average score
for all six factors of the Malaysian image attributes. With the highest mean score of 4.00 for
‗Environment‘, respondents agreed that this type of information helped them to develop a
knowledge of the country‘s natural and scenic beauties; varieties of flora and fauna; the climate;
and the many interesting places to visit. In addition, information received from this source
helped them in developing the image for other factors (with mean score of 3.8).
Table 2Types of information source that influenced the formation of Malaysian image
TOTAL MEAN (M) OF IMAGE ATTRIBUTES
Types of
information
sources Factor Factor Factor Factor Factor Factor
1* 2* 3* 4* 5* 6*
Internet
3.9 3.5 3.4 3.4 3.7 3.4
(n=171)
165
Family and
3.9 3.7 3.6 3.6 3.7 3.6
Friends(n=93)
TV
3.9 3.5 3.6 3.4 3.6 3.5
Show/Movies(n=40)
Special Package
4 3.8 3.8 3.7 3.8 3.8
Offer(n=40)
Articles in the
3.8 3.6 3.3 3.4 3.5 3.4
newspaper(n=22)
Travel Agents and

Tour 3.8 3.5 3.6 3.5 3.8 3.4
Operators(n=76)
Brochure(n=71) 3.9 3.5 3.5 3.5 3.7 3.5
Newspaper and
4 3.6 3.5 3.4 3.5 3.5
Magazine(n=26)
Advertisement(n=37) 3.8 3.5 3.5 3.4 3.5 3.4
Other
3.7 3.5 3.4 3.4 3.7 3.4
(n=18)
*Factor 1 = Environment; Factor 2 = Food and Travel Expenses;

Factor 3 = Tourist Amenities and Accommodation; Factor 4 = Cleanliness and Shopping Facilities;
Factor 5 = Local Culture; Factor 6 = Activities.
The Internet was found to be the main source of information, especially for building the
‗Environment‘ image of Malaysia, with the highest mean score of 3.9. Scores for the specific
attributes are given in the figure. Malaysia‘s image was also developed from information
received from family and friends and also through TV shows and movies, with mean scores of
3.9 in helping respondents to develop the ‗Environment‘ image. Again, TV helped respondents
to build a picture of the other factors, especially for accommodation and local culture.
Information gathered from newspaper articles helped respondents to develop an
‗Environment‘ image, followed by ‗Food and Travel Expenses‘ and ‗Local Culture‘. Meanwhile,
the information gathered from ‗Travel Agents and Tour Operators‘ highlighted not only the
varieties of hotels with good facilities, and information about shopping facilities and the country‘s
cleanliness, but it again added to knowledge about Malaysia‘s ‗Environment‘ and ‗Local Culture‘
and achieved a mean score of 3.8. The information from ‗Brochures‘ also helped respondents to
develop an ‗Environment‘ and Local Culture‘ images with mean scores of 3.9 and 3.7,
respectively. ‗Newspapers and Magazines‘ helped respondents to form most for the
‗Environment‘ image factor.
5. DISCUSSION AND CONCLUSION
166
According to Burgess (1978), the type, quality, and quantity of information sources
determine the type of image that is likely to be developed; and Baloglu (2000) claimed that it
could also influence the intention to visit a destination. Fakeye and Crompton (1991) claimed
that people with a desire to travel may become involved in an active information search leading
to specific information sources. This section will discuss the influence of sources of information
in building the perceived image of Malaysia. Goodall (1990) indicated that knowing the factors
influencing the perceived image can help to identify target markets and decide which images
should be promoted to the appropriate market.
The results of the current study are consistent with a previous study conducted by
Woodside and Lysonski (1989). They commented that information sources influence the
formation of people‘s perception towards a place. The current study found that 67% of
respondents used the Internet as the most common source of information about the country
(refer to Figure 2). This finding supports the finding stated in Beeton (2001), that tourism has
been touted as the perfect product for online sales and distribution, particularly in relation to its
intangible nature which can be emotively presented through electronic media. Other than the
Internet, information received through recommendation from family members and relatives
(36%); the services of travel representatives (30%); and brochures (28%) were favoured when
seeking information about Malaysia. This study concurs with Badaruddin, Lee and Nikmatul
(2003) study, which found that visitors to Malaysia obtained information about the country
through recommendations from their friends and relatives, information gathered from travel
guides and also travel agencies. Beerli and Martin (2004) confirmed that the greater the role of
travel agency staff in providing information, the better will be the image of a destination
perceived by potential tourists. However, Nishimura, Waryszak and King (2006) found that
information received from ‗word of mouth from family and friend‘ and ‗past experience‘ was
apparently used by a relatively small number of peoples. The most information sources used by
the Japanese tourists prior to travel was ‗travel guidebook‘. Travel agent and package tour
brochure were also popular, though users did not perceived their usefulness to be as high as
the case for travel guidebook. In particular, the Japanese tourists used the travel guidebook for
gathering the information of a destination, local transport, places to visit, meals and shopping
information.
The results of this study are consistent with a previous study conducted by Um and
Crompton (1990) and Um (1993), showing that peoples‘ perceptions are formed by external
factors which include various information sources such as promotional efforts of a destination
through media, and recommendation from friends and relatives (word of mouth). Baloglu and
McCleary (1999) confirmed that word of mouth recommendations from friends and relatives
were the most important source in forming touristic images. In addition, the result of this study
supports the findings of a previous study conducted by Gartner (1993), that both advertisements
and non-promotional information sources contributed to the perceived tangible or physical
destination attributes; while the word of mouth affected people‘s perception of intangible or
psychological attributes. Consistent with the study conducted by Beerli and Martin (2004),
information received by word of mouth is considered to be the most believable and truthful
communication channel and it is important that these messages match the reality of the
destination. Hence, the development of the image must be based on reality, otherwise the
destination will not succeed in satisfying tourists, and this in turn will have a negative effect on
the image that they will transmit by word of mouth. In addition, Milman and Pizam (1995)
confirmed that when people gather information they will become more familiar with a
destination. Gartner (1993) suggested that in order to increase tourist familiarity and reinforce
the current image of a destination, the use of brochures is necessary.
Even though the Internet was found in the current study to be the most usable source of
information, it did not greatly influence the image formation of the destination. The results of the
current study show that different types of information source helped respondents to form
167
different images of Malaysia as a travel destination. This is inconsistent with Beerli and Martin‘s
(2004) findings, which indicated that traditional forms of advertising were found to have little
influence on the post-visit image formed by tourists. Beerli and Martin (2004) found that sources
of information such as the brochures provided by the destination‘s public authorities, tour
operators‘ brochures, advertising campaigns, and the Internet had no significant influence on
the different image factors. Respondents in this study, young students, thought that the
information they gathered from special packages was found to be most influential in developing
their perception of all six factors of Malaysia‘s image (as discussed in Table 2).
This study has showed that the special packages had received higher attention from
young tourists in influencing their perceived image of a destination. In addition, the results of the
current study show that other than special package offers, the sources of information that most
influenced the formation of the environment image was also from promotions received from
newspaper and magazines. The results of this study support the claims by Tuan (1975) that an
image of an environment or place is something formed in the human mind in the absence of
physical presence. Meanwhile, this study also found that special package offers and information
received from travel agents and tour operators had helped respondents to build their image of
Malaysia‘s culture. The information given by the travel representatives was more accurate and
diverse because these people usually have more knowledge about the destination offered to
tourists. The current study‘s findings also support the claims made by Murphy (1983) and Beerli
and Martin (2004), that travel agency staff were responsible for influencing people‘s positive
image of a destination; and that tour operators responsible for creating attractive destination
packages for tourists should have more knowledge of the place (Gartner, 1993). This study is
consistent with Baloglu and Mangaloglu‘s (2001) findings that travel intermediaries could
represent the ‗clear‘ image of a place and will later influence the decisions in promoting a
destination to potential tourists because they have visited the destination regularly.
Previous studies suggested the type of information source influences the perceived image
of a destination (Beerli and Martin, 2004). This study therefore aimed to identify the types of
information that influence the perceived image of Malaysia. It explored the frequency of use of
different information types and the impact on image formation. The study found the most used
induced sources of information were from the Internet (67%); travel agents (30%) and brochures
(28%); and organic information was derived from friends‘ and relatives‘ recommendations
(36%). Even though the Internet was found to be the most used source, it did not greatly
influence the image formation of Malaysia‘s attributes. This study has added to the body of
knowledge in that the level of frequency of use of information seeking about a destination did
not influence the perceived image.
REFERENCES
Baloglu, S. (2000). A path analytic model of visitation intention involving information sources,
socio-psychological motivations, and destination image. Journal of Travel and Tourism
Marketing. 8(3), 81-90.
Baloglu, S., and Brinberg, D. (1997). Affective images of tourism destinations. Journal of Travel
Research, 35(4), 11-15.
Baloglu, S.&Mangaloglu, M. (2001). Tourism destination images of Turkey, Eygypt, Greece and
Italy as perceived by US-based tour operators and travel agents. Tourism Management,
22(1), 1-9.
Baloglu, S.&McCLeary, K. (1999). US international pleasure travellers‘ images of four
Mediterranean destinations: A comparison. Journal of Travel Research, 35(4), 11-15.
Beerli, A. & Martin, J. D. (2004). Factors influencing destination image. Annals of Tourism
Research, 31(3), 657–681.
168
Beeton, S. (2001). Marketing tourism destination online; strategies for the information age.
Tourism Management, 22,419-426.
Badaruddin, M., Lee, L. M., and Nikmatul, A. N. (2003). Malaysia‘s International Tourism
Promotion and Image Positioning-Perceptions of the International Tourists.
Proceedingsof the 8th Annual Conference Asia Pacific Tourism Association, 10-18.
Bigne, E., Shanchez, I. &Shanchez, J. (2008). The functional-psychological continuum in the
cognitive image of a destination: A confirmatory analysis. Tourism Management,1-9.
Burgess, J. A. (1978). Image and Identity. Occasional Papers in Geography. University of Hull
Publications.
Gartner, W. C. (1993). Image formation process. Journal of Travel and Tourism Marketing, 2(2),
191–216.
Gunn, C. (1972). Vacationscape. Bureau of Business Research, University of Texas: Austin.
Goodall, B. (1990). How tourists choose their holidays: An analytical framework, In: Marketing in
the tourism industry: the promotion of destination regions (Goodall. B.& Ashworth, G.
Eds). London: Routledge, 1-17.
Jenkins, O. H. (1999). Understanding and measuring tourist destination images. International
Journal of Tourism Research, 1. 1-15.
Mackay, K. J., and Fesenmaier, D. R. (2000). An exploration of cross cultural destination image
assessment. Journal of Travel Research, 38, 417-423.
Martin, H. S.& Rodriguez, I. A. (2008). Exploring the cognitive-affective nature of destination
image and the role of psychological factors in its formation. Tourism Management, 29.
263–277.
Milman, A.&Pizam, A. (1995). The role of awareness and familiarity with a destination: the
Central Florida case. Journal of Travel Research, 33(3). 21-27.
Murphy, P. (1983). Perceptions of attitudes of decision making groups in tourist centres, In: The
image of destination regions (Stabler, M). Croom Helm, Inc. New York, 133-160.
Nishimura, S., Waryszak, R.& King, B. (2006). The use and perceived usefulness of information
sources among Japanese overseas tourists. Tourism and Hospitality Research, 6(4).
285-295.
Phelps, A. (1986). Holiday destination image–holiday assessment. Tourism Management, 168-
180.
Reilly, M. D. (1990). Free elicitation of descriptive adjectives for tourism image assessment.
Journal of Travel Research, 28(4), 69-76.
Sekaran, U. (2005). Research methods for business: a skill building approach. John Wiley and
Sons.
Sussman, S. &Unel, A. (2000). Destination image and its modification after travel: an empirical
study on Turkey, In: Consumer behaviour in travel and tourism (Pizam, A., and
Mansfeld, Y.). Haworth Hospitality Press. New York. London. Oxford.
Um, S. (1993). Pleasure travel destination choice, In: Encyclopedia of Hospitality and Tourism
(Khan, M., Olsen, M., and Var, T.). New York: Van Nostrand Reinhold, 811-821.
Um, S.& J. L. Crompton (1990). Attitude determinants in tourism destination choice. Annals of
Tourism Research, 17, 432-448.
Woodside, A. G.&Lysonski, S. (1989). A general model of traveller destination choice. Journal of
Travel Research, 27, 8-14
-GP25-
Kecukupan Maklumat Penilaian Dalam Melestarikan Proses Penilaian Prestasi
Kerja Oleh Pegawai Penilai
169
Low Kah Choon1 dan Muhamad Ali Embi2

1 Pusat Pengajian Kerajaan, UUM COLGIS, Universiti Utara Malaysia, 06010 UUM Sintok
kahchoon@uum.edu.my
2 Pusat Pengajian Kerajaan, UUM COLGIS, Universiti Utara Malaysia, 06010 UUM Sintok
ali@uum.edu.my
Abstrak
Pegawai penilai memainkan peranan yang penting dalam memastikan proses penilaian
prestasi kerja pegawai yang dinilai dilaksanakan dengan baik. Walau bagaimanapun, pegawai
penilai dikatakan mempunyai maklumat penilaian yang kurang mencukupi dari segi
pelaksanaan proses penilaian prestasi dan pemantauan prestasi kerja. Kajian ini
mengaplikasikan reka bentuk cross-sectional survey dan borang soal selidik digunakan sebagai
instrumen kajian. Responden kajian adalah 488 orang Pegawai Penilai Pertama dari Kumpulan
Pengurusan dan Profesional yang berkhidmat dalam Kementerian dan Jabatan Persekutuan di
Putrajaya. Hasil kajian mendapati pegawai penilai memerlukan dua jenis maklumat penilaian
iaitu maklumat berkaitan sistem penilaian prestasi dan maklumat berkaitan pemantauan kerja.
Majoriti pegawai penilai bersetuju bahawa mereka mempunyai maklumat sistem dan maklumat
pemantauan yang mencukupi. Hasil kajian ini memberi pendedahan penting kepada Pengurus
Sumber Manusia dan pegawai penilai akan faktor kecukupan maklumat yang harus diberi
tumpuan dalam melestarikan proses penilaian prestasi kerja bagi memastikan matlamat
penilaian yang objektif, adil dan telus dapat dicapai.
Kata Kunci:Kecukupan Maklumat Penilaian, Melestarikan Proses Penilaian Prestasi Kerja,

Pegawai Penilai, Sektor Awam.
1. Pendahuluan
Kewujudan penilaian prestasi yang objektif, adil, dan telus dikatakan menyumbang
kepada sistem pengurusan sumber manusia yang lebih efektif (Longenecker, Fink, & Caldwell,
2014) serta merupakan salah satu amalan kerja berprestasi tinggi (Cardy, 2015).Walau
bagaimanapun, pengkaji lepas mendapati bahawa terdapat kekurangan kajian yang
berfokuskan kepada perspektif pegawai penilai mengenai apakah maklumat berkaitan penilaian
prestasi yang diperlukan pegawai penilai untuk membuat penilaian yang lebih baik (Roch,
McNall, & Caputo, 2011).
Pegawai penilai memainkan peranan yang penting dalam proses pengurusan prestasi
(Murphy & Cleveland, 1995; Pulakos & O‘Leary, 2011) kerana pegawai penilai masih
merupakan sumber yang penting dalam memberikan input, khususnya dalam penilaian prestasi
(Meriac, Gorman, & Macan, 2015). Selain itu, pegawai penilai juga bertanggungjawab untuk
memberikan maklum balas prestasi dan terlibat dalam proses pelaksanaan penilaian prestasi,
tetapi mereka berasa kurang selesa dalam melaksanakan tanggungjawab tersebut (Cardy,
2015). Salah satu sebabnya adalah kerana pegawai penilai mempunyai maklumat yang kurang
mencukupi dari segi pelaksanaan proses penilaian prestasi dan data serta bukti pemantauan
170
prestasi kerja pegawai yang dinilai dalam membantu pegawai penilai membuat penilaian
prestasi yang lebih berasas (Bol, 2011; Rabenu & Tziner, 2016).
Bagi menghasilkan penilaian yang lebih berasas, maka pegawai penilai perlu
mempunyai maklumat untuk membantu mereka dalam melaksanakan proses penilaian prestasi
(Brewer & Wells, 2006; Kondrasuk, Crowell, Dillon, Kilzer, & Teeley, 2008). Memandangkan
konteks setiap kajian adalah berbeza, maka jenis maklumat dan tahap kecukupan maklumat
bagi pegawai penilai adalah berbeza bergantung kepada sistem penilaian prestasi yang
dilaksanakan dalam organisasi masing-masing. Maka, timbul persoalan sejauh manakah
kecukupan maklumat mempengaruhi penilaian pegawai penilai terhadap prestasi pegawai di
bawah seliaan mereka dalam Perkhidmatan Awam Malaysia. Oleh itu, kajian ini akan mengkaji
faktor kecukupan maklumat dalam konteks Sistem Penilaian Prestasi Pegawai Perkhidmatan
Awam Malaysia (SPPPPAM) di bawah Skim Saraan Malaysia (SSM).
2. ULASAN KARYA
Maklumat merupakan salah satu faktor yang kritikal dalam proses penilaian prestasi
kerana ia merupakan sumber utama untuk dirujuk pegawai penilai bagi membuat keputusan
penilaian yang lebih berasas serta menjadikan proses penilaian prestasi lebih objektif, adil, dan
telus (Cheng, Bai, & Li, 2009). Oleh itu, penilaian yang dibuat oleh pegawai penilai didapati
bergantung kepada maklumat yang ada semasa membuat penilaian (Tversky & Kahneman,
1973, 1974).
2.1. Konsep Kecukupan Maklumat

Konsep kecukupan maklumat didefinisikan sebagai ―amount of the information received
and its perceived relevance” (Sheer & Cline, 1995, hlm. 49). Dalam konteks penilaian prestasi,
maklumat merujuk kepada ―meaningful organized data‖ (Upadhyay, dalam Kumar, 2015, hlm.
3). Maklumat yang bermakna serta teratur yang sering dicari oleh pegawai penilai bagi
melengkapkan laporan penilaian prestasi adalah maklumat berkaitan pelaksanaan sistem
penilaian prestasi dan pemantauan prestasi kerja yang boleh didapati serta relevan dengan
aspek prestasi yang dinilai dalam borang penilaian. Konsep ini diukur berdasarkan kepada
tahap kecukupan maklumat sistem penilaian prestasi seperti prosedur pelaksanaan penilaian
dan standard penilaian aspek-aspek prestasi serta tahap kecukupan maklumat pemantauan
kerja pegawai yang dinilai seperti hasil kerja dan gelagat kerja yang digunakan sebagai rujukan
oleh pegawai penilai untuk membantu mereka dalam menilai aspek-aspek prestasi yang
ditetapkan dalam borang prestasi (Rusli Ahmad, Azman Ismail, & Wan Khairuzzaman Wan
Ismail, 2007).
171
2.2. Kecukupan Maklumat dalam Konteks Penilaian Prestasi Perkhidmatan Awam

Malaysia
Maklumat ini digunakan untuk memberikan input yang berguna kepada pegawai penilai
semasa membuat penilaian terhadap prestasi pegawai yang dinilai. Maklumat prestasi boleh
berbentuk numerikal yang bersifat objektif mahupun berbentuk kualitatif yang bersifat subjektif
(Bol, 2011). Maklumat ini akan memberikan gambaran keseluruhan mengenai prestasi pegawai
yang dinilai dengan lebih menyeluruh dan tepat (Rabenu & Tziner, 2016). Sejajar dengan itu,
pegawai penilai perlu mempunyai maklumat yang jelas tentang sistem penilaian prestasi yang
digunakan serta maklumat pemantauan terhadap aspek prestasi kerja yang dinilai (OECD,
1997). Pegawai penilai perlu mendapatkan pelbagai jenis maklumat seperti maklumat berkaitan
dasar penilaian prestasi dan prosedur pelaksanaan penilaian prestasi (Findley, Giles, &
Mossholder, 2000), maklumat pemantauan kerja pegawai yang dinilai (Jawahar, 2005) serta
maklumat berkaitan aspek-aspek prestasi yang hendak dinilai dalam jumlah yang berbeza
(Williams, DeNisi, Blencoe, & Cafferty, 1985).
Pada kebiasaannya, pegawai penilai mempunyai maklumat yang kurang mencukupi

berkaitan dengan prestasi kerja pegawai yang dinilai dan membuat penilaian berdasarkan
kepada maklumat yang terhad (DeNisi & Williams, 1988). Ketidakcukupan maklumat
merupakan keadaan yang mana pegawai penilai mendapat serta mempunyai maklumat yang
kurang lengkap berkenaan proses penilaian prestasi dan maklumat berkaitan prestasi pegawai
yang dinilai (Longenecker & Fink, 2011). Ketidakcukupan maklumat ini menyebabkan
ketidakpastian dan ketidakjelasan di pihak pegawai penilai serta pelbagai masalah dalam
organisasi (Longenecker et al., 2014).
Dalam situasi ketidakcukupan maklumat, penilaian yang dibuat oleh pegawai penilai
akan mempengaruhi kebolehpercayaan dan kesahan keputusan penilaian prestasi. Pegawai
penilai yang tidak mempunyai maklumat yang mencukupi akan menghasilkan penilaian yang
mempunyai tahap kesahan dan kebolehpercayaan yang rendah berbanding dengan pegawai
penilai yang pakar atau mempunyai pengalaman dalam membuat penilaian (Roberts, 1998).
Kesan daripada masalah ketidakcukupan maklumat, Fried, Tiegs, dan Bellamy (1992)
mendapati pegawai penilai kurang memberikan maklum balas atau ragu-ragu ketika membuat
penilaian terhadap prestasi pegawai yang dinilai kerana akses kepada maklumat yang terhad
akan mempengaruhi penilaian pegawai penilai terhadap prestasi kerja pegawai yang dinilai.
Dalam konteks Perkhidmatan Awam Malaysia, maklumat didefinisikan sebagai

maklumat-maklumat yang berkaitan dan relevan dengan aspek-aspek prestasi yang dinilai
(seperti aspek penghasilan kerja, aspek ilmu dan pengetahuan, aspek kualiti peribadi dan
aspek kegiatan dan sumbangan di luar tugas rasmi) yang ditetapkan dalam borang penilaian
prestasi (Jabatan Perkhidmatan Awam Malaysia, 2009). Pegawai penilai perlu dilengkapkan
dengan maklumat yang mencukupi berkaitan sistem penilaian prestasi seperti prosedur
pelaksanaan penilaian dan standard penilaian aspek-aspek prestasi serta maklumat
pemantauan kerja pegawai yang dinilai seperti hasil kerja dan gelagat kerja yang digunakan
sebagai rujukan oleh pegawai penilai untuk membantu mereka membuat penilaian (Rusli
Ahmad et al., 2007). Oleh itu, kecukupan maklumat merupakan salah satu faktor yang penting
172
dalam penilaian prestasi supaya penilaian yang dibuat oleh pegawai penilai adalah lebih
berasas (Bol, 2011; Kondrasuk et al., 2008).
3. Metodologi
Kajian ini mengaplikasikan reka bentuk cross-sectional survey dan borang soal selidik
digunakan sebagai instrumen kajian. Kajian ini berfokuskan kepada para Pegawai Penilai
Pertama (PPP) dalam Kumpulan Perkhidmatan Pengurusan dan Profesional yang menyandang
gred jawatan 41 hingga 54 dan berkhidmat di bahagian-bahagian dalam Kementerian dan
Jabatan Persekutuan di Putrajaya sebagai unit analisis. Bilangan populasi kajian ini adalah
tertakluk kepada senarai nama PPP yang diberikan oleh Jabatan Perkhidmatan Awam Malaysia
dan Kementerian masing-masing. Pegawai Penilai Pertama yang memenuhi kriteria yang
ditetapkan dipilih secara rawak bagi setiap strata dengan saiz sampel yang ditetapkan secara
tidak berkadaran atau disproportionate sampling untuk menjadi sampel dalam kajian ini.
4. dapatan Kajian
4.1. Analisis Faktor bagi Faktor Kecukupan Maklumat
Hasil analisis faktor bagi kecukupan maklumat menghasilkan dua faktor dengan masing-
masing mencatatkan nilai eigen 8.363 dan 2.327. Faktor pertama menjelaskan sebanyak 52.3%
varians bagi pemboleh ubah ini, manakala faktor kedua menjelaskan 14.5% varians bagi
pemboleh ubah ini. Faktor pertama mempunyai 11 item dengan nilai muatan faktor dalam julat
antara .663 dan .816, manakala faktor kedua mempunyai 5 item, mencatatkan nilai muatan
faktor dalam julat antara .804 dan .852. Selain itu, nilai komunaliti bagi semua item di bawah
pemboleh ubah ini adalah dalam julat antara .542 dan .775. Dengan merujuk kepada nilai
muatan faktor dan nilai komunaliti yang dicapai dalam analisis faktor, tiada item yang
digugurkan. Seterusnya, penamaan diberikan kepada faktor-faktor yang terbabit, iaitu faktor
pertama sebagai kecukupan maklumat pemantauan dan faktor kedua sebagai kecukupan
maklumat sistem. Keputusan analisis faktor bagi kecukupan maklumat adalah seperti dalam
Jadual 1.
Jadual 1 Keputusan Analisis Faktor bagi Pemboleh Ubah Kecukupan Maklumat

Kecukupan Maklumat Deskripsi Item Nilai Muatan Nilai
Faktor Komunaliti
Kecukupan Maklumat Sejauh manakah kecukupan maklumat anda

Pemantauan mengenai pemantauan terhadap kerja pegawai
yang dinilai di bawah seliaan anda berkaitan
- jalinan hubungan dan kerjasama?

Nilai Eigen: 8.363 - keberkesanan komunikasi?
- kualiti hasil kerja?
Peratus Varians - ketepatan masa?
- keberkesanan hasil kerja?
173
Dijelaskan: 52.3 - disiplin? .816 .691

- kebolehan mengelola?
- kuantiti hasil kerja? .812 .688
- ilmu pengetahuan dan kemahiran dalam bidang
kerja? .802 .681
- proaktif dan inovatif?
- pelaksanaan dasar, peraturan dan arahan .790 .655
pentadbiran?
.780 .655
.780 .638
.761 .614
.745 .628
.744 .619
.740 .596
.663 .542
Kecukupan Maklumat Sejauh manakah kecukupan maklumat anda

Sistem mengenai Sistem Penilaian Prestasi Pegawai
Perkhidmatan Awam Malaysia (SPPPPAM) di
bawah Sistem Saraan Malaysia (SSM) berkaitan
Nilai Eigen: 2.327 - prosedur pelaksanaan penilaian prestasi?

- tanggungjawab Pegawai Penilai Pertama?
Peratus Varians - ciri-ciri sistem penilaian prestasi?
Dijelaskan: 14.5 - panduan penyediaan SKT?
- panduan pengisian borang HRMIS-LNPT?
.852 .775
.842 .762
.833 .738
.818 .713
.804 .696
174
4.2. Profil Responden

Seramai 488 Pegawai Penilai Pertama yang menjadi responden dalam kajian ini.
Majoriti responden bergred jawatan 48 dan ke bawah (80.9%) serta berkhidmat lebih daripada
enam tahun dalam Kerajaan (85.5%). Kebanyakan responden berpengalaman sekurang-
kurangnya enam tahun (71.3%) dalam menjadi Pegawai Penilai Pertama dalam Kerajaan dan
bertanggungjawab untuk menilai kurang daripada 11 Pegawai Yang Dinilai di bawah seliaan
mereka (85%). Sejumlah 311 responden atau 63.7% tidak pernah mengikuti latihan formal
berkaitan penilaian prestasi dalam Kerajaan. Dari segi demografi, seramai 269 responden
perempuan (55.1%) dan 219 responden lelaki (44.9%) yang majoritinya berada dalam
lingkungan umur 45 tahun dan ke bawah (85.1%) telah berkahwin (81.4%) serta mempunyai
kelulusan pendidikan pada tahap Ijazah dan ke atas (98%).
4.3. Analisis Deskriptif

Berdasarkan kepada Jadual 2, kebanyakan pegawai penilai bersetuju bahawa mereka
mempunyai maklumat pemantauan yang mencukupi (min= 3.94, sisihan piawai= 0.53) dan
mempunyai maklumat sistem yang mencukupi (min= 3.67, sisihan piawai= 0.70).
Jadual 2 Keputusan Statistik Deskriptif bagi Pemboleh Ubah Kecukupan Maklumat

Pemboleh Ubah Min Sisihan Piawai
Kecukupan Maklumat Pemantauan 3.94 0.53
Kecukupan Maklumat Sistem 3.67 0.70
5. SUMBANGAN KAJIAN
Hasil kajian ini memberi pendedahan penting kepada Pengurus Sumber Manusia dan
pegawai penilai akan faktor kecukupan maklumat yang harus diberi tumpuan dalam membuat
penilaian prestasi yang lebih berasas bagi memastikan matlamat penilaian yang objektif, adil
dan telus dapat dicapai.Penumpuan kepada faktor ini boleh meningkatkan pemahaman
pegawai penilai dalam mengenal pasti maklumat yang diperlukan semasa berada dalam dilema
untuk memberikan penilaian akibat ketidakpuasan hati pegawai yang dinilai yang
mempersoalkan penilaian pegawai penilai yang tidak berasas. Oleh yang demikian, kajian ini
menyumbang dalam 1) mengenal pasti maklumat yang diperlukan oleh pegawai penilai dalam
membuat penilaian iaitu maklumat berkaitan sistem penilaian prestasi dan pemantauan prestasi
pegawai yang dinilai serta 2) mengkaji faktor kecukupan maklumat-maklumat tersebut dalam
konteks Sistem Penilaian Prestasi Pegawai Perkhidmatan Awam Malaysia (SPPPPAM) di
bawah Skim Saraan Malaysia (SSM).
175
6. KESIMPULAN
Bagi memastikan proses penilaian prestasi ini dapat mencapai matlamat penilaian yang
objektif, adil dan telus, maka pegawai penilai perlu mempunyai maklumat yang mencukupi
dalam membantu mereka membuat penilaian yang berasas. Jikalau pegawai penilai tidak
mempunyai maklumat yang mencukupi mengenai sistem dan pemantauan terhadap hasil kerja
pegawai yang dinilai, maka ia boleh menimbulkan salah faham dan tanda tanya di kalangan
pegawai yang dinilai. Bagi melestarikan pelaksanaan proses penilaian prestasi, pihak Jabatan
Kerajaan perlu mewujudkan mekanisma pemantauan secara berkala melalui sistem yang
mampan supaya maklumat perkembangan prestasi kerja pegawai yang dinilai dapat dikemas
kini dari semasa ke semasa. Selain itu, kewujudan satu pangkalan data pembelajaran sebagai
sumber maklumat dalam melatih pegawai penilai untuk menjadi seorang penilai yang
bermaklumat dan berpengetahuan adalah penting dengan memasukkan contoh-contoh kaedah
pemarkahan, kajian-kajian kes berkaitan penilaian prestasi serta panduan-panduan menilai
secara atas talian.
RUJUKAN
Bol, J. C. (2011). The determinants and performance effects of managers‘ performance

evaluation biases. The Accounting Review, 86(5), 1549-1575.
Brewer, N., & Wells, G. L. (2006). The confidence–accuracy relationship in eyewitness
identification: Effects of lineup instructions, foil similarity, and target-absent base rates.
Journal of Experimental Psychology: Applied, 12(1), 11-30.
Cardy, R. L. (2015). Informal and formal performance management: Both are needed. Industrial
and Organizational Psychology, 8(1), 108-111. doi:10.1017/iop.2015.7.
Cheng, J., Bai, H., & Li, Z. (2009). Information: A critical factor in the process of performance
appraisal. IEEE, 772-777.
DeNisi, A. S., & Williams, K. J. (1988). Cognitive approaches to performance appraisal. Dalam
G. Ferris & K. Rowland (Eds.), Research in personnel and human resource
management (hlm. 109-155). Greenwich, CT: JAI Press.
Findley, H. M., Giles, W. F., & Mossholder, K. W. (2000). Performance appraisal process and
system facets: Relationships with contextual performance. Journal of Applied
Psychology, 85, 634-640.
Fried, Y., Tiegs, R. B., & Bellamy, A. R. (1992). Personal and interpersonal predictors of
supervisors' avoidance of evaluating subordinates. Journal of Applied Psychology, 77,
462-468.
Jabatan Perkhidmatan Awam Malaysia. (2009). HRMIS: Transformasi pengurusan sumber

manusia sektor awam Malaysia abad ke-21. Sepang: JPA.
Jawahar, I. M. (2005). Do raters consider the influence of situational factors on observed
performance when evaluating performance? Evidence from three experiments. Group
and Organization Management, 30(1), 6-41. doi:10.1177/1059601104267664.
176
Kondrasuk, J. N., Crowell, E., Dillon, K., Kilzer, S., & Teeley, J. (2008). Appraising performance
appraisal: The problems. Proceedings of the 16th Annual International Conference 2008
(hlm. 228-245). Chicago, Illinois, USA: The Association on Employment Practices and
Principles (AEPP). Diakses daripada www.aepp.net.
Kumar, A. (2015). HRIS- An essential tool for HRM decision making. Indian Streams Research
Journal, 5(1), 1-4. doi: 10.9780/22307850.
Longenecker, C. O., & Fink, L. S. (2011). Key competencies for performance appraisal
effectiveness. The Journal of Compensation and Benefits, 27(5), 11-18.
Longenecker, C. O., Fink, L. S., Caldwell, S. (2014). Current U.S. trends in formal performance
appraisal: Practices and opportunities- Part II. Industrial and Commercial Training, 46(7),
393-399. doi:10.1108/ICT-03-2014-0019.
Meriac, J. P., Gorman, C. A., & Macan, T. (2015). Seeing the forest but missing the trees: The
role of judgments in performance management. Industrial and Organizational
Psychology, 8(1), 102-108. doi:10.1017/iop.2015.6.
Murphy, K. R., & Cleveland, J. N. (1995). Understanding performance appraisal: Social,
organizational, and goal-based perspectives. Thousand Oaks, California: SAGE
Publications.
OECD. (1997). Performance pay schemes for public sector managers: An evaluation of the
impacts. Paris: OECD.
Pulakos, E. D., & O‘Leary, R. S. (2011). Why is performance management broken? Industrial
and Organizational Psychology, 4(2), 146-164.
Rabenu, E., & Tziner, A. (2016). Performance appraisal in a constantly changing work world.
Industrial and Organizational Psychology, 9(2), 370-377. doi:10.1017/iop.2016.28.
Roberts, G. E. (1998). Perspectives on enduring and emerging issues in performance appraisal.
Public Personnel Management, 27(3), 301-319.
Roch, S. G., McNall, L. A., & Caputo, P. M. (2011). Self-judgments of accuracy as indicators of
performance evaluation quality: Should we believe them? Journal of Business and
Psychology, 26(1), 41-55. doi: 10.1007/s10869-010-9173-6.
Rusli Ahmad, Azman Ismail, & Wan Khairuzzaman Wan Ismail. (2007). Sistem penilaian
prestasi sektor awam di Malaysia: Pemikiran semula terhadap peranan dan
tanggungjawab pegawai penilai prestasi. Jurnal Kemanusiaan, 10, 80-89.
Sheer, V. C., & Cline, R. J. (1995). Testing a model of perceived information adequacy and
uncertainty reduction in physician-patient interactions. Journal of Applied
Communication Research, 23(1), 44-59. doi: 10.1080/00909889509365413.
Tversky, A., & Kahneman, D. (1973). Availability: A heuristic for judging frequency and
probability. Cognitive Psychology, 5(2), 207–232.
Tversky, A., & Kahneman, D. (1974). Judgment under uncertainty: Heuristics and biases.
Science, 185(4157), 1124-1131.
Williams, K. J., DeNisi, A. S., Blencoe, A. G., & Cafferty, T. P. (1985). The role of appraisal
purpose: Effects of purpose on information acquisition and utilization. Organizational
Behavior and Human Decision Processes, 35, 314-339.
177
-GP26-
Memahami Urus Tadbir Dalam Pentadbiran Di Sekolah
Mohd Faiz Mohd Yaakob

Pusat Pengajian Pendidikan dan Bahasa Moden
mohd.faiz@uum.edu.my
Abstrak
Kertas kerja ini bertujuan untuk membincangkan urus tadbir di sekolah dengan memberikan
perhatian kepada akauntabiliti dan jenis-jenis akauntabiliti. Peranan Pengetua/Guru Besar
(PGB) dalam sistem tadbir urus di sekolah memerlukan kefahaman dan komitmen yang sangat
tinggi. Justeru, dalam menentukan tahap tersebut berjaya dicapai, akauntabiliti sepatutnya
menjadi amalan dan keutamaan dalam budaya kerja di sekolah. Namun, PGB dibelenggu untuk
memahami jenis-jenis akauntabiliti yang sepatutnya diberikan perhatian yang serius di sekolah.
Cadangan dan perbincangan juga turut dinyatakan agar diberikan perhatian oleh pihak yang
bertanggungjawab.
1. PENDAHULUAN
Kerajaan sangat prihatin terhadap isu dan masalah penyelewengan serta

penyalahgunaan kuasa dikalangan penjawat awam. Pelbagai usaha telah dilakukan untuk
memastikan supaya gejala ini tidak menjadi suatu beban yang harus dipikul oleh rakyat dan
negara. Salah satu usaha yang terpenting ialah dengan menubuhkan Jawatankuasa Khas
Kabinet Menangani Keutuhan Pengurusan Kerajaan (JKKMKPK). Jawatankuasa ini ditubuhkan
pada tahun 1988 dan di antara tujuan utamanya ialah untuk mewujudkan Pentadbiran Kerajaan
dan Perkhidmatan Awam yang cekap, berdisiplin serta mempunyai integriti yang paling tinggi
dengan mempertingkatkan amalan nilai-nilai murni disamping berusaha mengatasi masalah-
masalah dan kelemahaan terutamanya dalam pengurusan kewangan kerajaan, pentadbiran
awam, pengendalian kes tatatertib, rasuah, penyalahgunaan kuasa dan penyelewengan yang
ditegah oleh peraturan, perundangan dan agama. Pendekatan ini membolehkan sesuatu isu
atau masalah yang dikaji, diteliti dan diselesaikan secara menyeluruh, bersepadu dan
terancang selaras dengan usaha mewujudkan pengurusan berkonsepkan tadbir urus terbaik
(Good Governance). Dalam konteks organisasi pendidikan, tidak boleh dinafikan bahawa
penubuhan jawatankuasa ini memang perlu dan penting memandangkan pengurusan
pendidikan pada hari ini agak mencabar dan memerlukan komitmen yang tinggi dari semua ahli
organisasi. Manakala di negara-negara maju, sekolah diberikan autonomi dalam urus tadbir
sekolah (Amanda Keddie, Brad Gobby & Chris Wilkins, 2017). Bahkan, urustadbir yang betul ini
akan memberikan kesan kepada keuntungan kepada organisasi seperti sekolah swasta (Chris
James & Paul Sheppard,2014). Hakikatnya, dalam konteks Malaysia,penjawat awam juga
terdedah kepada elemen-elemen negatif seperti rasuah, penyalahgunaan kuasa dan
sebagainya. Misalnya dalam urusan bantuan kewangan seperti pemberian biasiswa, Kumpulan
Wang Amanah Pelajar Miskin (KWAPM), Skim Baucer Tuisyen (SBT), pembelian Buku-buku
Rujukan dan Bahan Bantu Mengajar (BBM) yang menggunakan wang sekolah, kutipan bayaran
sekolah dan sebagainya. Terdapat sekolah yang tidak melaksanakan dasar pengurusan
kewangan yang betul. Perbelanjaan tidak mengikut prosedur serta keperluan sebenar. Buku
Tunai, Pajar Wang Runcit (PWR), Buku Cek Sekolah, resit murid, resit pejabat, daftar kutipan
harian, daftar bil, daftar aset dan inventori, dan sebagainya tidak diurus dengan baik. Justeru,
178
perlu ada suatu proses akauntabiliti yang telus agar pengurusan kewangan dan perbelanjaan
sekolah dilaksanakaan mengikut prosedur-prosedur yang ditetapkan.
2. AKAUNTABILITI
Konsep ini menjadi kata kunci kepada urus tadbir yang betul (Good Governance). Istilah
ini diberi konsep kepertanggungjawaban dan Bertanggungjawab kepada seseorang mengenai
sesuatu (Dewan Bahasa). Sementara itu, akauntabiliti merupakan prinsip di mana individu yang
berkuasa dikawal kuasanya oleh peraturan dan norma yang berada di dalam mahupun luaran
organisasi (Chander & Plano, 1988). Akibat daripada delegasi kuasa yang dipraktikkan dalam
pengurusan sumber manusia masa kini maka ahli-ahli organisasi juga perlu
dipertanggungjawabkan ke atas kuasa yang diberikan (Muhamad, 2003). Disamping itu,
akauntabiliti juga ditakrifkan sebagai obligasi seseorang untuk memberi jawapan dan
penjelasan mengenai tindakan dan prestasinya kepada pihak yang berhak untuk mendapatkan
jawapan dan penjelasan tersebut. Kesimpulannya, akauntabiliti selalunya sinonim dengan
konsep kebertanggungjawaban, kebolehpersalahan dan lialibiliti. Ia juga boleh dikaitkan dengan
ekspektasi seperti penyerahan tugas tertentu yang diamanahkan yang mesti ditunaikan. Ia juga
berkait rapat dengan tanggungjawab individu atau organisasi dalam perlaksanaan fungsi-fungsi
tertentu (Dr. Amini Amir Abdullah, 2010).
3. JENIS-JENIS AKAUNTABILITI
Terdapat beberapa jenis akauntabiliti yang sering diperdebatkan oleh para sarjana.
Namun dalam konteks ini, tumpuan diberikan kepada tiga jenis akauntabiliti iaitu; a)
Akauntabiliti Fiskal (Fiscal Accountability) iaitu akauntabiliti ke atas dana awam, b) Akauntabiliti
Program (Programme Accountability) iaitu tanggungjawab untuk melaksanakan program, d)
Akauntabiliti Proses (Process Accountability) iaitu tanggungjawab untuk melaksanakan
prosedur yang ditetapkan. Akauntabiliti tidak akan tercapai berdasarkan kepada peraturan-
peraturan, prosedur dan kawalan yang ketat tetapi bergantung kepada suatu garis panduan
yang dibentuk melalui objektif yang ditetapkan.
Antara ciri-ciri garis panduan berkenaan ialah:
a) Prinsip-prinsip keadilan dan kesaksamaan dalam polisi dan perlaksanaan organisasi;
b) Standard prestasi dihubungkan dengan inisiatif, ganjaran dan hukuman yang sesuai;
c) Kuasa dan sumber yang sesuai untuk menyiapkan sesuatu kerja, dan
d) Penilaian kepada amalan-amalan yang dilaksanakan.
Selain langkah-langkah yang diambil untuk menghasilkan akauntabiliti, ia juga perlu mempunyai
standard pengukuran yang bersesuaian dan berkesan. Kebiasaan tahap akauntabiliti ini dapat
dinilai melalui kepuasan pelanggan, keharmonian organisasi dan kepatuhan kepada undang-
undang, peraturan dan polisi organisasi. Antara matlamat utama pengurusan sesebuah
organisasi sekolah adalah memastikan kebajikan dan kesejahteraan secara berterusan
dinikmati oleh mereka yang ditadbir atau yang memerlukan perkhidmatan. Maka penekanan
kepada elemen-elemen akauntabiliti, integriti dan kawalandalaman yang kukuh dapat
memastikan sistem pentadbiran dan pengurusan yang jitu ke arah matlamat, wawasan dan
pencapaian.
3.1 Akauntabiliti Fiskal
179
Akauntabiliti Fiskal merupakan obligasi ke atas pengurusan dana awam khususnya dari
aspek pengurusan kewangan dan belanjawan sekolah. Ini bertujuan untuk menjamin semua
akaun yang disimpan boleh dipercayai dan urusan dijalankan dengan luhur mengikut peraturan
yang termaktub. Sementara itu, akauntabiliti ini memberi jaminan bahawa akaun-akaun yang
diselenggarakan boleh dipercayai dan segala urus niaga boleh dijalankan dengan jujur,
berintegrasi, teratur serta mematuhi undang-undang dan peraturan kewangan. Sebagai contoh,
wang lebihan asrama daripada peruntukan bantuan makanan asrama boleh digunakan untuk
meningkatkan kemudahan asrama dan dihadkan kepada pembayaran utiliti, pembelian
komputer tertakluk kepada kelulusan Jawatankuasa Maklumat dan Pengkomputeraan
Kementerian (JMKP), dan pembelian serta pemasangan alat penghawa dingin untuk
perpustakaan dan pusat sumber asrama (Kementerian Pendidikan Malaysia, 2005:2-15).
Pematuhan ini terkandung dalam mandat seperti Arahan Perbendaharaan (Bab A–Bab C) dan
Akta Prosedur Kewangan 1957 (Akta 61) dan Tatacara Pengurusan Kewangan dan
Perakaunan Kumpulan Wang Sekolah. (v) Sumber-sumber mandat yang lain ialah surat-surat
pekeliling seperti:
(a) Surat Pekeliling Perbendaharaan Bil. 3/2003: Peningkatan Akaun Pelupusan dan Hapuskira
yang boleh diluluskan oleh Kementerian Pendidikan Malaysia,
(b) Surat Pekeliling Kewangan Bil. 5/2002: Pemberian Bantuan Perkapita
(c) Surat Pekeliling Kewangan Bil. 1/2003: Penyelenggaraan Buku Tunai Sekolah Tahun 2003
selaras dengan Surat Pekeliling Kewangan Bil. 5/2002,
(d) Surat Pekeliling Bahagian Kewangan Bil. 2/2003: Kenaikan Had Perbelanjaan dan Dana
Pusingan (Revolving Fund) Pajar Wang Runcit Sekolah,
(e) Surat Pekeliling Perbendaharaan Bil. 8/2004: Had Nilai dan Syarat-syarat Pembelian Terus
Bagi Bekalan dan Perkhidmatan.
3.2 Akauntabiliti Pengurusan Sumber
Pengurusan sumber begitu penting diadun dengan aspek akauntabliti. Akauntabiliti

Pengurusan Sumber merupakan pematuhan terhadap penggunaan tenaga sumber manusia
dan sumber-sumber lain secara cekap dan ekonomik. Tanggungjawab penjawat awam adalah
untuk menggunakan sumber-sumber awam dengan cekap untuk mengelakkan pembaziran.
Akauntabiliti ini menentukan sama ada pengurusan tenaga kerja, wang dan lain-lain sumber
dibuat dengan cekap, berkesan dan tiada pembaziran. Pematuhan ini terkandung dalam
mandat seperti Perintah Am (Bab A – Bab G), Peraturan-peraturan LembagaTatatertib
Perkhidmatan Awam 1993, dan Akta Pendidikan 1996 (Akta 550). (iv) Sumber-sumber mandat
yang lain ialah Surat-surat Pekeliling seperti:
(a) Surat Pekeliling Ikhtisas Bil. 5/1991: Perlaksanaan Kemahiran Hidup Sekolah Menengah
Atas (Ting. IV-V),
(b) Surat Pekeliling Ikhtisas Bil. 10/1991: Pengunaan Buku Kerja di Sekolah Rendah,
(c) Surat Pekeliling Ikhtisas Bil. 9/1993: Kerja Kursus Untuk PMR,
(d) Surat Pekeliling Ikhtisas Bil. 10/2001: Semua Guru adalah Guru Disiplin,
(e) Surat Pekeliling Ikhtisas Bil. 6/2003: Dasar Penggunaan Media dan Teknologi dalam
Pengajaran dan Pembelajaran.
Surat Pekeliling Ikhtisas Bil. 10/2001 menjelaskan tentang peranan guru sebagai guru disiplin.
Ini bertujuan untuk mengelak tanggapan sesetengah guru yang menyerahkan masalah disiplin
murid-murid hanya kepada Pengetua atau Guru Besar atau guru disiplin sahaja.
180
3.3 Akauntabiliti Program
Akauntabiliti Program merupakan pematuhan ke atas pengurusan program sama ada ia

mencapai objektif yang dirancang atau tidak. Oleh itu, akauntabiliti ini memastikan sesuaatu
program untuk spesifikasi dan output yang dilaksanakan serta impaknya mencapai objektif dan
matlamat yang ditetapkan. Dalam perlaksanaan program, perancangan telah dibuat dengan
pemilihan opsyen yang terbaik bagi mencapai objektif tersebut. Biasanya pematuhan ini
berasaskan kepada dasar atau peraturan yang sudah ditetapkan dari hasil perbincangan atau
keputusan di antara ahli-ahli organisasi. Mandat-mandat yang boleh dijadikan landasan untuk
bertindak ialah surat-surat pekeliling seperti:
(a) Surat Pekeliling Ikhtisas Bil. 7/1988: Penyertaan Murid dalam Pertandingan atau Kejohanan
Sukan anjuran Persatuan dan Badan Induk Sukan,
(b) Surat Pekeliling Ikhtisas Bil. 1/1989: Penyertaan Murid dalam Kegiatan Sukan di Sekolah,
(c) Surat Pekeliling Ikhtisas Bil. 4/1992: Panduan Pembukaan dan Pengurusan Silat Sekolah,
(d) Surat Pekeliling Ihktisas Bil. 12/2001: Gerakan Membaca di Sekolah-sekolah melaalui
Persatuan Perpustakaan Sekolah Peringkat Negeri,
(e) Surat Pekeliling Ikhtisas Bil. 5/2002: Lawatan Sekolah pada hari persekolahan.
4. CADANGAN DAN PERBINCANGAN
PGB merupakan orang yang berperanan dalam menguruskan organisasi sekolah

berasaskan pengurusan sumber utama iaitu kewangan, sumber manusia, sumber fizikal atau
sebagainya. Pengurusan kewangan perlu diurus dengan baik. Kegagalan mengurus sumber ini
selalunya dikaitkan dengan kelemahaan mengurus hal-hal kewangan dan belanjawan sekolah
dengan berkesan dan bijaksana. Pengurusan sumber manusia juga sangat penting dan
bertindak sebagai pemangkin kepada kecemerlangan sekolah daripada aspek kurikulum,
kokurikulum, hubungan dengan masyarakat setempat, dan meletakkan sekolah sebagai sebuah
institusi yang mulia dan dihormati. Pengurusan sumber fizikal pula sebagai pelengkap kepada
kejayaan dan keberkesanaan sekolah. Apabila semua sumber ini dapat diurus dengan baik dan
berkesan, tidak mustahil sesebuah sekolah itu boleh berjaya dan cemerlang dari semua aspek.
Ketika ini, demand dan tanggungjawab PGB semakin mencabar. Mereka sering mengalami
dilema dalam pentadbiran harian.
Walaupun ada PGB yang telah berjaya meningkatkan kecemerlangan sekolah mereka,
namun masih ada juga yang kurang berwibawa atau kurang berketrampilan dalam menjalankan
tugas sebagai pengurus atau pentadbir sekolah. Di antara faktor penyebab terjadinya perkara
ini ialah kerana mereka tidak serius dalam menjalaankan tugas dan tanggungjawab yang telah
diamanahkan. Disamping itu juga, terdapat PGB yang kurang ilmu atau kemahiran yang
mencukupi untuk menjadikan mereka benar-benar berperanan. Justeru, proses akauntabiliti
merupakan suatu landasan yang berkesan untuk mengawal kepiawaian sistem tadbir urus
sekolah agar bergerak mengikut garis panduaan seperti yang ditetapkan oleh Kementerian
Pendidikan Malaysia. Banyak kes sekolah yang tidak akur dengan prosedur kewangan.
Misalnya, tidak menyelenggara Akaun Kumpulan Wang Kerajaan (SP. Kew. Bil. 5/2002); tidak
mematuhi syarat pemberian Bantuan SBT (SPI Bil. 1/2004); tidak mematuhi syarat pembelian
komputer (SP Komputer Bil. 1/1997); dan sebagainya.
Salah satu mekanisme yang digunakan oleh Perkhidmatan Awam untuk
mempertingkatkan akauntabiliti dan kecekapan pengurusan kewangan agensi awam ialah
melalui tindakan susulan yang diambil ke atas teguran dan pemerhatian yang terkandung dalam
laporan tersebut. Melalui cara ini, agensi awam dapat memperbaiki dan seterusnya
menambahbaik pengendalian pengurusan kewangannya. Pengurusan Sumber Manusia juga
181
dikaitkan dengan keperluan pendidikan. Pengurusan sumber manusia yang berkesan akan
membolehkan ahli-ahli organisasi berkerja dan bertindak selari dengan perancangan Jabatan
dan Daerah. Misalnya dalam menetapkan headcount sekolah, Jabatan telah meletakkan ETR
Negeri, maka setiap daerah dan sekolah juga perlu mematuhi setiap ETR yang telah
ditetapkan. Di sini proses akauntabiliti bertindak sebagai pengawal untuk memastikan sekolah-
sekolah bergerak selari dan senada dengan kehendak dan hasrat Jabatan. Jabatan dan PPD
pula perlu membuat pemantauan dan penyeliaan secara kolaboratif melibatkan semua unit di
Jabatan dan PPD. Sebagai contoh, program yang dilakukan kepada Sekolah Berprestasi
Rendah (SPR) melalui Program Kunjung Bantu. Program ini bertujuan untuk mendekati dan
memahami permasalahan yang dihadapi oleh sekolah dan bagaimana untuk membantunya. Ini
penting kerana ada pentadbir yang kurang proaktif dan tidak komited. Jadi melalui perjumpaan
dan perbincangan ini sekurang-kurangnya permasalahan tersebut dapat di atasi dengan
bijaksana.
Daripada aspek Pengurusan Fizikal pula, ada juga pentadbir yang kurang peka terhadap
keperluan fizikal dalam membantu mencapai kecemerlangan sekolah. Mereka berpendapat,
semua ini tidak penting dan yang lebih penting ialah pencapaian akademik. Tetapi selepas
keputusan peperiksaan diumumkan, pencapaian akademik sekolah tersebut juga belum begitu
baik. Di antara pengurusan sumber fizikal ialah meliputi pengurusan persekitaraan sekolah
serta pembangunan lanskap, peralatan dan kemudahan-kemudahan sedia ada. Menurut Fidler
(1999), analisis sumber sesebuah sekolah dimulai dengan bangunan sekolah dan pemeriksaan
lokasi serta kemudahan tertentu seperti bilik darjah, bilik khas dan kemudahan-kemudahan lain.
Justeru, selaku pengurus sekolah PGB perlu memainkan peranan dalam memastikan sumber
fizikal sekolah seperti bilik darjah, tandas, padang permainan dan persekitaran seperti lanskap
berada pada keadaan yang cukup baik dan kondusif.
Keadaan fizikal yang kondusif boleh membantu kepada tahap keselesaaan,
keselamatan dan meningkatkan pencapaian murid. Misalnya dalam suatu kes, pernah Sekolah
Rendah ditegur kerana kurang mengambil berat terhadaap persekitaran sekolah yang
mempunyai banyak pecahan batu-batu kasar dan tajam. Keadaan tersebut telah membataskan
pergerakan murid-murid untuk bermain di waktu rihat. Akhirnya murid kurang cergas daan
pencapaian akademik sekolah tersebut merosot. Kes-kes lain pula seperti pembukaan kelas
baru atau pengubahsuaian bilik-bilik yang tidak dirujuk atau mendapat kebenaran pihak
Jabatan. Keadaan ini juga berlaku sehingga pada akhirnya menyusahkan Jabatan apabila
berlaku insiden-insiden seperti kemalangan atau sebagainya. Kadang kala pengubahsuaian ini
tidak mengikut spesifikasi-spesifikasi yang dicadangkan. Dari aspek Pengurusan Program pula,
selalunya pihak sekolah kurang mengambil berat dari aspek perancangan. Kebanyakan
program dilaksana secara ‗ad-hoc‘ walhal untuk melatih murid dalam bidang sukan dan
permainan, ia memerlukan proses yang agak lama dengan latihan yang konsisten dan
terancang, disamping memerlukan permakanan yang baik, semangat yang tinggi serta
kekuatan emosi yang mendalam. Setiap murid mempunyai potensi yang berbeza-beza. Maka
sikap dan minat mereka kepada aktiviti juga berbeza-beza. Justeru, PGB seharusnya membuat
perancangan yang sistematik dan perlu menjadi keutamaan tindakan. Justeru melalui proses
akauntabiliti seperti pemantauan oleh PGB, akan dapat mengesan kekuatan daan kelemahan
perancangan dan perlaksanaan aktiviti.
RUJUKAN
Amanda Keddie, Brad Gobby & Chris Wilkins (2017): School autonomy reform in Queensland:
governance, freedom and the entrepreneurial leader, School Leadership &
Management, DOI: 10.1080/13632434.2017.1411901
182
Chandler, Raliph C. & Plano, Jack C. (1988), The Public Administration. Dictionary (2 nd) ed.
California: ABC-CLIO.
Chris James & Paul Sheppard (2014) The governing of international schools:the implications of
ownership and profit motive, School Leadership & Management, 34:1, 2-20, DOI:
Fidler, B (1999). Perancangan Strategik Untuk Kemajuan Sekolah. Terjemahan Abd. Aziz Abdul
Rahman. Kuala Lumpur: Institut Terjemahan Negara Malaysia Berhad.
Lembaga Penyelidikan Undang-undang (1996). Akta Pendidikan 1996 (Akta 550). International
Law Book Services.
Lembaga Penyelidikan Undang-undang (1999). Perintah-perintah Am & Arahan
Perbendaharaan. International Law Book Services.
Muhamad Ali Embi (2003). Konsep Asas Pengurusan Sumber Manusia (Penggunaan Konsep).
Utusan Publication & Distributor Sdn. Bhd. KL.
Surat-surat pekeliling iktisas Kementerian Pendidikan Malaysia, 1988-2004. Kuala Lumpur:
Bahagian Sekolah-sekolah, Kementerian Pendidikan Malaysia.
Whitaker, K.S. (1996). Exploring Cause Of Principal Burnout. Jurnal Of Educational

Administration. 34(1).
-GP29-
KONSEP DAN PERLAKSANAAN DEMOKRASI BERPARLIMEN DI MALAYSIA
Mokhtafizam bin Mokhtar

Pusat Pengajian Kerajaan (SOG)
Kolej Undang-Undang, Kerajaan dan Pengajian Antarabangsa
Universiti Utara Malaysia, 06010 Sintok, Kedah Darul Aman
emel :zam@uum.edu.my
Abstrak
Kertas kerja ini bertujuan untuk menjelaskan konsep dan perlaksanaan demokrasi berparlimen
di Malaysia. Konsep demokrasi merupakan salah satu elemen penting dalam merancakkan
pertumbuhan penyertaan di kalangan rakyat secara keseluruhan. Demokrasi juga memainkan
peranan penting dalam melestari halatuju pembangunan dalam sesebuah negara bangsa.
Jatuh bangunnya sesebuah negara banyak bergantung kepada kepekaan dan peranan yang
dimainkan oleh warganya selain daripada kredibiliti pemimpin. Justeru bagaimana demokrasi
berparlimen acuan Malaysia ini dilaksanakan sangat penting diterjemahkan dari segi
perlaksanaannya bagi mencapai maksud negara demokrasi secara keseluruhan. Demokrasi
dari segi institusinya, demokrasi dari segi rakyatnya, demokrasi dari segi tindakannya dan
demokrasi dalam pelbagai perkara lagi. Bila menyentuh tentang demokrasi berparlimen maka
tiga institusi tentinggi akan dikupas iaitu Yang Di-Pertuan Agong, Dewan Rakyat dan Dewan
Negara. Kertas kerja ini akan turut menjelaskan peranan dan hubungkait antara satu sama lain
bagi memartabatkan kedudukan Parlimen secara keseluruhan.Intipati penting ini perlu
diperjelas dan diterjemahkan sebaik mungkin hingga ke akar umbi agar peranan dan
komitmennya akan terasa dan dihargai oleh semua pihak.
Kata kunci: demokrasi, parlimen dan rang undang-undang
183
1.0 PENDAHULUAN
Negara merujuk kepada sekumpulan manusia yang mendiami sesuatu kawasan dan
daerah tertentu di bawah undang-undang dan perlembagaan. Bangsa pula merujuk kepada
kewujudan dan kumpulan tertentu dengan ciri yang sama. Justeru Negara Bangsa3 merujuk
kepada konsep ataupun bentuk sesebuah Negara memperolehi pengesahan politiknya dengan
menjadi sebuah entiti berdaulat bagi satu-satu bangsa. Harold Laski (1977), menterjemahkan
negara sebagai satu kelompok masyarakat yang telah bersatu dan mendapat satu kuasa yang
sah di sisi undang-undang. Asas kepada kebanyakan pandangan bertitik tolak dari pemikiran
tokoh sains politik terkemuka Greek bermula dari Socrates, Plato dan Aristotle, di mana ia
melihat bahawa negara adalah instrumen penting serta keperluan ramai4. Ia juga untuk
kebaikan bersamadan bagi mewujudkan keadilan serta keamanan maka perlu ada kepada
peraturan dan undang-undang.
Malaysiasebagai sebuah negara turut melalui satu perjalanan bernegara yang panjang
melalui proses tersebut. Malaysia mengamalkan konsep demokrasi berparlimenraja
berperlembagaan (DBRB) di bawah pentadbiran raja berperlembagaan di mana Yang Di-
Pertuan Agong (YDPA) merupakan Ketua Negara sejak kemerdekaan pada 31 Ogos 1957.
Malaysia, sebuah negara yang ditubuhkan berasaskan kepada sistem demoraksi maka sudah
pasti unsur demokrasi memerlukan penglibatan umum untuk bertindak dan membuat
keputusan. Pemimpin sebagai ketua yang akan merencana seterusnya melunaskan hasrat dan
iltizam rakyat kebanyakan. Ia sejajar sebagaimana yang diterjemahkan oleh mantan Presiden
Amerika Syarikat yang ke-16, Abraham Lincoln (1809-1865) begitu terkenal dengan, slogannya
dari rakyat, kepada rakyat dan untuk rakyat. Sistem demokrasi sekiranya dapat dijalankan baik,
tersusun serta adil dapat mengangkat martabat dan maruah sesebuah negara untuk dihormati
oleh kawan dan lawan.
Demokrasi berparlimen secara jelasnya memberi kesempatan kepada rakyat untuk

melibatkan diri dalam sistem pemerintahan negara disamping raja-raja Melayu menjadi
lambang taat setia rakyat kepada sistem tersebut. Sistem demokrasi di Malaysia adalah satu
sistem yang jelas memberi ruang kepada rakyat untuk memilih pemimpin dari orang
kebanyakan. Demokrasi ini juga memberi peluang kepada rakyat untuk memilih pemimpin dan
kerajaan mana yang sesuai untuk menerajui negara untuk tempoh lima tahun ke hadapan.
Proses ini dinamakan sebagai pilihanraya umum dan dijalankan oleh satu badan yang telah
diamanahkanmelalui Perlembagaan Persekutuan (PP) iaitu Suruhanjaya Pilihan Raya Malaysia
(SPR)5.
2.0 LATAR BELAKANG
3
Tiga ciri Negara bangsa iaitu, taat setia, ideologi politik yang sama dan kepercayaan serta keyakinan diri yang tinggi kepada
pemerintah.
4
Laski,H. (1984) turut mengariskan 4 ciri negara iaitu:-
a. Penduduk atau rakyat
b. Kawasan atau wilayah di mana penduduk tinggal
c. Jentera pentadbiran dan pemerintah
d. Kuasa tertinggi yang menentukan kedaulatan
5
Perkara 113. (1) PP Maka hendaklah ada suatu Suruhanjaya Pilihan Raya yang hendaklah ditubuhkan mengikut Perkara 114,
yang, tertakluk kepada peruntukan undang-undang persekutuan, hendaklah menjalankan pilihan raya ke Dewan Rakyat dan
Dewan-DewanUndangan Negeri dan menyediakan dan menyemak daftar pemilih bagi pilihan raya itu.
184
Malaysia mengamalkan sistem Persekutuan dengan pengiliran Ketua Negara iaitu

YDPA dalam tempoh lima tahun sekali. Ia merangkumi negeri-negeri Melayu yang
mengamalkan sistem beraja iaituRaja-raja Malaysia merujuk kepada sistem monarki
perlembagaan. Sistem politik Malaysia adalah berdasarkan kepada sistem parlimen
Westminster dengan ciri-ciri sebuah persekutuan.
Malaysia terdiri daripada 13 negeri dan 3 wilayah Persekutuan yang

merangkumisembilan negeri-negeri di Malaysia diketuai oleh Raja dan Sultan Melayu iaitu
Perlis, Kedah, Perak, Selangor, Negeri Sembilan, Johor, Pahang, Terengganu dan Kelantan.
Manakala negeri yang tidak mempunyai Raja dan Sultan ditadbir oleh Ketua Negeri yang
dikenali sebagai Tuan Yang Terutama (TYT) iaitu Pulau Pinang, Melaka, Sabah dan Sarawak.
Selebihnya adalah Kuala Lumpur, Putrajaya dan Labuan dikenali sebagai Wilayah Persekutuan
yang mana ketuanya adalah YDPA.
3.0 RAJA BERPERLEMBAGAAN
Raja berperlembagaan adalah satu sistem bernegara yang telah ditubuhkan di bawah
perlembagaan yang mengiktiraf raja sebagai Ketua Negara. Dalam konteks ini YDPA
merupakan ketua utama persekutuan walaubagaimanapun kuasa eksekutif adalah kepunyaan
Perdana Menteri. Ia sesuai sebagaimana yang telah dinyatakan di dalam PP; Perkara 32 (1) -
Maka hendaklah ada seorang Ketua Utama Negara bagiPersekutuan, digelar Yang di-Pertuan
Agong, yang hendaklah diberikeutamaan daripada segala orang di dalam Persekutuan dan
yang tidak boleh dikenakan apa-apa jua pun prosiding di dalam mana-mana mahkamah kecuali
di dalam Mahkamah Khas yang ditubuhkandi bawah Bahagian XV.
Setiap raja mempunyai kelayakan untuk dipilih menjadi YDPA, melainkan ia tidak cukup
umur atau tidak mahu pilih atau pada perkiraan Majlis Raja-Raja (MRR) melalui undi sulit tidak
layak menjadi YDPA dengan sebab keuzuran akal dan badan atau apa-apa sebab yang lain
(Ahmad Mohamed Ibrahim & Ahilemah Joned, 1986:160).
Apabila YDPA menjalankan kuasa pentadbiran yang mana kuasa eksekutif utama
adalah Perdana Menteri maka setiap tindakan dan keputusan yang dilakukan olehnya perlulah
mendapat dan mengikut nasihat Jemaah Menteri6 melainkan sedikit kuasa yang dipunyai oleh
YDPA yang dinamakan kuasa budi bicara.
Ini bermakna walaupun YDPA mempunyai kesemua kuasa pemerintahan boleh

dikatakan hampir kesemuanya dijalankan oleh Jemaah Menteri atau dijalankan olehnya sendiri
atas nasihat Jemaah Menteri7.
6
Perkara 39 PP,Kuasa eksekutif Persekutuan hendaklah terletak hak padaYang di-Pertuan Agong dan, tertakluk kepada
peruntukan mana-mana undang-undang persekutuan dan peruntukan JadualKedua, bolehlah dijalankan olehnya atau oleh
Jemaah Menteri atau oleh mana-mana Menteri yang diberi kuasa oleh Jemaah Menteri, tetapi Parlimen boleh, melalui undang-
undang, memberikan fungsi eksekutif kepada orang lain.
7
Perkara 40 (1)PP, Pada menjalankan fungsinya di bawah Perlembagaan iniatau undang-undang persekutuan, Yang di-Pertuan
Agonghendaklah bertindak mengikut nasihat Jemaah Menteri atau nasihat seseorang Menteri yang bertindak di bawah kuasa
am Jemaah Menteri, kecuali sebagaimana yang diperuntukkanselainnya oleh Perlembagaan ini; tetapi Yang di-Pertuan Agong
berhak, atas permintaannya, untuk mendapat apa-apa maklumat berkenaan dengan pemerintahan Persekutuan yang boleh
didapati oleh Jemaah Menteri.
185
4.0 PARLIMEN
Parlimen adalah tempat atau bangunan di mana penggubal undang-undang biasanya

bersidang dan terma yang biasa digunakan di negara-negara Komanwel. Parlimen itu asasnya
dari perkataan Perancis iaitu parlement, tempat untuk bercakap atau berbincang. Parlimen yang
paling terkenal ialah Parlimen United Kingdom yang dikenali sebagai ibu segala Parlimen
kerana ramai negara Komanwel yang mengasaskan kerajaan mereka bersandarkan sistem
Westminster8(www.ms.wikipedia.com).
Parlimen adalah badan perundangan tertinggi di Malaysia di mana Parlimen merupakan

majlis pembuat undang-undang (legislatif). Parlimen turut berperanan sebagai platform
perbincangan dan perbahasan sebelum sesuatu dasar dan undang-undang negara dibentuk,
direalisasi, dipinda dan dimansuhkan. Terdapat 2 jenis dewan yang banyak dipraktikkan di
duniaiaitu unicameral (1 dewan) dan bicameral (2 dewan). Parlimen Bicameral terdiri dari 2
dewan iaitu dewan bawah (ahlinya dipilih dalam pilihanraya) dan dewan tinggi (biasanya
dilantik). Di Malaysia, dewan bawah (Dewan Rakyat) merupakan dewan yang lebih berprestij
dan mempunyai bidang kuasa yang lebih besar daripada dewan tinggi (Dewan Negara).
Demokrasi berparlimen di negara ini menggariskan kepada tiga unsur utama yang wujud
di dalam Parlimeniaitu YDPA, Dewan Rakyat dan Dewan Negara.Ketiga-tiga ini merupakan
nadi utama dan elemen penting yang perlu ada dalam konsep demokrasi di Malaysia malah
ianya berkaitan di antara satu sama lain bagi melestarikan sistem perundangan di Malaysia.
4.1 YDPA
YDPA adalah gelaran rasmi yang diberikan kepada ketua negara Malaysia. Gelaran
rasmi penuh bagi jawatan tersebut ialah Kebawah Duli Yang Maha Mulia Seri Paduka Baginda
Yang di-Pertuan Agong yang juga merupakan Raja bagi negara Malaysia. Jawatan YDPA
merupakan jawatan penggiliran setiap 5 tahun sekali di kalangan 9 raja dan sultan Melayu
selepas diperkenankan oleh Majlis Raja-Raja. Peranan dan kuasa baginda sangat luas namun
mempunyai batasan tertentu termaktub sebagaimana menurut PP.
YDPA adalah salah satu daripada unsur tradisi terpenting di dalam pembentukan
Persekutuan Malaysia. Unsur tradisi telah wujud begitu lama dalam masyarakat sebelum
perlembagaan digubal lagi. Salah satu daripada unsur tradisi yang wujud ialah Kesultananan
Melayu. Elemen ini amat dititik beratkan perlaksanaannya seiring dengan pembentukan
Malaysia sebagai sebuah negara yang berdaulat dan merdeka. Kuasa ini dikembalikan semula
kepada Raja Melayu selepas kerajaan British gagal dengan pembentukan Malayan Union di
Tanah Melayu hasil daripada penolakkan menyeluruh orang Melayu pada ketika itu.
Walaupun YDPA diperuntukkan sebagai Kepala Utama Negara bagi Persekutuan (Per.
32(1)PP iaitu mengatasi sesiapa di dalam Persekutuan namun kuasa YDPA adalah sangat
terhad. Kuasa baginda secara simbolik tetapi kuasa itu perlu dengan nasihat Jemaah Menteri
dan kuasa eksekutif terletak kepada badan eksekutif (Per 39 &Per 40 (1). Jelas di sini bahawa
kuasa YDPA sangat terhad dan terbatas dan keputusan yang dibuat oleh YDPA bukanlah
muktamad namun perlu kepada nasihat Jemaah Menteri (Mohamed Suffian, 2007:70-71)
8
Sistem Westminster ialah sistem parlimen kerajaan demokratik yang diasaskan mengikut model kerajaan British. Istilah ini
datangnya dari Istana Westminster di mana terletaknya Parlimen United Kingdom.
186
Sungguhpun demikian YDPA dan Raja masih mempunyai ruang yang telah
diperuntukkan melalui undang-undang berkaitan dengan kuasa budi bicara baginda iaitu:-
4.1.1 Membenar, menolak dan membubarkan Parlimen/Dewan Undangan Negeri

4.1.2 Melantik Perdana Menteri/Ketua Menteri/Menteri Besar
4.1.3 Memanggil Majlis Raja-Raja bersidang
YDPA turut berperanan memanggil, memprorog dan membubarkan Parlimen sesuai

dengan Perkara 55 (1),(2)dan(3)9. MRR juga terlihat seolah-olah mempunyai kuasa mutlak
untuk mengawal pergerakan YDPA di mana apabila baginda ingin meninggalkan negara lebih
daripada 15 hari kebenaran MRR adalah diperlukan (Abdul Aziz Bari, 2006:72)
Selain daripada itu perlantikan waris, pemilihan permaisuri, peraturan berkaitan dengan
istana dan darjah kebesaran juga merupakan kuasa mutlak baginda. Justeru jelas kepada kita
batasan dan had kuasa yang dipunyai oleh YDPA sebagai simbol kepada kuasa Persekutuan
berlandaskan kepada demokrasi berparlimen raja berperlembagaan.
4.2 DEWAN RAKYAT
Mohd Salleh Abas(1997:67), Dewan Rakyat turut dikenali sebagai Lower House.
Dewan ini merupakan dewan yang sangat penting di dalam Parlimen kerana keahliannya
adalah dipilih oleh rakyat dalam pilihanraya umum yang mewakili 222 kerusi Parlimen seluruh
Malaysia10.Institusi yang memegang tampuk utama demokrasi ini perlu mempunyai kekuatan
9
Perkara 55. (1) PP Yang di-Pertuan Agong hendaklah memanggil Parlimen dari semasa ke semasa dan tidak boleh membiarkan
enam bulan berlalu antara persidangan yang akhir dalam satu penggal dengan tarikh yang ditetapkan untuk mesyuarat
pertamanya dalam penggal yang berikutnya.
Perkara55..(2) PP Yang di-Pertuan Agong boleh memprorog atau membubarkan Parlimen.
Perkara 55 (3) PP Melainkan jika dibubarkan terlebih dahulu, Parlimen hendaklah terus berjalan selama Lima tahun dari tarikh
mesyuarat pertamanya dan selepas itu adalah terbubar
10
Perkara 46. (1) PP Dewan Rakyat hendaklah terdiri daripada dua ratus duapuluh dua orang ahli dipilih.
(2) Maka hendaklah ada—
(a) dua ratus sembilan orang ahli dari Negeri-negeri di
Malaysia seperti yang berikut:
(i) dua puluh enam orang ahli dari Johor;
(ii) lima belas orang ahli dari Kedah;
(iii) empat belas orang ahli dari Kelantan;
(iv) enam orang ahli dari Melaka;
(v) lapan orang ahli dari Negeri Sembilan;
(vi) empat belas orang ahli dari Pahang;
(vii) tiga belas orang ahli dari Pulau Pinang;
(viii) dua puluh empat orang ahli dari Perak;
(ix) tiga orang ahli dari Perlis;
(x) dua puluh lima orang ahli dari Sabah;
(xi) tiga puluh satu orang ahli dari Sarawak;
(xii) dua puluh dua orang ahli dari Selangor; dan
(xiii) lapan orang ahli dari Terengganu; dan
(b) tiga belas orang ahli dari Wilayah Persekutuan Kuala
Lumpur, Labuan dan Putrajaya seperti yang berikut:
(i) sebelas orang ahli dari Wilayah Persekutuan Kuala
Lumpur;
(ii) seorang ahli dari Wilayah Persekutuan Labuan;
187
dan integriti yang tinggi agar kredibiliti ahli-ahli Yang Berhormat akan disanjung sebagai tunjang
utama rakyat yang telah membuat keputusan memilih mereka.
Tempoh keanggotaan ahli Dewan Rakyat akan tamat sebaik sahaja dewan Parlimen
mendapat perkenan pembubaran daripada YDPA. Sungguhpun demikian, ahli Dewan Rakyat
masih boleh melepaskan jawatan yang dimenangi masing-masing dengan menulis sepucuk
surat kepada Yang Dipertua Dewan Rakyat sebagaimana yang telah diperjelaskan di dalam
Per. 51 PP bagi menerangkan maksud pelepasan keahlian tersebut.
Dewan Rakyat yang beriltizam memperjuangkan demokrasi secara langsung oleh rakyat
ini juga mempunyai beberapa nadi dan kekuatan sebagai contoh, Perdana Menteri perlu
datangnya dari Dewan Rakyat, berhak memutuskan sebarang pindaan atau pembatalan rang
undang-undang dan membincangkan perkara yang tidak boleh dibincang di Dewan Negara
seperti rang undang-undang kewangan.
Selain daripada itu bagi maksud pemilihan ketua di dalam dewan, Per 57, 1(a)& 1(b) PP
menjelaskan bahawa ketua iaitu Speaker atau Yang Dipertua Dewan Rakyat perlu dilantik
samada dikalangan ahli dewan atau sebaliknya dan 2 orang Timbalan Yang Dipertua, di mana
mereka perlu di kalangan ahli Dewan Rakyat (Mohamed Suffian, 2007:76).
Aspek keahlian di dalam dewan turut berperanan dalam melestarikan iltizam dan
dokongan bersama.Malah sebagai platform merangka, menggubal, meminda dan membatalkan
rang undang-undang memerlukan kepada sokongan majoriti diperolehi sebelum ianya boleh
dipertimbangkan di peringkat seterusnya. Dari aspek sejarahnya sebelum Singapura berpisah
dengan Malaysia jumlah kerusi Parlimen di Dewan Rakyat ialah seramai 159 orang. Jumlah ahli
dewan selepas perpisahan tersebut adalah seramai seramai 144 orang (Mohd Salleh Abbas,
1997:71). Namun prosedur dan proses persempadanan telah dilakukan beberapa kali oleh SPR
membawa kepada pertambahan kerusi Parlimen bagi memastikan rakyat keseluruhan akan
diberikan perhatian oleh pihak yang dipilih bagi mewakili mereka di Parlimen. Sebagai contoh
pada pilihanraya ke 10 (1999) kerusi Parlimen bertambah ke 193, pilihanraya ke 11 (2004)
bertambah ke 219 kerusi manakala pilihanraya ke 12 (2008) membawa kepada 222 kerusi
Parlimen sehingga ke pilihanraya ke 14 baru-baru ini jumlah itu kekal sebanyak 222 kerusi
Parlimen telah dipertandingkan.
Dari aspek kelayakan sebagai ahli Parlimen Dewan Rakyat perlu berumur tidak kurang
daripada 21 tahun, Per. 47 PP. manakala Per 48 (1) PP menjelaskan calon atau ahli akan
hilang kelayakan sekiranya;
4.2.1 Tidak sempurna akal.

4.2.2 Bankrap yang belum dilepaskan.
4.2.3 Memegang satu jawatan yang berpendapatan.
4.2.4 Setelah dinamakan sebagai calon pilihanraya atau ejen, dia tidak menghantar
penyata perbelanjaan pilihanraya yang dikehendaki oleh undang-undang dalam
masa dan mengikut cara yang dikehendaki sedemikian.
4.2.5 Dia disabitkan dengan suatu kesalahan dan dihukum penjara tidak kurang dari
SATU tahun atau denda tidak kurang daripada RM2000.00 dan tidak mendapat
pengampunan.
4.2.6 Dia dengan sengaja memperolehi kewarganegaraan negara asing atau
menggunakan hak keistimewaan negara tersebut.
(iii) seorang ahli dari Wilayah Persekutuan Putrajaya.
188
Per. 50 PP, turut memperkukuhkan institusi ini dengan memperlihatkan kuasa yang
diberikan kepadanya, di mana jika hilang kelayakan tetapi masih dipilih atau dilantik bagi Dewan
Negara maka perlantikan itu akan terbatal. Demikian juga jika ahli Parlimen tidak hadir pada
setiap persidangan selama tempoh 6 bulan tanpa memaklumkan kepada speaker dan
mendapat persetujuan maka kerusinya akan dianggap kosong (Per. 52 (1) PP.
Bagi mengelakkan ahli dewan bias dan mempunyai kepentingan dalam mengawal
perjalanan Parlimen, Per.49 PP telah menetapkan seseorang itu tidak boleh menjadi ahli bagi
kedua-dua dewan dalam satu masa, bagi Dewan Rakyat tidak boleh mewakili lebih daripada
satu kerusi Parlimen, bagi Dewan Negara tidak boleh mewakili lebih daripada satu negeri dan
tidak boleh menjadi ahli yang dipilih dan dilantik dalam Dewan Negara.
Sehubungan dengan itu jelas kepada kita bahawa peruntukan PP memperincikan

dengan konsisten dan sistematik kedudukan, hak dan perkara yang boleh membawakan
kepada terbatalnya satu lantikan dan pemilihan. Oleh yang demikian sesiapa juga yang telah
dipilih oleh rakyat sebagai ahli Parlimen, perlulah menunaikan tanggungjawab dengan
berintegriti, amanah dan akauntabiliti agar pilihan yang dibuat oleh rakyat benar-benar dapat
memberikan manafaat kepada mereka.
4.3 DEWAN NEGARA
Dewan Negara turut dikenali sebagai Upper House atau Dewan Tinggi. Di Malaysia,
Dewan Negara adalah yang tertinggi kerana ia ditubuhkan untuk membahaskan rang undang-
undang dengan lebih halus dan teliti lagi. Keanggotaan11 Dewan Negara adalah seramai 70
orang yang telah memberikan jasa, bakti dan sumbangan yang tinggi kepada Negara12.
Memandangkan Dewan Rakyat telah dipilih oleh orang ramai iaitu rakyat maka Dewan
Negara pula ditubuhkan bagi mewakili negeri-negeri dalam Persekutuan dan pihak yang
mempunyai kepentingan. Justeru yang demikian itu maka bolehlah dianggap bahawa
penubuhan parlimen ini sememangnya mewakili semua orang (truly representative) (Mohd
Salleh Abas, 1997:68).
Dewan Negara berperanan dalam membantu dan menyemak apa jua keputusan yang
telah dibuat oleh Dewan Rakyat. Ianya sebagai satu institusi timbal balik bagi mengkaji
keputusan yang telah dibuat. Namun peruntukkan undang-undang menjelaskan bahawa Dewan
Negara tidak mempunyai kuasa untuk menolak keputusan yang telah dibuat oleh Dewan
11
Perkara 45. (1) PP Tertakluk kepada Fasal (4), Dewan Negara hendaklah terdiri daripada ahli-ahli dipilih dan dilantik seperti
yang berikut:
(a) dua orang ahli bagi setiap Negeri hendaklah dipilih mengikut Jadual Ketujuh; dan
(aa) dua orang ahli bagi Wilayah Persekutuan Kuala Lumpur,seorang ahli bagi Wilayah Persekutuan Labuan dan seorang ahli
bagi Wilayah Persekutuan Putrajaya hendaklah dilantikoleh Yang di-Pertuan Agong; dan
(b) empat puluh orang ahli hendaklah dilantik oleh Yangdi-Pertuan Agong.
12
Perkara 45 (2) PP Ahli-ahli yang akan dilantik oleh Yang di-Pertuan Agong hendaklah orang yang pada pendapatnya telah
memberikan perkhidmatan awam yang cemerlang atau telah mencapai keunggulandalam profesion, perdagangan,
perindustrian, pertanian, aktiviti kebudayaan atau perkhidmatan sosial atau yang mewakili ras minoriti atau berkebolehan
mewakili kepentingan orang asli.
189
Rakyat cuma ianya mempunyai kuasa untuk mengarahkan Dewan Rakyat menghalusi dan
mengkaji semua keputusan yang telah dibuat.
Sehubungan dengan itu juga Dewan Negara berperanan sebagai medan bagi ahli politik
lama, orang awam yang mempunyai jasa kepada negara untuk menyertai majlis perundangan
ini tanpa melalui proses pilihanraya. Oleh yang demikian negara tidak akan kehilangan tokoh
yang banyak pengalaman dan berkebolehan untuk sama-sama berperanan sebagai ahli
legislatif.
Sebagaimana syarat yang telah ditetapkan di dalam Dewan Rakyat ianya turut terpakai
di dalam Dewan Negara, cuma dari segi umur ia perlulah tidak kurang dari 30 tahun berbanding
Dewan Rakyat 21 tahun. Ahli Dewan Negara dikenali sebagai Senator. Ahli Dewan Negara
hanya boleh berperanan selama 2 penggal maksimun di mana 1 penggal menyamai 3 tahun. Ini
bermakna sehebat mana pun ketokohan ahli Dewan Negara ini, maksimum untuk menjawat
peranan tersebut hanya 6 tahun sahaja dan ia tidak terbatal walaupun parlimen Malaysia
dibubarkan.
5.0 KEISTIMEWAAN PARLIMEN
Parlimen sebagai satu badan perundangan negara yang penting serta membuat
undang-undang yang dikuatkuasakan ke seluruh negara pastinya perlu mempunyai
keistimewaan tertentu selain daripada kekebalan yang perlu diberikan kepada ahli Parlimen. Ini
penting kerana sebagai satu badan yang kritis dan bertindak tanpa sebarang diskriminasi serta
prejudis, sedikit sebanyak ruang perlu diberikan kepada ahli dewan agar dapat menjalankan
tanggungjawab tanpa gangguan dan ancaman dari mana-mana pihak. Apatah lagi parlimen
turut berperanan sebagai badan yang menjalankan forum awam dan pendapat rakyat bagi
membincangkan perkara nasional.
Bagi memastikan Parlimen mampu menjalankan peranan dan tanggunjawabnya dengan

lebih berkesan PP telah memperuntukkan beberapa hak dan keistimewaan sebagaimana yang
dinyatakan dalam Per. 63 PP iaitu keistimewaan Parlimen di dalam kedua-dua dewan.
5.1 Prosiding mana-mana majlis Parlimenatau mana-mana jawatankuasanya tidak boleh

dipersoalkan di mana-mana mahkamah.
5.2 Dakwaan tidak boleh dikenakan terhadap sebarang bentuk ucapan dan undian di dalam
dewan bagi menjamin kebebasan dan ketelusan.
5.3 Tidak boleh dikenakan prosiding dalam mana-mana mahkamah berkaitan dengan apa
jua yang disiarkan di bawah kuasa mana-mana Majlis Parlimen.
5.4 Tidak ada seorang pun yang boleh dikenakan apa-apa prosiding dalam mana-mana
mahkamah berkenaan dengan apa juga yang diperkatakan olehnya tentang YDPA atau
seseorang Raja dalam mana-mana satu Majlis Parlimen kecuali jika ia menganjurkan
penghapusan kedudukan berperlembagaan YDPA sebagai Kepala Utama Negara bagi
Persekutuan atau kedudukan perlembagaan mana-mana Raja sesuatu negeri
(Perlembagaan Persekutuan, 2017).
6.0 PROSES PENGGUBALAN UNDANG-UNDANG
Parlimen mempunyai kuasa mutlak untuk menggubal, meminda atau membatalkan

sesuatu rang undang-undang melalui Dewan Rakyat dan Dewan Negara dengan meluluskan
190
sesuatu undang-undang dan diperkenankan oleh YDPA sebagaimana menurut Per. 66 PP.
Ianya tidak akan menjadi satu rang undang-undang jika hanya diputuskan oleh Dewan Rakyat
sahaja. Justeru setiap rang undang-undang perlu mendapat persetujuan kedua-dua Majlis
Parlimen serta mengikut peraturan-peraturan tertentu dan mengikut segala prosedur yang telah
ditetapkan oleh perlembagaan (Mohd Salleh Abas, 1997:81).Setiap undang-undang yang
diluluskan perlu melalui empat peringkat iaitu:
6.1 Bacaan Pertama

Bacaan atas tajuk rang undang-undang itu sahaja oleh setiausaha dewan Parlimen.
6.2 Bacaan Kedua

Perlu kepada suatu tempoh yang bersesuaian antara bacaan pertama dan kedua tetapi
sekiranya ianya penting dan kerajaan memerlukan ianya dilakukan dengan cepat,
bacaan kedua dan ketiga boleh diadakan dalam satu persidangan serentak dengan
bacaan pertama.
6.3 Peringkat jawatankuasa

Apabila rang undang-undang telah dibaca buat kali kedua, maka rang undang-undang
itu akan dibincang dan diperhalusi dengan lebih teliti di dalam jawatankuasa.
6.4 Bacaan Ketiga

Bacaan ketiga bagi suatu rang undang-undang adalah bacaan yang terakhir dan dengan
bacaan ini rang undang-undang itu dianggap telah diluluskan di Dewan Rakyat.
Selepas melalui proses tersebut di Dewan Rakyat, proses yang sama turut dilakukan di
Dewan Negara dan apabila telah diluluskan maka rang undang-undang itu akan
dipersembahkan kepada baginda YDPA untuk mendapat perkenan. Persetujuan YDPA kepada
satu rang undang-undang adalah dimeterai dengan dicopkan Mohor Negara ke atasnya dan
seterusnya digazetkan sebagai Warta Kerajaan untuk diimplimentasikan (Mohd Salleh Abas,
1997:84-90).
7.0 HUBUNGAN DIANTARA KOMPONEN DI DALAM PARLIMEN
YDPA, Dewan Rakyat dan Dewan Negara merupakan insitusi penting yang menjadi
tonggak kepada Parlimen Malaysia. Setiap komponen ini mempunyai kuasa,had dan percaturan
masing-masing yang telah ditetapkan oleh Perlembagaan. Pastinya prosedur sesuatu rang
undang-undang tidak akan lengkap dan berjaya sekiranya hanya mendapat persetujuan kedua-
dua Majlis Parlimen iaitu Dewan Rakyat dan Dewan Negara tanpa melibatkan perkenan YDPA.
Sebagaimana resamnya menurut perlembagaan, YDPA tidak akan enggan untuk tidak
memperkenan dan memberikan persetujuan baginda terhadap rang undang-undang yang telah
diluluskan oleh Dewan Rakyat dan Dewan Parlimen. Persoalannya, apakah yang akan berlaku
sekiranya satu rang undang-undang yang telah diluluskan di peringkat Dewan Rakyat tetapi
ditolak dan diarahkan untuk dipinda oleh Dewan Negara? Lebih merumitkan lagi keadaan
sekiranya Dewan Rakyat tidak akur dan tidak mahu membuat sebarang perubahan dan pindaan
terhadap rang undang-undang yang telah diluluskan mereka. Lantas ianya pasti menjadi satu
persoalan dan perdebatan yang tidak ada kesudahan seandainya berlaku sebagaimana yang
demikian.
191
Justeru ianya perlu berbalik semula kepada PP yang telah memperuntukkan kuasa
kepada setiap institusi yang berkaitan. Per. 68 PP sebagai contoh dengan jelas dan nyata
memperincikan bahawa Dewan Negara tidak mempunyai kuasa untuk menolak rang undang-
undang yang telah dipersetujui oleh Dewan Rakyat. Maka PP juga jelas menyatakan jika rang
undang-undang itu tidak diluluskan oleh Dewan Negara tanpa pindaan dalam tempoh sebulan
maka rang undang-undang itu perlu diserahkan kepada YDPA untuk proses yang seterusnya.
Lantas ianya juga boleh mengundang persoalan yang lebih rumit, apa perlunya Dewan Negara
diwujudkan sekiranya langsung tidak mampu dan berkuasa untuk menolak rang undang-
undang yang telah diluluskan di peringkat Dewan Rakyat sekiranya Dewan Negara tidak
bersetuju.
Sehubungan dengan itu, pemahaman terhadap PP sangat perlu bagi meletakkan yang
hak di tempat yang sepatutnya. Oleh sebab itu, dapat kita lihat dengan jelas bahawa Dewan
Rakyat yang dipilih oleh rakyat keseluruhan yang layak mempunyai kuasa yang besar
diperuntukkan oleh undang-undang. 222 ahli Dewan Rakyat yang dipilih mendokong amanah
dan aspirasi besar rakyat kebanyakkan. Mereka ini dipilih oleh rakyat bukannya dilantik atas
kapasiti tertentu maka pastinya mereka perlu lebih bertanggungjawab dan beramanah
melaksanakan apa yang sepatutnya dilakukan oleh mereka. Dewan Negara hanya boleh
menegur, memberi pandangan dan cadangan terhadap rang undang-undang tersebut selain
melengahkan sesuatu rang undang-undang yang telah dipersetujui oleh Dewan Rakyat.
Namun atas kapasiti check and balance, kewujudan Dewan Negara sangat diperlukan
apatah lagi dengan keahliannya yang mempunyai pengaruh, kepakaran dan pengalaman yang
banyak pastinya dapat menyuntik sesuatu yang baik untuk perkembangan dan percambahan
idea yang kritis terhadap sesuatu rang undang-undang yang dipersembahkan kepada mereka
untuk kajian yang lebih mendalam.
8.0 KESIMPULAN
Demokrasi berparlimen bukan satu amalan baru yang diamalkan dalam negara kita
tetapi ia telah direalisasikan seawal kemerdekaan negara lagi. Terlalu banyak susah payah dan
kejerihan yang terpaksa dilalui bagi membolehkan kita berada sebagaimana hari ini. Justeru
sebagai satu sistem yang telah lama diguna pakai seharusnyaia menjadi satu paltfom yang
lebih baik dan utuh tanpa diragui oleh mana-mana pihak. Keahlian Majlis Parlimen itu perlulah
kepada mereka yang mempunyai iltizam dan jatidiri yang tinggi serta mempunyai nilai integriti
yang tinggi. Rakyat perlu menilai, memeriksa dan membuat kajian latar belakang agar tidak
silap memilih pemimpin yang mewakili mereka di dalam Dewan Rakyat. Keanggotaan perlu
kepada mereka yang mempunyai pendidikan yang baik, pengalaman dan yang paling penting
ialah amanah tanpa terikat kepada mana-mana pihak ataupun individu tertentu.
Hal ini masih boleh diperbaiki sekiranya setiap pihak menghormati kuasa dan hak
masing-masing sebagaimana yang telah diperuntukkan oleh perlembagaannegara. Apabila
wujud sifat menghormati selain daripada ingin melaksanakan tadbir urus yang baik dalam
sistem pemerintahan negara pastinya segala bentuk undang-undang dan perlembagaan akan
dapat kita ikuti dengan teratur kerana iltizam kita adalah ingin membentuk sebuah negara
bangsa yang mampu untuk diketengahkan sebagai idola dan ikutan negara-negara lain.
Namun, jika mentaliti kelas ketiga diamalkan secara menyeluruh tanpa mempunyai prinsip dan
pegangan masing-masing maka akan lahirlah sebuah negara yang berteraskan kepada
192
kleptokrasi dan banyak salahguna kuasa diamalkan apatah lagi ianya tidak berani dinafikan
oleh kebanyakan pihak, atas dasar kedudukan, kuasa dan kepentingan.
Kesedaran dan kematangan itu perlu menyeluruh, demokrasi perlu disuburkan sebaik
mungkin dan bukannya dikuburkan tetapi perlu kepada had dan batasannya. Ini penting agar
setiap tindakan itu tidak dibuat sewenang-wenangnya atas nama demokrasi tanpa
menghiraukan kepada kedaulatan undang-undang serta kesopanan dan kesusilaan yang
menjadi pegangan rakyat Malaysia secara keseluruhan.
RUJUKAN
Abdul Aziz Bari. (2006). Majlis Raja-Raja – Kedudukan dan Peranan Dalam Perlembagaan
Malaysia. Kuala Lumpur: Dewan Bahasa dan Pustaka.
Ahmad Mohamed Ibrahim & Ahilemah Joned. (1986). Sistem Undang-Undang di Malaysia.
Kuala Lumpur: Dewan Bahasa dan Pustaka
Laski, H. (1984). A Grammar of Politics. New Delhi: S. Chand & Co.
Mohamed Suffian. (2007). An Introduction To The Constitution Of Malaysia. (3rd Ed). Petaling
Jaya: Pacifika Publications.
Mohd Salleh Abas. (1997). Prinsip Perlembagaan dan Pemerintahan di Malaysia. Kuala
Lumpur: Dewan Bahasa dan Pustaka
Perlembagaan Persekutuan. (2017). Lawnet. Kuala Lumpur: Percetakan Nasional Malaysia

Bhd.
-GP31-
STUDENTS’ PERCEPTIONS TOWARD USAGE OF EDMODO SOCIAL LEARNING
PLATFORM
Farah Mohamad Zain

School of Education and Modern Languages, Universiti Utara Malaysia,
06010 UUM Sintok, Kedah
mz.farah@uum.edu.my
Abd. Latif Kasim

School of Education and Modern Languages, Universiti Utara Malaysia,
06010 UUM Sintok, Kedah
mz.farah@uum.edu.my
ABSTRACT
193
This studyfocused on the students‘ perception on the strength and weakness of Edmodo Social
Learning Platform (ESLP)as well on factors inhibiting activeparticipation of students
inforumboard.A total of42 first year students of theSchool of Industrial Technology(SIT),
UniversitiSainsMalaysia(USM) enrolled forIMK209-FoodPhysicalProperties course were
involvedin this study.Findingsof the study wasobtainedthrough the descriptive analysis of the
open-ended questionnaire revealed time constraints and technical aspects were found to be the
main factors inhibiting the active participation of students in ESLP. The findingsprovedthat the
ESLP is accepted as alearningplatform by the studentsand able to promotea highlevelof
collaboration and interaction in teaching and learning.
Keywords: Edmodo, Social Learning Platform, Perception
INTRODUCTION
Web 2.0 was introduced by Darcy DiNucci in 1999 (Wikipedia, 2011). However, it
became popular in 2003 through O'Reilly Media and MediaLive, hosting the first Web 2.0
conference. Web 2.0 framework consisting of three main areas of collaborative/social, learner
as designer and knowledge management (Tutty and Martin, 2009). Social or collaborative
framework creates a workspace to support users in the learning process, self-assessment,
collaboration and contribution. Learner as designer refer to situations where users use Web 2.0
tools to generate creative knowledge based on their own interests and produce meaningful
information and relevant learning outcomes. Knowledge management is the use of knowledge
efficiently and wisely(Tutty and Martin, 2009).
Most of Web 2.0 tools are related to podcasting, blogging, tagging, social bookmarking
and social networking.Social networking is one of the most popular Web 2.0 features and is
today's favourite teenager. From Friendster to mySpace and the latest Facebook, social
networking has indeed become one of the necessities in their lives. Although it was initially
established for the purpose of communicating and sharing information with each other, now the
social networking was also exploited in various fields such as business, politics, religion,
entertainment and education.
Social networking is also considered as apps that are capable of expanding interactions
and sharing space for collaboration, social relationships and information exchange in a web-
based environment. This definition provides an understanding of the teaching and learning
environment that utilizes the various tools and activities available within the network.
Edmodo is one of the Web 2.0 tools and also a web-based social networking application
that is ideal for learning platforms. In January 2018, Rachelle has recognized Edmodo as one of
'12 Digital Tools to Try in 2018‘. Additionally, Edmodo is also listed in 'Top 100 Tools for
Learning 2017' and ranked 41th.
Edmodo social learning platform (ESLP) has the appropriate educational features as a
teaching medium for all levels of education and training. It is free to use and lecturers have full
control to connect other lecturers and students. In addition, ESLP provides a safe and functional
as a learning resource, assessment and communication tool.
194
LITERATURE REVIEW
Studies on the use of ESLP in teaching are quite limited. Holland and Muilenburg
(2011) studied the participation of students in literary discussions through asynchronous forum
boards at ESLP. Participation and student engagement, the complexity of discussion and
effectiveness of ESLP are discussed. The study by Kongchan (2008) explores the possibility of
teachers who are not a digital background using ESLP as a medium in conducting online
classes including workshops on ESLP for other teachers. The findings revealed that ESLP was
seen as a simple and user-friendly social learning platform. Teachers successfully use this
program without any support from technicians.
Thongmak (2013) reviews the use of ESLP as a tool for collaboration and student
views towards ESLP. The findings show that perceived ease of use and perceived usefulness of
ESLP are an important factor in influencing ESLP acceptance and use. Sanders (2012)
examines the effects of ESLP on the student engagement and self-learning. The results of the
study had shown that the implementation of ESLP in teaching and learning encourages student
engagement and produces self-directed learning when ESLP features are applied. Nevas
(2010) in his study examined the effects of microblogging on student engagement and
performance and found that communication between students improved when they performed
challenging tasks progressively in the ESLP. Balasubramanian, Jaykumar and Fukey (2014) in
his study found that ESLP as a learning platform to create a responsible learning environment
that students would prefer to use while supporting the RASE models (Resources, Activity,
Resources and Evaluation).
Al-said (2015) in his study of bachelor's degree at Taibah University found that they had a
positive perception of ESLP as an app for the M-learning environment as it had many benefits to
supporting learning processes such as facilitating and improving the effectiveness of
communication in learning. They also appreciated ESLP because it allowed them to learn
through flexible time.
Cankaya, Durak and Yunkul (2013) in his study of 22 undergraduate students found that
students had a positive attitude towards the use of ESLP in education. For example, they think
ESLP is fun and almost all students want to use ESLP in the future after they become teachers.
Wolfer (2012) in his study of the effects of using microblogging (through ESLP) on student
engagement and understanding found that the collaboration and knowledge sharing influenced
student engagement positively in discussions at ESLP.
According to Bita, Seyyed and Ali (2015), the use of ESLP as a technology tool can
support writing capabilities. The results show that using different colors while providing feedback
helps students to realize their mistakes.
STATEMENT OF THE RESEARCH PROBLEM
Most of online courses are supported through Learning Management Systems

(LMS) such as Moodle because of the features of competency, safety and organization
195
(McLoughlin and Lee, 2010). However, this platform has generally been used as a static source
of content without social networking features such as Facebook or YouTube (Brady, Holcomb
and Smith, 2010; Schroeder, Minocha and Schneider, 2010). Other studies also criticize LMS
for not giving motivation, enthusiasm or personalization (Naveh, Tubin and Pliskin, 2010), as
well as preventing pedagogical support with default settings and familiar features. Meanwhile,
social networking platforms provide students with social communication, autonomy, online
discussions and management (Brady et al., 2010: McLoughlin and Lee, 2010). The social
networking platform has the potential to facilitate interaction and collaboration by focusing on
the use of technology to support education. Social networks create an informal and relaxing
environment but promote effective learning. In addition, social networks also help students and
lecturers build good relationships and overcome constraints (Bosch, 2009).
The most dominant social networking tool among university students and
researchers is Facebook as it was initially designed to cater for the needs of students
communicating and building networks (Clark and Gruba, 2010). However, the use of Facebook
in education is not as widespread as in other areas due to privacy concerns (Duncan and
Chandler, 2011; Nentwich and Kong, 2012). Other social networks that appear and are best
suited for application in the teaching and learning process are Edmodo social learning platforms
(Motteram, 2013) as this platform facilitates grading process, able to evaluate student
performance and complement lecturer learning plans. In addition, ESLP also provides a
comprehensive environment for online education experience and keeps students safe and
focused. However, the study on the use of ESLP in teaching is still quite limited (Evriklea and
Jenny, 2014) mainly refers to its acceptance, collaboration and interaction pattern and its impact
on knowledge generation.
RESEARCH METHODOLOGY
This study involved 42 students at the School of Industrial Technology, Universiti Sains
Malaysia who enrolled for IMK 209-Food Physical Properties. Research briefings to all students
registered with this course were delivered by IMK 209 course lecturer Prof. Dr. Abd. Karim Alias
at the lecture hall. The briefing is also relevant to the use of ESLP. The lecturer also informed
students about the various activities to be undertaken through ESLP during the 14 weeks of the
IMK 209 course. In order to answer the question on student opinion about ESLP, researchers
use open-ended questionnaire method. The questionnaire was aimed to look at students'
perceptions on ESLP advantages, disadvantages, collaboration in ESLP and the lack of active
involvement among students. An open-ended questionnaire provides an opportunity for
students to express their opinions or views on the questions raised. In this research,
researchers have formulated questions to get afeedback from students after they have used
ESLP. This open-ended questionnaire consists of four questions that require students to submit
their answers with explanations and opinions. This questionnaire was adapted from the
Noorizdayantie (2012) study which deals with the advantages and disadvantages of using e-
learning platforms.The data obtained were analyzed using descriptive analysis. This analysis is
in quantitative form through frequency for the main themes presented by the students.
196
RESULTS AND DISCUSSION
Student demographics
The results of the demographic are shown in figure 1, 2, 3 and 4. The figure
indicates that most of the students were female (81%) with majority of them was Malay (71%).
Most of them were average student with CGPA ranging between 2.00-3.00 with 64%. The
usage of ESLP in a week quite regularly with 62% of them used at least 3 times a week.
Chinese
[CATEGOR 29%
Y NAME]
[PERCENT Malay
[CATEGOR
Y NAME]AGE] 71%
[PERCENT
AGE]
Male Female Malay Chinese
Fig 1Gender Fig 2 Race
35
30
25
20
15
10
5
0
2.00-2.50 2.50-3.00 3.00-3.50 3.50-4.00
Percentage (100%) 31 33 29 7
Fig 3 Current CGPA
197
60
50
40
30
20
10
0
Once 2-3 Times 3-4 times more than 4 times
Percentage (100%) 9.5 28.6 50 11.9
Fig 4 Usage of Edmodo in a week
Descriptive Analysis
There are four open-ended questions given to students which is include the
advantages and disadvantages of using ESLP as well as student perceptions about the
collaboration taking place in ESLP and the lack of active participation of students. This analysis
is intended to examine students' views on the use of the platforms they have been through
throughout a semester. Students are required to give perceptions of each question.
Each student view is categorized according to the general criteria and the frequency
of each of these criteria is calculated. The findings from feedback received were analyzed by
percentage of the total frequency recorded.
(i) The Advantages of ESLP

Figure 5 shows the findings from open-ended question related to the advantages of
using ESLP. A total of 55.6% (n = 25) students stated that they were able to obtain in the IMK
Able to upload and downloadin the ESLP while 11.1% (n = 5) students thought that the use of
ESLP encouraged collaboration between students and lecturers and acquired knowledge
(11.1%). In addition, 8.9% (n = 4) of the students explained that they obtained an additional note
for the IMK 209 course in the ESLP from the sharing of lecturer and students. Other responses
to the advantages of using ESLP stated that the use of ESLP increased interest in the IMK 209
course of 4.4%, ESLP can be accessed anywhere at 4.4% and ultimately ESLP is able to
upload and download learning material files shared by lecturer and students at 4.4%.
198
60
50
40
30
20
10
0
Able to
Increased
Obtain an upload and
Obtain useful Encouraged Acquired interest Accessed
additional download
information collaboration knowledge toward the anywhere
note learning
course
materials
Percentage (100%) 55.6 11.1 11.1 8.9 4.4 4.4 4.4
Fig 5 Advantages of ESLP
This finding revealed that ESLP was useful to supplement traditional learning method
since it provides various features supporting the teaching and learning process. In addition, it
was considered a comprehensive content since obtain useful information recorded the highest
percentage (55.6%). The findings of this study were supported by Enriquez (2014) that found
ESLPsuitable to use to send assignments, sit on the online quiz and facilitate participants to
access learning materials provided by course lecturer. In addition, activities and discussions in
the ESLP motivate them to learn more about this course. Kongchan (2012); Sanders (2012);
Cruz and Cruz (2013) have proven many benefits of employing Edmodo as a technology tool for
classroom teaching and learning. Hence, researchers conclude that although ESLP only serves
as a support system for conventional learning, it helps students to gain information and
knowledge that enhances the construction of student knowledge.
(ii) The Disadvantages of ESLP
Figure 6 shows the findings on open questionnaires related to disadvantagesof using

ESLP. It was found that 42.8% (n = 18) students argued that Internet speed problem in USM
caused them difficult to log in to ESLP. While 26.2% (n = 11) students stated that the
information or learning materials shared are too much that sometimes make them confused. In
addition, 21.4% (n = 9) students face the time constraints for them to engage in discussions at
ESLP and read all the learning materials shared by lecturers and students. 4.8% (n = 2) think
that the influence of social networks like facebook and twitter makes it difficult for them to focus
on using ESLP. Other responses to the disadvantages of using the ESLP stated include a less
attractive display (2.4%) and have no smartphone to enable them to access ESLP (2.4%).
199
45
40
35
30
25
20
15
10
5
0
Learning
Influence of Less attractive
Internet speed materials shared Time constraints No smartphone
social networks display
are too much
Percentage 42.8 26.2 21.4 4.8 2.4 2.4
Fig 6 Disadvantages of ESLP
This finding revealed that the lack of Internet speed in USM (42.8%) makes it difficult for
them to engage in activities in the ESLP. Perhaps in the future, researchers hope this problem
can be overcome to enable teaching and learning based on the internet to run
smoothly.According to Enriquez (2014), weaknesses in using ESLP are time constraints,
difficulty in following ESLP procedures, plagiarizing other work and not all students have access
to the internet.
Table 1 shows students' overall perception on the advantages and disadvantages of

using ESLP.
Table 1: Perception towards ESLP
Advantages Number of Percentage

Students (%)
Obtain useful information 25 55.6
Acquired knowledge 5 11.1
Encouraged collaboration 5 11.1
Obtain an additional note 4 8.9
Increased interest toward the course 2 4.4
Accessed anywhere 2 4.4
Able to upload and download learning materials 2 4.4
Total 45 100
200
Disadvantages Number of Percentage

Students (%)
Internet speed 18 42.8
Learning materials shared are too much 11 26.2
Time constraints 9 21.4
Influence of social networks 2 4.8
Less attractive display 1 2.4
No smartphone 1 2.4
Total 42 100
(iii) ESLP encouraged collaboration
This open-ended question also looks at the extent to which students and lecturer are
collaborating in the ESLP. Table 2 show the findings obtained from student feedback. It was
found that 69.05% (n = 29) students thought that the use of ESLP encouraged collaboration
between students and lecturer while only 9.52% (n = 4) students did not support the opinion that
the use of ESLP encouraged collaboration.
For students who supported, they felt that collaboration occurred because of the
interaction between students and lecturer (19.05%), through the discussion in the forum board
at ESLP (16.67%), information sharing between students and lecturer (14.29%), to change
ideas (9.52%) and opinions (9.52%) and ultimately the question-answer process between
students and students-lecturers.
For students who do not support, some students are inactive to engage in discussions
(11.90%) and students are more often involved in face-to-face rather than online (2.38%). For
these factors, they assume that the use of ESLP does not encourage collaboration between
students-students and students-lecturer.
Table 2: Perception about collaboration between students in ESLP
Number of Percentage
Students (%)
Collaboration 29
Interaction between students-lecturer 8 25.8
Collaboration takes place through discussion in 7 22.6

the forum board
201
Collaboration occurs when sharing information 6 19.4
Collaboration occurs when exchanging ideas 4 12.9
Collaboration occurs when exchanging opinions 4 12.9
question-answer process between students and 2 6.5

students-lecturers
Total 31 100
Number of Percentage
Students (%)
No Collaboration 4
Inactive students 5 83.3
Involved in face-to-face rather than online 1 16.7
Total 6 100
According to Looi and Yusop (2011), ESLP contains a collaborative learning feature in
which discussions can occur in small groups. This is supported by Enriquez (2014) where ESLP
is a supplementary tool in addition to face-to-face discussions and provides collaborative
platforms for students and lecturer.Therefore, the researchers conclude that when students
discuss, share information, exchange ideas and opinions, collaborate between students and
lecturer, thus proving the role of ESLP in promoting constructivism learning approaches.
(iv) The lack of active involvement among students

Figure 7 shows the findings related to the lack of active involvement among students in
the ESLP. It is found that 48.4% (n = 15) think that they are very busy with the coursework and
have no time to read all the learning materials provided in the ESLP. While 38.7% (n = 12)
stated that the unsatisfactory Internet speed enabled them to actively engage in the ESLP. In
addition, 9.7% (n = 3) students are not interested in using ESLP and 3.2% (n = 1) students
stated that there is no internet access at their place.
202
60
50
40
30
20
10
0
Unsatisfactory Internet Not interested in using
Busy with the coursework No Internet access
speed ESLP
Percentage 48.4 38.7 9.7 3.2
Fig 7 The lack of active involvement among students
CONCLUSION
ESLP provides opportunities for greater collaboration and ways to facilitate teaching and
learning. This research can help stakeholders in e-learning especially in the administration,
lecturer, teaching designers, content specialists and information technology to better understand
the collaborative effectiveness, the advantage of using ESLP as well as the importance of
interaction between students and students-lecturers. As well as improving the effectiveness of
the learning process, the collaborative approach is able to develop social skills, communication
skills, leadership, teamwork and problem-solving skills.
REFERENCES
Al-said, K. M. (2015). Students ‘ perceptions of edmodo and mobile learning and their real
barriers towards them. TOJET: The Turkish Online Journal of Educational Technology, 14(2),
167–180.
Balasubramanian, K., Jaykumar, V., & Fukey, L. N. (2014). A Study on ―Student Preference
towards the Use of Edmodo as a Learning Platform to Create Responsible Learning
Environment.‖ Procedia - Social and Behavioral Sciences, 144, 416–422.
http://doi.org/10.1016/j.sbspro.2014.07.311
Bita B. S., Seyyed D. A. & Ali G. M. (2015). The effect of Edmodo on EFL learners‘ writing
performance. International Journal of Educational Investigations, 2(2), 88-97.
203
Bosch, T. E. (2009). Using online social networking for teaching and learning: Facebook use at
the University of Cape Town. South African Journal for Communication Theory and Research,
35 (2), 185-200.
Brady, K. P., Holcomb, L. B., & Smith, B. V. (2010). The use of alternative social networking
sites in higher educational setting: A case study of the e-learning benefits of ning in education.
Journal of Interactive Online Learning, 9(2), 151-170.
Cankaya, S., Durak, G. & Yunkul, E. (2013). Using educational social networking sites in higher
education: Edmodo through the lenses of undergraduate students. European Journal of
Educational Technology, 1(1), 3-23.
Clark, C., & Gruba, P. (2010). The use of social networking sites for foreign language
learning:an autoethnographic study of Livemocha. Proceedings ASCILITE-Australian Society for
Computers in Learning in Tertiary Education Annual Conference 2010 (164-173).
Duncan, J. C. And Chandler, P. D. (2011), ‗A Community of Practice for Early Career Biology
Teachers: Social Networking and Digital Technologies, Proceedings of Contemporary
Approaches to Research in Mathematics, Science, Health and Environmental Education,
Deakin University, Melbourne Burwood Campus.
Evriklea Dogoriti & Jenny Pange (2014). Instructional design for a ―social‖ classroom: Edmodo
and Twitter in the foreign language classroom. ICICTE 2014 Proceedings, pp: 154-165.
Holland, C. & Muilenburg, L. (2011). Supporting student collaboration: Edmodo in the

classroom. Proceedings of Society for Information Technology and Teacher Education
International Conference 2011, Chesapeake, VA, 3232-3236.
Kongchan, C. (2008). How a Non-Digital-Native Teacher Makes Use of Edmodo. International

Conference “ICT for Language Learning.”
McLoughlin, C. & Lee, M.J.W (2010). Personalised and self regulated learning in the Web 2.0
era: International exemplers of innovative pedagogy using social software. Australian Journal of
Educational Technology, 26(1). http://ascilite.org.au/ajet/ajet26/mcloughlin.html
Motteram, G (Ed). (2013). Innovations in learning technologies for English language teaching.
British Council.
Naveh, G., Tubin, D. & Pliskin, N. (2010). Student LMS use and satisfaction in academic
institutions: The organizational perspective. The Internet and Higher Education, 13(3), 127-133.
Nentwich, M., & Kong, R. (2012). Cyberscience 2.0: Research in the age of digital social
networks. Frankfurt; New York: Campus Verlag.
Nevas, B. (2010). Inquiry through action research: Effects of the Edmodo microblog on student
204
engagement and performance. Retrieved from http://www.scribd.com/doc/27372047/Edmodo-

Research
Sanders, K. S. (2012). An examination of the academic networking site Edmodo on student

engagement and responsible learning. (Unpublished doctoral dissertation). University of South
Carolina College of Education.
Schroeder A., Minocha S., & Schneider C. (2010). The strengths, weaknesses, opportunities
and threats of using social software in higher and further education teaching and learning.
Journal of Computer Assisted Learning, 26, 159-174.
Thongmak, M. (2013). Social Network System in Classroom: Antecedents of Edmodo ©

Adoption. Journal of E-Learning and Higher Education, 2013, 1–15.
http://doi.org/10.5171/2013.657749
Tutty, J. I., & Martin, F. (2009). User generated design teaching and learning with Web 2.0. In
Wired for Learning: An Educator‟s Guide to Web 2.0 by Information Age Publishing. Pages 43-
58.
Wikipedia, 2011.https://en.wikipedia.org/wiki/Web_2.0
Wolfer, C. (2012). Effects on student engagement and comprehension when using

microblogging with fourth grade reading groups. Action Research Project. CI 515.
-GP32-
The Effects of Perceived Local Economic Conditions on Support for Sustainable
Tourism Development at a World Heritage Site Destination
Ahmad Edwin Mohamed1, NurhazaniMohd Shariff1, Kalsom Kayat2

1
School of Tourism, Hospitality and Event Management
2
Graduate School of Othman Yeop Abdullah
edwin@uum.edu.my
ABSTRACT
In general, tourism is often perceived as a catalyst for economic development at tourist

destinations, especially in the developing countries. However, very little studies have
systematically examined this relationship. Therefore, this study attempts to confirm the
relationship between perceived local economic condition and residents‘ support for sustainable
tourism development. For that purpose, a structured questionnaire was administered to gather
responses from local residents who live in Lenggong district, one of Malaysia‘s World Heritage
Site destinations. The data was then treated with statistical analysis including descriptive
analysis and simple regression. The outcomes of the study indicated that, perceived local
economic condition was found to establish an inverse relationship with support for sustainable
tourism development. In other words, when the local residents perceived the local economic as
205
poor, they became very supportive of tourism development as an alternative to boost the local
economy.
Keywords: Perceived local economic condition, support for sustainable tourism development.
1.0 INTRODUCTION
As of lately, perceived local economic condition has been introduced as a factor in the
study of tourism attitudes and supports (Gursoy, Chi, & Dyer, 2009; Sinclair-Maragh&Gursoy,
2015). In general, Var, Kendall &Tarakcoglu (1985) argued that residents in regions with poor
economic condition would happily accept tourism as an economic catalyst regardless of its
negative consequences. This is especially true when tourism often perceived as a tool for
national or regional development, especially in many developing countries (Liu & Var, 1986;
Sinclair-Maragh&Gursoy, 2015). One of the key issues with this construct is related to the
measurement instrument which is far from comprehensive as it focuses merely on the
availability of job opportunity as indicator for economic condition. There are more variable items
that could be included in order to better capture this construct, e.g. business opportunity as
attempted in this study.
Based on social exchange theory, residents‘ support for tourism development could
indicate their willingness to enter into exchange as a result of evaluated consequences (Ap,
1992). In this study, the operationalization of support is - residents‘ endorsement and inclination
towards policies, programs, plans, projects, and any social change processes invoked by those
interventions as modified from Long (2006). Perceived local economic condition on the other
hand refers to how local residents evaluate the condition of local economy according to both
quantitative and qualitative aspects including human capital, critical infrastructure, regional
competitiveness, environmental sustainability, social inclusion, health, safety, literacy and others
(Mathieson & Wall, 1982). In this study, the operationalization of this concept focuses on the
current job and businesses opportunities available in the destination as borrowed from Gursoy
and Rutherford (2004).
2.0 LITERATURE REVIEW
This section discusses the understudy variables based upon existing literature, namely
support for sustainable tourism development, and perceived local economic condition.
2.1 Support for Sustainable Tourism Development
The term ‗support‘ although has been used extensively in the literature yet little was
explained about its conceptual definition. According to social exchange theory, support
represents the consequence of exchange (Ap, 1992). In social exchange process, a person will
evaluate the consequence of exchange before he or she make a decision whether or not to
enter into exchange. If the impact is judged more positively than its costs, they will then enter
into the exchange (e.g. engage in tourism activities, support etc.). The consequences of the
exchange will be in the forms of output, actions, or outcomes. In other words, people who
believe tourism is beneficial for them will act in the best interest of tourism. They actions or
behaviours can be in the forms of collaboration, cooperation, involvement, commitment to the
development policy and even support for tourism development. In overall, social exchange
theory infers that residents‘ support for tourism development could indicate their willingness to
enter into exchange as a result of evaluated consequences (Ap, 1992; Jurowski, Uysal, &
Williams, 1997; Long & Kayat, 2011).
206
On the other hand, Deery, Jago&Fredline (2012) in their seminal work defined ‗support‘ as
the behavioural outcomes as a result of perceived impacts. According to their study, the
outcomes of an evaluated social impact (e.g. support or no support) can be determined by a
number of variables such as host-guest relationships, resident characteristics, residents‘
perceptions of tourism impacts, and also destination characteristics. The perception towards
tourism impacts including economic benefits and costs, recreational opportunities, delinquent
behaviours, pride, and development of infrastructure acting as the major factors for support or
opposition for tourism development.
Using the above theoretical definitions as a guideline, this study operationalizes support as
residents‘ endorsement and inclination towards policies, programs, plans, projects, and any
social change processes invoked by those interventions as modified from Long (2006). Such
endorsement and inclination are formed by the influence of various determinants such as
perceptions and trust. Without endorsement and inclination by the public, sustainable tourism
development planned by the government will face great difficulties.
To date, studies examining support towards tourism development has been the focus
among scholars due its sheer importance (Gursoy,Juroswki, &Uysal, 2002; Gursoy& Rutherford,
2004; Lee, 2013; Long &Kayat, 2012; Nicholas, Thapa, & Ko, 2009; Nunkoo&Gursoy, 2012).
Based on the above studies, this construct mainly revolves around how local residents support
or oppose tourism development plans or programmes including economic activities, community
development, cultural heritage preservation, tourist arrival, and participation in tourism industry.
2.2 Perceived Local Economic Conditions
People who live in regions with low level of economic activities are more favourable towards
tourism development than others (Sharpley, 2014; Sinclair-Maragh&Gursoy, 2015). In fact, they
tend to underestimate the costs and overestimate the economic benefits (Gursoy& Rutherford,
2004; Kim, Uysal, &Sirgy, 2013). For example, residents in Turkey acknowledge their
willingness ―to put up with some inconvenience in exchange for tourist money‖ (Var, Kendall
&Tarakcioglu, 1985, p.654). One reason for this phenomenon is because tourism often
perceived as a tool for national or regional development, especially in developing countries (Liu
& Var, 1986; Sinclair-Maragh&Gursoy, 2015).
Thus far, only three studies have been found in the published literature to empirically
examine the influences of local economic conditions on support for tourism (Gursoy et al., 2002;
Gursoy et al., 2009; Gursoy& Rutherford, 2004). Early studies (Allen, Hafer, Long, & Perdue,
1993; Perdue, Long, & Allen, 1990) suggested that this factor may explain the variance in
support for tourism development. In addition, Cater (1987) also argued that many destinations
with poor economic condition will be more than happy to embrace tourism as their economic
boost.
3.0 METHODOLOGY
This section describes important research protocols including the instrument development,
sampling procedure, data collection, and data analysis. The field work for this study took place
in Lenggong District between February and May 2013.
3.1 Study Site
The study site is Lenggong district situated in the rural Perak, Malaysia. Lenggong has been
designated as a WHS by United Nation Educational, Scientific and Cultural Organization
(UNESCO) in 2012. Lenggong WHS is one of the most important archaeological sites in the
world as it provides evidence of early human inhabitants in South East Asia dating back as early
207
as 1.8 million years ago. The carbon dating tests also found many other archaeological finds
including pre-historic stone tools and early human skeletons. Since its designation, Lenggong
has been receiving a growing number of visitors and funding from federal government agencies
to improve its tourist-related infrastructures (Rasoolimanesh, Jaafar, Kock, &Ramayah, 2015).
Based on existing official record, the population of Lenggong District was 18,086 people or
3,759 households dispersed into 18 villages (Lenggong District Council, 2010).
3.2 Instruments Development
This study utilised four items of perceived local economic condition as adopted from Gursoy
and Rutherford (2004). Lower score reflects poor local economic condition and vice-verse.
Meanwhile, eight measurement items used to measure support for sustainable tourism
development were adapted from a study by Nicholas et al. (2009). In this case, the higher score
reflects the stronger support for sustainable tourism development in the local area. The
measurement scale for perceived local economic condition was in the form of continuous scale,
where 1 indicated ‗strongly agree‘ and 7 as ‗strongly disagree‘. Meanwhile, for support for
sustainable tourism development, the continuous scale was according to this; 1 indicated
‗strongly disagree‘ and 7 as ‗strongly disagree‘.
3.3 Sampling Procedures
The sample unit of this study were the households who live in villages within and adjacent to
the WHS. In this case, only five villages and a town were purposely selected. From that, a total
of 450 households were chosen using the systematic random sampling procedures of every 5th
house.
3.4 Data Analysis
The data from this study was subjected to multivariate analysis techniques including
descriptive analysis, and simple regression using Statistical Packages for Social Science (SPSS
version 21). Before the analysis, all the data were subjected to normality test, univariate and
multivariate outlier detections, reliability test, linearity of phenomenon, homoscedasticity, and
multicollinearity tests to ensure its appropriateness.
4.0 STUDY RESULTS
The following section discusses the findings of data analysis namely the profile of
respondents, descriptive analysis, and simple-regression.
4.1 Profiles of Respondents
A total of 450 questionnaires were personally distributed to household‘s representatives

over five selected villages and a town within the Lenggong District. The response rate was
almost 100% as the distribution of questionnaires were carried out personally by trained
enumerators from house to house based on systematic random sampling approach. In total
there were 450 questionnaires collected. However, 49 cases were eliminated after data
screening due to incomplete responses and the presence of outliers. Hence, only a total of 401
cases were included for further analysis. The following table showcases the profiles of
respondents in details.
Table 1: Socio-demographic Characteristics of Respondents
208
Parameter Percentage
Gender Male 48.3
Female 51.7
Age 21 – 30 38.0
31 – 40 21.7
41 – 50 19.0
51 – 60 13.0
Above 60 8.3
Ethnicity Malay 94.5
Chinese 2.8
Indian 1.2
Siamese 1.5
Education level Did not go to school 6.0
Primary school 13.5
Secondary school 63.5
First degree 15.2
Post-graduate 1.5
Others 0.3
Income No income 34.3
Less than RM1000 27.1
RM1,001-2,000 23.8
RM2,001-3,000 11.5
RM3,001-4,000 2.3
RM4,001-5,000 1.0
Length of residency < 5 years 9.2
6-10 years 7.5
11-20 years 13.0
21-30 years 24.4
> 30 years 45.9
Occupations Agriculture 18.5
Fishery 1.0
Quarry 0.3
Logging 0.3
Guano collector 0.3
Government 18.4
Restaurant 3.2
Homestay 4.0
Local cottage industry 3.0
Hotel 1.0
Museum 1.3
Grocery stores 8.0
Housewife 24.2
Student 12.2
Others 4.5
4.2 Descriptive Analysis
The following sections discussed the results of descriptive analysis for each of the under
study variable using mean and standard deviation.
Table 2: Descriptive Analysis of the Understudy Variables
Items Mean Standard

deviations
Perceived local economic condition
Government should help to create more jobs in Lenggong 1.33 .693
Lenggong desperately needs more job opportunities 1.38 .687
209
Lenggon needs more job opportunities to stop young people moving away to 1.53 .843
cities 1.31 .639
Lenggong desperately need more business opportunities in the local area
Support for sustainable tourism development

Development of community-based tourism initiatives 5.88 1.176
Local involvement in tourism planning and development 5.86 1.187
Cooperation and unity in tourism planning and development 5.95 1.057
Promotion of heritage education and conservation 6.17 .960
Commitment in adhering to the regulations & guidelines to maintain the WHS 6.01 1.148
The designation of Lenggong Valley as UNESCO‘s WHS 6.63 .760
The analysis of perceived local economic condition indicated that the majority of
respondents preferred tourism industry to be developed in the district as it can create economic
benefits. This also reflects the economic condition of the district was poor where many are
expecting more new jobs and business opportunities as indicated by the lower score on the
related items. On the other hand, the majority of respondents were very supportive of
sustainable tourism development in Lenggong. Therefore, it can be concluded that, the majority
of residents in Lenggong preferred to have sustainable tourism development within their district.
4.3 Simple-regression Analysis
Perceived economic conditions recorded significant negative relationships with support for
sustainable tourism development as expected (β=-.268, t=-7.269, p˂.05). The lower scores on
perceived economic conditions will results in higher support for sustainable tourism
development and vice-verse. In this case, residents that perceived the local economic as poor
will most likely support sustainable tourism development. The following is the summary of
simple regressions between perceived local economic condition and support for sustainable
tourism development.
5.0 CONCLUSION
The analysis indicated an inverse relationship between perceived local economic condition
and support for sustainable tourism development. The finding implies that residents who
perceived the local economic condition in a poor state or very much in-need of improvement are
likely to support sustainable tourism development and tend to perceive tourism positively. This
finding is consistent with the result reported by previous studies (Gursoy et al., 2002; Gursoy&
Rutherford, 2004). Var et al. (1985, p. 654) further pointed out that ―residents in Turkey
acknowledge a willingness to put up with some inconvenience in exchange for tourist money‖.
This means that residents would be very appreciative of tourism when they are economically
depressed despite other negative consequences. This is also normally the case for rural areas,
especially the ones that located in remote countryside that are marginally left behind from
development compared to urban areas. As mentioned earlier, Lenggong District is a rural area
that is highly dependent on traditional resource-based economies. Thus, tourism in rural areas
is always seen as an alternative economic activity that could give values to the local residents
(Pakurar&Olah, 2008). Tourism is widely known to contribute to the economic development of
tourist destinations through job creations, business opportunities, direct investments and so
forth.
Reference:
210
Allen, L., Hafer, H., Long, R., & Perdue, R. (1993). Rural residents‘ attitudes toward recreation and
tourism development. Journal of Travel Research 31(4):27–33.
Ap, J. (1992). Residents‘ perceptions on tourism impacts. Annals of Tourism Research, 19(4), 665–690.
Cater, E. A. (1987). Tourism in the least developed countries. Annals of Tourism Research 14, 202–226.
Deery, M., Jago, L., &Fredline, L. (2012). Rethinking social impacts of tourism research: A new research
agenda. Tourism Management, 33(1), 64–73.
Gursoy, D., Chi, C. G., & Dyer, P. (2009). An examination of locals‘ attitudes. Annals of Tourism
Research, 36(4), 723–726.
Gursoy, D., Juroswki, C., &Uysal, M. (2002). Resident attitudes. Annals of Tourism Research, 29(1), 79–
105.
Gursoy, D., & Rutherford, D. G. (2004). Host attitudes toward tourism: An improved structural model.
Annals of Tourism Research, 31(3), 495–516.
Jurowski, C., Uysal, M., & Williams, D. R. (1997). A theoretical analysis of host community residents
reaction to tourism. Journal of Travel Research, 36(2), 3–11.
Kim, K., Uysal, M., &Sirgy, M. J. (2013). How does tourism in a community impact the quality of life of
community residents? Tourism Management, 36, 527–540.
Lee, T. H. (2013). Influence analysis of community resident support for sustainable tourism development.
Tourism Management, 34, 37–46.
Lenggong District Council (2010). Unjuran Jumlah Penduduk Daerah Lenggong.
Liu, J. & Var, T. (1986). Resident attitudes towards tourism impacts in Hawaii. Annals of Tourism
Research, 13, 193-214.
Lo, M.-C., Ramayah, T., & Hui Hui, H. L. (2014). Rural communities‘ perceptions and attitudes towards
environment tourism development. Journal of Sustainable Development, 7(4), 84–94.
Long, P. H., & Kayat, K. (2011). Residents' perceptions of tourism impact and their support for tourism
development: The case study of Cuc Phuong National Park, NinhBinh province, Vietnam. European
Journal of Tourism Research, 4(2), 123-146.
Mathieson, A., & Wall, G. (1982). Tourism, economic, physical and social impacts. London: Longman.
Nicholas, L. N., Thapa, B., & Ko, Y. J. (2009). Residents‘ perspectives of a world heritage site. Annals of
Tourism Research, 36(3), 390–412.
Nunkoo, R., &Gursoy, D. (2012). Residents‘ support for tourism. Annals of Tourism Research, 39(1),
243–268.
Rasoolimanesh, S. M., Jaafar, M., Kock, N., &Ramayah, T. (2015). A revised framework of social
exchange theory to investigate the factors influencing reisdents‘ perceptions. Tourism Management
Perspectives, 16, 335-345.
Sharpley, R. (2014). Host perceptions of tourism: A review of the research. Tourism Management, 42,
37–49.
Sinclair-Maragh, G., &Gursoy, D. (2015). A conceptual model of residents‘ support for tourism
development in developing countries. Tourism Planning & Development, 8316 (October), 1–20.
Pakurar, M., &Olah, J. (2008). Definition of rural tourism and its characteristics in the Northern Great Plain
Region. AnaleleUniversităţii din Oradea, Fascicula: Ecotoxicologie, ZootehnieşiTehnologii de
IndustrieAlimentară, 7, 255-260.
Perdue, R., Long, P., & Allen, L. (1990). Resident support for tourism development. Annals of Tourism
Research 17, 586–599.
Var, T., Kendall, K., &Tarakcioglu, E. (1985). Resident attitudes toward tourists in a Turkish resort town.
Annals of Tourism Research, 12(4), 652-658.
-GP33-
ISU PEMILIKAN DAN PEMAJUAN KE ATAS TANAH PERTANIAN SAWAH PADI
DI KAWASAN MADA. KAJIAN KES : DAERAH KOTA SETAR,
KUBANG PASU DAN YAN
Mohd Syahril Bin Said, Dr. Azlizan Bin Talib, Prof. Dr. Kamarudin Bin Ngah,
Sr. Dr. MohdNazaruddin Bin Yusof, Dr. MohdFitri Bin Abdul Rahman,
211
dan Mat Khalid Bin Md Noh

Pusat Pengajian Kerajaan, Universiti Utara Malaysia
Abstrak
Kertaskerjainimembincangkanisu-isuberkaitanpemilikantanah dan
aktivitipemajuantanahpertaniansawahpadi di kawasan MADA di Negeri Kedah
khususnya di Daerah Kota Setar, Kubang Pasu dan Yan. MADA adalahsebuahagensi
yang telahdipertanggungjawabkanuntukmentadbir, mengurus dan
menyelarasaktivitipertaniansawahpadi dan penghasilanbekalanberas negara di Wilayah
Utara iaitu di Kedah dan Perlis. Bagaimanapun, MADA
tidakmempunyaikuasauntukmemilikitanah, mengawal dan
menghalangsekiranyaterdapattanah-tanahsawahpadi di kawasanpentadbiran MADA
yang ingindijualataupundimajukan oleh pemiliktanahbagitujuanpembangunanprojek-
projekpembangunanbaharu. Hasil
kajianmendapatiwujudtekananpembangunankeatastanah-tanahpertaniansawahpadi di
bawahpentadbiran MADA dan transaksiubahsyarattanah, pindahhakmiliktanahdan
pemajuanprojek-projekbaharusepertiperumahan, perniagaan dan
institusisemakinmeningkatsetiaptahun. Kajian ini juga telahmengenalpastifaktor-faktor
yang mendorongpemilik-pemiliktanahsawahpadi di bawah MADA
membuatkeputusantanahmerekadijualataupundimajukan oleh pihakpemaju.
Kata kunci : MADA, Tekanan Pembangunan, UbahSyarat Tanah
PENGENALAN
MADA ditubuhkan melalui Parlimen di bawah Akta 70, Akta Lembaga Kemajuan
Pertanian Muda, Tahun 1972. Dibawah Akta tersebut, tugas-tugas MADA telah
digariskan seperti berikut :
i. Memaju, menggalak, membantu dan mengusahakan projek pembangunan ekonomi

dalam Kawasan Muda.
ii. Merancang dan mengusahakan dalam Kawasan Muda apa-apa kemajuan Pertanian
mengikut sebagaimana yang diperuntukkan kepadanya oleh pihak berkuasa negeri
bagi negeri Kedah dan Perlis.
Dua matlamat utama dibentuk oleh MADA, yang diasaskan kepada aspek-aspek
kemanusiaan dan komoditi. Matlamat-matlamat tersebut ialah:
i. Memajukan kesejahteraan hidup sebilangan besar penduduk desa.

ii. Melebihkan hasil untuk keperluan Negara
212
Peranan utama yang dimainkan oleh MADA ialah mendorong, menggerak dan
menyatukan petani-petani ke dalam satu masyarakat yang dinamis dan progresif. MADA
juga adalah agensi yang akan mencetuskan pembangunan pertanian, ekonomi dan
sosial di mana akan sentiasa berlaku proses keperluan serta peluang-peluang baru.
Struktur organisasi MADA telah dibentuk menggabung perkhidmatan-perkhidmatan
pentadbiran, kejuruteraan, pertanian dan latihan ke dalam satu pengurusan yang
fleksibel.
Bagaimanapun peranan dan fungsi MADA adalah hanya tertumpu kepada aspek
perancangan, pentadbiran dan pengurusan kawasan dan tanah pertanian sawah padi,
tetapi MADA tidak mempunyai kuasa dalam konteks perundangan untuk mengawal
sebarang proses transaksi pindah milik, pembangunan dan pemajuan ke atas tanah-
tanah sawah padi oleh pemilik tanah.
KAWASAN MADA
Menerusi konsep Pembangunan Kawasan, Kawasan Muda telah dibahagikan
kepada 27 lokaliti pembangunan yang pengawasannya dikendalikan menerusi pejabat-
pejabat di empat daerah MADA (Rajah 1). Di setiap lokaliti pula didirikan kompleks
geraktani yang juga menjadi pusat gerakan pertubuhan peladang kawasan.
Rajah 1 :Blok Pengairan Kawasan Muda

213
Keluasankeseluruhantanah MADA adalahseluas 130,282 hektar yang

merangkumi Negeri Kedah dan Perlis.
Pecahangunatanahdibahagikankepadasebelaskategori di mana
gunatanahutamanyaialahsawahpadiiaitusebanyak 100,685 hektariaitu77.28 peratus
(MADA, 2017). PecahankategorigunatanahditunjukandalamJadual 1.
Jadual 1 : Kategori Gunatanah MADA

KELUASAN
KATEGORI %
(HEKTAR)
1. Padi 100,685 77.28
2. Perkebunan Campur 9,544 7.33
Sungai, Parit, Taliair dan Jalan-
3. 8,572 6.58
jalan
Bandaran dan Pelbagai
4. 6,387 4.90
Pembangunan
Kawasan Semak, Paya, Tanah
5. 1,976 1.52
yang tidakdiusahakan
6. Getah 1,207 0.93
7. PelbagaiTanamanKekal 779 0.60
8. Kolam-kolamTernakan 446 0.34
9. Kawasan Lombong dan Galian 276 0.21
PelbagaiTanamanJangkaPendek
10. 198 0.15
dan Kontan
11. Lain-lain 212 0.16
JUMLAH 130,282 100.00
Sumber : MADA, 2017
Bilanganpeladangasal MADA mengikut PPK MADA adalahberdasarkan data Skim Baja

Padi Kerajaan Persekutuan (SBPKP) Musim 1/2009. Bilanganpeladangbaru MADA
adalahbilanganpeladangdalam Kawasan Pinggir MADA. Bilanganpeladangterkini MADA
ialahbilanganpeladangasal MADA dan bilanganpeladangbaru MADA yang
merupakanjumlahpeladang MADA yang mengusahakansawah
214
Jadual 2 : Bilangan Peladang MADA

BIL.
BIL. PELADANG BIL. PELADANG
KAWASAN MADA PELADANG
BARU MADA TERKINI MADA
ASAL MADA
Perlis 9,656 524 10,180
Kedah 45,474 1,981 47,455
MADA 55,130 2,505 57,635

Sumber : MADA, 2017
Tekanan Pembangunan dan Pemajuan KeAtasTanah MADA

Merujuk Rajah 2, radius tekanan pembangunan paling kritikal ke atas tanah
sawah padi MADA di Daerah Kota Setar adalah di antara kawasan Hutan Kampung
sehingga keTandop di mana tahap tekanan adalah kurang dari 1 kilometer disebabkan
oleh pembangunan yang telahtepu di kawasan tersebut. Tekananpembangunan
bertahap sederhana keatas tanah sawah padi adalah di antara kawasan Kepala Batas,
Kuala Kedah dan Tandop iaitu dalam radius kurang dari 3 kilometer.
Rajah 2:Tekanan Pembangunan bagi Daerah Kota Setar

215
Tren dan pola pembangunan guna tanah semasa di Daerah Kubang

Pasutertumpu di koridor Lebuhraya Utara-Selatan di antara Changlun keKepala Batas.
Kawasan yang paling terkesan akibat pembangunan adalah di bahagian Barat Pekan
Jitra sehingga ke Pekan Kodiang.
Rajah 3 :Tekanan Pembangunan Bagi Daerah Kubang Pasu
Tren dan pola pembangunan gunatanah semasa di Daerah Yan

tertumpu di antara Pekan Guar Chempedak ke arah Pekan Yan Besar dan dari
Sungai Yan Kecil menghala ke Kuala Kedah. Namun begitu, kawasan yang
paling terkesan akibat pembangunan adalah di kawasan Pekan Yan Besar
dan Pekan Guar Chempedak.
216
Rajah 4 :Tekanan Pembangunan Bagi Daerah Yan
TransaksiUbahSyarat Tanah kawasan MADA untukketiga-

tigadaerahkawasankajianbagitahun 1970 hingga 2015 adalah 2,043.34 ekar (Kota
Setar), 462.03 ekar (Kubang Pasu) dan 150.96 ekar (Yan) daripadakeseluruhan 2,656.6
ekartanahkawasan MADA telahdiubahsyaratkepadapembangunanperumahan, komersil
dan institusi (Jadual 3).
Kehilangantanahpertanianinitelahmemberiimplikasiterhadapaspekkeluasan dan
tekananpembangunantanahsawahpadibagitujuanpembangunanbaru.
Jadual3 :TransaksiUbahSyarat Tanah di Kawasan MADA (2005 – 2015)

Tahun Daerah Kota Daerah Kubang Daerah Jumlah
Setar Pasu Yan
2005 198.30 30.77 5.63 234.7
2006 263.00 44.71 22.00 329.71
2007 184.18 31.97 18.49 234.64
2008 229.82 11.48 10.72 252.02
2009 183.29 2.88 5.37 191.54
2010 150.98 28.58 8.24 187.8
217
2011 166.88 49.17 17.13 233.18
2012 128.44 116.87 25.27 170.58
2013 90.19 6.37 6.96 103.52
2014 254.16 19.65 11.28 285.09
2015 194.10 119.58 19.87 333.55
Sumber : Kajian GeranPenyelidikan NAPREC, 2017
Isu-isuPemajuanKeAtasTanah MADA
PenawaranPembelian Tanah Oleh Pemaju
Analisiskeataspenawaranpembeliantanahmilikpeserta MADA oleh

pihakpemajumenunjukkanterdapataktivitipenawarantersebut
dansebabutamakenapaberlakunyatransaksipenjualantanahiniadalahantaranyaisupemili
kanhartapusakamenimbulkanmasalahkepadapembahagian di kalanganahlikeluarga
(mewakili 54.8 peratus), dan akibatnyamendesakpemilikuntukmenjualtanahmereka.
Usaha pertanian di atastanahini juga menjaditidakekonomik. 21.1
peratuspemiliktanahmenerimatawaranpembelianiniatasdasarmemperolehipendapatanut
ama, 13.7 peratuspemiliktanahmenerimatawaranatassebabtawaranharga yang tinggi
oleh pembeliataupemajudan selebihnyaatasalasantanah yang tidaklagisubur.
Jadual4 :AlasanMenerimaTawaranPembelian Tanah

SebabMenerima Bil.Responden Peratus (%)
Pusaka 126 54.8
Pendapatan Utama 48 21.1
Harga Mahal 32 13.7
218
Tanah TidakSubur 24 10.4

JUMLAH 230 100
PengambilanBalik Tanah Oleh Kerajaan

BerdasarkanJadual5, 17.6 peratustanahmilikpeserta MADAtelahdiambil oleh
pihakkerajaanuntuktujuanpembangunan.
Sekaligusmenggambarkanbahawapihakkerajaanturutmenjadikantanahpertaniansawahp
adisebagaipilihanuntuktujuanpembangunanbaru.
Jadual5 :PengambilanBalik Tanah Oleh Kerajaan

PengambilanBalik Bil.Responden Peratus (%)
Tanah
Ya 40 17.6
Tidak 190 82.4
JUMLAH 230 100
KesanTrend Pembangunan SemasaDi Kawasan Sekitar
Aktivitipemajuansemasaturutmemberiimpakkeatasnilaitanahmilikpeserta MADA.
Analisismenunjukkan 27.8 peratuspemiliktanahmendapatilokasitanahmerekasesuaidan
strategic dengantrenpembangunansemasakawasansekitarnya, 23.9
peratuspemilikmelihattanahmilikmerekamempunyaipotensibesaruntukdibangunkan.
Manakala 16
peratusrespondenberanggapanaktivitipemajuansemasameningkatkannilaitanahmilikmer
eka.
Jadual6 :KesanAktivitiPemajuanKeAtas Tanah
KesanAktivitiPemajuan Bil.Responden Peratus (%)
Meningkatkan Nilai 37 16
Tanah BerpotensiTujuan 55 23.9
Pembangunan
MeningkatkanPermintaan 52 22.6
Lokasi Tanah Strategik 64 27.8
TiadaKesan 22 9.7
JUMLAH 230 100
219
Kesimpulan
Secarakeseluruhannya,
analisismenunjukkanwujudnyatekananpembangunankeatastanahMADA
(tanahsawahpadi) yang begituketara di ketiga-tigadaerahkawasankajian,
terutamanyasepanjangkoridor Lebuhraya Utara-Selatan sertajalan-jalanutama yang
merangkumi radius pembangunan di antara 1 sehingga 5 kilometer.
StatistiktransaksiUbahSyarat Tanah di ketiga-tigadaerah juga
semakinmeningkatsetiaptahunmenunjukkanaktivitipemajuan dan
pembangunankeatastanahsawahpadisemakinmeluas.
Selainitu, faktor-faktorsepertitawaranpembeliantanahdenganharga yang tinggi,
peningkatannilaitanah, pengambilantanah oleh pihakkerajaanbagitujuanpembangunan
dan konflikpengurusanhartapusakamendorongpemiliktanahataupunpeserta MADA
menjualtanahmereka. Justeru, pernilaiansemulakeatasperanan dan
pengukuhanbidangkuasa MADA
khususnyadalamaspekkawalanpembangunanharuslahdilakukansegerasupayaagensiber
kenaanmampuuntukmeminimumkanaktivitipemajuankeatastanah-
tanahpertaniansawahpadi di Negeri Kedah dan
Perlissertadapatmengoptimumkankebajikan dan keuntunganpemilik-
pemiliktanahpeserta MADA di sampingmengekalkanprospekpengeluaranberas di
negara ini.
Rujukan
Azlizan Talib, et All. (2018). Tekanan dan Kawalan Pembangunan Kawasan Pertanian dan
Tanah SimpananMelayu Di Negeri Kedah. ImplikasiKeAtas Pembangunan Perumahan
dan KomunitiPetani di Kawasan MADA. LaporanAkhirGeranPenyelidikan NAPREC.
Putrajaya :InstitutPernilaian Negara.
KamarudinNgah. (1993). Peraturan dan KawalanGuna Tanah Bandar. Kuala Lumpur : Dewan
Bahasa dan Pustaka.
Keith Thomas. (2004). Development Control-Principles and Practice. Routledge, London.
Kementerian Tanah dan Pembangunan Koperasi. (2008). Tanah RizabMelayu di Semenanjung

Malaysia. http://www.nre.gov.my [13 Mei 2017].
MADA. (2017). StatistikPentadbiran MADA. AlorSetar : Lembaga KemajuanPertanian Muda
RancanganStruktur Negeri Kedah 2020
RancanganTempatan Daerah Kota Setar 2020
RancanganTempatan Daerah Kubang Pasu 2020
RancanganTempatan Daerah Yan 2006-2020
220
-GP34-
LEVERAGING ON TRADITIONAL KNOWLEDGE AND COMPLEMENTARY
MEDICINE IN LAW FROM THE PERSPECTIVE OF DEVELOPING COUNTRIES
Al Hanisham Mohd Khalid*, Dr.YuhanifYusof, Mazita Mohamed

Noor’ Aza Ahmad, dan Nor Hayati Abdul Samat
School of Law
College of Law Government and International Studies
06010 Sintok, Kedah
e-mail: hanisham@uum.edu.my*
Abstract
The world today has evolved into more sophisticated society; however there are certain
issues which still unsettled by the international community. For example issues on traditional
knowledge has caused international debate - to certain point of view the term itself already
create contentious perspectives and occasionally being perceived as something is relic and
backwards. On the hands, undeniably that traditional knowledge has made major contributions
in our daily life and perhaps traditional knowledge may contribute in developing the modern
technology that we are using today.
On contrary, our societies already acknowledged and accept western science
nowadays. Thus, the western science always being referred in any matters, i.e. preferred in
term of methods and scientific ideas since the rise of western civilisation. Nonetheless, the
existing of other kind of knowledge cannot be denied, even though traditional knowledge may
not be able to fit into western concepts but if the gap could be reduce between these two
knowledge, the possible could be benefitted to the present and future generations.
Alternatively, traditional knowledge and complementary medicine (CAM) is a promising
field to be developed as cohabitation between western science and traditional knowledge.
Moreover, developing countries are rich with natural resources, as CAM may beneficially from
society development and economic development of the country. Before CAM could successfully
being implemented some issues need to be tackled, for example in area of law development.
This paper will focus prospects and challenges in introducing CAM. By selecting Malaysia as
case study, this paper will examine overview challenges which will introduce by the government
as part of its approach for traditional knowledge preservation and the benefits for local
communities.
Key Words: Traditional knowledge, Complimentary Alternative Medicine, Intellectual Property

Rights, Local Communities, Malaysia.
INTRODUCTION
Traditional knowledge and complementary medicine (TCAM) has been around the
developing countries and the usage has been increased lately.According to The World Health
Organisation (WHO) the population of countries that applied TCAM was estimated at around
221
80% out of developing countries.13Therefore, it seems clear that despite its inadequacies, the
contribution of it as the foundation of primary health care has been acknowledged nationwide.
There are many opinions when it comes to the definitions of traditional knowledge since there
are many theories and beliefs involving experience and cultures that influence the
understanding of it. However, relying on definition of traditional knowledge as described by
WHO is as follows;
‗sum total of the knowledge, skills and practices based on the theories, beliefs
and experiences indigenous to different cultures, whether explicable or not, used
in the maintenance of health, as well as in the prevention, diagnosis,
improvement or treatment of physical and mental illnesses‘14
In addition, the terms are frequently used interchangeably when being applied which
referring to a broad set of health care which are not part of country‘s own and not integrated into
primary health care system. From the perspective of Malaysia as a developing country, it
comprises of multicultural society with three major ethnic groups; Malays, Chinese, Indians and
Bumiputras (son of soil) who live and work together in peace and harmony for many decades.
Thus, Malaysia is characterized as a country that utilizes TCAM as part of main healthcare
alongside with modern medicines15. The influence of various ethnicities among the
communities16 in Malaysia has produce a significant impact on the usage of TCAM as
alternative or complementary medicine to help cure diseases that are unable to be cured by
modern medicines17. Hence, undeniably there is high interest of TCAM in developing countries
and specifically in Malaysia.18
This paper aims at highlighting the usage of TCAM in developing specifically in Malaysia
aligned with the WHO Traditional Medicine Strategy 2014-2023. It will explores the usage of
TCAM by looking at several perspectives including distribution of users, intention to use and
challenges faced by regulatory bodies in implementing TCAM. This paper contributes by giving
some suggestions and recommendations based on study being conducted by previous
13
World Health Organisation, Legal Status of Traditional Medicine and Complementary/Alternative Medicine, a
Worldwide Review (Geneva: WHO, 2001), WHO/EDM/TRM/2001.2;2001. See also Bannerman R.H., Traditional
Medicine and Healthcare Coverage (Geneva: WHO ,1983).
14
World Health Organisation, General Guidelines for Methodologies on Research and Evaluation of Traditional
Medicine (Geneva: WHO , 2000), 1
15
H.K. Heggenhougen, ‘Bomohs, Doctors and Sinsehs – Medical Pluralism in Malaysia’, Social Science & Medical.
Vol. 14B, (1980): 236.
16
Approximately 70 percent Malaysian used complementary medicine see Lee Yuk Peng, Izatun Shari, TehEng
Hock and Yuen Meikeng, ‘70% of Malaysians have used alternative medicine’ Thestar, 23 November 2010,
[Parliament Section], Viewed 1 March 2011,
<http://thestar.com.my/news/story.asp?file=/2010/11/23/parliament/7482825&sec=parliament>
17
There are also other ethnics and TKCM practices but all these are outside the discussion of the paper. The Malay,
Chinese, Indian practices mentioned as an example of these non-scientifically based medical treatments available in
Malaysia.
18
Mohd Ismail Merican, ‘Traditional Complementary Medicine: the Way Ahead’, Medical Journal Malaysia, 57(3)
(2002):1–4
222
researchers such Z.M. Sitiet al,19 M. Ramesh,20NorchayaTalib,21Kamil M. Ariff and Khoo S.

Beng,22 Mohd. Ismail Mericanet a23 and to namely few otherson various strategies to adopt in
the future for TCAM users, policy makers and stakeholders.
OVERVIEW OF TCAM IN MALAYSIA
The Institute for Public Health, National Institute of Health, Malaysia Ministry Of Health in
2015 has conducted a national health and morbidity survey 2015(NHMS 2015) which include a
total of 7982 respondents. The survey uses questionnaires to collect the data and the
demographic details of users involved with TCAM as depicted in Figure 1.
1142
1200
1000
800 678 631

532 567 551 526
600 456 453 487 477 476 465
400 332
209
200
Figure1: Users of TCAM general demographics distribution arranged according to states in

Malaysia
Source: Adapted from theNational Health and Morbidity Survey 2015 (NHMS 2015)
Figure 1 shows the distribution on TCAM users arranged according to states in Malaysia. It
is clearly shown that the state of Selangor has the highest number of users (1142) followed by
19
Z.M. Siti et al., ‗Use of Traditional and Complementary Medicine in Malaysia: A Baseline Study‘, Journal
Complementary Therapies in Medicine, 17 (2009): 292-299
20
M. Ramesh, ‗Malaysia Health Policy in Comparative Policy‘ in Health Care in Malaysia; the dynamic of
provision, financing and access, eds. Chee HengLeng& Simon Barraclough ( NewYork: Routledge,
2007), 71-84.
21
NorchayaTalib, ‗Alternative, Complementary and Traditional Medicine in Malaysia‘, Journal Medicine
and Law Vol. 25(3) (2006):445-462.
22
Kamil M. Ariff and Khoo S. Beng, ‗Cultural Health Belief in a Rural Family Practice: A Malaysian
Perspective‘ Australia Journal Rural Health 14 (2006):3-5
23
Mohd Ismail Merican et al., ‗Managing the Growth of Health Care Expenditure in an Affordable and
Sustainable Health System‘, Malaysia Journal of Public Health Medicine, Vol. 3(1) (2003):1-10
223
the state of Johor (678) and Sabah & Labuan (631). Arguably Kuala Lumpur and Putrajaya
recorded the lowest number of users, they are not considered separately (i.e.: federal territory)
but instead should be considered as single state. Thus, the state of Melaka (453) and Kelantan
(456) should be regarded among the state with the lowest number of TCAM users. By looking at
this statistics, it supports the upcoming Figure 2 which reveals that users are mostly from the
urban area compared to the rural.
Figure2: Comparison between Urban & Rural Area of Users of TCAM in Malaysia
Source: Adapted from the National Health and Morbidity Survey 2015 (NHMS 2015)
PROSPECT OF TCAM IMPLEMENTATION IN MALAYSIA
Historically, since the beginning of trading routes in Malacca straits, Indian and Chinese
traders and migrants;they not only bring goods but also traditional knowledge (i.e. TCAM). The
TCAM usually accompanied the local medical system in Malaysia but did not substitute it.
However, major changes occur in traditional medical system since the introduction of Islamic
religion by Arabs and Indians – Muslim which include narration of verse from the Holy Quran
during treatment. Therefore diversity of population in Malaysia has reflected assortment medical
system which origin from Malay, Chinese, Indian and indigenous heritage.
When it comes to TCAM usage, the National Health and Morbidity Survey 2015 revealed
that users seek TCAM for several purposes. For example, majority of its users are treating
TCAM as complementary treatment. On the other hand, quite equivalent portion of percentage
(40.44%) are actually treating TCAM as primary treatment while only 18.38% uses TCAM as
alternative medicine. This survey result shows that there are good prospect of TCAM among
Malaysian due to TCAM is less expensive compared to modern medicines.
224
Figure3: The Intention to Use TCAM practices

The survey proceeds to describe further the usage of TCAM by looking into several of its
types. Figure 4 illustrates the usage of TCAM arranged according to various use practices.
5% 2% 1%
7% Traditional Malay Medicine
Traditonal Chinese Medicine
Complimentary Medicine
24% Islamic Medicinal Practise
61%
Hemopathy
Traditional Indian Medicine
Figure 4: The Usage Of TCAM Arranged According To Various Use Practices.

Based on Figure 4, the highest use practice is from the traditional Malay medicine
(52.1%). This is due to the Malay medical practice can be traced from Indonesia and these
practise is highly accepted among Malay especially in a rural area. These medical practises
depend upon observation and hands-on knowledge which normally pass from generation to
generation through orally or in writing form of knowledge. Treatment will be performed to patient
depending on medicine practitioner, as one or more combination of treatments may be used.
For example treatment may include enumerating charm over water, administering usage of
herbs (i.e. which is applying to externally or internally), perform special bath and giving amulets.
The second biggest number is the traditional Chinese medicine(24%). Meanwhile, Chinese
traditional medicine gains it popularity since the British introduce Chinese migrant in tin mining
sector. These migrants also contributed by bringing herbal medicine and other forms of
medicine practise such as acupuncture. Sinsehis Chinese medical practitioner and hold high
social status due to their knowledge and experience in Chinese herbal medicine.24 Currently,
24
NorchayaTalib, ‗Traditional Medicine in Malaysia‘, 3-4.
225
traditional Chinese can be obtained in nationwide rather in mining estate previously. 25The
lowest percentage of use practice goes to traditional Indian medicine. The traditional Indian
medicine is not something new, before the introduction of Islam in Malaysia, majority of
Malaysian adopted Hinduism as part of practise. Hence, ayurveda and other Indian traditional
medical knowledge are accepted in Malaysia. Indian traditional medical system comprises
usage of plants, animal origins and other mineral usage.26Generally it can be implied that TKCM
system in Malaysia is being accepted by local communities as part of their culture. TKCM
system may include bonesetters, traditional birth attendants, traditional medicine practitioners,
spiritualists, and others who may use home remedies. Other medical alternative medicine such
as homeopathy, naturopathy, reflexology, aromatherapy, and chiropractic is also can be
considered part of TKCM.
CHALLENGES OF TCAM IMPLEMENTATION
It is widely known that WHO is responsible in managing health related issues worldwide.
Western scientific and TCAM are two epistemological health‘s path view, integrated by WHO.
Based on WHO‘s constitution specifically mentioned health as ―state of complete physical,
mental and social well-being and not merely the absence of disease or infirmity.”27 Furthermore,
biomedical and psychosocial concept is part of the impression of health and this concept usually
associated to modern medicine and TCAM in dealing with health and sickness.Despite TCAM
has a lot of prospects, it comes together with challenges as well ahead of its
implementation.Figure 5 shows the challenges faced by member states in implementing TCAM.
The top figure to represent the challenges is on lacking of research data (105 states), followed
by lack of mechanism to control and regulate TCAM advertising and claims (83 states).
Meanwhile the lowest is mainly on lacking of education and training for TCAM providers (58
states) and lack of mechanisms to monitor safety of TCAM related products (60 states).
Although WHO adopt a doctrine of pluralism in health but this institution is unable to achieved
any international provision or legal framework that authorise and control TCAM practises.
Furthermore, it is complex to explain how such a situation could occur since WHO has the
authority to govern and initiate legally treaty, agreements and convention pertaining to
international public health.
25
Leslie C.M., ‗Pluralism and integration in The Indian and Chinese Medical Systems‘, in Culture, Disease
and Healing – Medical Anthropology, ed. Landy D. (New York: MacMillan, 1977), 511-517.
26
Colley F.C., ‗Traditional Indian Medicine in Malaysia‘,Journal Malaysian Branch of the Royal Asiatic
Society.51(233) (1978):77-109.
27
See World Health Organisation, Preamble to ‗The Constitution of The Worlds Health Organisation‟, 100
and NorchayaTalib, ‗Traditional Medicine in Malaysia‘, 445-462
226
Figure 5: Challenges faced by Member States in Implementing TCAM

Source: Adaptation on Interim data from 2nd WHO TRM global survey 2012
A large numbers of scholars admit that WHO has less effectively apply its legal potential
in international law and public health field.28 Therefore, as a result there is no comprehensive
international public health policy or convention pertaining to TCAM. On the other hands,
conventional (i.e. Western medicine) gaining status quo and continued to be privileged, while
other health systems are regarded as unconventional.29
CONCLUSION
In summary, regardless whatever the status quo outcome of WHO policy,this already impacted
all its members including developing countries particularly Malaysia. The TCAMwill be persisting
to exist and being use among indigenous and local communities as their source of health care.
Whether this is approved by government policy or not TCAM will remain as socio-cultural
characteristic of indigenous and local communities.i The next section will touch on TCAM on
local perspective particularly Malaysia. The discussion relates TCAMpractices, policy or state
practises officially recognising TCAMpractise. Also included in the section, is the historical
context of TCAM development which is on next section – local perspective.
Acknowledgement
Authors would like to thank several colleagues who have made this paper possible namely
Assoc. Prof. Dr RohaidaNordin and Assoc. Prof Dr. Shafinaz Hussain for whom without their
knowledge sharing and positive feedbacks this paper will not be produced.
28
Until very recently, WHO had been isolated from developments in international law since 1945.
According to Fidler, WHO deliberately limited itself to a ‗transnational Hippocratic society made up of
physicians, medical scientists and public health expert,‘ while undermining the important of legal strategy
in the implementation of its mandate. See David P. Fidler, ‗International Law and Global Public Health‘,
48 University of Kansas Law Review, 1(1999):15
29
Micheal A. Attisso, ‗Pharmacology and Phsyhotheraphy,‘ in,Traditional Medicine and Health Care
Coverage: A Reader for Health Administrators and Practitioners, eds.Jan Stepan in Robert H.
Bannerman, John Burton, and Ch‘en Wen-Chieh(Geneva: World Health Organisation, 1983), 196.
227
REFERENCES
_______, Act 436 of Malaysia Midwife Act 1966.In Law of Malaysia [as amendments up to 1
January 2006], Kuala Lumpur; PercetakkanNasionalBerhad, 2006.
_______, Act 50 of Malaysia Medical Act 1971. In Laws of Malaysia, [as amendments up to 1
January 2006], Kuala Lumpur: PercetakkanNasionalBerhad, 2006.
Bannerman R.H., Traditional Medicine and Healthcare Coverage. Geneva: WHO, 1983.
Charles M. Good, Ethno medical System in Africa: Patterns of Traditional Medicine in Rural and
Urban Kenya. New York: The Guildford Press, 1987.
Colley F.C., ‗Traditional Indian Medicine in Malaysia‘,Journal Malaysian Branch of the Royal
Asiatic Society.51(233) (1978):77-109.
David P. Fidler, ‗International Law and Global Public Health‘, 48 University of Kansas Law
Review, 1(1999):15.
H.K. Heggenhougen, ‗Bomohs, Doctors and Sinsehs – Medical Pluralism in Malaysia‘.Social
Science & Medical. Vol. 14B, (1980): 236.
Halfdan Mahler. Foreword to Traditional Medicine and Health Care Coverage: A Reader for
Health Administrators and Practitioners, edited by Robert H. Bannerman, John Burton,
and Ch‘en Wen-Chieh, 7, Geneva: World Health Organisation, 1983.
Jan Stepan,. In Traditional Medicine and Health Care Coverage: A Reader for Health
Administrators and Practitioners, edited by Robert H. Bannerman, John Burton, and
Ch‘en Wen-Chieh, 295-308. Geneva: World Health Organisation, 1983.
Kamil M. Ariff and Khoo S. Beng, ‗Cultural Health Belief in a Rural Family Practice: A Malaysian
Perspective‘ Australia Journal Rural Health 14 (2006):3-5.
Lee Yuk Peng, Izatun Shari, TehEng Hock and Yuen Meikeng, ‗70% of Malaysians have used
alternative medicine‘ Thestar, 23 November 2010, [Parliament Section], Viewed 1 March
2011, .
Leslie C.M., ‗Pluralism and integration in The Indian and Chinese Medical Systems‘. In Culture,
Disease and Healing – Medical Anthropology, edited by Landy D. 511-517. New York:
MacMillan, 1977.
M. Ramesh, ‗Malaysia Health Policy in Comparative Policy‘ in Health Care in Malaysia; the
dynamic of provision, financing and access, eds. Chee HengLeng& Simon Barraclough (
NewYork: Routledge, 2007), 71-84.
Maria Safura Mohamad. ‗T&CM INFO‘, Buletin BPTK@KKM, 7, Kuala Lumpur; Ministry of
Health Malaysia, 2010.Micheal A. Attisso, ‗Pharmacology and Phsyhotheraphy‘. In
Traditional Medicine and Health Care Coverage: A Reader for Health Administrators and
Practitioners, edited by Robert H. Bannerman, John Burton, and Ch‘en Wen-Chieh, 196.
Geneva: World Health Organisation, 1983.
Mohd Ismail Merican et al., ‗Managing the Growth of Health Care Expenditure in an Affordable
and Sustainable Health System‘, Malaysia Journal of Public Health Medicine, Vol. 3(1)
(2003):1-10.
Mohd Ismail Merican, ‗Traditional Complementary Medicine: the Way Ahead‘, Medical Journal
Malaysia, 57(3) (2002):1– 4.
Mohd. Ismail Merican et al, ‗Managing the growth health care expenditure in an affordable and
sustainable health system‘, Malaysia Journal of Public Health Medicine, 3(1) (2003): 2-3.
228
NorchayaTalib, ‗Alternative, Complementary and Traditional Medicine in Malaysia‘, Journal

Medicine and Law Vol. 25(3) (2006):445-462.
Paul C. Y. Chen, Traditional and Modern Medicine in Malaysia in Social Science Medicine, vol.
15A (1983):127-136. R. Shahperi. ‗Annual Budgeting Statisitic.‘Buletin BPTK@KKM, 6,
Kuala Lumpur: Ministry of Health Malaysia, 2009.
SankaraSubramaniam, ‗Alternative Medicine Gaining Ground in Malaysia‘, Bernama, 04
January, Viewed 1 March 2011.
Syed Shahzad Hassan et al, ‗Use of complementary and alternative medicine among patient
with chronic diseases at outpatient clinics‘Complementary Therapies in Clinical Practices
15 (2009):152-157
-GP35-
The Impact of Education Policy on Girl Child Enrolment and Retention in school:
Case Study of Northern Nigeria
Ja’afar Abdulkadir, abdulrkah@gmail.com,

Department of Sociology, Kaduna State University, Kaduna, Nigeria
Nur Syakiran Akmail bt. Ismail, nsai@uum.edu.my,
School of Government,University Utara Malaysia
Abstract
Educating girls is fundamental to the development of society. Although many significant
efforts by the international community, gender disparity in education continues to exist,
especially in developing countries. Hence, this study explored the impact of education policy on
the enrollment and retention of the girl child in school. Related literature was reviewed, and the
policy cycle theory was also adopted for the study. Epistemological interpretivism and semi-
structured interview under qualitative method were employed in conducting the research.
Purposive sampling was used to select the informants for the study. The data were analyzed,
using thematic analysis, and supported by Nvivo 12 software. The findings reveal that the
constitution of the Federal Republic of Nigeria 1999 (as amended) has specifically stipulated the
responsibility of government to provide free, basic and compulsory education to all children, but
the peculiarity of girl child was not considered. Perhaps, the inconsistency of the policy couple
with lack of monitoring in the process of implementation and other problems, have made the
policy only on paper. The study, therefore, recommends that girl child education should be
made accessible at all levels, to provide scholarship to the less privilege girl child, and to
empower the youth and women. The sensitisation strategies should be more effective with the
collaboration of all education stakeholders on the importance of girl child education for the
national development.
Keywords. Education Policy, Girl Child education, Gender disparity
1.1 INTRODUCTION
Education is the process of providing the information to an individual to help him/her
develop mentally, physically, socially, economically, politically, spiritually and emotionally
229
(Grace, 2015). It is a means that a person acquires adequate skills, knowledge, attitude and
values, which makes him/her to effectively functions in the society (A & Etumabo, 2016).
The status of a woman could only improve with education as the important foundation.
Education has been identified as a fundamental strategy for a socials‘ development (Nmadu et
al., 2010). As was stressed by the World Bank that there is no effective investment for realising
the development goals than girl‘s education. This was supported by the adage says ―educate a
man, you educate an individual, but educate a woman, you educate a nation‖ Kofi Anan.
Therefore, the Federal Republic of Nigerian constitution1999, Section 18 clearly
stipulated that ―the government of every state of the federation shall as and when practicable,
make basic education free and accessible to every Nigerian citizen‖ (Sec. 18, 1999, the Federal
Constitution). similarly, Sec. (2) of the same Nigerian constitution states that ―every government
in Nigeria should provide free, compulsory and universal basic education for every child of
primary and junior secondary school age. The Government in this context refers to the thirty-six
states government of the federation‖ (Sec. 2 (1) free and compulsory UBE Act).
Furthermore, the rights of a child recognize in the convention that ―State parties shall
respect and ensure the rights set forth in the present Convention to each child within their
jurisdiction without discrimination of any kind, irrespective of the child‘s or his or her parent‘s or
legal guardians, race - colour, sex, language, religion, political or another opinion, national,
ethnic or social origin, property, disability, birth or status‖ (Beijing platform for action
1995(Huzeru, 2012).
Furthermore, the Universal Basic Education (UBE) departed from the previous education
policy (UPE) in some few ways. Firstly, ―the school attendance is compulsory. Categorically, it
specified that all the levels of government must provide the children with compulsory, free and
universal basic education for complete nine years, that is six years for primary and three years
junior secondary school‖ (Akinola, 2009)). Secondly, ―the parents must register their wards or
children to ensure they complete the schools' basic cycle of education‖. Thirdly, ―that there are
penalties forwards for parents who fail to comply with the law‖ (Kazeem, Jensen, & Stokes,
2018).
Despite the target placed on the educational system, there are many challenging and
contentious issues governing the sector—one of which, according to Bolaji, Gray, & Campbell-
Evans, (2015), has to do with the question of ineffectiveness in attaining education policy aims
since 1842 in Nigeria. Though, the challenges continue to manifest in the process of amending
policies on education due to rigid bureaucratic processes towards executing the educational
policies (Stephen Dele Bolaji, 2014). The processes continue in the phases of Nigerian
educational system, ranging from the colonial era, independent period and passes several
administrations (civilians and military) to the ushering of the democratic dispensation 1999 to
date, all yield the same result (Bolaji, 2014; ,Alabi & Alabi, 2014).
It obvious from the previous researches that ―the enrolment of girls needs more than a
cursory and half-hearted approach in developing countries such as Nigeria‖ (Abdul, 2003). This
is premised on the fact that ―women should be able partners with the men and optimal national
development cannot be achieved without the input of the women in the society‖. Despite their
equal access to education in the country with boys, the policies have not made any peculiar
provision for them (Olukayode & Ph, 2015)). In the light of the above, this study focuses on the
impact of education policy on girl child enrolment and retention in schools in Kaduna, Nigeria.
1.2 LITERATURE REVIEW
230
Education serves as a tool that people use to attain the level of l freedom or liberty that
essential useful they feel is, (Dondieu, 2010) as well as achieving basic levels of knowledge
achievement which serve as a beneficial key to the better development of education. According
to Curzon (1996) cited in Huzeru, (2013), ―education is generally concerned related to the
beliefs and moral standards accumulate knowledge and skills, as an investment in human
capital and the nurture of human‘s personality‖. This implies that education is a process of
learning and is recognized as a societal way of life which need to be learned.
While, education policy is the outcome of a collection of the conceptual perspectives about a
group of people, nation or society, organizations, including political parties, civil servants,
politicians, businesses, pressure groups, trade unions and international organizations (Burton,
1992). Hence, (Stephen Dele Bolaji, 2014), views that ―any procedures in designing a policy
require a series of stages through conceptualization, start-up, and evaluation, which revolves
around social issues‖ .
The population that is qualified as ―Girl child‖ emerged as a new concept in the last two
decades. The Feminists Scholars initiated in the early 1980s, in response to ―the increasing
acknowledgment of the ways in which girls encounter discrimination and exploitation, coupled
with the growing tendency as commercial sexual oppression, forced marriage, and female
genital mutilation‖ (Wareing, 2007). Which serves as the earliest to make use of the concept Girl
child, to differentiate woman or female victims of domestic labour, rape and others from prior
nondescript children. Girl child education is the process through which the female children
between the age of (0 to 18) years attend good schools and acquire good standard or quality
education in an enabling environment.(Elmore, 1990).
1.3 METHODS
The study used in-depth interviews (semi-structured) under the qualitative method of data
collection. Because, qualitative research encourages active participation between the
researcher and the informants‘ in the study and to develop high level of confidence about the
informants and the study‘s site (Denzin & Lincoln 2005; 2011, Creswell, 2012; 2014). Literature
was reviewed that are relevant to the study serves as a secondary source used. The research
informants (twelve) were selected by the used of purposive sampling. However, thematic
analysis and supported by Nvivo 12 software were used in analysing the data collected from the
informants in the study.
1.4 FINDINGS AND DISCUSSIONS
The emergence theme in the study analysis, was categorised into further subthemes in
accordance with the understanding and experiences of the informants on the social
phenomenon under study. The impacts of cultural practices on girl child education as the main
theme, follows by Poverty, Early marriage and patriarchy system as subthemes in the study.
Therefore, below is the figure extracted from Nvivo 12 software.
231
Figure.1.1. The main theme and subthemes on the effect of education policy on girl child
enrolment and retention in school
The effect of education policy on girl child enrolment and retention in school
The education policy under Universal Basic Education (UBE) categorically compels the
government at three levels in Nigeria to provide, ―compulsory, free, universal basic education for
every child of primary and junior secondary school age. All the services to be provided shall be
free in the public primary and secondary schools‖ (UBE, 2004). Bus this goes in contrary with
the numerous views of the informants who indicated that most of the problems that affects the
enrolment and retention of the girl child in school lies in the structure and nature of the
education policies which are determined by the existing government. According to some of the
informants who lamented that the major issue of policy in education is any new government will
discard the previous policy and start a new one without full implementation. While, as one of the
informants reveals that;
“We witnessed frequent revisions of policies most especially in education,
before one is fully implemented another one comes by different government.
232
The major issue is that any new government will discards the previous policy
and start a new one without fully implemented. The actually has a multiplier
effects on the continuity in the educational policy in the country” (Inf two).
Further by another informant observes that on the policy issues that some factors are
not put into considerations when it comes to policy making and implementation, like the issue of
religious differences, as;
“One of the challenges faced in education policy is that the policy does not in
any way consider the nature and tradition of people in the process of
formulating or making policies. Take for example, in curriculum in the primary
and secondary schools, in my own view, the exceptional and uniqueness of
girl child are not captured (Inf ten).
However, this has been in line with the literature reviewed that the primary and junior
secondary education in Africa has been a historical phenomenon. Education policy faced
problems of continuous educational quality, access, equity and relevance, especially for girl
child. This is because the system of education was inherited from colonial masters (MacJessie-
Mbewe, 2004). This has some consequences on the present stage of the girl child enrolment in
Northern Nigeria.
1.1.1 The Provision of Scholarship to the Less Privilege Girls

In the study conducted most of the informants lamented on their background of extreme
poverty and the need for government, individuals or Non-governmental organisation, to support
the girl child‘s education in terms of giving them grant or scholarship. Because for the population
called ―girl child‖ to be sponsored for their education, the family have no resources to support
them educationally, which became a major setback for their education.One of the informants
pointed out some of the reasons why girl child required scholarship for her education by
highlighting some of the significance of her education to the development of society, that;
“Girl child needs support for her education, mostly for those that from poor families.
Because girl‟s education spurs exponential positive effects on the social and economic
development for generation to come. Added that; “her education will contribute
significantly to the development of a stable, prosperous and healthy nation, productive
and empowered “(Inf five).
According to one of the dropout victims who lamented and appealed to the government
to come to her aids to sponsor her education, as she points out that children from well to do
families are always going to school which she is at home always and not happy for her being
home, that:
“if government or any person can take care of my education I will go back to school, because I
am not happy for not going to school while my friend from well to do families are going to school
every day” and added “please government should come to our aids by sponsoring my
education, I want to go back to school but my parent do not have money to pay school fee,
please” (Inf fourteen).
Further in support of the findings, the literature has reveals that the value of girl child
education can be enhancing by motivation and payoff strategy. The parents and even the girl
child need to see and believe that her education if acquired can lead to a job and an income
(Rihani & Academy for Educational Development DC., 2006)(Rihani & Academy for
Educational Development DC., 2006). The rural children are those that need educational
support to the highest level of education. The most effective strategy to encourage girl child
233
education is through awarding scholarship to the less privileged girl, most specifically at the
early stage or level of her education. It would serve to support those that cannot afford and at
the same time to attract them to attend the schools to the completion level (Kilwake, 2014).
Monitoring
One of the fundamental area of concern in the enrolment and retention of girl child in
school is monitoring. According to the education policy section 9 (B) of Universal Basic
Education (UBE) Act of 2004, has empowered the commission to audit and examine the
financial records of State Universal Basic Education Board (SUBEB) and equally by checking
the receipts and expenditure of the accessed Federal- UBE intervention fund (UBE, 2012).
While the legislative arm of government at the state and federal levels are responsible for
monitoring the activities of executive arms of government with the education sector is inclusive.
But one of the informants observed that:
“Monitoring the execution or implementation of education policy on girl child enrolment
and retention is the responsibility of the house of assemble and national assemblies,
but unfortunately, they are not doing their work as designed in the constitution. Some of
the problems in monitoring are the issue of releasing fund from the government for the
officials to visit various schools frequently and lack of dedication and commitment to
the work by the government officials” (Inf2 ).
However, this indicates that ineffective monitoring system by the legislative arms of
government resulted to the poor education performance and for its poor commitment. While,
weak monitoring system affects check and balance in the education sector, because, most of
the education supervisors of inspectors are not coming to check the situation of the schools as
scheduled, rather they always concentrate in administrative works. Though, as one of the
informants reveals on how the government are not providing all necessary facilities for day to
day activities in the school, that;
“Whenever we requested for some things needed in the school, they complaints always
that the incentives to go for monitoring is not available, frankly speaking, it is affects
day to day activities in the school. Not even to talk about the vehicles and how to fuel
them for the inspection is another problem. My thinking is that the high rank
management staff used to divert the money for their personal interest and this the real
corruption in the sector” (Inf5).
Based on the informant‘s views, it is revealed that one of the major problems which need
urgent attention that affect primary and junior secondary level of education in education system
is weak monitoring to enhance free and compulsory education for the children in the study area.
They informants collectively appealed to the government NGO‘s, companies, and individuals to
sponsor the education of girls in the study area, most specifically among the poor families.
According toUche S. Anaduaka, (2013) ―only through monitoring/evaluation that the
effectiveness of an educational policy can be measured. He added that the poor implementation
of education policy curriculum process in Nigeria consists of three stages – what is intended,
implemented and what is learn or attained. That the only possible ways to achieve any
educational policy is by regular curriculum reform and organising training for teachers to
equipped them with required skills to implement the intended curriculum‖.
Furthermore, to suggest on the right thing to do, to make sure of effective monitoring,
Uche S. Anaduaka, (2013) opined that ―there should be a regular and effective monitoring and
evaluation to ensure the system does not in any way deviate from the set objectives. That
government has not shown a commitment in the implementation of education policy (Bolaji,
2014), there has been ineffective monitoring in Nigeria (Stephen D Bolaji et al., 2015). While
234
Uche (2013) attributes the weak monitoring as the major cause of the problem that affects
education policy.
However, other informants in the study have expressed their views on the obstacles
encountered in the enrolment and retention of girl child in school in relation to education policy,
in respect to, provision of security in their environment, empowered the youth and women,
sensitisation to the public on the importance of girl child education, and imposing sanctions on
any parent who has refuse to send or withdrawn his daughter from school.
1.5 FRAMEWORK
The policy cycle approach as a framework in the study stipulated on the process of policy
executing what the policy mandates, to reach the objectives stated and with the means
highlighted in the policy statutes, and runs through many stages (Cairney, 2013). The main
issue in public policy implementation definition is the question that ―where implementation starts
and what role does it play in the policy process‖? Based on the informants‘ views on the
effective remedy to girl child education, there are challenges in respect of policy initiative and
execution. Therefore, the findings indicate that unless the government becomes more active in
addressing the fundamental issues that are related to the policy processes in formulating and
execution/implementation of the education policy on girl child education in the country at large
the problem will remain.
1.6 CONCLUSION
The policy draft on education in the study area is elegantly drafted as a document but
adhering to the statutes by the authority in charge became ineffective and insufficient. This is
due to lack of constant monitoring and other issues as a strong means in the process of policy
implementation. These have become some greatest challenges facing the enrollment and
retention of girl child in schools. Therefore, there is urgent need to award a scholarship to the
needy girl child as a morale booster which will cover her every need in the school. The
education of girl child is important because its affect the future of every society. Also, as a role
model in the society, women should be educated because they provide younger ones with good
manners and the zeal to seek for knowledge.
REFERENCES
A, B. O. A., & Etumabo, A. G. (2016). The Implications of Girl-Child Education to Nation Building
in the 21st Century in Nigeria, 16(3), 0–4.
Akinola, O. B. (2009). Children ‘ s Rights and Participation in Schools : Exploring the Awareness
Level and Views of Nigerian Primary School, 8(1), 176–182.
Alabi, T., & Alabi, S. O. (2014). The Girl-Child : A Sociological View On The Problems Of Girl-
Child Education In Nigeria, 10(2), 393–409.
Bolaji, S. D. (2014). Intent to Action : Overcoming Barriers to Universal Basic Education Policy
Implementation in Nigeria Intent to Action : Overcoming Barriers to Universal Basic
Education Policy Implementation in Nigeria.
Bolaji, S. D., Gray, J. R., & Campbell-Evans, G. (2015). Why Do Policies Fail in Nigeria? Journal
of Education & Social Policy, 2(5), 57–66.
Burton, A. (1992). ‗history‘ is now: Feminist theory and the production of historical feminisms.
Women‟s History Review, 1(1), 25–39.
Creswell, J. W. (2012). Philosophical, Paradigm, and Interpretive Frameworks. Qualitative
235
Inquiry & Research Design: Choosing Among Five Approaches, (2), 15–34.
Elmore, R. F. (1990). Restructuring schools: The next generation of educational reform.The
Jossey-Bass Education Series.
Huzeru, S. (2012). THE Rolem Of Non Governmenta Organization In Girl Child Education in the
Tolon-Kumbungu District Of The Northern, (July), 1–177.
Kazeem, A., Jensen, L., & Stokes, C. S. (2018). School Attendance in Nigeria : Understanding
the Impact and Intersection of Gender , Urban ‐ Rural Residence , and Socioeconomic
Status International Education Society School Attendance in Nigeria : Understanding the
Impact and Intersection of Gender , Ur, 54(2), 295–319.
Kilwake, J. M. (2014). Effect of Socio-cultural determinants on girl child performance in Kenya
certificate of secondary education in Kenya, the case of Saboti division, Trans-Nzoia
county.
MacJessie-Mbewe, S. (2004). Rural communities-education relationship in developing
countries: The case of Malawi. International Education Journal, 5(3), 308–330.
Nmadu, G., Avidime, S., Oguntunde, O., Dashe, V., Abdukarim, B., & Mandara, M. (2010). Girl
Child Education: Rising to the Challenge. African Journal of Reproductive Health, 14(3),
107–112.
Olukayode, J., & Ph, D. (2015). Gender Disparity in Enrolment into Basic Formal Education in
Nigeria : Implications for National Development, 9(38), 11–23.
Rihani, M. A., & Academy for Educational Development DC., W. (2006). Keeping the Promise:
Five Benefits of Girls‘ Secondary Education. Academy for Educational Development.
Uche S. Anaduaka. (2013). the Universal Basic Education (Ube) Programme in Nigeria: Proble
Ms and Prospects. Jorind Ii, 53(9), 1689–1699.
Wareing, T. L. (2007). Improving Educational Opportunities and Outcomes for Youth in Care
Why Focus on Education ?
-GP39-
Isu-Isu Kawalan Pembangunan di Kawasan Persisiran Pantai,
Pantai Chenang, Langkawi
Kamarudin Ngah1, Zainal Md Zan2, Mohd Syahril Said3, Mohd Fitri Abdul Rahman4,
Azlizan Talib5, Mohd Nazaruddin Yusoff6, Jamaludin Mustafa7dan Ravindra Nath Vyas8
Pusat Pengajian Kerajaan, UUM COLGIS, Universiti Utara Malaysia.
1
Email :kamarudinngah@uum.edu.my
Abstrak
Di Malaysia, aspek Kawalan Perancangan terkandung dalam beberapa bahagian seperti
Bahagian IV Akta Perancangan Bandar dan Desa 1976 (Akta 172). Ia merangkumi perkara
berkaitan kebenaran merancang yang menjadi asas kepada usaha mengatur dan mengawal
pemajuan gunatanah oleh pihak berkuasa perancang tempatan. Namun, kegagalan dalam
merancang, mengatur dan mengawal gunatanah seringkali menjadi persoalan membabitkan
keberkesanan peranan agensi-agensi kerajaan yang diberikan tanggungjawab. Dalam konteks
kajian ini, proses merancang, melaksana dan mengawal pemajuan di kawasan Pantai
Chenang, Langkawi terletak di bahu Lembaga Pembangunan Langkawi (LADA) dan Majlis
Perbandaran Langkawi Bandaraya Pelancongan (MPLBP). Objektif utama kajian ini ialah
menilai signifikan dan kepentingan kawalan pembangunan di kawasan Pantai Chenang,
Langkawi dengan menganalisis isu-isu berkaitan kawalan pembangunan di Pantai Chenang,
Langkawi dalam konteks perancangan fizikal, pembangunan pelancongan dan keselamatan
236
awam/bangunan Hasil kajian mendapati terdapat beberapa isu yang berlaku berkaitan kawalan
pembangunan di Langkawi iaitu ancaman kualiti air laut dan biodiversity, situasi „over capacity‟,
konflik guna tanah, keselamatan pelancong dan bangunan, eksploitasi kawasan pantai dan
aksesibiliti dan sistem sirkulasi. Di akhir bahagian ini, beberapa saranan telah dikemukakan
untuk memperbaiki kawalan pembangunan di kawasan persisiran pantai, Pantai Chenang
secara lebih holistik berteraskan praktis kawalan pembangunan yang lebih dinamik.
Kata Kunci:Perancangan, Kawalan Pembangunan Kawasan Pantai, Pantai Chenang,

Langkawi.
1. PENGENALAN
Idea dan praktis kawalan pembangunan mulai dikesan di United Kingdom sekitar tahun
1990an, dengan merujuk kepada bidang kuasa yang terkandung dalam Town and Country
Planning Acts 1947. Ia menjadi asas kepada perancangan bandar secara lebih sistematik,
dengan mengambil kira pelbagai faktur termasuk aspek sosial, ekonomi, kelas masyarakat,
persekitaran dan tuntutan amalan beragama, sepertimana terbukti dalam perancangan bandar-
bandar lama Greek dan Roman, dan lain-lain bandar di Eropah dan Asia (John Ratcliffe,
Michael Stubbs & Miles Keeping, 2010). Di Malaysia, aspek Kawalan Perancangan telah
dinyatakan dan terkandung dengan jelas dalam Bahagian IV Akta Perancangan Bandar dan
Desa 1976 (Akta 172) yang memperincikan peruntukan-peruntukan perundangan dan
perancangan berkaitan penggunaan tanah dan bangunan (Seksyen 18), larangan terhadap
pemajuan tanpa kebenaran merancang (Seksyen 19) serta larangan terhadap pemajuan yang
berlawanan dengan kebenaran merancang (Seksyen 20). Setiap permohonan untuk kebenaran
merancang perlu dibuat kepada pihak berkuasa perancang tempatan beserta butir-butir,
dokumen-dokumen dan pelan-pelan sepertimana dinyatakan dalam Seksyen 21 (1) hingga (8).
Di bawah Seksyen 21A, setiap permohonan untuk kebenaran merancang perlu dikemukakan
bersama satu Laporan Cadangan Pemajuan (Development Proposal Report) yang
mengandungi butir-butir terperinci tentang konsep dan justifikasi pemajuan, butir-butir pemilikan
tanah, analisis gunatanah, pelan tataur dan lain-lain perkara, termasuk suatu analisis implikasi
sosial pemajuan ini dan kesannya kepada kawasan keliling. Kesemua peruntukan-peruntukan
menjadi asas kepada usaha mengatur dan mengawal pemajuan gunatanah oleh pihak
berkuasa perancang tempatan dan sebarang kesalahan atau pelanggaran syarat dengan
kebenaran yang diberikan (Seksyen 26 hingga 30) membolehkan pihak berkuasa perancang
tempatan mengambil tindakan yang sewajarnya sepertimana diperincikan dalam Bahagian IV
Akta Perancangan Bandar dan Desa 1976 (Akta 172) ini.
Isu yang sering dikaitkan dengan kegagalan dalam merancang, mengatur dan mengawal
gunatanah adalah persoalan keberkesanan peranan agensi-agensi kerajaan yang diberikan
tanggungjawab dalam merancang, melaksana dan mengawal pemajuan di kawasan Pantai
Chenang, Langkawi. Lembaga Pembangunan Langkawi (LADA) dan Majlis Perbandaran
Langkawi Bandaraya Pelancongan (MPLBP) merupakan dua agensi kerajaan yang berfungsi
berasaskan peruntukan kuasa pentadbiran dan undang-undang dalam mengatur dan mengawal
237
gunatanah pembangunan, serta bertanggungjawab mematuhinya secara holistik, selain

berperanan menggubal dan memperakukan polisi, strategi dan program-program pembangunan
yang menepati peruntukan atau perancangan yang ditetapkan. Contoh paling nyata adalah
kegagalan agensi-agensi ini dalam memastikan setiap permohonan merancang perlu mematuhi
peruntukan-peruntukan dan syarat-syarat yang telah ditetapkan dalam apa jua mekanisma
polisi dan kawalan pemajuan, termasuk dasar-dasar umum di peringkat nasional, Rancangan
Struktur Negeri, Rancangan Tempatan, Piawaian Perancangan, dan lain-lain garis panduan
yang ditetapkan oleh Jabatan Perancangan Bandar dan Desa (Persekutuan dan Negeri), serta
Kementerian Perumahan dan Kerajaan Tempatan.
Zon persisiran pantai melibatkan kawasan dinamik yang saling berinteraktif, melibatkan
aspek pengurusan sumber (kehidupan laut, sistem kumbahan, pelupusan sampah dan
sebagainya), pengurusan keselamatan bencana (banjir, tanah runtuh dan lain-lain), serta
hubungan manusia dengan persekitaran fizikal. Ia merupakan kawasan berisiko tinggi kepada
aktiviti pembangunan, serta sensitif bertindak balas dengan tindakan atau aktiviti manusia.
Koridor Pelancongan Pantai Chenang, Langkawi telah mula dibangunkan sejak awal 1980-an,
menampilkan kepelbagaian tatatur dan reka bentuk kemudahan-kemudahan penginapan, yang
sebahagian besarnya menampakkan ketidak seragaman pelan tatatur, ketiadaan kawalan
pembangunan, ketiadaan sistem pengaliran sisa buangan, perparitan, dan pelbagai konflik yang
sekaligus memperlihatkan kelemahan proses perancangan dan kawalan pembanguanan di
kawasan persisiran pantai ini, tanpa spesifikasi pembangunan yang terperinci dan
komprehensif.
Kajian oleh Johan Afendi dan Mohamad Zaki (2011) di Pulau Langkawi menunjukkan
industri pelancongan di Langkawi telah menyebabkan berlakunya perubahan-perubahan ke
atas sektor fizikal dan gunatanah, sosio-ekonomi penduduk tempatan serta kemudahan
infrastruktur dan kemudahan pelancongan. Di sebalik kesan-kesan positif, limpahan ekonomi
tidak dinikmati sepenuhnya oleh penduduk tempatan, di samping berlakunya pencemaran laut
dan kemusnahan terumbu karang, pembangunan pelancongan yang tidak terancang serta
masalah perkhidmatan feri dan pengangkutan.
Sebaliknya kajian oleh Suhaya, Md. Shafiin dan Norlida (2013) menunjukkan berlakunya
impak positif hasil dari pembangunan pelancongan di Langkawi, terutamanya ke atas aspek
ekonomi penduduk tempatan. Di samping peningkatan peluang pekerjaan, sektor pelancongan
juga turut menerima kesan limpahan akibat daripada pertambahan perbelanjaan para
pelancong luar. Kajian oleh Azizan (2011) pula mendapati pembangunan pelancongan
berupaya memberikan impak positif kepada masyarakat setempat. Umumnya kajian ini
merumuskan bahawa pembangunan pelancongan telah memberikan impak ke atas penjanaan
peluang pekerjaan, peluang perniagaan dan keusahawanan, pelaburan serta kemudahan
infrastruktur yang lebih baik. Namun dalam waktu yang sama pembangunan pelancongan
memberi kesan ke atas kemerosotan budaya dan pembangunan fizikal/alam sekitar. Selain itu,
kajian oleh Jaafar, Rasoolimanesh dan Ismail (2015) mendapati faktor umur dan jantina
masyarakat setempat di Pantai Chenang, Langkawi, mempengaruhi persepsi dan penyertaan
masyarakat dalam pembangunan pelancongan. Ini memberikan indikator kepada pihak
238
kerajaan dalam melihat dan menilai faktur-faktur demografi dalam usaha merancang dan
melaksanakan program-program pembangunan pelancongan di kawasan terbabit.
Umumnya, kertas ini bertujuan meneliti beberapa dapatan hasil kajian yang berpandukan
kepada objektif i. Menilai signifikan dan kepentingan kawalan pembangunan di kawasan Pantai
Chenang, Langkawi, ii. Menganalisis isu-isu berkaitan kawalan pembangunan di Pantai
Chenang, Langkawi, dalam konteks perancangan fizikal, pembangunan pelancongan dan
keselamatan awam/bangunan dan iii. Menyarankan strategi kawalan pembangunan di kawasan
persisiran pantai, Pantai Chenang secara lebih holistik berteraskan praktis kawalan
pembangunan yang lebih dinamik.
2. Peraturan dan Kawalan Guna Tanah Bandar

Peraturan dan kawalan guna tanah bandar merupakan aspek terpenting dalam
perancangan bandar dan kajian-kajian geografi penempatan dan geografi bandar. Ia
merupakan suatu kaedah bagi mengawal dan merancang pembangunan kawasan supaya
rancangan-rancangan pembangunan yang dibuat tidak meninggalkan kesan buruk kepada imej
bandar, perkembangan bandar, penempatan manusia serta persekitaran. Perkembangan
bandar yang semakin pesat dan kompleks memerlukan penilaian kembali ke atas peraturan dan
kawalan guna tanah masa kini (Kamarudin, 1993). Asas kepada kawalan pembangunan adalah
bertujuan untuk melindungi kepentingan awam dan bukannya memihak kepada mana-mana
kumpulan tertentu (Kamarudin Ngah et al, 2012).
Bahagian III Akta Perancangan Bandar dan Desa 1976 (Akta 172), Pindaan 2001 (Akta
A1129) telah memperuntukkan keperluan kepada penyediaan sistem rancangan pemajuan
sebagai pelan pembangunan bagi sesebuah kawasan pemajuan, sama ada di peringkat negeri,
daerah mahupun kawasan-kawasan khas. Rancangan pemajuan ini terdiri daripada Rancangan
Struktur Negeri (RSN) meliputi perancangan strategik bagi sesebuah negeri, Rancangan
Tempatan Daerah (RTD) sebagai rancangan pembangunan sesebuah daerah dan Rancangan
Kawasan Khas (RKK). Pelan-pelan ini berfungsi untuk merancang, mengawal serta memandu
arah pembangunan di dalam kawasan pemajuannya (Akta Perancangan Bandar dan Desa
1976, Akta 172).
Kerajaan Tempatan dalam menjalankan tugas sebagi pihak berkuasa perancang

tempatan perlu memahami dan mengenali kewujudan pelbagai jenis golongan awam yang
wujud dalam sesuatu komuniti. Golongan awam tidak boleh dilihat sebagai satu entiti tunggal
kerana golongan awam terdiri daripada pelbagai kumpulan komuniti yang mempunyai
pandangan yang berbeza terhadap satu-satu projek pembangunan (Nikmatul Adha Noordin &
Kamarudin Ngah, 2016).
3. Kajian-Kajian Terdahulu
Teori-teori klasikal dalam perancangan bandar memperlihatkan bahawa keputusan ke atas
sebarang guna tanah adalah hasil daripada manifestasi fizikal tuntutan masyarakat industri. Ini
jelas terbukti menerusi Teori Zon Berpusat (Burgess, 1925), Model Bersektor (Hoyt, 1939),
239
Model Kepelbagaian Nukleui (Harris & Ullman, 1945), Teori Guna Tanah dan Aktiviti Manusia
(Chapin, 1957), serta Teori Petempatan Berpusat (Christaller, 1966).
Burgess menonjolkan suatu deskripsi model guna tanah bandar, yang membahagikan
bandar kepada suatu set kitaran bertumpu (concentric circles) yang berkembang daripada
pusat bandar kepada kawasan pinggir bandar, di mana model ini mengandaikan wujudnya
hubungan antara status sosio-ekonomi (terutamanya pendapatan isirumah) dengan jarak
daripada Daerah Perniagaan Berpusat (Central Business District-CBD).
Goodmann & Freud (1968) melihat bahawa perancangan guna tanah amat perlu bagi
meramalkan projeksi masa depan penduduk dan aktiviti ekonomi yang melibatkan kesemua
bentuk guna tanah. Sehubungan itu, perancangan guna tanah lebih mengarah kepada
pembentukan kriteria yang sesuai dan bertepatan bagi sesebuah bandar, yang menawarkan
kualiti kehidupan yang baik dan corak fizikal yang bertepatan bagi melaksanakan pelbagai
aktiviti kependudukan. McGee (1967) dan Smith (1962), berdasarkan penyelidikan, telah
merumuskan corak guna tanah yang tersendiri bagi bandar-bandar di South East Asian.
Penemuan utama kajian mereka menunjukkan bahawa praktis ekonomi dualistik oleh negara-
negara di South East Asian ini telah mewujudkan dua bentuk sektor; sektor-sektor maju dan
sektor-sektor tidak maju di negara ini.
Menurut Barnet (2004), fungsi setiap guna tanah adalah berdasarkan kepada nilai-nilai
sesebuah masyarakat, dan ini melibatkan keputusan dan pemilihan manusia agar sumber-
sumber yang ada (tanah) boleh digunakan secara optima. Kamarudin Ngah (1993), dalam
kajiannya di negeri Terengganu dan Kedah, mendapati bahawa corak guna tanah terhasil
akibat daripada tindakan manusia terhadap alam persekitaran, yang terhasil daripada keperluan
untuk menggunakan tanah bagi tujuan aktiviti ekonomi dan sosial. Ianya melibatkan hubungan
antara keperluan manusia dan alam yang akhirnya mempengaruhi corak guna tanah.
Pihak berkuasa tempatan merupakan pihak yang bertanggungjawab dalam memastikan

setiap perancangan pembangunan yang dijalankan di kawasan mereka mengikut garis panduan
yang telah ditetapkan. Pihak berkuasa tempatan juga diberi kuasa oleh undang-undang untuk
memastikan kawasan pentadbiran mereka berada dalam keadaan selamat dan merancang
sesuatu pembangunan dalam keadaan sempurna sesuai dengan keadaan masyarakat
setempat. Kesesuaian pembangunan perlu diambil kira sebelum sesuatu pembangunan
dilaksanakan. Kesesuaian pembangunan dilihat dari aspek rancangan struktur dan rancangan
tempatan bagi memastikan projek pembangunan yang dibangunkan mengikut pengstrukturan
yang telah dibuat. Hal ini adalah bagi mengelakkan percanggahan guna tanah (Ibrahim Wahab,
2015).
Berdasarkan kajian yang dijalankan ke atas Daerah Barat Daya Negeri Pulau Pinang,
Kamarudin Ngah (2015) merumuskan bahawa:
“Urban land policy is deemed crucial in planning and controlling urban

development so that any act undertaken will not leave negative effects on the town‟s
240
image, human settlements as well as the living environment. Since land is a limited
resource, it is vital that its use is maximized for the benefits of humans.
Nevertheless, rapid increase in urban population also means high demands on urban
land. Consequently, such demands may change the socio-cultural actions, economy,
politics and town‟s system too”.
Strategi pembangunan luar bandar turut mempengaruhi corak guna tanah masa kini.
Strategi ini bermatlamatkan untuk mengurangkan kesesakan di kawasan metropolitan dengan
cara mengalihkan migrasi penduduk ke kawasan bandar-bandar baru. Walau bagaimanapun
strategi ini memberikan implikasi sebaliknya;
“The phenomenon of change in land use patterns especially the ones which
happen drastically and uncontrollably is feared to leave negative impact on the socio-
economy, demographic and geo-politic aspects of a certain area. Continuous
pressure of development affects the application of rules for agriculture lands. This in
turn influences the activities of planning applications which are forwarded by property
developers” (Kamarudin Ngah et al., 2015).
Kajian ini membuktikan pembangunan pesat guna tanah di Daerah Barat Daya ini telah
mengubah struktur sosial petempatan di dalam kawasan ini. Pembangunan yang tertumpu di
Relau, Bukit Jambul, Batu Uban dan Bayan Bay memberikan kesan ke atas struktur sosio-
ekonomi dan pemilikan hartanah di negeri ini khususnya kepada golongan Bumiputera.
Sehubungan itu peranan kerajaan dalam pembangunan komuniti berasaskan pertanian dan
pelancongan harus menjadi asas dalam usaha pemajuan guna tanah di kawasan ini,
sepertimana telah dijelaskan bahawa;
“The existing agriculture land has to be developed parallel to the efforts to

develop agro-tourism and to provide support to the objective of making this district as
a centre for production, processing and main supplier of agro-products for the whole
of Penang. In this context, tourism programme in the form of homestay as well as
conservation of living heritage in agriculture land and forestry can be undertaken in
order to balance the pressure of land use in this district as well as to optimize the
existing resources.” (Kamarudin Ngah et al, 2015).
Dalam konteks yang sama Azlizan dan Hamzah (2016) menjelaskan ―strategi
pembangunan in-situ sektor padi berteraskan konsep pembangunan pertanian bersepadu yang
merupakan strategi menyeluruh bagi membangunkan kawasan yang mundur menerusi
241
pemodenan kegiatan ekonomi, pembekalan input pertanian serta perkhidmatan sokongan yang
lain. Umumnya strategi ini telah berjaya dalam meningkatkan hasil dan pendapatan petani,
tetapi faedahnya lebih dinikmati oleh petani yang memiliki tanah yang besar. Mereka yang tidak
mempunyai tanah akan terpinggir memandangkan hasil yang diperolehi adalah minimum dan
penggunaaan teknologi yang tidak menyeluruh‖.
Menurut Jane Silberstein dan Chris Maser (2000), pemilikan tanah dan hak ke atasnya
merupakan asas kepada perundangan di kebanyakan negara di dunia ini. Menyeimbangkan
hak pemilikan hartanah ini dengan kehendak komuniti secara umumnya menjadikan
perancangan guna tanah sebagai proses yang sukar. ‗Right‘ atau hak ini ini melibatkan dua
entiti; i) pemilik tanah, dan ii) komuniti yang dilindungi oleh peraturan-peraturan kerajaan.
Keadaan ini selalunya menimbulkan perdebatan tentang hak sebenar seseorang ke atas tanah
atau hartanah pemilikannya serta persoalan perundangan guna tanah yang menghalang atau
menghadkan hak ini.
Kamarudin Ngah et al (2016) dalam kajiannya di Bandaraya George Town telah

merumuskan antara lain;
“One of the three core principles applied as stated in the Heritage Protection for
the 21st Century was that engaging with the planning system, and acknowledged that
the historic environment constituted an essential element of building sustainable
community. The policy emphasis previously given to the benefits of heritage a sense
of place would now be part of the new legislative system”.
Dalam konteks kajian kawasan-kawasan warisan harus juga merujuk kepada kawasan
pertanian tradisional (padi) yang merupakan warisan petempatan dan sosio-ekonomi dan
budaya yang tersendiri khususnya melibatkan golongan petani.
Antara saranan yang dikemukakan berkaitan usaha mengatur dan mengawal guna tanah
yang berdasarkan kajian di Daerah Barat Daya Negeri Pulau Pinang ialah;
“Land use management combines the regulatory needs which are efficient
(including administration, enforcement and control), as well as being environmentally
sensitive for every land resources. This involves a more balanced process between
conservation and development. Failure in this aspect today has resulted in existing
land resources becoming victims of development; balding hills, landslide, water
source pollution and threats to life and the ecological system. In light of these issues,
it is suggested that this district is declared as an „Ecologically Fragile Areas‟. This
involves efforts to preserve and conserve the more sensitive areas; forest reserves,
irrigation areas, beach/river areas, aquaculture, hilly areas and agriculture land.
242
These sensitive areas are fragile to human threats, so their actions in land use
development must be controlled strictly”. (Kamarudin Ngah et al, 2015).
Bertitik-tolak daripada konflik-konflik guna tanah seperti yang dibincangkan, kini

perancangan guna tanah untuk pembangunan mampan menjadi agenda utama negara-negara
maju di dunia.
3.1. Rancangan Struktur Negeri Kedah
Rancangan Struktur Negeri Kedah telah mengezonkan Langkawi sebagai Zon Pelancongan
Utama (Pelancongan Antarabangsa). Zon Pantai Chenang pula berada di Hierarki
Antarabangsa dan dilabelkan sebagai Daerah Pelancongan Utama. Di antara dasar-dasar
utama yang telah digariskan dalam Rancangan Struktur Negeri Kedah yang berkaitan secara
langsung dalam konteks kajian antaranya:
i) Pembangunan secara terkawal sahaja yang dibenarkan di dalam Kawasan Sensitif Alam
Sekitar, melibatkan kawasan hutan, tanah tinggi, persisiran pantai, persisiran sungai,
kawasan pulau, zon warisan sejarah, kawasan tadahan air, empangan dan badan air.
ii) Mempertingkatkan tahap penyediaan kemudahan infrastruktur dan utiliti selaras dengan
keperluan penduduk, pembangunan ekonomi dan perkembangan teknologi.
3.2. Rancangan Tempatan Daerah Langkawi 2020
Pantai Chenang terletak dalam Blok Perancangan 12 (BP 12) di bawah RT Daerah Langkawi
2020. Beberapa matlamat dan strategi telah digariskan dalam RT Daerah Langkawi 2020 ini,
khususnya melibatkan aspek perancangan dan garis panduan pembangunan, antaranya:
i) Penstrukturan semula kawasan perniagaan

ii) cadangan mewujudkan nodus bagi aktiviti-aktiviti pelancongan utama
iii) cadangan pemeliharaan alam sekitar dan sumber semulajadi
iv) cadangan pembangunan pelancongan desa (homestay, rumah budaya dan kampong
angkat).
Walau bagaimanapun beberapa aspek yang terkandung dalam RT Daerah Langkawi 2020 ini
telah dibatalkan dan dipinda, dan diselaraskan dengan peruntukan dan strategi yang digariskan
dalam Rancangan Kawasan Khas Pantai Chenang. Ini termasuklah perubahan kepada Peta
Cadangan Blok Perancangan Kecil 12.1, perubahan Jadual Kelas Kegunaan Tanah Blok
Perancangan Kecil 12.1, Anjakan Bangunan, serta Had Ketinggian Bangunan.
3.3. Rancangan Kawasan Khas Pantai Chenang
243
Berdasarkan peruntukan Akta Perancangan Bandar dan Desa 1976, Akta 172, Rancangan
Kawasan Khas Pantai Chenang (RKK Pantai Chenang) telah disediakan sebagai rancangan
pemajuan yang bersifat „action area plan‟, serta berfungsi sebagai alat pembangunan kepada
Pihak Berkuasa Negeri (PBN) dan Pihak Berkuasa Tempatan (PBT) bagi merancang dan
mengawal pembangunan di kawasan-kawasan khusus, melibatkan tindakan-tindakan terperinci
untuk pembangunan semula atau pembangunan baru.
RKK Pantai Chenang merupakan Pelan Strategi Pembangunan Fizikal (2012-2015) yang
menjelaskan corak pembangunan guna tanah dan susun atur yang meliputi Spesifikasi
Pembangunan terperinci dan Jadual Tindakan Pembangunan. Pelan ini turut mengandungi
tindakan-tindakan pengurusan fizikal yang meliputi pendekatan pelaksanaan, fasa, agensi
pelaksana dan anggaran kos pembangunan bagi kawasan Pantai Chenang.
4. PERBINCANGAN PENEMUAN KAJIAN

Terdapat enam isu utama yang telah dibincangkan secara terperinci di dalam bab analisis data.
Keenam-enam isu ini dirumuskan seperti berikut:
4.1. Ancaman Kualiti Air Laut dan Biodiversiti
Terdapat tiga sebab utama kenapa berlakunya ancaman ke atas kualiti air laut dan
biodiversiti. Pertama, akibat daripada eksploitasi rancangan-rancangan pembangunan guna
tanah pelancongan yang melibatkan pemajuan perhotelan, ruang perniagaan dan aktiviti-aktiviti
lain yang berkaitan. Lebih ketara ialah apabila berlakunya pembangunan guna tanah tersebut
pada skala besar yang tidak terkawal. Kedua, berlakunya amalan pembinaan premis-premis
perhotelan dan perniagaan tanpa mendapat kelulusan kebenaran merancang serta ketidak
patuhan kepada peruntukan-peruntukan yang terkandung di dalam Akta Perancangan Bandar
dan Desa 1976, Akta 172, terutamanya berkaitan dengan permohonan dan kebenaran
merancang serta kawalan pemajuan. Ketiga, ketiadaan sistem pembetungan dan kumbahan
yang sistematik dan berpusat di kawasan kajian. Akibatnya, penyaluran sisa buangan daripada
premis hotel dan perniagaan terus disalurkan ke laut tanpa dirawat terlebih dahulu. Ini memberi
kesan negatif ke atas kualiti biodiversiti pantai dan marin, khususnya kemerosotan kualiti air.
Keith Thomas (2004) menjelaskan bahawa ― In practice, development control have very little
influence on the quality of environment once it has been developed, other than through the
enforcement of conyinuing planning conditions. It is important therefore at the development
control stage to get the design right‖.
4.2. Situasi ‘Over Capacity’
Terdapat tiga keadaan yang boleh menjelaskan situasi ‗over capacity‘ di kawasan kajian.
Pertama, pembinaan struktur-struktur binaan hotel/perniagaan yang tidak terkawal, termasuk
bangunan kekal dan separa kekal, terutama di kawasan pantai telah menyebabkan berlakunya
hakisan kawasan pantai. Kedua, ketiadaan kawalan ke atas nisbah plot dan ketumpatan yang
244
dibenarkan di dalam kawasan kajian, berlandaskan peruntukan piwaian perancangan telah

menyumbang kepada situasi kesesakan yang lebih serius, apatah lagi dengan terbinanya
pemajuan pembangunan guna tanah perhotelan dan perniagaan pada skala yang besar. Sekali
gus ia memberi kesan ke atas kualiti kebersihan dan alam persekitaran. Ketiga, situasi ‗over
capacity‘ ini turut dipengaruhi oleh perlakuan para pengusaha perhotelan dan peniaga yang
memaksimakan penggunaan ruang/tanah tanpa menyediakan ruang rizab, tanah lapang serta
tempat letak kenderaan, sepertimana digariskan di bawah piawaian perancangan. Kegagalan-
kegagalan ini turut memberi kesan ke atas aspek keselamatan dan keselesaan
pelancong/pengunjung di kawasan kajian. Keith Thoma (2004) antara lain menyarankan
bahawa ―Large shops innew planned developments may be either at the ends of malls, and
sited away from each other if there are more than one, to even out pedestrian flow through the
mall (so-called magnet stores), or free-standing superstores, hypermarkets or retail warehouses
placed within extensive parking‖.
4.3. Konflik Guna Tanah
Isu konflik guna tanah di kawasan kajian boleh dirumuskan akibat daripada tiga faktur.
Pertama, kebanyakan premis perhotelan dan perniagaan yang dibina di kawasan kajian tidak
mendapat kelulusan kebenaran merancang dan ketiadaan kelulusan pelan bangunan (Sijil
Kelayakan Menduduki) daripada pihak berkuasa tempatan. Kedua, terdapat premis-premis
berkaitan yang dibina di atas tanah-tanah rizab kerajaan, termasuk rizab jalan, rizab pantai dan
rizab perparitan, serta tidak mempunyai kemudahan infrastruktur dan awam yang sepatutnya.
Ketiga, konflik guna tanah turut berlaku akibat daripada aktiviti rekreasi dan perusahaan
perhotelan/perniagaan yang gagal mematuhi garis panduan pembangunan guna tanah
kawasan persisiran pantai yang telah ditetapkan oleh Jabatan Perancangan Bandar dan Desa,
Pihak Berkuasa Tempatan serta lain-lain agensi berkenaan.Davies (1989) antara lain menyebut
bahawa ―Siting describes how buildings sit within a plot and relate to their immediate
surroundings. The location of a building describes its position in a region and/or a town, or
perhaps in a deep rural setting. Location is also a material consideration in development
control‖.
4.4. Keselamatan Pelancong dan Bangunan
Isu ini boleh dirumuskan dalam tiga keadaan. Pertama, lanjutan daripada isu ‗over
capacity‘ dan ketidak patuhan ke atas piawaian perancangan dan peruntukan perundangan
telah mengakibatkan kawasan kajian terdedah kepada risiko keselamatan
pelancong/pengunjung dan keselamatan bangunan (kebakaran). Keadaan ini diburukkan lagi
dengan kebanyakan premis tidak memperolehi Sijil Kelayakan Menduduki daripada pihak
berkuasa tempatan, ketiadaan sistem pemasangan eletrik dan pengesanan
kecemasan/kebakaran yang sistematik. Kedua, isu keselamatan ini turut berkait dengan aktiviti
rekreasi dan sukan air yang dijalankan tanpa lesen, gagal menitik beratkan aspek keselesaan
dan keselamatan pelancong, terutama di kawasan persisiran pantai yang menjadi tumpuan
kepelbagaian aktiviti rekreasi dan sukan air yang ditawarkan kepada para pelancong dan
pengunjung. Ketiga, ketiadaan kemudahan balai bomba dan pili bomba di kawasan kajian, serta
ketiadaan akses perkhidmatan bomba terutamanya ke kawasan pantai memberikan risiko yang
245
besar kepada aspek keselamatan pelancong/pengunjung sekiranya berlaku kemalangan atau

kebakaran. Malahan Keith Thomas (2004) melihat isu keselamatan ini dalam konteks yang lebih
luas..‖Crime prevention is a material consideration in development control. Circular 5/94,
Planning out Crime (DOE, 1994b), stresses that development control solutions to the problem of
crime are essentially local. The Circular argues that the causes of crime are complex, but
desolate surroundings foster hostility, and attractive environments may discourage anti-social
behavior‖.
4.5. Eksploitasi Kawasan Pantai
Isu eksploitasi kawasan pantai yang tidak terkawal ini berpunca daripada tindakan para
pengusaha hotel/chalet yang bersaing menguasai kawasan persisiran pantai dengan membina
premis sehampir mungkin dengan kawasan pergigian air, tanpa mematuhi garis panduan
piawaian perancangan dan perundangan berkaitan pemajuan guna tanah di kawasan persisiran
pantai. Bentuk eksploitasi juga dilihat dalam konteks penguasaan kawasan persisiran pantai di
kalangan para pengusaha bagi menawarkan aktiviti rekreasi dan sukan air, tanpa pembahagian
zon rekreasi aktif dan pasif secara jelas. Keadaan ini diburukkan lagi dengan ketiadaan kawalan
ke atas kemasukan kenderaan awam/pengusaha ke kawasan pantai, konflik sirkulasi dan sosio-
budaya. Davies (1989) mengaitkan situasi ini dengan aspek ‗privacy‘ dengan menjelaskan
bahawa ―The desire to exploit pleasant views of distant landscapes out of buildings, amenity
spaces or merely of the access roads, with their comings and goings, affects the siting of
buildings. Views out over access roads, parking and other buildings improve site security‖.
4.6. Aksesibiliti dan Sistem Sirkulasi
Isu ini boleh dirumuskan dalam empat keadaan. Pertama, ketiadaan akses masuk ke
kawasan pantai untuk tujuan aktiviti rekreasi dan sukan air daripada jalan utama kawasan
kajian. Akses ini juga penting sekiranya berlaku sebarang kecemasan seperti kebakaran dan
lain-lain. Kedua, ketiadaan jalan pemisah di antara bangunan perhotelan/chalet dan perniagaan
dengan kawasan persisiran pantai. Kedua-dua isu ini memperlihatkan kegagalan pematuhan ke
atas garis panduan pemajuan di kawasan persisiran pantai serta kegagalan memenuhi
keperluan piawaian perancangan yang ditetapkan oleh pihak berkuasa tempatan dan Jabatan
Perancangan Bandar dan Desa. Ketiga, penggunaan ruang rizab jalan dan pantai di kalangan
para pengusaha untuk tujuan memaksimakan ruang lantai perhotelan dan perniagaan, serta
penggunaan ruang letak kenderaan awam di bahu jalan. Keadaan ini menimbulkan kesesakan
dan kesulitan kepada para pelancongan/orang awam untuk mendapatkan ruang/petak meletak
kenderaan yang sepatutnya disediakan untuk mereka. Malahan terdapat para pengusaha
kereta sewa/motorsikal sewa yang menggunakan ruang letak kereta awam ini sebagai tempat
meletak/simpanan kenderaan mereka yang kekal. Keempat, ketiadaan sistem hierarki jalanraya
dan lalulintas yang jelas di kawasan kajian yang mengakibatkan semua jenis kenderaan
menggunakan jalan yang sama, menimbulkan konflik kesesakan dan ketidakselesaan. Davies
(1989) pernah menjelaskan bahawa ― Plans and development control should aim to inhibit the
use of long-distance routes by short-distance traffic by strictly limiting access from sites to trunk
246
roads…traffic management schemes can deny heavy vehicles access to roads unsuitable for
them. Fundamental to traffic planning is the concept of the road hierarchy‖.
5. SARANAN DAN CADANGAN PELAN TINDAKAN PEMBANGUNAN
5.1. Sistem Aksesibiliti dan Sirkulasi Bersepadu
Cadangan kawalan pembangunan menerusi pendekatan perancangan aksesibiliti dan sistem

lalu lintas yang terancang perlu mengambil kira bukan semata-mata aksesibiliti ke kawasan
koridor Pantai Chenang, sebaliknya perlu melihat dalam kerangka penyelesaian masalah
aksesibiliti dan sistem sirkulasi yang lebih kompleks dari dua sudut; pertama, menyediakan satu
sistem aksesibiliti dan sirkulasi yang komprehensif dan bersepadu dalaman (sepanjang koridor
Pantai Chenang dan kawasan persisiran pantai), serta kedua, mengintegrasikan kedua-dua
sistem ini (aksesibiliti dan sirkulasi) dalam konteks Koridor Pantai Chenang dan kawasan
pembangunan sekelilingnya dengan ‗catchment areas‘ dalam lingkungan 1 hingga 3 kilometer.
Dalam konteks yang pertama, penekanan perlu diberikan kepada aspek keselesaan pengguna,
khususnya para pejalan kaki dan golongan kurang upaya. Ciri-ciri reka bentuk jalanraya dan
kemudahan perlu menepati piawaian perancangan yang ditetapkan oleh Jabatan Perancangan
Bandar dan Desa dan pihak berkuasa tempatan. Aksesibiliti ke kemudahan pelancongan,
khususnya ke kawasan persisiran pantai perlu diintegrasikan dengan kemudahan tempat letak
kenderaan yang jaraknya dalam lingkungan 10 minit berjalan kaki, yakni satu ‗standard‘ atau
piawaian yang diterimapakai dalam konteks perancangan bandar secara umumnya. Rezab
jalan perlu kekal selebar 20 meter bagi binaan jalan baru. Dalam konteks kedua, sistem
jaringan aksesibiliti dan sirkulasi yang bersepadu dalam satu kawasan ‗catchment areas‘ yang
dikenalpasti perlu diberikan penekanan. Pembangunan jalan alternatif sepertimana yang
disarankan dalam Rancangan Kawasan Khas Pantai Chenang serta menaikkan taraf jalan
sediaada merupakan strategi terbaik dalam merealisasikan sistem aksesibiliti dan sirkulasi ini.
Ini melibatkan usaha menaik taraf dan reka bentuk Jalan Pantai Tengah-Jalan Pantai Chenang,
Jalan Pantai Chenang-Jalan Bohor Tempoyak dan persimpangan antara Jalan Pantai Chenang
dengan jalan-jalan tempatan.
5.2. Rawatan dan Pemulihan Kualiti Air Laut
Satu pendekatan strategik dan komprehensif diperlukan untuk memulihkan kualiti air laut dan
mengurangkan impak negatif terhadap hidupan marin, serta meningkatkan kualiti persekitaran
pantai dan laut yang selamat dan selesa. Dalam konteks kajian, cadangan penyambungan paip
pembentungan melibatkan tiga fasa; fasa pertama (25 buah premis), fasa kedua (28 buah
premis), dan fasa ketiga (melibatkan premis dalam program pemutihan). Sistem pembentungan
berintegrasi ini membolehkan isu pencemaran air laut serta persekitaran dapat diatasi dengan
kos yang lebih efisyen. Dalam jangka panjang, satu Pelan Induk Sistem Perparitan dan
247
Pembetungan perlu disediakan bagi kawasan kajian untuk menampung pembangunan baru dan
dalam waktu yang sama memastikan kualiti air terawat yang berterusan tanpa menjejaskan
alam sekitar dan kehidupan marin. Davies (1989) merumuskan bahawa ―Drainage and flood
control must be discussed at the pre-planning and outline stages of planning applications on a
‗prevention is better than cure ‗basis‘.
5.3. Pembangunan Persisiran Pantai Chenang
Kawasan persisiran pantai, Pantai Chenang merupakan Kawasan Sensitif Alam Sekitar. Setiap
pembangunan yang dirancang di kawasan ini perlu tertakluk sepenuhnya kepada amalan
kawalan pembangunan yang berteraskan prinsip perancangan, pentadbiran dan perundangan
yang telah ditetapkan oleh pihak berkuasa tempatan. Objektif utama adalah untuk
mengoptimumkan penggunaan tanah secara efisyen dan adil, meminimum konflik guna tanah,
dan dalam waktu yang bersifat responsif kepada keperluan persekitaran semulajadi. Selain
keperluan penyediaan fasiliti pelancongan, pembangunan ini juga perlu mematuhi keperluan
penyediaan ruang lapang, tempat letak kenderaan, serta lain-lain keperluan seperti Kajian
Analisis Impak Alam Sekitar (EIA) dan Kajian Analisis Impak Sosial (SIA). Kesemua syarat-
syarat teknikal perlu dipatruhi sepenuhnya di kawasan pembangunan yang sensitif ini. Ini tidak
terkecuali daripada keperluan menyediakan Laporan Cadangan Pemajuan (Development
Proposal Report) mengikut justifikasi yang telah ditetapkan di bawah Seksyen 21A dan 21B
Akta Perancangan Bandar dan Desa 1976, Akta 172.
Cadangan pemberian kebenaran kepada para pengusaha hotel terutamanya pengusaha hotel
tempatan untuk menggunakan kawasan rizab pantai, biarpun tertakluk kepada keperluan rizab
pantai 20 meter dari paras air pasang tertinggi, sepertimana disarankan dalam Rancangan
Kawasan Khas Pantai Chenang, dikhuatiri bertentangan dengan amalan kawalan
pembangunan dan mendatangkan lebih banyak kesan negatif, bukan sahaja dari sudut
sensitiviti alam sekitar tetapi juga dari aspek keselamatan dan keselesaan para pelancong. Jika
ini dibenarkan ia akan menjadi satu ‗precedent‘ dalam praktis kawalan pembangunan dan
pastinya menimbulkan konflik guna tanah yang lebih kompleks pada masa hadapan. Antara
garis panduan umum yang disarankan adalah:
i) Pantai berpasir dan pantai penambakan berjarak 60 meter dari garis air pasang perbani
dan 15 meter dari jalan utama.
ii) Laluan awam selebar 6 meter di sepanjang jalan utama persisiran pantai.
iii) Penyediaan kawasan rizab persisiran pantai bagi tujuan rekreasi semulajadi dan
digalakkan penanaman pokok bagi tujuan mengelakkan hakisan.
iv) Penyediaan wakaf dan gazebo yang mempunyai rekabentuk dan warna yang sesuai
dengan kawasan sekitar dalam kawasan rizab persisiran pantai sebagai teduhan kepada
pengunjung.
v) Menyediakan ruang tempat letak kereta yang mencukupi dengan kadar 1 petak kereta per
75 meter persegi ruang lantai. Bagi motorsikal pula, 100 meter persegi bagi setiap 1 petak
motorsikal.
248
Bagi mengawal aktiviti rekreasi dan sukan air di kawasan kajian, kawasan persisiran pantai
Pantai Chenang boleh diklasifikasikan sebagai ‗multi-activity beach area‘ yang membahagikan
zon-zon berdasarkan aktiviti secara jelas. Dalam konteks kajian, 4 zon dicadangkan meliputi
zon ruang keluarga dan perkelahan, zon ruang aktiviti bersifat aktif, zon ruang rehat dan
bersantai, serta zon ruang aktiviti bersifat pasif. Pembahagian zon-zon ini membolehkan aktiviti
rekreasi dan rehat dapat dilakukan secara lebih teratur, mudah dikawal dan tidak memberikan
kesan negatif terutamanya berkaitan dengan isu keselamatan awam/pelancong dan
persekitaran.
5.4. Pelan Pemutihan Pembangunan Kawasan Persisiran Pantai Chenang
Objektif utama pelan tindakan ini ialah untuk memastikan 96% premis-premis resort bajet
sediada memperolehi kelulusan Sijil Layak Menduduki menjelang tahun 2015. Program
pemutihan adalah pemudah cara kepada prosedur bagi mendapatkan kelulusan Kebenaran
Merancang dan Pelan Bangunan serta kelulusan Sijil Layak Menduduki bagi premis sediada
yang gagal berbuat sedemikian. Program Pemutihan ini melibatkan proses permohonan dan
kelulusan pihak berkuasa tempatan. Setiap permohonan perlu mengemukan butir-butir yang
melibatkan ubah jenis kegunaan tanah, kebenaran merancang (as-built plan), pelan bangunan
(as-built plan), permohonan kelulusan Sijil Layak Menduduki, dan Lesen Perniagaan. Proses
kelulusan Program Pemutihan ditunjukkan dalam rajah di bawah.
5.5. Penyerakan dan Agihan Guna Tanah
Strategi ini bertujuan untuk meminimumkan konflik guna tanah yang yang turut
menyebabkan berlakunya ‗over capacity‘, dengan cara menyebarkan pemajuan guna tanah
perniagaan dan perhotelan yang berpotensi ke kawasan tanah-tanah pertanain yang tidak
ekonomik. Kawasan baru bagi menampung permintaan guna tanah perniagaan dan perhotelan
disebarkan ke kawasan baru dan tidak lagi tertumpu di sepanjang koridor Pantai Chenang. Dua
pendekatan digunapakai dalam strategi penyerakan dan pengagihan ini iaitu Alternatif 1:
Pembangunan oleh Tetuan Tanah (Tetuan tanah persendirian atau swasta mempunyai hak
sepenuhnya untuk membangunkan semula, mengurus dan mengendalikan lot-lot yang dikenal
pasti) dan Alternatif 2: Konsesi antara kerajaan dan tetuan tanah(memberi peluang kerjasama
antara pihak kerajaan dan tetuan tanah bagi memastikan pengurusan tanah-tanah kosong dan
terbiar diselaraskan dan dikoordinasikan dengan sistematik).
5.6. Kawalan Perancangan
Umumnya sebarang cadangan pemajuan di kawasan kajian perlu tertakluk sepenuhnya

kepada Garis Panduan Perancangan yang telah ditetapkan oleh Jabatan Perancangan Bandar
dan Desa, dan digunapakai sepenuhnya oleh Pihak Berkuasa Tempatan, sebagai salah sat
daripada mekanisme kawalan pembangunan. Garis panduan ini juga termasuk perkara
249
pengekalan pokok dan elemen semulajadi, aktiviti pembangunan pantai serta garis panduan
khusus mengikut zon kegunaan tanah. Bagi mencapai strategi-strategi pembangunan yang
telah digariskan dalam Rancangan Kawasan Khas Pantai Chenang ini, beberapa aspek
perancangan dan garis panduan pembangunan yang telah dirumuskan dalam Rancangan
Tempatan Daerah Langkawi 2020 perlu dipatuhi. Kawalan pembangunan bagi Blok
Perancangan 12 ini adalah berasaskan kepada peta cadangan guna tanah, jadual kelas
kegunaan tanah, anjakan bangunan minimum serta had ketinggian yang telah ditetapkan dalam
Rancangan Tempatan ini.
5.7. Cadangan Peta Gunatanah
Cadangan peta gunatanah bagi Blok Perancangan 12 (Pantai Chenang) dibahagikan

kepada enam kategori; perniagaan dan perkhidmatan, jalan dan kemudahan pengangkutan,
tanah lapang dan rekreasi, hutan, pantai, dan sungai.
Berasaskan kepada pembahagian enam kategori gunatanah, butir-butir mengenai aktiviti-aktiviti

yang dibenarkan, samada bersyarat, tidak dibenarkan atau tanpa syarat di perjelaskan dalam
Jadual Kelas Kegunaan Tanah BPK 12. Penetapan lain-lain syarat tertakluk kepada Had
Ketinggian dan Nisbah Plot, serta keperluan anjakan bangunan minimum dan panduan piwaian
yang digunapakai oleh MPLBP. Manakala sebarang aktiviti yang bercanggah dengan
penetapan Kolum I (jenis gunatanah) dan Kolum II (Aktiviti yang dibenarkan) perlulah
mendapatkan kelulusan khas daripada Pihak Berkuasa Negeri (Jadual 1).
5.8. Anjakan Bangunan Minimum
Penetapan 66 kaki rizab jalan utama, termasuk rizab Pantai Chenang (paras air pasang
tertinggi) dengan sempadan lot premis yang dibenarkan. Anjakan 15 kaki bangunan minimum
dari bahu jalan bagi setiap premis yang terlibat ditetapkan. Ini termasuk serahan rizab laluan
dan utiliti 10 kaki setiap lot bagi lot-lot bersempadan (Rajah 1).
5.9. Had Ketinggian Bangunan
Kawalan ketinggian bangunan diperlukan untuk menjaga intensiti pembangunan, masalah

hakisan dan menghalang pandangan ke kawasan pantai. Had kebenaran ketinggian bangunan
bagi BPK 12 ini dibahagikan kepada tiga kategori, mengikut tahap rendah, sederhana dan
tinggi. Secara spesifik pembahagian tahap ini diwakili dengan ketinggian bangunan; 5 tingkat, 8
tingkat dan 12 tingkat.
5.10. Kawalan Pembangunan Kawasan Perniagaan/Perdagangan
250
Aktiviti perniagaan perlu dirancang kerana ia merupakan komponen guna tanah terpenting
dalam perancangan pembangunan. Dalam konteks kajian, aktiviti perniagaan, perhotelan,
rekreasi dan sebagainya tertumpu dalam Koridor Pantai Chenang, dalam kelompok guna tanah
bercampur dan menimbulkan konflik guna tanah. Perancangan aktiviti perniagaan perlu
mematuhi piawaian perancangan yang telah ditetapkan oleh pihak JPBD dan kerajaan
tempatan. Ini termasuk aspek kawalan ketinggian bangunan, anjakan antara bangunan, nisbah
plot, sistem jalan dan sirkulasi serta keperluan tempat letak kenderaan. Kawasan perniagaan
perlu dilengkapkan dengan sistem dan hierarki jalan serta lalulintas fizikal yang berterusan,
teduh dan mesra kanak-kanak, orang-orang tua dan golongan kurang upaya. Kesemua kategori
jalan ini hendaklah mematuhi ‗Guidelines and Geometric Standars On Road Network System‘
dan lain-lain garis panduan yang disediakan oleh pihak JPBD.
Kemudahan tempat meletak kenderaan perlu direkabentuk dengan mengambilkira faktur

keselamatan, menyediakan tempat menunggu dan kemudahan awam yang mudah untuk
diselenggarakan. Sekurang-kurangnya 15% daripada kawasan meletak kenderaan ini
disediakan untuk penanaman pokok atau kotak tanaman/pergola.
Aspek reka bentuk bangunan yang harmoni, unik dan menarik perlu diintegrasikan dengan ciri-
ciri senibina yang melambangkan sosio-budaya tempatan. Reka bentuk bangunan juga perlu
mengambil kira faktur topografi semulajadi dan harmoni dengan alam semulajadi.
Jadual 1 Guna Tanah Mengikut Kesesuaian Aktiviti
251
252
Rajah 1: Garis Panduan Piawaian Perancangan Rizab Jalan dan Pantai
5.11. Zon Pembangunan Reruang

Pengezonan merupakan satu kaedah atau pendekatan yang seringkali digunakan sebagai alat
kawalan pembangunan guna tanah yang berkesan. Ianya bertujuan untuk mengawal konflik
guna tanah serta memastikan penggunaan sumberjaya kawasan persisiran pantai dapat
digunakan dengan sebaik-baiknya tanpa kesan negatif kepada alam dan manusia. Rancangan
Kawasan Khas Pantai Chenang telah mengklasifikasikan zon guna tanah kawasan Pantai
Chenang kepada tiga zon; i) zon pembangunan insentif, ii) zon pembangunan terkawal, dan iii)
zon pemeliharaan.
Rasional ketiga-tiga zon ini dibentuk adalah untuk memulihkan semula persekitaran dan imej
Pantai Chenang sebagai kawasan pelancongan pantai dan nodus aktiviti resort bajet utama di
Langkawi, di samping melindungi ekosistem dan habitat semulajadi, serta melindungi
petempatan desa dan kawasan pertanian sediada. Zon Pembangunan Insentif merupakan
kawasan yang telah dibangunkan dan kawasan utama bagi memenuhi keperluan pengusaha
dan pengunjung. Zon Pembangunan Terkawal merupakan kawasan petempatan tradisional dan
pertanian sediada, di mana sebarang aktiviti pembangunan dan hiburan tidak digalakkan di
dalam zon ini. Manakala Zon Pemeliharaan merujuk kepada kawasan rekreasi pantai dan
badan-badan air (sungai dan laut).
6. RUMUSAN
253
Koridor Pembangunan Pantai Chenang merupakan daya tarikan utama aktiviti

pelancongan di Pulau Langkawi dan usaha perlu dibuat dalam memastikan kehadiran
pelancong yang berterusan bagi menyokong pembangunan fizikal serta sosio-ekonomi
tempatan. Bagi kawasan yang dikategorikan sebagai Kawasan Sensitif Alam Sekitar, aspek
perancangan pembangunan guna tanah amat kritikal dan sensitif. Perancangan pembangunan
guna tanah perlu dikawal memandangkan tanah merupakan sumber yang terhad, tetapi amat
bernilai di kawasan kajian. Cabaran utama adalah bagaimana menyelesaikan konflik guna
tanah terdahulu (premis tanpa kelulusan permohonan merancang dan sijil layak menduduki)
dengan pembangunan baru yang berterusan tertumpu di kawasan utama persisiran pantai. Isu
‗over capacity‘, ketiadaan sistem perparitan dan pembetungan yang sistematik, dan lain-lain isu
yang telah dibincangkan memperlihatkan keperluan tindakan segera dalam mengatur dan
mengawal pembangunan guna tanah di kawasan kajian, samada melibatkan pendekatan
pentadbiran, perundangan mahupun perancangan. Oleh yang demikian cadangan yang
dikemukakan ini merupakan langkah-langkah segera, jangka sederhana dan jangka panjang
dalam memastikan kawalan pembangunan dan perancangan guna tanah yang sistematik,
komprehensif dan harmoni.
RUJUKAN
Akkerman, A. (2000). Harmonies of Urban Design and Discords of City-form: Urban Aesthetics
in the Rise of Western Civilization, Journal of Urban Design, V, 267-290.
Amino Agos Suyub, Raja Norazli Raja Nordin & Khairil Anuar Karim. 2008. Tanah Rizab Melayu
: Kaedah-kaedah Memaju dan Mengekalkan Pemilikannya. Kertas Kerja, Jabatan
Pentadbiran Hartanah, Fakulti Kejuruteraan dan Sains Geoinformasi. Skudai : Universiti
Teknologi Malaysia.
Azizan, M. (2011). Resident attitudes towards impacts from tourism development in Langkawi
Islands, Malaysia. World Applied Sciences Journal, 12 (Special Issue of Tourism &
Hospitality), 25-34.
Azlizan Talib & Hamzah Jusoh. 2016. Penyertaan Komuniti Dalam Keusahawanan Luar Bandar
Di Malaysia. Sintok : UUM Press.
Azman Ahmad. (1998). Tanah Rizab Melayu : Analisis Prospek Pembangunan. Kuala Lumpur.
Institut Tadbiran Awam Malaysia dan Jabatan Perkhidmatan Awam Malaysia.
Barnett, J. (1982). In C. Linda Dingler (Ed.). An Introduction of Urban Design, New York.
Fitzhenry & Whiteside Limited.
Barnett, J. (2004). Codifying New Urbanism: How to Reform Municipal Land Development
Regulations. Chicago, IL.
Bruce L. Berg (2009). Qualitative Research Methods for the Social Sciences. Pearson. Boston.
Carr, S., Francis, M., Rivlin, L., & Stone, A. (1992). Public Space. Cambridge. Cambridge
University Press.
Chen, X., Orum, A.M., & Paulsen, K.E. (2013). Introduction to Cities-How Place and Space
Shape Human Experience, Wiley-Blackwell, Sussex.
Davies H.W.E., D. Edwards, A.R. Rowley. (1989). The Approval of Reserved Matters Following
Outline Planning Permission. London. HMSO.
Francis, M. (2003). Urban Open Space-Designing for User Needs. Island Press. Washington.
254
Goh, M. (2007). Singapore‘s Waterfront Rejuvenation Efforts. Singapore delivered to the

Harbour Business Forum, Luncheon. Hong Kong.
Hemmati, M., (2002). Multi-stakeholder Processes for Governance and Sustainability: Beyond
Deadlock and Conflict. London. Earthscan Publications. Dicapai dalam
http://site.ebrary.com/lib/uum/Doc?id=10128845&ppg=18.
Hill, J., Terry, A. & Woodland, W. (2006). Sustainable Development: National Aspirations and
Local Implementation. Abingdon. Ashgate Publishing Limited. Dicapai dalam
http://site.ebrary.com/lib/uum/Doc?id=10211493&ppg=18.
Hussein, H. (2006). Urban Recreational Riverfronts: Successful Revitalization Elements. Journal
of Design and the Built Environment, I(2).
Ibrahim Wahab. (2015). Perumahan : Pengurusan Projek dan Urus Tadbir. Dewan Bahasa dan
Pustaka : Kuala Lumpur.
Institut Tanah dan Ukur Negara. (2007). Intisari Enakmen Tanah Rizab Melayu (Tak kan Melayu
Hilang Di Dunia). http://www.instun.gov.my [20 Feb 2017].
Irdayati Abdul Air. (2014). Tesis Sarjana Muda. Kadar Ketersediaan Tanah Untuk
Pembangunan Perumahan Di Kawasan Bandar Menurut Rancangan Tempatan Daerah
: Keberkesanannya Dari Perspektif Pemaju. Skudai : UTM.
Jaafar, M., Rasoolimanesh, S.M., & Ismail, S.M. (2015). Perceived sociocultural impacts of
tourism and community participation: A case study of Langkawi Island. Tourism and
Hospitality Research. https://doi.org/10.1177/1467358415610373.
Jane Silberstein & Chris Maser. (2000). Land Use Planning for Sustainable Development, Lewis
Publisher, Washington D.C.
Johan Afendi, I., & Mohamad Zaki, A. (2011). Impak pembangunan pelancongan terhadap
destinasi pantai: Kajian kes Pantai Chenang, Langkawi. Persidangan Kebangsaan
Ekonomi Malaysia ke VII, (pp. 601-610). Dicapai melalui
http://www.ukm.my/fep/perkem/pdf/perkemVii/PKEM2012_2E2.pdf.
John Ratcliffe, Michael Stubbs & Miles Keeping (2010). Urban Planning and Real Estate
Development. London. Routledge.
Kamarudin Ngah & Jamaludin Mustaffa. (2015). Ahli Majlis dan Kerajaan Tempatan. Dewan
Bahasa dan Pustaka : Kuala Lumpur.
Kamarudin Ngah, Mohd Fitri Abdul Rahman, Zainal Md Zan & Zaherawati Zakaria. (2015).
Development Pressure in South West District Of Penang: Issues and Implications. 2nd
Global Conference on Business and Social Sciences. Bali, Indonesia.
Kamarudin Ngah, Mohd Fitri Abdul Rahman, Zainal Md Zan & Zaherawati Zakaria. (2015). The
Protective Designation For Urban Conservation and Heritage Development in George
Town, Penang. Global Journal of Business and Social Science Review, Vol. 3(1), July-
September 2015: 13-22.
Kamarudin Ngah, Zaherawati Zakaria, Mohd Fitri Abdul Rahman & Mohd Hilmi Hamzah. (2015).
Land Use Planning : Lesson From Penang Development, The 6th International
Conference On Governance, Fraud, Ethics and Social Responsibility 2015 (iConGFESR
2015), Penang.
Kamarudin Ngah, Zaherawati Zakaria, Nazni Noordin & Mohd Zool Hilmie Mohamed Sawal.
(2012). Decision-Making Process at Malaysian Local Government. Lambert Academic
Publishing, Deutschland.
255
Kamarudin Ngah. (1993). Peraturan dan Kawalan Guna Tanah Bandar. Dewan Bahasa dan
Pustaka : Kuala Lumpur.
Kamarudin Ngah, et. al..(2013). Waterfront Development within the Urban Design and Public
Space Framework in Malaysia. Asian Social Science, Vol. 9, No. 10. Canadian Center of
Science and Education. Toronto.
Keith Thomas. (2004). Development Control-Principles and Practice, Routledge, London.
Kementerian Tanah dan Pembangunan Koperasi. (2008). Tanah Rizab Melayu di Semenanjung
Malaysia. http://www.nre.gov.my [13 Mei 2017].
Leiper, N. (1981). Towards a cohesive curriculum in tourism: the case for a distinct discipline.
Annals of Tourism Research 7(2), pp. 255-258.
Lichfield, N. (1978), What is Land Policy, Working Paper 1, International Centre for Land Policy
Studies, London.
Malaysia. (2012). Rancangan Kawasan Khas Pantai Chenang. JPBD. Kuala Lumpur.
Malaysia. (2014). Akta Perancangan Bandar dan Desa 1976 (Akta 172) & Perintah.
International Law Book Services. Petaling Jaya.
Malaysia. (2005). Garis Panduan Perancangan Pembangunan Di Kawasan Persisiran Pantai.
JPBD. Kuala Lumpur.
Michael Pacione.(2009). Urban Geography-A Global Perspective. London. Routledge.
Nijkamp, P. & Perrels, A. (1991). Sustainable Cities in Europe: a Comparative Analysis of Urban
Energy-environmental Policies. London. Earthscan Publications Limited.
Nik Haslinda Nik Hussain. (2010). Enakmen Tanah Rizab Melayu Kelantan dan Pemilikan
Tanah, 1930-40. Jurnal Kemanusiaan 2010 (17):37-64.
Nikmatul Adha Noordin & Kamarudin Ngah. Demokrasi dan Birokrasi Dalam Perancangan
Bandar. Dalam Kamarudin Ngah & Jamaludin Mustaffa. (2016). Komuniti dan Kerajaan
Tempatan. Dewan Bahasa dan Pustaka : Kuala Lumpur.
Rancangan Struktur Negeri Kedah 2020
Rogers, P.P., Jalal, K. F., & Boyd, J.A. (2008). An Introduction to Sustainable Development.
New Delhi. Prentice Hall of India.
Salleh Buang. (2010). Malaysian Torrens System (2nd Edition). Kuala Lumpur : Dewan Bahasa
dan Pustaka.
Suhaya, S., Md. Shafiin, S., & Norlida Hanim, M.S. (2013). Impak pembangunan industri
pelancongan kepada komuniti di Pulau Langkawi. Dalam Persidangan Kebangsaan
Ekonomi Malaysia ke Viii (PERKEM VIII) (Vol. 1, pp. 207-216).
Tim May.(2011). Social Research Issues, Methods and Process. Open University Press.
Berkshire.
Tyler, N. & Ward, M.R. (2011). Planning and Community Development-A Guide for the 21st
Century.W.W. Norton & Company. New York.
Uma Sekaran & Roger Bougie.(2010). Research Methods for Business-A Skill Building
Approach.United Kingdom. John Wiley & Sons Ltd.
Uwe Flick.(2003). An introduction to Qualitative Research. London. Sage Publications Ltd.
Zainal Md Zan & Kamarudin Ngah (2016). Agenda 21 Di Malaysia-Keberkesanan Pelaksanaan.
Kuala Lumpur. Dewan Bahasa dan Pustaka.
256
-GP40-
PENGGAWA DALAM PEMBANGUNAN MASYARAKAT DI JAJAHAN
KOTA BHARU, KELANTAN
Zainal Md Zan dan Nik Mawardi Mohamed
Abstrak
Dalam menghadapi era globalisasi masakini, peranan dan tanggungjawabpemimpin diperingkat

lokaladalah kompleks dan mencabar. Pelbagai isu yang berlegar dalam masyarakat setempat
harus dihadapi oleh pemimpin masyarakat agar pembangunan yang sejahtera dan berterusan
dapat dinikmati. Institusi penghulu atau disebut penggawa di Kelantan juga harus mendepani
isu dan cabaran ini. Kertas ini meneliti isu dan cabaran masakini penggawa di Jajahan Kota
Bharu, Kelantan dalam memainkan peranan mereka. Jajahan Kota Bharu dipilih kerana
merupakan salah sebuah daerah yang mempunyai kepelbagaian corak fizikal, sosio-ekonomi
dan juga demografi penduduk. Kepelbagaian sifat ini sudah pastinya memberikan maklumat
yang pelbagai dalam kajian. Sebanyak 14 Daerah (Mukim jika di negeri selain Kelantan) yang
diketuai oleh Penggawa di Kota Bharu, Kelantan dipilih. Seramai 10 orang Penggawa dipilih
bagi mendapatkan maklumat melalui kaedah temubual bersemuka. Hasil kajian mendapati
penggawa di jajahan Kota Bharu berhadapan dengan beberapa isu dan cabaran dalam
melaksanakan peranannya dalam pembangunan masyarakat. Antaranya isu yang dihadapi
ialahPertindihan tugas antara Penggawa dan Penghulu, campurtangan politik dalam
pentadbiran, kekangan sumber kewangan,kurang Kerjasama Masyarakat, Kekurangan
Kemudahan Teknologi, Kakitangan dan Aktiviti Kemasyarakatan. Namun demikian, dalam
konteks pembangunan komuniti luar bandar, hasil kajian mendapati bahawa Penggawa mampu
mencapai kejayaan dalam memimpin secara berkesan dalam memainkan peranannya.
Kata Kunci: Penggawa, Pembangunan Masyarakat, Kelantan
1. PENGENALAN
Penggawa memikul tanggungjawab besar memastikan isu-isu berkaitan pembangunan

sosio-ekonomi masyarakat ini dapat diselesaikan. Penggawa merupakan pemimpin yang paling
dekat dengan masyarakat dan menghadapi cabaran yang besar dalam melaksanakan
tanggungjawab mereka. Kepimpinan Penggawa amat penting dalam menyatukan mereka dan
membawa mereka ke dalam agenda pembangunan. Namun begitu, kedudukan Penggawa di
kaca mata masyarakat mempunyai kecacatan kerana Penggawa sendiri terikat dengan dasar
kerajaan negeri yang diperintah oleh Pas. Justeru, neutraliti Penggawa adalah terhad dan pada
masa yang sama masyarakat luar bandar amat memerlukan bantuan kerajaan Persekutuan
(Haris, 2009). Menurut Suhana dan Suraiya (2010), hal tersebut meruncing sejak beberapa
dekad dahulu kerana negeri ini dikuasai oleh kerajaan pembangkang. Pelbagai masalah
komuniti setempat yang memerlukan sokongan Penggawa dan Penghulu terencat akibat
257
daripada perbezaan fahaman politik. Kesannya, peranan Penggawa di mata masyarakat

semakin terhakis dan Penggawa menjadi tidak dikenali serta kurang popular. Kebanyakan ahli
masyarakat lebih gemar merujuk kepada Penghulu kampung lantikan Jabatan Pembangunan
Persekutuan kerana mampu menyelesaikan permasalahan yang diutarakan (Haris, 2009).
Perspektif ini akhirnya menimbulkan persoalan isu keupayaan institusi Penggawa sebagai
sebuah organisasi dan kebolehpercayaan terhadap institusi tersebut.
2. KEPIMPINAN PENGGAWA DALAM PEMBANGUNAN MASYARAKAT DI KELANTAN
Struktur pentadbiran di Malaysia terdiri daripadatiga peringkat iaitu peringkat Kerajaan

Persekutuan, Kerajaan Negeri dan Kerajaan Tempatan (Hussain, 1991). Di peringkat kerajaan
negeri, terdapat beberapa peringkat pentadbiran iaitu Daerah, Mukim dan kampung. Namun
demikian, ianya berbeza di Negeri Kelantan kerana peringkat pentadbiran negeri dibahagikan
kepada jajahan, daerah, mukim, dan kampung. Penggawa merupakan seseorang yang diberi
tanggungjawab untuk mengetuai dan menyelia mukim. Di negeri lain, jawatan ini dikenali
sebagai Penghulu. Penggawa merupakan orang perantaraan dalam konteks hubungan
penduduk kampung dengan Kerajaan Negeri. Kepimpinan Penggawa amat penting dalam soal
pembangunan sesebuah kawasan kerana setiap peruntukan yang diberikan kepada Daerah
akan diberikan kepada Penggawa dulu sebelum diagihkan kepada penduduk-penduduk
kampung di bawah mukim kepimpinan beliau (Izzudin, 2013).
Corak pentadbiran politik di negeri Kelantan pada hari ini adalah akibat kesan pengaruh
sejarah zaman lalu pemerintahan di Kelantan. Ini kerana negeri Kelantan pernah berada
dibawah jajahan takluk Siam (Suwannathat-Pian, 1982). Struktur pentadbiran tempatan negeri
Kelantan terpecah kepada lima bahagian iaitu negeri, jajahan, daerah, mukim dan kampung.
Tetapi bagi negeri-negeri lain, tiada pentadbiran peringkat jajahan. Di negeri Kelantan terdapat
dua pemimpin tempatan iaitu penggawa dan juga penghulu yang masing merupakan pemimpin
pada peringkat daerah dan juga mukim (Izzuddin, 2015).Menurut Afifuddin (1973) institusi
penggawa dan institusi penghulu di dalam lipatan sejarahnya merupakan organisasi yang telah
lama sedia ada dalam hierarki politik tradisional Melayu. Justeru itu, dalam pentadbiran
kampung, penggawa dianggap sebagai ―raja kecil‖ atau kadangkala dianggap sebagai ―cultural
broker‖ yang menjadi penghubung antara Sultan dan juga rakyat (Selat, 1983).
Kedudukan penghulu juga turut dianggap penting kerana fungsinya sebagai penyampai
masalah dan kepentingan rakyat kepada pihak yang lebih atas. Sebelum kedatangan, British
Penggawa dikenali dengan nama tok kweng. Menurut Izzudin (2013) Kweng merupakan istilah
yang dipinjam daripada sistem pentadbiran Siam. Manakala penghulu atau ketua kampung
dikenali dengan nama tok nebeng (De Josselin De Jong & Beaglehole, 1977). Walaupun
terdapat beberapa struktur pentadbir lain yang terletak diantara Sultan, penggawa dan
penghulu, namun disebabkan oleh pengaruh kuasa Sultan yang dimiliki pada waktu itu adalah
kuat, maka sebarang arahan kepada penghulu walaupun datang daripada penggawa, tetap
dianggap sebagai arahan daripada pihak Sultan (Izzudin, 2013). Menurut Dollah (1989)
sebarang bentuk pembangunan yang direncanakan oleh pihak Sultan pada peringkat kampung
akan dilakukan melalui bantuan penggawa dan kemudian daripada penggawa arahan
diperturunkan kepada penghulu atau tok nebeng. Semasa pemerintahan Sultan Muhammad II
misalnya, wujud Jabatan Pentadbiran dan Jabatan Keadilan yang menjadi saluran penting
perhubungan Sultan dan rakyat. Di bawah jabatan ini terdapat Ketua Jajahan yang berhubung
secara langsung dengan penggawa (Izzuddin, 2013).
Ahmad dan Muhammed (2011) berpendapat bahawa kini, institusi penghulu mempunyai
tanggungjawab yang besar dalam menggerakkan proses pembangunan di kawasan luar
bandar. Penghulu juga bertanggungjawab dalam hal ehwal pengurusan tanah dan
pembangunan desa (Syed Husin, 1976). Ini adalah berdasarkan kajian-kajian terdahulu
258
berkenaan dengan pemimpin tempatan yang memberi rujukan khusus negeri Kelantan kurang
memberi tumpuan kepada pemimpin penghulu (Rahman, 1985). Penghulu adalah pegawai
yang dilantik oleh kerajaan negeri untuk penghubung dengan masyarakat setempat. Pada masa
yang sama, kerajaan persekutuan yang melaksanakan pembangunan luar bandar turut
mendapatkan khidmat penghulu Hanipah et. al. (2007).
Ahmad dan Muhammed (2011) berpendapat, kini, institusi penghulu mempunyai
tanggungjawab yang besar dalam menggerakkan proses pembangunan di kawasan luar
bandar. Penghulu juga bertanggungjawab dalam hal ehwal pengurusan tanah dan
pembangunan desa (Syed Husin, 1976). Ini adalah berdasarkan kajian-kajian terdahulu
berkenaan dengan pemimpin tempatan yang memberi rujukan khusus negeri Kelantan kurang
memberi tumpuan kepada pemimpin penghulu (Rahman, 1985). Penghulu adalah pegawai
yang dilantik oleh kerajaan negeri untuk penghubung dengan masyarakat setempat. Pada masa
yang sama, kerajaan persekutuan yang melaksanakan pembangunan luar bandar turut
mendapatkan khidmat penghulu Hanipah et. al. (2007). Oleh yang demikian, penghulu
diperlukan untuk menerangkan segala perancangan dan program atau aktiviti yang ingin
dijalankan dalam kawasan seliaan mereka. Justeru itu, kemahiran berkomunikasi seperti yang
dibincangkan di bahagian sebelum ini perlu ada didalam menyampaikan maklumat mengenai
program atau aktiviti yang bakal dilaksanakan oleh kerajaan persekutuan mahupun kerajaan
negeri.
Walaupun, peranan penghulu adalah tidak sebesar seperti pegawai daerah tetapi beliau
memimpin masyarakat di mukimnya yang dikenali oleh beliau. Penghulu perlu menjaga
beberapa penghulu kampung dalam mukim seliaannya (Hussain, 1991). Hal ini disebabkan oleh
penghulu bertanggungjawap terhadap pembangunan di setiap kampung. Maka dengan
demikian, menurut Hussain (1991), konsep peranan penghulu merupakan orang ketiga penting
dalam sesebuah daerah selepas pegawai daerah dan penolongnya. Keistimewaan kedudukan
penghulu ini akan memberikan satu impak ke atas konsep peranan penghulu dalam
membangunkan masyarakat mukimnya. Setiap permasalahan dan urus tadbir mukim terletak di
bawah penghulu. Jika berlakunya kelemahan terhadap peranan penghulu maka hal ini akan
memberikan kesan ke atas sesebuah daerah seterusnya imej negeri tersebut.
Komuniti tradisional di Kelantan telah berubah dari satu zaman di bawah penjajahan
Siam kepada penjajahan British sehingga negara ini mencapai kemerdekaan. Sistem
pemerintahan moden hari ini menyebabkan kebergantungan kepada Penggawa semakin
longgar. Peranan Penggawa dalam masyarakat moden ini kelihatan tidak begitu bermaya dan
menghadapi tadbir urus dalam soal pembangunan komuniti seliaan beliau di luar bandar. Dalam
hal ini, Penggawa dilihat menghadapi cabaran di dalam mengimbangi kehendak birokratik dan
tanggungjawap komuniti.
3. FUNGSI DAN PERANAN PENGGAWA
Secara umumnya, menunjukkan fungsi dan peranan Penggawa utama adalah menjadi
perantara antara kerajaan. Perantaraan Penggawa kebiasaannya dalam tugas-tugas
pentadbiran, pembangunan, kegamaan, keselamatan, masyarakat, kebudayaan, sukan, hal
ehwal tanah dan juga membantu tugas-tugas penguatkuasaan. Di samping membantu kerajaan
dalam menyampaikan maklumat dasar-dasar yang diputuskan untuk disalurkan kepada rakyat.
Penggawa juga memainkan peranan penting menjadi mata telinga kerajaan dalam menangani
masalah sosial, ekonomi, dan keselamatan Daerah. Perkara ini dibuktikan dengan petikan hasil
temubual yang dijalankan terhadap responden yang mengatakan;
Pada pendapat saya, Penggawa diberi tugas-tugas di dalam pentadbiran yang

menghubungkan antara kerajaan dengan rakyat. Biasanya melibatkan tugas di dalam
259
pembangunan, kegamaan, keselamatan, masyarakat, kebudayaan, sukan, hal ehwal tanah

(pungutan hasil tanah/pesaka) dan juga membantu di dalam tugas-tugas penguatkuasaan di
bawah seksyen 425 dan 426 KTN 1965 (Responden 10).
Penggawa ini yang kita sedia maklum, biasanya tugasnya menjadi perantaraan
hubungan rakyat dengan kerajaan melalui Pegawai Daerah untuk disampaikan kepada
kerajaan yang memerintah…. Berkaitan menyampaikan maklumat dasar-dasar yang diputuskan
untuk disalurkan kepada rakyat…. Di samping menjadi mata telinga kerajaan dalam menangani
masalah sosial, ekonomi, dan keselamatan Daerah (Responden 9).
Kalau hendak ikutkan tugas penggawa terlalu banyak, biasanya perantaralah baik dalam
bidang agama, sosial, ekonomi dan politik di peringkat daerah masing-masing. Contohnya
Penggawa Daerah ketua tempat pengurusan banjir, ketua agama daerah, ketua
keselamatandan untuk pindah keluar daerah dan lain-lain lagi (Responden 7).
Oleh demikian jelas menunjukkan bahawa institusi Penggawa adalah salah satu institusi
yang diiktiraf sebagai institusi yang berperanan sebagai penghubung di antara kerajaan dengan
rakyat.
4. PERANAN PENGGAWA KEPADA MASYARAKAT
Dapatan menunjukkan Penggawa memainkan peranan utama kepada masyarakat

dalam menjadi orang tengah untuk menyelesaikan masalah dari segi memberi bantuan kepada
masyarakat miskin, penyampaian dasar-dasar kerajaan terkini, pengesahan dokumen pelbagai,
penasihat dan pendamaian.
Penyelesaian masalah dari segi memberi bantuan kepada masyarakat miskin peranan
yang dimainkan oleh Penggawa dengan memberi bantuan melalui saluran Jabatan Kebajikan
Masyarakat, Majlis Agama Islam, Sumber Kerajaan Negeri, NGO dan lain-lain Agensi. Hal ini
dibuktikan berdasarkan kepada temubual dengan beberapa orang responden yang menyatakan
seperti berikut;
Penggawa ini biasanya membantu masyarakat dengan segala masalah. Antaranya
Penggawa tolong selesaikan dengan angkat permohonan mereka kepada saluran yang untuk
membolehkan rakyat terbela. Contoh bantu rakyat miskin yang tidak ada rumah, angkat kepada
MAIK untuk dapat rumah. Zakat MAIK bagi selesaikan masalah tempat mereka yang miskin
(Responden 7).
Biasa peranan yang dimainkan oleh saya membantu orang miskin yang memerlukan
bantuan melalui saluran Jabatan Kebajikan Masyarakat, Majlis Agama Islam, Sumber Kerajaan
Negeri, NGO dan lain-lain Agensi (Responden 9)
Peranan yang lain ditugaskan kepada Penggawa berkaitan penyampaian dasar-dasar
kerajaan terkini kepada masyarakat sepertimana termaktub dalam bidang tugas yang
diamanahkan. Penyampaian ini melibatkan tugas-tugas pentadbiran, pembangunan,
keagamaan, keselamatan, kemasyarakatan, kebudayaan, pendidikan dan sukan yang
dilaksanakan oleh Penggawa dari masa ke semasa kepada masyarakat. Sepertimana maklum
balas yang diterima semasa temubual yang dilakukan sebelum ini responden menyatakan
seperti berikut;
Penggawa bertanggungjawa memberi sokongan dan kerjasama kepada wakil rakyat
DUN/Parlimen, pegawai-pegawai kerajaan serta agensi-agensi kerajaan. Dasar yang
disampaikan atau dilaksanakan perlu dilaksanakan mengikut tugas-tugas yang diamanahkan
dalam masyarakat (Responden 3)
Jika lihat kepada fail meja, peranan pengawa menyampaikan dasar sepertimana yang
terkandung dalam senarai tugas yang wajib dilakukan oleh Penggawa (Responden 4)
Selain itu, dapatan kajian juga menunjukkan Penggawa juga berperanan membantu
mereka yang memerlukan bantuan seperti Pengesahan Pendapatan bagi yang bekerja sendiri,
260
Pengesahan Sijil dan Dokumen dan menjadi pemudahcara bagi orang ramai bagi Tuntutan
Pesaka Kecil, Urusan Tukar dan Milik Tanah, Permohonan ROW dan sebagainya. Hasil
dapatan ini dibuktikan berdasarkan temubual yang dilakukan sebelum ini menunjukkan
responden menyatakan seperti berikut;
Penggawa ini juga berperanan membantu orang-orang yang memerlukan bantuan
seperti pengesahan pendapatan, pengesahan sijil, dokumen dan juga dokumen-dokumen
berkaitan tuntutan pesaka kecil, urusan tukar dan milik tanah, permohonan ROW dan
sebagainya (Responden 9)
Peranan Penggawa membantu masyarakat mendapatkan dokumen surat beranak/kad
pengenalan bagi mereka yang tercicir berbuat demikian akibat beberapa perkara yang tak
dapat dielakkan (Responden 5)
Analisis kajian juga menunjukkan Penggawa berperanan membantu masyarakat yang
perlukan kepada perkhidmatan nasihat yang bertujuan untuk menyedarkan masyarakat tentang
perkara-perkara yang perlu diselesaikan. Seperti mana yang dinyatakan oleh responden
semasa temubual di lakukan menyatakan perkara seperti berikut;
Sebagaimana di atas, tambahan mengatur aktiviti penerangan bagi memberi kesedaran
orang ramai tentang pelbagai perkara seperti masalah penyakit, keagamaan, sukan dan
sebagainya (Responden 1)
Penggawa membantu memberi nasihat dan pertolongan untuk masyarakat dan perkara
tersebut biasanya akan di bawa ke pihak yang lebih atas (Responden 5)
Peranan yang dimainkan Penggawa di dalam institusi masyarakat antaranya menjadi
orang tengah dalam pendamaian kepada pertikaian terutama mengenai masalah tanah, jalan
dan perbalahan suami isteri. Contohnya perbalahan/pertelingkahan tanah, gejala sosial, isu
infrastruktur dan lain-lain.
Penggawa membantu pendamaian kepada pertikaian terutamanya mengenai masalah
tanah, jalan, perbalahan suami isteri (Responden 5)
5. ISU UTAMA MASA KINI YANG DIHADAPI OLEH PENGGAWA
Penemuan kajian menunjukkan antara isu-isu utama yang dibangkitkan oleh Penggawa
iaitu masalah mengenai pertindahan tugas/kuasa/pangkat, campur tangan politik dan
kekosongan jawatan yang tidak disegerakan. Terdapat beberapa isu utama yang dihadapi oleh
penggawa (Rajah 1). Analisis menunjukkan isu utama yang dihadapi oleh Penggawa hingga
kini mengenaipertindahan tugas/kuasa/pangkat di mana sebanyak lapan (8) orang responden
membincangkan perkara tersebut. Kebiasaannya melibatkan isu pertindihan tugas penggawa
dengan Pentadbir Mukim yang dilantik oleh pihak politik lain dan penghakisan kuasa atau tugas
penggawa telah diambil alih oleh agensi-agensi berkenaan. Menurut responden 8, 9,
menyatakan;
tanggungjawab Penggawa kini pada sebahagian masyarakat telah menurun kerana
penggawa tidak dapat membuat keputusan untuk mambantunya kerana masalah pertindihan
tugas (Responden 8)
tugas penggawa yang dahulunya dilakukan oleh penggawa banyak diambil alih oleh
jabtan-jabatan lain seperti Jabatan Veterina dengan mengurus sendiri pengeluaran permit-
permit sembelih lembu dan kerbau dan Jabatan Kebajikan Masyarakat juga mencari sendiri
orang-orang miskin yang memerlukan bantuan. Ini kerana taraf jawatan penggawa lebih rendah
daripada Ketua-Ketua jabatan yang ada di daerah penggawa sedangkan penggawa merupakan
pengerusi di daerah berkenaan. Oleh yang demikian, rasa hormat telah berkurangan kerana
Ketua Jabatan di Daerah berada pada Gred U=yang lebih tinggi (52,48,44,41,40) sedangkan
penggawa yang mempengerusikan mesyuarat berada di Gred 27(Responden 9)
261
Isu kedua yang dibangkitkan oleh responden yang ditemubual mengenai campur tangan
politik di mana hasil analisis quires menunjukkan sebanyak enam (6) orang responden
menyatakan sedemikian.
Menurut responden 4, 5, 6 pula;
isu utama yang dihadapi oleh institusi penggawa ialah perbezaan fahaman politik di
antara kerajaan negeri dengan kerajaan persekutuan (Responden 4).
secara umumnya isu utama yang dihadapi penggawa masakini ialah banyak perkara
yang sepatutnya melalui penggawa tetapi tidak dibuat sedemikian, sebaliknya dibuat terus di
peringkat atas seperti masalah kerosakkan jalan raya dan kemudahan asas, masalah
kemiskinan, bantuan-bantuan keperluan asas dan lain-lain (Responden 5).
isu utama yang dihadapi oleh institusi Penggawa masakini ialah perebutan tugas dan
kuasa dengan Pentadbir Mukim iaitu orang-orang politik (Responden 6).
Isu utama terakhir pula ialah mengenai isu penggawa dan pembantu penggawa yang
bersara tidak diisi kekosongannya dengan segera. Menurut responden 7;
masalah sekarang ialah kekosongan penggawa tidak diisi segera oleh Suruhanjaya
Perkhidmatan Negeri (SPN). Apabila ada kekosongan penggawa, maka akan terjejas fungsi
penggawa di daerah yang tiada penggawa. Lantaran dengan itu, banyak masalah rakyat yang
tidak dapat diselesaikan kerana ketiadaan penggawa di daerah penggawa yang kosong
tersebut. Oleh itu, kemana lagi rakyat hendak mengadu dan untuk selesaikan masalah mereka
(Responden 7).
Rajah 1: Isu Utama Masa Kini Dihadapi oleh Penggawa
Pertindahan Tugas/Kuasa/Pangkat
ISU UTAMA MASA KINI DIHADAPI
(8)
R1, R3, R4, R5, R6, R8, R9, R10

OLEH PENGGAWA
Campur Tangan Politik

(6)
R3, R4, R5, R6, R7, R8
Kekosongan Jawatan Tidak

Disegerakan
(5)
R1, R2, R3, R7, R10
262
6. ISU-ISU LAIN YANG WUJUD DI DALAM INSTITUSI PENGGAWA
Selain daripada isu-isu utama yang dibangkitkan oleh Penggawa sebelum ini, analisis
kajian juga menunjukkan terdapat isu-isu lain yang perlu diberi perhatian bagi menjadikan
institusi Penggawa terus menjadi relevan pada masa kini. Antara isu-isu lain yang ditekankan
oleh responden berkaitan;
i. Tidak boleh membuat keputusan
Kadang-kala sukar membuat keputusan dalam hal-hal yang berkaitan tugas (Responden 9).
ii. Kekurangan Peruntukan
sebelum PAS memerintah Kelantan, segala projek kemudahan asas seperti jalan, Pejabat
Tanah Jajahan memberi amanah kepada penggawa untuk menguruskannya. Kini ianya telah
diambil alih oleh Pejabat Adun untuk melaksanakan tugas baik pulih jalan di daerah
(Responden 3).
iii. Kurang Kerjasama Masyarakat
Kurangnya kerjasama dari orang ramai. Masayarakat kini sibuk dengan urusan masing-masing
(Responden 2).
iv. Kekurangan Kemudahan Teknologi, Kakitangan dan Aktiviti Kemasyarakatan
isu-isu lain yang wujud ialah tidak mempunyai kemudahan internet untuk mangambil tindakan
segera apabila anak mukim membuat aduan atau mudah secara “online”. serta kurangnya
kemudahan teknologi maklumat seperti internet, computer riba, mesin fax di pejabat penggawa
menyebabkan maklumat lambat disampaikan kepada kerajaan seperti pendaftaran “E-Tegar”
dan sebagainya. (Responden 10).
v. Masalah Urusan Pengesahan/Cop Dokumen Pelbagai
isu-isu yang wujud ialah kekosongan jawatan penggawa dan peruntukan berkurangan.
Ketiadaan penggawa sukar untuk membuat pengesahan apa-apa borang yang perlu
ditandatangani oleh Penggawa (Responden 2).
vi. Keadaan Geografi
isu keadaan geografi seperti bencana alam dan sebagainya, sosio-politik dalam Daerah
pentadbiran dan juga lapisan masyarakat (Responden 4)
7. HALANGAN-HALANGAN YANG BERLAKU KEPADA ANDA SEBAGAI SEORANG

PENGGAWA
Hasil analisis tree nodes yang dijalankan menunjukkan terdapat tujuh halangan yang
dihadapi oleh Penggawa semasa menjalankan tugas. Tujuh halangan tersebut (mengikut
keutamaan) seperti berikut;
a) Pertindihan Kuasa dan Pembahagian Kuasa Tidak Selaras
Menurut Responden 10 mengatakan halangan yang saya hadapi ialah terdapat halangan dalam
menjalankan aktiviti daerah kerana berlaku pertindihan kuasa dari segi politik, di setiap daerah
terdapat dua yang dilantik oleh kerajaan Negeri dan persekutuan yang dilantik untuk menjaga
hal-ehwal rakyat mengikut idealogi politik.
b) Campur Tangan Politik
Menurut Responden 8 pula mengatakan halangan yang berlaku kepada saya adalah campur
tangan politik, mereka membuat dasar mengambil alih tugas-tugas penggawa kerana ingin
menaikkan parti masing-masing. Begitu juga yang diberitahu oleh Responden 6 yang
menyatakan saya menghadapi masalah campur tangan orang politik, tidak boleh membuat
keputusan dan kuasa yang terhad. Ini menyukarkan saya menjalankan tugas.
c) Peruntukan disediakan Terhad
Menurut Responden 9,masalah memilih penerima bantuan, dimana orang yang layak diberi
bantuan ramai sedangkan peruntukkan adalah terhad serta kurangnya kerjasama yang
263
diberikan oleh penghulu bagi memungut data mukim dan kampung, sedangkan maklumat yang
dikehendaki diberi dalam tempoh yang singkat.
d) Kekurangan Kemudahan Pejabat dan Kakitangan
Menurut Responden 5, saya lihat kemudahan yang ada di pejabat tidak mencukupi ini
menyebabkan perjalanan tugas menjadi terbantut. Begitu juga pendapat yang dikemukan oleh
Responden 3 yang menyatakan halangan-halangan yang saya hadapi ialah kemudahan pejabat
penggawa yang tidak lengkap serta tiada dana khas untuk melaksanakan program.
e) Kurangnya Kerjasama Masyarakat
Menurut Responden 4, halangan-halangan yang berlaku kepada saya adalah hubungan antara
penghulu dan masyarakat serta tidak mendapat kerjasama yang sepenuhnya. Seterusnya,
penggawa daripada
f) Pengganti Penggawa Tidak Disegerakan
Menurut Responden 7, mengatakan, apabila pembantu penggawa pencen dan lambat isi
pengganti di daerah menyebabkan banyak tugas-tugas pembantu seperti hantar notis-notis dan
apa-apa arahan dari Pejabat Tanah terpaksa di selesaikan sendiri oleh penggawa. Ini akan
membantutkan tugas-tugas penggawa yang banyak.
g) Masalah Tiada Berkelulusan
Menurut Responden 8 menyatakan kekurangan yang ada pada diri saya adalah tidak ada
kemahiran dalam menyelesaikan masalah dan kelayakkan masuk SPM/STP/diploma tidak
dihormat oleh ketua jabatan di peringkat daerah yang lebih tinggi kelayakkannya, seperti
pengetua sekolah, pegawai kesihatan, sedangka penggawa sebagai Pegawai Tadbir Daerah
8. MENGHADAPI ISU DAN CABARAN SEMASA
Dapatan menunjukkan terdapat enam elemen yang digunakan oleh Penggawa dalam
menghadapi isu dan cabaran semasa (Rajah 2). Elemen-elemen tersebut iaitu memerlukan
kreativiti dan penggunaan teknologi terkini, perbincangan dengan agensi-agensi kerajaan/pihak
atasan, penerangan kepada masyarakat,sabar dan ikhlas, sentiasa belajar dan program tetap
dilaksanakan walaupun kurang tugasan
Analisis menunjukkan elemen utama berkaitan memerlukan kreativiti dan penggunaan
teknologi terkini di mana sebanyak lima (5) orang responden menyatakan sedemikian bagi
menyelesaikan isu tersebut. Kebanyakkan penggawa akan mencari jalan dengan cara kreativiti
bagi menyelesaikan masalah tersebut berdasarkan kepada auotirti yang ada dan kebiasaanya
kebanyakan isu dapat diselesaikan dan Penggawa berkorban membayar sendiri dalam
melanggan internt supaya maklumat dapat disalurkan kepada kerajaan dengan segera. Perkara
ini dibuktikan berdasarkan kepada temubual yang dilakukan di mana responden menyatakan
seperti berikut;
Biasanya saya mencari pendekatan yang terbaik berdasarkan kreativiti yang ada dan mengikut
kuasa dan tugas-tugas yang dipertangungjawabkan (Responden 4)Kita perlu menggunakan
kreativiti sendiri untuk menyelesaikan masalah ini dan kebanyakan ianya dapat diselesaikan
(Responden 5)Untuk tidak ketinggalan dari segi teknologi masa kini Penggawa berkorban
membayat sendiri dalam melanggani internet bagi memudahkan maklumat disalurkan kepada
kerajaan melalui Ketua Jajahan dan lain-lain (Responden 9)Elemen kedua yang digunakan oleh
Penggawa dalam menyelesaikan isu-isu yang dibangkitkan dengan mengadakan perbincangan
dengan agensi-agensi kerajaan mahupun pihak atasan di mana sebanyak empat (4) orang
responden menyatakan sedemikian. Seperti mana menurut responden 7 dan 10 menyatakan;
Kesatuan Penggawa Kelantan kebiasannya pergi terus berurusan dengan pihak atasan
seperti Bahagian Sumber Manusia SUK. Begitu juga terus kunjung hormat dekat Pengarah JPP
264
Kelantan untuk bincangkan masalah yang berkaitan. Penyelarasan perlu untuk melicinkan
gerak kerja dan rakyat mudah berurusan di pejabat Penggawa (Responden 7)
Kebiasaanya saya pergi berbincang dengan agensi-agensi kerajaan yang berkait rapat
dengan masalah tersebut seperti isu wabak denggi saya jumpa Jabatan Kesihatan Daerah
(Responden 10)
Elemen ketiga dalam menyelesaikan masalah, Penggawa akan memberi penerangan

kepada masyarakat mengenai tugas-tugas yang dilakukan oleh Penggawa dan Penggawa
memberi penjelasan bagaimana cara untuk menyelesaikan aduan dengan secepat mungkin.
Seperti mana menurut Responden 1 menyatakan;
Memberi penerangan kepada masyarakat tentang tugas-tugas Penggawa dan halangan

yang dihadapi kerana pertindihan kuasa dan berusaha menyelesaikan masalah tersebut
secepat mungkin (Responden 1)
Selain itu, elemen-elemen lain yang perlu ada dalam menyelesaikan isu-isu yang
disuarakan oleh rakyat iaitu;
a) Bersikap sabar dan ikhlas. Seperti mana menurut Responden 8 menyatakan dalam
menyelesaikan sesuatu isu perlu kuatkan tahap kesabaran dan memberi pertolongan
seikhlasnya. Berjaya atau tidak terpulang kita sudah berusaha.
b) Sentiasa belajar. Menurut Responden 8isu-isu ini membuatkan kita dapat belajar
tentang sesuatu perkara dan pada masa akan datang berlaku isu yang seperti berlaku sebelum
ini kita dapat tangani kerana kita telah belajar perkara tersebut sebelum ini.
c) Program tetap dilaksanakan walaupun kurang tugasan. Seperti mana menurut
Responden 2 menyatakan walaupun kurang mendapat kerja atau aduan isu yang dibangkitkan
segala perancangan program yang ditetapkan sebelum ini diteruskan sehingga kita mencapai
matlamtnya.
Rajah 2: Halangan-Halangan Yang Berlaku Kepada Anda Sebagai Seorang Penggawa
265
9. KESIMPULAN
Jelaslah bahawa Penggawa menghadapi pelbagai isu dalam melaksanakan tugasan mereka.
Isu utama yang dihadapi adalah masalah peruntukan kewangan yang kecil dalam
menggerakkan aktiviti kecil seperti gotong-royong dan bantuan segera kepada rakyat di
kawasan mereka. Selain itu, terdapat juga isu pertindihan tugas penggawa dengan Pentadbir
Mukim yang dilantik oleh pihak politik lain. Ini menyebabkan wujud penghakisan kuasa atau
tugas Penggawa telah diambil alih oleh agensi-agensi berkenaan selain kurangnya kerjasama
daripada masyarakat tempatan. Pembangunan kepimpinan komuniti amat diperlukan dalam
konteks kaca masyarakat luar bandar yang moden dan berdaya saing. Oleh yang demikian,
Penggawa perlulah lenih proaktif menjalankan tugasan dalam membangunkan masyarakat
setempat supaya tidak ketinggalan. Komuniti pula sebaliknya perlu memberikan komitmen
kepada visi dan misi penggawa dalam menggerakkan pembangunan dan pembentukan masa
depan mereka.
266
RUJUKAN
Hasmah Abu Zarin, Ahmad Ariffian Bujang & Mohd Fildaus Mohamed.(2008). Kesan
Pembangunan Kolej Universiti Teknologi Tun Hussien Onn (Kuittho) Terhadap Keperluan
Perumahan Kakitangan Kajian Kes: Parit Raja, Batu Pahat, Johor. Laporan penyelidikan
yang tidak diterbitkan, Fakulti Kejuruteraan dan Sains Geoinformasi,Universiti Teknologi
Malaysia.
Institut Kemajuan Desa (INFRA). (1996). Gerakan Desa Wawasan: Ke Arah Transformasi
Kedua Luar Bandar. Institut Kemajuan Desa (INFRA): Kementerian Pembanbangunan
Luar Bandar.
Kementerian Kemajuan Luar Bandar dan Wilayah. (2010). Pelan Induk Pembangunan Luar
Bandar. Putrajaya: Kementerian Kemajuan Luar Bandar.
Kementerian Pembangunan Luar Bandar dan Wilayah. (2010). Garis Panduan Tatacara Kerja
JKKK. Kuala Lumpur.
Koharuddin Balwi. (2005). Pembangunan Luar Bandar di Malaysia: Gerakan Desa Wawasan
(GDW) Sebagai Mekanisme Pembangunan Masyarakat Luar Bandar. Jurnal Teknologi,
42(E), 31–48.
Maimunah Ismail. (1999). Pengembangan Implikasi Ke Atas Pembangunan Masyarakat (Edisi
Ke -2). Kuala Lumpur: Dewan Bahasa dan Pustaka.
Mohd Izzuddin Ramli. (2013). Politisasi Pemimpin Bawahan Dalam Pentadbiran Negeri:
Rujukan Khusus Institusi Penghulu/Ketua Kampung dan Penggawa di Kelantan.Social
Sciences Postgraduate National Seminar. Gelugor: Universiti Sains Malaysia.
Yusof Abdullah. (2003). Keberkesanan Fungsi Jawatankuasa Kemajuan dan Keselamatan
Kampung (JKKK) dalam Pembangunan Luar Bandar: Satu Kajian Kes. Tesis Ijazah
Doktor Falsafah yang tidak diterbitkan, Sekolah Pengajian Siswazah, Universiti Putra
Malaysia.
Yusof Abdullah, Noor Rahamah Abu Bakar, Junaenah Sulehan, Abd Hair Awang & Ong P Uay
Liu. (2011). Komunikasi dan Pembangunan Komuniti Peringkat Desa: Berkongsi
Pengalaman antara Indonesia dengan Malaysia. Jurnal Melayu, 6, 227-237.
Zainal Md Zan. (2012) Keberkesanan Perlaksanaan „Local Agenda 21‟ di Malaysia: Kajian kes
Majlis Perbandaran Seberang Perai (MPSP), Pulau Pinang.
-GP41-
PROGRAM TRANSFORMASI EKONOMI PEKAN SEMPADAN DI
PERSEMPADANAN MALAYSIA-THAILAND KE ARAHPEMBANGUNAN
EKONOMI LESTARI DAN BERPENDAPATAN TINGGI
Prof. Madya Abdul Rahim Anuar, dan Prof. Madya Dr. Azhar Harun
h.azhar@uum.edu.my
Abstrak
Pembangunan di wilayah perbatasan akan mengukuhkan lagi aspek sekuriti di perbatasan.
Dalam pada itu, kegiatan ekonomi informal di perbatasan boleh diinstitusikan dengan lebih
formal dan mudah dipantau.. Kegiatan sosioekonomi yang bersifat ancaman bukan tradisional
(non traditional security threat) boleh dibanteras dengan/oleh kedua-dua pihak pemerintah
267
dengan lebih efektif. Kegiatan ekonomi lintas batas boleh dikembangkan dan mencipta peluang
pekerjaan dan perniagaan di wilayah perbatasan. Kajian ini akan menumpukan kepada
sempandan Malaysia-Thailand. Walau bagaimanapun ekonomi lintas pekan sempadan
berkembar di antara Malaysia-Thailand, adalah sedikit walaupun terdapat 7 pekan sempadan
berkembar yang utama di antara sempadan Malaysia-Thailand. Objektif kajian ini adalah untuk
mengenal pasti fundamental ekonomi di pekan sempadan berkembar serta mencadangkan
bidang ekonomi di pekan sempadan berkembar yang berpotensi dibangunkan sebagai Zon
Ekonomi Sempadan Eklusif (Special Border Ekonomi Zone, SBEZ). Metodologi kajian adalah
berasaskan primari dan secondary dan bersifat kes studi, dimana satu kawasan senpandan
yang aktif dan terpilih akan dibincang dalam laporan ini, iaitu kawasan Rantau panjang,
Kelantan (Malaysia) – Sungai Golok, Narathiwat (Thailand). Kajian mendapati, aktiviti ekonomi
lintas sempadan antara Sg. Kolok dan Rantau Panjang adalah aktif dengan jumlah dagangan
meningkat dalam tempoh kajian. Ini memberi kesan limpahan kepada ekonomi sempadan
masing-masing dengan mewujudkan peluang pekerjaan, peningkatan pendapatan dan
pengurangan kadar kemiskinan. Bagaimanapun, ekonomi lintas sempadan juga mendorong
kepada aktiviti ekonomi penyeludupan dengan tujuan untuk mengelak barang dikenakan cukai
atau barang yang dilarang oleh kerajaan masing-masing.
Kata Kunci : Pekan sempadan, Zon Ekonomi Sempadan Eklusif, Ekonomi penyeludupan
1. PENGENALAN
Tata kelola perbatasan (border governance) adalah penting bagi negara yang
berbatasan dengan negara lain secara darat atau maritim atau kedua-duanya sekali. Aspek
sekuriti adalah perkara yang penting dalam tata kelola perbatasan bagi menjaga keamanan dan
kedaulatan negara. Pada umumnya, aspek sekuriti mendominasi pembangunan dalam tata
kelola perbatasan. Namun, pembangunan di wilayah tidak boleh diabaikan. Pembangunan di
wilayah perbatasan akan mengukuhkan lagi aspek sekuriti di perbatasan. Dalam pada itu,
kegiatan ekonomi informal di perbatasan boleh diinstitusikan dengan lebih formal dan mudah
dipantau.. Kegiatan sosioekonomi yang bersifat ancaman bukan tradisional (non traditional
security threat) boleh dibanteras dengan oleh kedua-dua pihak pemerintah dengan lebih efektif.
Kegiatan ekonomi lintas batas boleh dikembangkan dan mencipta peluang pekerjaan dan
perniagaan di wilayah perbatasan
Malaysia berbatasan darat dan maritim dengan negara Thailand, Indonesia dan Brunei.
Jarak perbatasan Malaysia-Thailand dari timur ke barat ialah kira-kira 656 km. Dari jumlah
tersebut, sejauh 551 km adalah perbatasan darat (land boundary) manakala 105 km adalah
perbatasan sungai, iaitu Sungai Golok, Kelantan. Negeri yang bersempadanan dengan
Thailand negeri Perlis, Kedah, Perak sehingga ke Kelantan berbatasan darat dan sungai
dengan provinsi di selatan Thailand dari Satun, Songkhla, Yala dan Narathiwat. Terdapat tujuh
Pos Lintas Batas utama antara Malaysia dengan Thailand iaitu Wang Kelian-Wang Prachan,
Padang Besar-Padang Besar, Bukit Kayu Hitam-Danok, Durian Burung-Ban Prakop, Pengkalan
Hulu-Betong, Bukit Bunga- Ban Buketa, Rantau Panjang-Sg. Kolok, dan Pengkalan Kubur-Tak
Bai.
268
2. PERSOALAN KAJIAN
Kajian mengenai ekonomi lintas pekan sempadan berkembar di antara Malaysia-

Thailand, adalah sedikit walaupun terdapat 7 pekan sempadan berkembar yang utama di antara
sempadan Malaysia-Thailand. Pekan sempadan pada amnya adalah kurang membangun
berbanding wilayah yang berada atau berhampiran dengan arus pembangunan negara.
Pembangunan wilayah di sempadan adalah tidak seperti rancangan pembangunan wilayah
umum kerana kedudukannya yang berada di sempadan melibatkan isu keselamatan dan
sekuriti.
Pendekatan pembangunan di sempadan yang strategik dengan pertimbangan pembangunan
dan latar belakang ekonomi wilayah sempadan adalah penting untuk menjamin perkembangan
dan kemapanan pembangunan lintas sempadan. Kelebihan komparatif di wilayah sempadan
dari segi sosial, ekonomi dan alam sekitar akan dapat mencorak dasar pembangunan yang
sesuai untuk wilayah sempadan dan memanfaatkan wilayah sempadan dan penduduk
tempatannya. Ini boleh memberi kesan limpahan ekonomi kepada pekan sempadan di negara
jiran – Thailand, Brunei dan Indonesia.
Oleh itu persoalan utama dalam kajian ini ialah:

i. Apakah fundamental ekonomi yang sedia ada dan berpotensi di pekan
sempadan berkembar?
ii. Apakah bidang aktiviti ekonomi yang utama di pekan sempadan berkembar yang
berpotensi dibangunkan untuk pekan sempadan mencapai status wilayah
berpendapatan tinggi?
3. OBJEKTIF KAJIAN
Seiring dengan persoalan kajian, objektif kajian ini ialah:

i) Mengenalpasti fundamental ekonomi di pekan sempadan berkembar.
ii) Mencadangkan bidang ekonomi di pekan sempadan berkembar yang
berpotensi dibangunkan sebagai Zon Ekonomi Sempadan Eklusif (Special
Border Ekonomi Zone, SBEZ)
4. METODE KAJIAN
Kajian berasaskan primari dan secondari data adalah bersifat kajian kes dengan
menumpukan pekan sempadan terpilih antara Malaysia-Thailand.
1. Wang Kelian, Perlis (Malaysia) – Wang Prachan, Satul (Thailand),

2. Padang Besar,Perlis (Malaysia) – Padang Besar, Songkhla (Thailand),
3. Bukit kayu hitam, Kedah (Malaysia) – Dan Nok, Songkhla (Thailand),
4. Durian Burung, Kedah (Malaysia) – Dan Prakob, Songkhla (Thailand),
5. Pengkalan Hulu, Perak (Malaysia) – Betong, Yala (Thailand),
6. Bukit Bunga, Kelantan (Malaysia) – Weng, Narathiwat (Thailand),
7. Rantau panjang, Kelantan (Malaysia) – Sungai Golok, Narathiwat (Thailand),
8. Pengkalan kubur, Kelantan (Malaysia) – Takbai, Narathiwat (Thailand),
Daripada 8 pekan sempadan seperti di atas sebanyak empat (4) pekan rentas
sempadan yang berbeza wilayahtelah dipilih dalam kajian ini, iaitu (1), (3), (5) dan (7).
Walau bagaimanapun hanya 1 kawasan senpandan yang aktif akan dibincang dalam
269
laporan ini, iaitu kawasan Rantau panjang, Kelantan (Malaysia) – Sungai Golok,
Narathiwat (Thailand),
4.1 Analisis Tinjauan
Kajian ini menggunakan analisis tinjauan (scoping analysis)

(Escalada2009, Arksey & O‘Malley 2005) untuk menganalisis kekuatan dan
kelemahan fundamental ekonomi di kawasan sempadan. Potensi ekonomi di
wilayah sempadan boleh dikenalpastikan dengan meneliti literatur, data sejarah,
laporan dan mengumpul data primer dan sekunder untuk meninjau isu
pelaksanaan, menyediakan kefahaman ke atas pemasalahan itu, dan
membangunkan strategi bersepadu untuk menangani masalah yang berbangkit
daripada perjanjian itu. Kaedah SWOT (kekuatan, kelemahan, peluang,
ancaman) adalah teras kepada pendekatan analisis tinjauan.
Seterusnya, pendekatan pembangunan ekonomi lestari menerusi
integrasi ekonomi wilayah dalam bentuk Zon Ekonomi Sepadan Eksklusif boleh
diaplikasi untuk memastikan ekonomi pekan sempadan berkembar itu mapan
dan lestari. Penyelidik juga membuat pengamatan dan pemerhatian secara
langsung di lokasi kajian untuk mengenali dengan lebih dekat profil sosial dan
ekonomi kawasan kajian. Ini boleh mengukuh lagi analisis kajian.
4.2 Data sekunder
Data sekunder dalam bentuk laporan dan atas talian (online) diperolehi
daripada agensi di Malaysia ialah Jabatan Perangkaan Malaysia, Jabatan
Kastam Diraja Malaysia, Jabatan Imigresen Malaysia, Unit Perancangan
Ekonomi, Majlis Daerah, Pejabat Daerah. Di selatan Thailand ialah dari Sungai
Kolok Municipality Office, Sungai Kolok Customs House, Narathiwat, Thailand,
Sungai Kolok Immigration Checkpoint, dan National Statistical Office, Songhkla,
Thailand.
5. KEPENTINGAN KAJIAN
Dapatan kajian ini dapat ketengahkan isu-isu pembangunan yang berdepan dengan
penduduk di wilayah sempadan dan dalam pada itu dapat menentukan tahap aktiviti ekonomi
antara pekan sempadan. Pembangunan SBEZ adalah antara strategi pembangunan yang boleh
merapatkan jurang pembangunan antara pekan sempadan dan meningkatkan aktiviti ekonomi
rentas sempadan. Aliran masuk modal ke SBEZ akan menwujudkan peluang pekerjaan dan
perniagaan kepada penduduk ekonomi tempatan di sempadan.
6. PENEMUAN KAJIAN (Malaysia-Thailand)
Peta 15 menunjukkan pekan sempadan antara Malaysia-Thailand. Terdapat lapan

pekan sempadan antara Malaysia-Thailand. Sempadan Malaysia-Thailand terdiri dari
sempadan darat dan sungai. Sempadan darat adalah dari Bukit Batu Putih (Perlis) hingga Bukit
270
Bunga (Kelantan) dengan panjang 551.1 km. Manakala dengan sungai ialah dari Bukit Bunga
(Kelantan) hingga Pengkalan Kubor (Kelantan) dengan panjang sungai 95 km.
Penentuan sempadan antarabangsa Malaysia-Thailand berasaskan kepada Triti
bertarikh 10 Mac 1909 yang ditandatangani di antara Great Britain dan Siam. Persetujuan untuk
menandai dan mengukur sempadan antarabangsa Malaysia dan Thailand telah dibuat dengan
menandatangani Memorandum Persefahaman di Bangkok, Thailand pada 8 September 1972 .
Di antara lapan pekan sempadan, kajian ini memfokus kepada pekan sempadan
Rantau Panjang (Kelantan) – Sg. Kolok (Nartihawat, Thailand).
Peta 15: Pekan sempadan Malaysia-Thailand
Sumber: www.google.com.my/map
6.1 Rantau Panjang-Sg. Kolok
Negeri Kelantan mempunyai 10 jajahan dan pekan Rantau Panjang terletak dalam
mukim Rantau Panjang dan di bawah pentadbiran jajahan Pasir Mas.30Pekan Rantau Panjang
adalah kira-kira 40 km ke barat daya bandar Kota Bharu (ibu kota negeri Kelantan). Manakala
negara Thailand mempunyai empat pentadbiran wilayah utama: Utara, Timur Laut, Tengah dan
Selatan. Selatan Thai mempunyai 14 jajahan dan Narathiwat adalah satu daripadanya.31 Mukim
30
Jajahan di Kelantan terdiri daripada jajahan (1) Bachok, (2) Gua Musang, (3) Jeli, (4) Kota Bharu, (5) Kuala Krai, (6)
Machang, (7) Pasir Mas, (8) Pasir Putih, (9) Tanah Merah dan (10) Tumpat. Jajahan Pasir Mas mempunyai 10
daerah (1) Alor Pasir, (2) Kubang Gadong, (3) Rantau Panjang,( 4) GualPeriok, (5) Kangkong, (6) Chetok,( 7) Bunut
Susu (8). Kubang Sepat ( 9).Pasir Mas, dan (10) Kuala Lemal. Daerah Rantau Panjang pula mempunyai 7 mukim
iaitu Rantau Panjang, Lubok Gong, Gual Nering, Lubok Setol, Telaga Mas, Bakat dan Rahmat.
31
Selatan Thailand meliputi 14 wilayah pentadbiran (1) Chumphon,(2) Krabi,(3) Nakhon Si Thammarat, (4)
Narathiwat, (5) Pattani, (6) Phang Nga, (7) Phatthalung, (8) Phuket, (9) Ranong, (10) Satun, (11) Songkhla, (12)
Surat Thani, (13)Trang dan (14) Yala.
271
Sg. Kolok adalah satu daripada 13 mukim di bawah pentadbiran jajahan Narathiwat.32 Pekan
utama bagi mukim Sg. Kolok ialah Sg. Kolok, yang mengambil nama sama dengan mukimnya.
Kelantan mengikut Jajahan Pasir Mas Kedudukan pekan Rantau

jajahan mengikut daerah Panjang dalam daerah Pasir Mas
Sumber: http://jaguh.org/portal/ Sumber: google map
metroroomates.com
Peta 16: Kelantan, Jajahan Pasir Mas dan Pekan Rantau Panjang
Narathiwat mengikut Kedudukan pekan Sg, Peta Jambatan Sg. Kolok-

mukim Kolok dalam mukim Sg. Rantau Panjang
Sumber: mapsofworld.com Kolok Sumber: google map
Sumber: google map
Peta 17: Narathiwat dan Pekan Sg. Kolok
Jumlah penduduk pekan Rantau Panjang dianggarkan 3,864 orang (2010) dan
menyumbang 2% daripada keseluruhan penduduk Pasir Mas. Majoriti daripada penduduk
pekan Rantau Panjang adalah etnik Melayu (92%). Bagi pekan Rantau Panjang, sektor
perniagaan runcit dan borong adalah aktiviti ekonomi yang penting. Industri pelancongan turut
menyumbang kepada kepesatan ekonomi Rantau Panjang berikutan kewujudan Zon Bebas
Cukai di pekan tersebut yang dibuka pada tahun 2002.
Bagi wilayah Narathiwat, jumlah penduduknya ialah 719,930 orang (2008)dan daerah
Sg. Kolok ialah 72,426 orang. Penduduk di pekan Sg. Kolok ialah 39,564 orang. Kira-kira 75%
daripada penduduk Narathiwat beragama Islam (Melayu Patani), 20% Buddha dan selebihnya
32
Wilayah Narathiwat terdiri daripada 13 daerah (1) Mueang Narathiwat, (2) Tak Bai, (3) Bacho, (4) Yi-ngo, (5) Ra-
ngae, (6) Rueso, (7) Si Sakhon, (8) Waeng, (9) Sukhirin, (10) Sg. Kolok, (11) Sg. Padi, (12) Chanae, dan (13) Cho-
airong.
272
Kristian dan penganut agama lain.33 Majoriti daripada penduduk pekan Sg. Kolok mempunyai
saudara mara dan hubungan kekeluargaan di Kelantan. Malah, ada di kalangan mereka
mempunyai dwi warga negara iaitu Malaysia dan Thailand.
Aktiviti ekonomi wilayah Narathiwat menumpu dalam sektor pertanian, iaitu 60%
daripada jumlah pengeluaran ekonomi Narathiwat dan bakinya (40%)adalah dalam sektor
bukan pertanian. Hasil pertanian yang utama ialah padi, getah dan perikanan. Sumbangan
sektor perkilangan dalam jumlah pengeluaran Narathiwat adalah kecil, 5%.Bagi pekan Sg.
Kolok, sesuai dengan kedudukannya sebagai pekan lintas sempadan, aktiviti ekonomi di pekan
Sg. Kolok lebih menumpu kepada sektor perdagangan dan perniagaan runcit dan borong.
Industri yang berkaitan dengan pelancongan seperti hotel dan restoran adalah juga penting.
Berdasarkan data tahun 2008, GDP Narathiwat ialah kira-kira RM5 bilion. (atau 51 bilion
Baht) dengan pendapatan per kapita RM6,569 (atau 67,511 Baht).Berdasarkan petunjuk
pendapatan per kapita, Narathiwat berada pada kedudukan yang ke-12 daripada 14 wilayah
dalam wilayah Selatan Thailand. Kedudukan itu menunjukkan Narathiwat adalah wilayah
mundur. Wilayah yang paling maju di Selatan Thailand ialah Phuket yang terkenal dengan
industri pelancongannya.
Pekan Rantau Panjang diisytiharkan sebagai Zon Bebas Cukai (ZBC) pada tahun
2002.ZBC itu mempunyai keluasan 1 hektar. Terdapat 1,808 peniaga di ZBC Rantau Panjang
(Majlis Daerah Pair Mas 2013).ZBC Rantau Panjang dibuka dari 8 pagi hingga 6 petang. Pada
musim cuti sekolah, pekan Rantau Panjang adalah musim yang paling sibuk di Kelantan. Pasar
ini menyediakan barangan yang murah daripada selatan Thailand. Majoriti barang yang dijual di
ZBC Rantau Panjang adalah buah-buahan, sayuran, pakaian, pinggan mangkuk, periuk dan
kuali, aksesori perkahwinan dan barang permainan daripada Selatan Thailand. Barangan yang
dikenakan cukai adalah barangan buatan Thailand yang dibeli secara borong atau pada kuantiti
yang banyak seperti selimut (jenama Toto), beras, dan pinggan mangkuk. Lazimnya, barang
seperti ini dikecualikan daripada cukai jika untuk kegunaan sendiri.34
Kehadiran pasar minggu di pekan Mundok (Selatan Thailand)telah memberi saingan
kepada aktiviti perniagaan di ZBC Rantau Panjang sehingga boleh menjejaskan pendapatan
perniagaan.35 Pelancong menumpu ke pasar Mundok kerana tiada kawalan imigresen ke pekan
Mundok dan tiada dikenakan cukai 10% ke atas setiap pembelian barangan berbanding di ZBC
Rantau Panjang. Oleh itu, harga ditawarkan di pasar Mundok lebih murah dan menjadi tarikan
pelancong tempatan, khususnya penduduk Pasir Mas (Berita Harian, 28 September 2011).
Kini pelancong tidak dibenarkan masuk secara bebas ke pekan Munduk melalui
pangkalan haram bagi menjaga keselamatan pelancong dan mengekalkan aktiviti ekonomi
tempatan ZBC Rantau Panjang. Pelancong yang mengingkari larangan tersebut boleh
dikenakan tindakan mengikut Akta Imigresen 1959 Seksyen 6(3) yang memperuntukkan
kompaun sebanyak RM10,000 atau lima tahun penjara atau kedua-duanya sekali. Menurut
Pejabat Imigresen, tiga pintu masuk utama yang sah ialah Rantau Panjang (Pasir Mas), Bukit
Bunga, (Tanah Merah) dan Pengkalan Kubur(Rabiatul, 2012).
Jadual 6 menunjukkan bilangan pelancong ke jajahan Pasir Mas yang melalui CIQ
Rantau Panjang. Sebahagian besar daripada pelancong adalah pelancong antarabangsa.
Destinasi utama pelancong tempatan dan asing adalah ZBC Rantau Panjang. Bagi tempoh
33
Population Information Centre 2011
34
Mengikut Perintah Duti Kastam (1988) dan Akta Zon Bebas (1990), semua barang bercukai yang dibeli dalam ZBC
adalah tertakluk kepada kadar cukai sebanyak 10% .
35
Pekan Mundok yang terletak di pinggir Sungai Golok Thailand amat terkenal. Jika dari Malaysia Pekan Mundok ini
terletak di seberang sungai Bukit Lata, atas sedikit pada Kg Terusan (jika dari Rantau Panjang), iaitu di
jalan lama Pasir Mas - Rantau Panjang.
273
2005-2007, purata bilangan pelancong yang melalui CIQ Rantau Panjang ialah 1.4 juta (88%
daripada jumlah pelancong) berbanding 0.2 juta (atau 12%).Purata perbelanjaan
sehari/pelancong pada tahun 2007 ialah RM362.00.36
Jadual 6 : Ketibaan Pelancong ke Jajahan Pasir Mas dan Rantau Panjang
Tahun Pelancong Pelancong Jumlah

Tempatan Antarabangsa -
melalui Pos
Imigresen Rantau
Panjang
Bil (%) Bil (%) Bil.
2005 239,025 14.4 1,418,830 85.6 1,657,855
2006 157,586 10.3 1,377,869 89.7 1,535,455
2007 165,737 10.1 1,481,275 89.9 1,647,012
Okt.2008 91,075 27.9 235,188 72.1 326,263
Sumber: Majlis Daerah Pasir Mas (2008). Rancangan Tempatan Jajahan Pasir Mas, 2008 ‐ 2020
Khusus bagi negara Thailand, pada tahun 2007, pelancong dari Thailand mengambil
kira 99% daripada jumlah pelancong ke jajahan Pasir Mas (=1.5 juta pelancong). Jumlah
pelancong Thai yang tinggi adalah disebabkan oleh kerja rutin iaitu perjalanan masuk ke
Malaysia secara berulang bagi tujuan bekerja, berniaga dan menziarah keluarga.
Daerah Sg. Kolok (Narathiwat) adalah seluas 4,475 km2. Ekonominya adalah
berasaskan pertanian, perladangan dan perikanan. Industri pemprosesan berdasarkan hasil
sumber tempatan seperti getah, buah-buahan dan ikan juga telah dibangunkan. Manakala
pekannya, adalah pusat membeli belah dan hiburan di kalangan pelancong Malaysia dengan
aktiviti ekonominya yang penting ialah perhotelan, restoran, perniagaan peruncitan dan
pemborongan.
Industri pelancongan di pekan Sg. Kolok mudah terjejas dengan kekerapan pengeboman di
daerah Sg. Kolok, termasuk pekannya sejak tahun 2005 oleh puak pemisah Islam di Selatan
Thailand. Pada September 2011, tiga rakyat Malaysia terbunuh akibat letupan bom di pekan
Sg. Kolok (Malaysiakini 17 September 2011). Pada bulan Mei 2013, enam rakyat Thai cedera
berikutan bom di Asia Hotel, di Jalan Charoenkhet, tidak jauh dari stesen kereta api Sg. Kolok
(New Straits Times, 18 Mei 2013).
Dari segi perdagangan rentas sempadan Rantau Panjang-Sg. Kolok, Jadual 7
menunjukkan nilai eksport Malaysia ke Thailand dan import Malaysia dari Thailand yang dicatat
oleh pihak kastam Malaysia melalui CIQ Rantau Panjang bagi tempoh tahun 2007-2013.
Kecuali pada tahun 2013, kedudukan imbangan dagangan antara Malaysia dengan Thailand
adalah negatif. Ini menunjukkan yang perdagangan itu memihak kepada Thailand. Permintaan
ke atas barang Thailand, khususnya dari Narathiwat adalah tinggi untuk tujuan pasaran di
negeri Pantai Timur Semenanjung (Kelantan, Terengganu dan Pahang) pada amnya dan ZBC
Rantau Panjang pada khususnya.
Jadual 7: Malaysia - Eksport dan Import Malaysia ke dan dari Thailand

36
Jabatan Perancang Bandar dan Desa Negeri Kelantan (2008). Rancangan Tempatan Jajahan Pasir Mas, 2008 ‐
2020
274
Tahun Nilai Dagangan (RM juta)

Eksport ke Import dari Imbangan Jumlah
Thailand Thailand Dagangan dagangan
2007 54 183 (129) 237
2008 67 169 (102) 236
2009 78 194 (115) 272
2010 82 202 (121) 284
2011 117 206 (89) 322
2012 151 213 (62) 364
2013 248 204 44 453
Sumber: Jabatan Kastam Diraja Malaysia
Perdagangan lintas sempadan antara Malaysia dan Thailand menerusi CIQ Rantau
Panjang dan Sg. Kolok adalah aktif. Di pihak Malaysia, ZBC Rantau Panjang adalah penjana
utama kepada kepesatan dagangan lintas sempadan itu. ZBC itu berperanan sebagai pusat
membeli belah di kalangan pelancong tempatan. Begitu juga pekan Sg. Kolok, dikunjungi oleh
pelancong Malaysia dan asing kerana ia juga sebagai pusat membeli belah kerana
menawarkan jenis produk yang tiada di ZBC Rantau Panjang dan menawarkan yang lebih
murah di samping berlibur.
Struktur ekonomi wilayah Narathiwat dan jajahan Pasir Mas adalah hampir sama yang
masing-masing adalah berasaskan pertanian, terutamanya getah dan padi. Manakala pekan
Sg. Kolok dan Rantau Panjang yang merupakan pusat kegiatan ekonomi bagi wilayah
Narathiwat dan Pasir Mas menumpu dalam sektor perdagangan runcit dan borong, penginapan
dan restoran, komunikasi dan perbankan. Kedua-dua pekan itu dihubungi dengan jambatan dan
memudahkan penduduk sempadan di Selatan Thailand dan Kelantan menjalankan aktiviti
ekonomi lintas sempadan. Perdagangan lintas sempadan adalah aktif dengan trend jumlah
perdagangan meningkat dalam tempoh kajian. Pekan sempadan Sg. Kolok dan Rantau
Panjang adalah pusat membeli belah lintas sempadan di kalangan pelancongan Malaysia,
Thailand dan asing lain.
6.1.1 Isu Pembangunan
Aktiviti penyeludupan berlaku dalam perdagangan lintas sempadan bagi mengelakkan

dikenakan cukai atau barang larangan seperti dadah. Berdasarkan data dari Jabatan Kastam
Diraja Malaysia, bagi tempoh 2007-2011, Unit Pencegahan Penyeludupan telah merampas
barang seludup antara Sg. Kolok dan Rantau Panjang bernilai kira-kira RM0.6 juta setiap tahun.
Barang yang diseludup ke Sg. Kolok meliputi barangan subsidi seperti petrol, diesel, minyak
masak, gandum dan gula. Barangan larangan pula terdiri daripada kereta curi, syabu, mercun,
ubat-ubatan, dan pil kuda. Barangan yang diseludup ke Rantau Panjang ialah seperti haiwan
ternakan, beras, beras pulut, beras nasi dagang dan tepung beras.
Beberapa pengkalan haram wujud di sepanjang Sungai Golok, sungai yang menghubungkan
persaudaraan dan perniagaan penduduk Kelantan/Rantau Panjang di sempadan Malaysia dan
Narathiwat/Sg. Kolok di Thailand. Pengkalan itu atau jalan tikus menjadi pusat penyeludupan
untuk memenuhi pasaran di kedua-dua negara. Sepanjang Pengkalan Kubor, Tumpat sehingga
Rantau Panjang sahaja terdapat lebih daripada 130 pengkalan haram bagi kegiatan
penyeludup. Antara pengkalan haram yang sering dilalui dan diberi gelaran tertentu ialah
Pengkalan Syed Agil dan MCA. Tidak kurang popular adalah Pengkalan Pohon Jambu,
275
Pengkalan Gergaji, Pohon Buluh, Che Kasim dan Pauh. Pengkalan ini adalah laluan air yang
menggunakan galah. Selain aktiviti penyeludupan, laluan air ini digunakan oleh mereka yang
ingin ke pekan Sg, Kolok tanpa menggunakan dokumen perjalanan. Tambang perahu ini ialah
RM1. Seorang pembawa perahu dianggarkan mendapat pendapatan pada purata RM300
sehari. (Kosmo 10 Jun 2013).
Dari satu segi, aktiviti penyeludupan itu adalah sumber pendapatan utama bagi mereka
yang terlibat walaupun risiko ditangkap oleh pihak berkuasa adalah tinggi. Barangan pilihan
penyeludupan ke Selatan Thailand meliputi barang subsidi keperluan harian seperti gula, beras,
minyak masak serta gandum, minyak petrol dan diesel. Produk lain yang diseludupi antara
Malaysia dan Thailand meliputi juga pakaian haiwan ternakan, mercun dan bunga api, dan
dadah. (Kosmo 10 Jun 2013).
Tidak seperti Rantau Panjang, industri pelancongan di pekan Sg. Kolok mudah terjejas
dengan kekerapan pengeboman di daerah Sg. Kolok, termasuk pekannya sejak tahun 2005
oleh puak pemisah Islam di Selatan Thailand. Perintah undang darurat di wilayah selatan
Thailand Yala, Narathiwat dan Pattani mula dikuatkuasakan pada 2005 untuk mengawal
keganasan sejak awal 2004 berikutan rasa tidak puas hati penduduk yang majoritinya
keturunan Melayu dan beragama Islam, terhadap penindasan yang dilakukan oleh kerajaan
Thailand.
6.1.2 Strategi Pembangunan
Selain daripada faktor pasaran, pembangunan ekonomi kawasan sempadan juga

dipengaruhi oleh dasar keselamatan dan pembangunan daripada kerajaan Malaysia dan
Thailand, antaranya ialah Perjanjian Persempadanan Malaysia-Thailand, Strategi
Pembangunan Bersama Malaysia-Thailand (Joint Development Strategy Malaysia-Thailand)
untuk kawasan sempadan, Pelan Tindakan Pembangunan untuk Daerah Sempadan Selatan
(Action Plan on Southern Border Provinces Development) Thailand, Koridor Ekonomi Pantai
Timur (ECER) dan Segi Tiga Indonesia, Malaysia, Thailand (IMT-GT).
Di bawah perancangan pembangunan Koridor Ekonomi Wilayah Timur (ECER), Rantau
Panjang akan dibangunkan sebagai Koridor Pelancongan Lintas Sempadan bersama
Pengkalan Kubur dan Bukit Bunga. ZBC Rantau Panjang adalah zon ekonomi sempadan yang
dibuka oleh kerajaan Pusat pada tahun 2002. Kewujudan ZBC itu telah menggalakkan ekonomi
lintas sempadan yang aktif antara Sg. Kolok dan Rantau Panjang. Majoriti daripada produk
yang dijual di ZBC adalah daripada selatan Thailand dan harga yang ditawar kepada
pengunjung adalah murah. Ia adalah pusat membeli belah di kalangan pelancong Malaysia.
Peta 18: Koridor pelancongan Rantau Panjang-Pasir Mas – Kota Bharu – Pengkalan Kubor
Sumber: www.ecerdc.com.my/ecerdc/masterplan.htm‎
ZBC Rantau Panjang adalah Zon Ekonomi Sempadan Istimewa yang ditubuhkan pada
tahun 2002. Infrastruktur kemudahan awam di ZBC yang sedia ada perlu dipertingkatkan bagi
276
menyediakan kemudahan ruang sirkulasi, keselesaan, dan keselamatan kepada pelancong.

Pembangunan infrastruktur yang mesra pelancong ini akan mewujudkan suasana keselesaan
kepada pelancong apabila membeli belah. Ini akan menarik lagi pelancong baru ke ZBC Rantau
Panjang.
7. RUMUSAN
Sebagai rumusan, aktiviti ekonomi lintas sempadan antara Sg. Kolok dan Rantau
Panjang adalah aktif dengan jumlah dagangan meningkat dalam tempoh kajian. Ini memberi
kesan limpahan kepada ekonomi sempadan masing-masing dengan mewujudkan peluang
pekerjaan, peningkatan pendapatan dan pengurangan kadar kemiskinan. Bagaimanapun,
ekonomi lintas sempadan juga mendorong kepada aktiviti ekonomi penyeludupan dengan
tujuan untuk mengelak barang dikenakan cukai atau barang yang dilarang oleh kerajaan
masing-masing. Ini berlaku kedudukan Sg. Kolok itu mudah dilintasi tanpa menggunakan
pasport. Bagi pihak Malaysia, usaha penguatkuasaan telah dan sedang dilakukan untuk
mengatasi aktiviti penyeludupan. Pembangunan koridor pelancongan Rantau Panjang – Pasir
Mas – Kota Baharu –Pengkalan Kubur di bawah pelan pembangunan ECER akan
menambahkan lagi nilai Zon Ekonomi Sempadan Istimewa di ZBC Rantau Panjang.
RUJUKAN
Abd Hair Awang, Junaenah Sulehan, Noor Rahamah Abu Bakar, Mohd Yusof Abdullah dan
Ong Puay Liu. (2013). Informal cross-border trade Sarawak (Malaysia)-Kalimantan
(Indonesia): a catalyst for border community‘s development. Asian Social Science; Vol. 9,
No. 4.167-173.
Abdul Rahim Anuar and Muszafarshah Mohd Mustafa (2012, Mei). Border Town Economy: Twin
Border Towns On The Thailand-Malaysian Border: Danok-Bukit Kayu Hitam. Kertas kerja
yang dibentangkan di International Seminar on Malaysia-Thailand Studies. Sintok:
Universiti Utara Malaysia.
Ademola, O.T., Bankole, A.S., dan Adewuyi A.O. (2009) China–Africa Trade Relations: Insights
from AERC Scoping Studies, European Journal of Development Research (2009) 21,
485–505. doi:10.1057/ejdr.2009.28
Agustinus Handoko Selasa, 21 Juni 2011 Rusunawa Entikong Dapat Aliran Listrik.
http://regional.kompas.com/.
Asan Ali G.H., Abu Sufian A.B., & Tuan Marina T.I. (2009). Kajian impak penilaian sosio-
ekonomi ke atas pembangunan pekan pelancongan Wang Kelian, Perlis. Kertas kerja
yang dibentangkan di Persidangan Kebangsaan Ekonomi Malaysia. Bangi: UKM
Choen Krainara. (2008). Cross-border trade and commerce in Thailand: policy implications for
establishing special border economic zones (Unpublished doctoral thesis). Asian Institute
of Technology, Bangkok, Thailand.
Development of the Five Southern Border Provinces Special Zone. (n.d.). Inside Thailand
Review. Dicapai daripada from http://thailand.prd.go.th/.
Maneepong, C. (2003). Dynamics of industrial development in border towns: case studies of
Thailand (Unpublished doctoral thesis). The University of New South Wales, Australia.
Maneepong, C. dan Wu, C.T. (2004). Comparative borderland development in Thailand.
ASEAN Economic Bulletin, 21(3), 133-166.
Tsuneishi, T. (2008). Development of border economic zones in Thailand: expansion of border
trade and formation of border economic zones, IDE Discussion Paper, 153. Tokyo:
Institute Developing Economy.
277
-GP42-
PEMBENTUKAN DASAR PEKERJA ASING DI MALAYSIA: KAJIAN TERHADAP
PROSES DAN PENDEKATAN
Mohd Na’eim Ajis, Zawiyah Mohd Zain, dan

School of Government, College of Law, Government and International Studies, Universiti Utara Malaysia,
naeim@uum.edu.my; zmzain@uum.edu.my
Mohamad Faisol Keling
School of International Studies, College of Law, Government and International Studies, Universiti Utara
Malaysia, m.faisol@uum.edu.my
Abstrak
Permintaan terhadap pekerja asing ke Malaysia merupakan sesuatu isu yang tidak dapat
dielakkan dan kerajaan telah mewujudkan dasar dan program bagi mengawal kemasukan
pekerja asing ke Malaysia. Terdapat dua persoalan utama yang akan dibincangkan dalam
artikel ini, iaitu proses pembuatan dasar dan pendekatan yang digunakan dalam pembentukan
dasar pekerja asing. Dalam kajian ini, pengkaji menggunakan kaedah kualitatif dengan
menemubual responden yang terlibat dalam pembuatan dasar pekerja asing yang terdiri
daripada aktor formal seperti ahli dalam Jawatankuasa Kabinet Mengenai Pekerja Asing dan
PATI (JKPA-PATI) dan aktor tidak formal seperti wakil majikan, wakil pekerja, Badan Bukan
Kerajaan (NGO) dan ahli akademik. Hasil kajian menunjukkan terdapat tiga peringkat dalam
proses pembuatan dasar pekerja asing, iaitu peringkat pertama, perbincangan antara
kementerian dengan kumpulan berkepentingan seperti MEF, MTUC dan NGO. Peringkat
kedua, perbincangan antara Kementerian Dalam Negeri dan Kementerian Sumber Manusia
dengan agensi kawal selia yang terdiri daripada kementerian-kementerian berkaitan dan
peringkat ketiga ialah mesyuarat secara formal yang melibatkan ahli-ahli dalam JKPA-PATI.
Manakala, pendekatan yang digunakan dalam pembentukan dasar pekerja asing adalah antara
ekonomi dan keselamatan. Setiap pihak yang berkaitan dengan pekerja asing mempunyai
justifikasi tersendiri dalam menimbangkan pendekatan yang dipilih. Konflik kepentingan antara
kementerian dan agensi yang menguruskan pekerja asing telah menjadi penyebab utama
dalam konflik dasar.
Kata Kunci: Dasar, Pekerja Asing, Pembuatan Dasar, Pendekatan Dasar dan Malaysia
1.0 PENDAHULUAN
Aktiviti pembangunan terancang selepas merdeka khasnya di bawah Dasar Ekonomi Baru
(DEB) menghasilkan beberapa faktor sosioekonomi yang menggalakkan penggajian pekerja
asing. Sektor pembuatan telah menjadi penjana utama pekerjaan akibat kemerosotan sektor
pertanian terutama antara tahun 1986 hingga 1990. Industrialisasi yang didukung oleh
pelaburan asing telah menjana banyak pekerjaan dalam bidang pembinaan dan perkhidmatan
sehingga jumlah pekerjaan melebihi tawaran tenaga kerja tempatan. Tambahan pula, ledakan
globalisasi yang semakin rancak mengakibatkan setiap negara mengamalkan dasar buka pintu
untuk menerima kemasukan pekerja asing (Azizah, 2012). Perkembangan aktiviti industri dan
ekonomi yang dialami Malaysia telah menyebabkan kemasukan pendatang asing terutamanya
pekerja asing merupakan sesuatu isu yang sukar dielakkan. Kekurangan sumber tenaga kerja
278
tempatan dalam sektor-sektor tertentu menyebabkan peluang tersebut digantikan dengan

tenaga kerja pekerja asing. Peningkatan kemasukan pekerja asing yang pada asalnya untuk
mengimbangi keperluan ekonomi telah mendatangkan masalah kepada kerajaan terutamanya
dengan kewujudan pendatang asing tanpa izin (PATI) sehingga ia membawa pelbagai masalah
lain yang timbul sama ada daripada aspek politik, sosial, budaya dan sebagainya. Castells
(1997) berpendapat kemasukan pendatang asing terutama yang tidak sah boleh mewujudkan
masalah politik apabila faedah daripada migrasi tersebut tidak boleh dikongsi bersama dengan
entiti yang wujud di sesebuah negara penerima. Situasi ini berlaku apabila rakyat di sesebuah
negara destinasi tidak dapat menerima kesan yang ditimbulkan oleh golongan pendatang
terutamanya dalam konteks persaingan pekerjaan dan ancaman keselamatan. Bagi menangani
masalah ini, kerajaan telah mewujudkan pelbagai dasar dan program untuk mengimbangi
permintaan tenaga kerja asing supaya ia tidak menjadi suatu krisis dalaman negara. Justeru itu,
artikel ini akan membincangkan persoalan utama dasar pekerja asing di Malaysia yang
melibatkan proses dan pendekatan yang diambil dalam pembuatan dasar pekerja asing.
2.0 KAJIAN PENTADBIRAN PEKERJA ASING: SUATU PENILAIAN

Kajian dan penulisan mengenai pengurusan dan dasar pekerja asing telah banyak dilakukan
oleh sarjana tempatan dan luar negara. Kebanyakan sarjana luar negara memfokuskan aspek
dasar dan pentadbiran migrasi (Meyers, 2000; Money, 2004, Freeman, 1995; Hugo, 1993;
Hollifield, 2000; Hammar, 1985; Cornelius & Tsuda, 2004; Castle, 2004; Rudolph, 2003;
Joppke, 1998; Patay, 2017) yang secara prolifik membincangkan secara teoritikal dan empirikal.
Meyers (2000) telah membuat perbandingan teori dalam membincangkan mengenai
pentadbiran dasar migrasi seperti teori institusionalisme, pendekatan politik domestik, teori
identiti nasional, teori ekonomi dan lain-lain lagi. Hammar (1985) pula telah memberi suatu
sumbangan yang signifikan dalam memahami dasar migrasi yang terbahagi kepada dua, iaitu
dasar kawalan imigrasi dan dasar imigran. Money (2004) menegaskan salah satu sebab
kelemahan dalam pengkajian dasar migrasi apabila kebanyakan kajian hanya tertumpu kepada
negara-negara maju dan Eropah Barat, sedangkan lebih daripada separuh migrasi global
berlaku di luar negara-negara maju tersebut. Hollifield (2000) membincangkan bagaimana
pengaruh politik dalam pentadbiran dasar migrasi dan Castle (2004) menghuraikan tiga faktor
utama yang mempengaruhi kegagalan dasar migrasi sesebuah negara, iaitu perubahan sosial
dalam proses migrasi, globalisasi dan transnasionalisme, dan sistem politik. Patay (2017)
membincangkan mengenai hubungan antara dasar migrasi dan pembangunan negara terutama
dalam melihat kesan terhadap sosio-ekonomi negara. Cornelius dan Tsuda (2004)
membincangkan mengenai kekaburan yang berlaku dalam pembuatan dasar kerana
penglibatan banyak pihak, contohnya, sebanyak 17 kementerian yang terlibat dalam pembuatan
dasar di Jepun.
Di samping itu, perbincangan mengenai dasar awam dan pentadbiran awam telah
dikemukakan oleh beberapa sarjana antaranya seperti Dye (1995), Freeman (1995), Birkland
(2005), Rudolph (2003), Hollifield (2000), Huntington (1965), Atory (1996), Whitaker (1987),
dan Geddes (2003). Manakala, Dye (1995) dan Birkland (2005) membincangkan mengenai
aspek pembuatan dan pelaksanaan dasar awam serta aktor-aktor yang terlibat dalam
pembuatan dasar. Birkland (2005) dan Freeman (1995) telah membincangkan mengenai
kumpulan berkepentingan dari segi jenis dan pengaruhnya terhadap sesuatu dasar yang dibuat.
Selain itu, terdapat sarjana tempatan dan pengkaji antrabangsa yang membincangkan isu dasar
dan pentadbiran pekerja asing di Malaysia (Azizah 1987, 1998 & 2012; Pillai 1999; Kanapathy,
2008; Kaur, 2004 & 2007; Spaan et al., 2002; Ramli & Kamarulnizam, 2017; Zarina & Nor
Azizan, 2015; Azizah & Ragayah, 2011, Fauzi & Ridhwan, 2014; Kurus, 2004, McGahan, 2008,
Rohani et al., 2015; Intan & Sity, 2016). Penulisan yang dilakukan oleh Azizah (1998 & 2012)
279
memfokuskan kepada isu migrasi sama ada dari aspek sosiologi, ekonomi, perundangan, dan
politik. Beliau turut mengakui penulisan tempatan mengenai dasar migrasi di Malaysia bermula
pada awal 1990-an. Ini kerana sebelum ini kebanyakan penulis dan pengkaji banyak memberi
tumpuan kepada aspek lain seperti ekonomi, demografi dan sosial. Beliau sendiri telah
melakukan langkah pertama dalam mengupas inti-pati dasar migrasi di Malaysia pada tahun
2008. Berdasarkan kajian dan penulisan lepas terdapat jurang literasi, dimana kebanyakan
literasi pengkaji dan sarjana luar negara membincangkan isu dasar pekerja asing di negara-
negara maju seperti di Amerika Syarikat, Britain dan lain-lain. Manakala, bagi pengkaji dan
penulisan tempatan mereka lebih memfokuskan kepada isu-isu pekerja asing dalam konteks
sosiologi, ekonomi dan keselamatan. Penulisan mengenai dasar pekerja asing seperti yang
dilakukan oleh Azizah (2012), Pillai (1999), Kanapathy (2008), Kaur (2007) dan Fauzi dan
Ridhwan (2014) tidak membincangkan secara mendalam mengenai konflik pembuatan dasar
pekerja terutama dari aspek proses dan pendekatan yang digunakan oleh kerajaan. Oleh hal
yang demikian, wujudnya jurang yang boleh disumbangkan oleh artikel ini dalam mengenal
pasti proses dan pendekatan yang diambil dalam pembuatan dasar pekerja asing di Malaysia.
3.0 METODOLOGI KAJIAN

Kajian ini dilakukan dengan menggunakan kaedah kualitatif. Kajian ini menggunakan data
primer dan sekunder yang dikumpul melalui beberapa kaedah. Pengumpulan data sekunder
dibuat melalui penyelidikan di perpustakaan terhadap bahan-bahan bacaan akademik, keratan-
keratan akhbar, terbitan-terbitan agensi dan perundangan yang berkaitan dengan dasar migrasi
khususnya yang berkaitan dengan pekerja asing. Manakala, pengumpulan data primer
dilakukan melalui temubual dengan pihak-pihak berkaitan dan mempunyai kepentingan dalam
isu pekerja asing. Antara responden yang ditemu bual adalah seperti kementerian-kementerian,
Lembaga Pembangunan Industri Pembinaan Malaysia (CIDB), Jabatan Imigresen Malaysia
(JIM) dan ahli akademik. Temu bual separa-struktur merupakan instrumen utama yang
digunakan dalam kajian ini. Soalan mungkin boleh diubah suai dari segi susunan dan cara
menyoal lebih fleksibel. Semua data dan maklumat yang diperoleh akan diproses dan dianalisis
menggunakan laporan secara diskriptif dan analitikal, di mana perkara-perkara penting yang
diperolehi dalam temu bual akan dikumpul dan disusun mengikut susunan tema isi (thematic
sequence) dengan berpandukan kepada objektif dan soalan kajian yang ditetapkan.
4.0 ANALISIS TERHADAP PROSES DAN PENDEKATAN DALAM PEMBUATAN DASAR

PEKERJA ASING DI MALAYSIA
Secara umumnya, proses pembuatan dasar pekerja asing melibatkan tiga peringkat, iaitu
perbincangan antara pihak kerajaan, wakil majikan dan wakil pekerja; perbincangan antara
agensi kawal selia dengan Kementerian Dalam Negeri (KDN) dan Kementerian Sumber
Manusia (KSM); dan mesyuarat Jawatankuasa Kabinet Mengenai Pekerja Asing-Pendatang
Asing Tanpa Izin (JKKPA-PATI). Peringkat pertama, pihak kementerian mendapatkan input
secara umum daripada pihak-pihak berkaitan seperti MEF dan MTUC, NUTW dan kesatuan-
kesatuan sekerja yang berkaitan. Pada peringkat kedua, perbincangan dilakukan antara KDN
dan KSM dengan agensi kawal selia. Agensi kawal selia adalah agensi yang ditempatkan di
Pusat Hentian Setempat (OSC) yang terdiri daripada pelbagai kementerian seperti Kementerian
Perladangan dan Komoditi, Kementerian Perdagangan Antarabangsa dan Industri, Kementerian
Asas Tani, Kementerian Pelancongan dan Kebudayaan, Lembaga Pembangunan Industri
Pembinaan (CIDB) dan Kementerian Perdagangan Dalam Negeri, Koperasi dan Kepenggunaan
(KPDNKK).37
37
Temu bual dengan Jabatan Tenaga Kerja Semenanjung Malaysia di Kementerian Sumber Manusia,
pada 17 September 2017.
280
Selain daripada KDN, KSM dan agensi kawal selia, kadang-kadang ia juga melibatkan
agensi-agensi kerajaan yang lain seperti Pihak Berkuasa Tempatan (PBT) dan persatuan
majikan, kesatuan sekerja dan Badan Bukan Kerajaan (NGO) yang bergantung kepada
keperluan perbincangan tersebut, contohnya, Kementerian Pertanian dan Industri Asas Tani
perlu membuat perbincangan dengan Jabatan Alam Sekitar dan Majlis Daerah mengenai
penanaman di kawasan curam seperti di Cameron Highland. Terdapat peruntukan tertentu
untuk meluluskan permohonan pekerja asing jika tanaman yang diusahakan di kawasan curam.
Ini menunjukkan dalam keadaan tertentu penglibatan pihak-pihak lain yang pada dasarnya
memang tidak terlibat dengan hal ehwal pekerja asing adalah diperlukan kerana ia melibatkan
kepakaran dan bidang kuasa mereka.38 Pada peringkat ini, agensi kawal selia akan mengambil
data-data daripada pihak berkaitan terutamanya golongan majikan seperti yang dinyatakan oleh
sebahagian agensi kawal selia yang ditemui:
―Apa yang kami buat adalah memanggil semua stake holder iaitu majikan dalam
sektor pembinaan untuk come out dengan formula pengambilan yang hendak
digunakan then kami tunjukkan kepada KDN melalui Bengkel Semakan
Penggajian Pekerja Asing yang diadakan 2 kali setahun‖39
―Kami cuma engage dengan persatuan perkilangan, iaitu FMM untuk dapat
maklumat. Di samping itu, kami juga ada membuat dialog-dialog dengan
international association seperti Japanese Chamber of Trade & Industry Malaysia
(JACTIM) dan America Malaysia Chamber of Commerce (AMCHAM) untuk
membincangkan isu-isu semasa yang berkaitan dengan pekerja asing.‖40
Bagi Kementerian Pelancongan dan Kebudayaan Malaysia (MOTAC) pula,

pembentukan kriteria yang ditetapkan bagi pengambilan pekerja asing adalah hasil daripada
beberapa sesi perbincangan antara kementerian bersama pihak industri pelancongan serta
Badan Bukan Kerajaan (NGO) dan juga perbincangan dengan lain-lain agensi kawal selia.41
Setelah mendapat data-data dan mengadakan perbincangan dengan pihak berkaitan, pihak
agensi kawal selia akan menyediakan kertas kerja terhadap pindaan atau pembuatan dasar
yang baru. Lazimnya, di peringkat kementerian, kertas kerja tersebut akan dibawa oleh KSU
kementerian berkenaan untuk dibincangkan bersama YB Menteri. Apabila KSU dan YB Menteri
bersetuju, maka kertas kerja tersebut akan dibawa kepada KSM dan KDN untuk dibincangkan
sebelum dibawa ke JKKPA-PATI. Dasar yang dibuat oleh agensi kawal selia ini lebih menjurus
kepada pembentukan formula pengambilan dan dasar-dasar yang lebih khusus dengan sektor
masing-masing seperti Kementerian Pertanian membuat kajian berdasarkan analisis kos-
faedah yang bersifat ergonomik terhadap item tanaman dan ternakan.42 Manakala, Kementerian
38
Ibid
39
Temu bual dengan Lembaga Pembangunan Industri Pembinaan (CIDB), di Lembaga Pembangunan
Industri Pembinaan (CIDB), Kuala Lumpur, pada 22 Januari 2017
40
Temubual dengan Kementerian Perdagangan Antarabangsa dan Industri, di Kementerian Perdagangan
Antarabangsa dan Industri, pada 25 November 2015
41
Temu bual dengan Bahagian Pengurusan Sumber Manusia, Kementerian Pelancongan dan
Kebudayaan Malaysia, di Kementerian Pelancongan dan Kebudayaan Malaysia, Putrajaya, pada 28
November 2016
42
Temu bual dengan Bahagian Industri Tanaman, Ternakan dan Perikanan, Kementerian Pertanian dan
Industri Asas Tani, di Kementerian Pertanian dan Industri Asas Tani Putrajaya, pada 19 November 2016
281
Perusahaan Perladangan dan Komoditi menetapkan formula dalam penanaman kelapa sawit
berdasarkan kajian oleh Lembaga Minyak Sawit Malaysia (MPOB).43
Peringkat ketiga adalah mesyuarat peringkat JKKPA-PATI yang dipengerusikan oleh

Timbalan Perdana Menteri (TPM). Dalam peringkat ini, agensi kawal selia memainkan peranan
yang penting dalam menentukan keperluan semasa mengikut sektor masing-masing. Sebarang
cadangan yang berkaitan dengan berapa jumlah pekerja yang diperlukan, negara sumber dan
sektor mana adalah dibuat oleh agensi kawal selia kepada JKKPA-PATI. Namun begitu,
cadangan yang dibuat boleh berbentuk atas ke bawah atau bawah ke atas dan TPM
mempunyai kuasa untuk menolak sebarang cadangan daripada agensi kawal selia jika
merasakan cadangan tersebut banyak keburukan daripada kebaikan kepada negara atau boleh
mendatangkan masalah kepada kementerian atau agensi lain.44
Berkaitan dengan pendekatan pembuatan dasar pekerja asing, secara umumnya

kerajaan akan mempertimbangkan elemen-elemen tertentu sebelum membentuk dasar pekerja
asing. Walaupun, pada dasarnya JKKPA-PATI mempunyai kuasa mutlak dalam menentukan
hala tuju dasar tetapi pembentukan dasar sebenarnya datang daripada kementerian masing-
masing. Ini menunjukkan penilaian dan analisis awal telah dibuat oleh pihak kementerian atau
agensi berkaitan terlebih dahulu. Bagi Kementerian Sumber Manusia, aspek yang sering
diambil kira dalam pembentukan dasar ini adalah implikasi terhadap aspek sosial dan nasib
pekerja tempatan. Kesan terhadap pekerja tempatan adalah apabila kemasukan pekerja asing
yang tidak dikawal akan menutup peluang pekerjaan kepada penduduk tempatan.45 Manakala,
kementerian atau agensi kawal selia yang lain selalunya mempunyai pendekatan masing-
masing dalam membentuk dasar yang berkaitan dengan pekerja asing seperti yang ditegaskan
oleh agensi kawal selia yang ditemui:
―Bagi MITI, aspek utama yang menjadi fokus kami adalah aspek ekonomi seperti
melibatkan nilai eksport, pasaran dan pelaburan yang dimiliki oleh industri serta
pekerja tempatan sedia ada yang dimiliki oleh setiap majikan‖46
―Dalam sektor pertanian, kami sebenarnya lebih melihat kepada keperluan industri
iaitu aspek ekonomi terlebih dahulu dan kemudian barulah kami melihat aspek
lain seperti keselamatan dan sebagainya. Keselamatan yang dimaksudkan adalah
bukan tradisional iaitu lebih kepada persaingan pekerjaan dengan orang
tempatan.‖47
―Bagi sektor perkhidmatan, pendekatan kami lebih kepada aspek ekonomi iaitu
membantu majikan bagi jangka masa sederhana dalam mengatasi short labour.
43
Temu bual dengan Bahagian Penggalakan Inovasi dan Modal Insan, Kementerian Perusahaan
Perladangan dan Komoditi, di Kementerian Perusahaan Perladangan dan Komoditi, Putrajaya, pada 26
November 2016
44
Temu bual dengan Jabatan Tenaga Kerja Semenanjung Malaysia di Kementerian Sumber Manusia,
Putrajaya pada 17 September 2017.
45
Temu bual dengan Jabatan Tenaga Kerja Semenanjung Malaysia, di Kementerian Sumber Manusia,
Putrajaya pada 17 September 2017
46
Temu bual dengan Bahagian Dasar Sektoral III, Kementerian Perdagangan Antarabangsa dan
Industri, di MITI, pada 25 November 2015
47
Temu bual dengan Bahagian Industri Tanaman, Ternakan dan Perikanan, Kementerian Pertanian dan
Industri Asas Tani, di Kementerian Pertanian dan Industri Asas Tani, Putrajaya, pada 19 November 2016
282
Kerajaan sebenarnya tidak dapat menolak kebergantungan kepada pekerja asing

seratus peratus kerana ia akan menjejaskan sektor perkhidmatan‖48
―Dalam isu migrasi ini tak kira sama ada pelarian, pekerja asing atau PATI tugas
kami lebih kepada menjaga kedaulatan dan keselamatan sempadan negara
daripada dicerobohi. Kami di bawah KDN akan lebih fokus kepada aspek
keselamatan negara daripada melihat aspek ekonomi seperti kementerian yang
lain‖49
Daripada pandangan yang diberikan oleh responden di atas, jelas menunjukkan pendekatan
yang digunakan dalam membentuk dasar migrasi selalunya berkisar kepada dua aspek utama,
iaitu ekonomi dan keselamatan. Jika dilihat daripada respons yang diberikan jelas menunjukkan
agensi kawal selia lebih menjurus kepada aspek ekonomi tetapi JTKSM dan JIM yang tidak
mempunyai liabiliti sektor lebih melihat kepada aspek ancaman keselamatan. Kedua-dua aspek
ini dianggap sebagai alat kepada kerajaan untuk membentuk dasar pekerja asing seperti yang
ditegaskan oleh Azizah Kassim50:
―So, kerajaan akan menggunakan dua alasan ini untuk mengawal kemasukan
pekerja asing. Kalau kerajaan nak get rid pekerja asing maka ia akan cakap pasal
security threat tapi kalau nak pekerja asing akan cakap pasal pembangunan
ekonomi la.‖51
Situasi di atas menjadi dilema kepada kerajaan untuk mempertimbangkan antara kedua-
dua aspek tersebut dalam membuat dasar migrasi. Jika kerajaan terlalu tegas dan rigid, maka
golongan majikan akan menentang tetapi jika kerajaan tidak tegas, maka golongan pekerja dan
masyarakat awam pula akan memberi tekanan. Akhirnya ia akan menjadi dilema kepada
kerajaan dalam menguruskan pekerja asing terutama dalam memenuhi kepentingan kedua-dua
faktor tersebut.
5.0 KESIMPULAN
Daripada perbincangan di atas, jelas menunjukkan kebergantungan kepada pekerja asing
adalah sesuatu perkara yang sukar dielakkan dan kadang-kala menunjukkan peningkatan
keperluan terhadap mereka. Dengan sebab itu, kerajaan perlu membuat dasar dan program-
program tertentu bagi merancang pengambilan pekerja asing di Malaysia. Secara umumnya,
dasar pekerja asing yang dibuat oleh kerajaan merupakan dasar jangka pendek. Ini kerana
kerajaan perlu sentiasa reflek kepada kehendak industri dalam pengambilan pekerja asing.
Pembuatan dasar pekerja asing melibatkan tiga peringkat, iaitu peringkat pertama, antara
kementerian dengan pihak industri, NGO dan golongan pekerja. Peringkat kedua melibatkan
pelarasan antara kementerian yang berkaitan seperti KDN, KSM dan agensi kawal selia.
Peringkat ketiga pula melibatkan kementerian dan jabatan kerajaan yang berkaitan dengan
48
Temu bual dengan Bahagian Perdagangan Dalam Negeri, KPDNKK, di KPDNKK, Putrajaya, pada 30
Oktober 2016
49
Temu bual dengan Bahagian Penguat kuasa Imigresen, di Jabatan Imigresen Malaysia, Putrajaya,
pada 2 Jun 2016
50
Profesor Azizah Kassim merupakan Felo Penyelidik Utama di Institut Kajian Malaysia dan
Antarabangsa (IKMAS). Beliau merupakan profesor dalam bidang antropologi dan merupakan pakar
dalam bidang kajian migrasi antarabangsa di Malaysia dan juga di peringkat antarabangsa.
51
Temu bual dengan Profesor Dr. Azizah Kassim, Felo Tamu Institut Kajian Malaysia dan Antarabangsa
(IKMAS), UKM, di Perpustakaan Utama Universiti Malaya, pada 13 Januari 2015
283
pengurusan migrasi. Peringkat pertama dan kedua boleh dikategorikan sebagai penglibatan
aktor tidak formal dan yang ketiga dikategorikan sebagai perbincangan dalam kalangan aktor
formal. Perbincangan pada peringkat ketiga ini yang akan membentuk dasar migrasi sama ada
yang berkaitan dengan PATI atau pekerja asing. Aktor-aktor yang terlibat pada peringkat formal
adalah terdiri golongan birokrat, iaitu kementerian atau jabatan kerajaan yang mempunyai
kepentingan dalam isu migrasi. Dalam peringkat ini, penglibatan golongan industri atau majikan,
pekerja, akademik dan NGO adalah tidak dibenarkan. Peranan mereka hanyalah sekadat
memberi input yang diminta sahaja oleh pihak kementerian semasa perbincangan di peringkat
pertama.
Selain itu, pendekatan yang digunakan oleh kerajaan dalam membentuk dasar pekerja
asing adalah pelbagai tetapi ia lebih tertumpu kepada dua aspek utama, iaitu ekonomi dan
keselamatan. Pendekatan ini bersandarkan kepada beberapa aspek seperti prestasi ekonomi
negara, tentangan masyarakat dan isu-isu yang timbul daripada pekerja asing. Tekanan yang
diberikan oleh pihak tertentu seperti golongan majikan dan pekerja juga boleh menjadi faktor
untuk dipertimbangkan dalam memilih pendekatan yang paling sesuai digunakan dalam
pembuatan dasar. Pertentangan dalam pendekatan ini boleh menimbulkan konflik antara
jabatan dan kementerian tertentu dalam isu menguruskan pekerja asing. Ia juga akan
mewujudkan perdebatan mengenai pendekatan pengurusan pekerja asing dalam kalangan
aktor-aktor tak rasmi yang lain seperti majikan, kesatuan sekerja pekerja, NGO, ahli politik dan
ahli akademik. Golongan yang menggunakan pendekatan ekonomi kebanyakannya terdiri
daripada agensi kawal selia, antaranya seperti kementerian-kementerian yang berkaitan dan
golongan majikan. Manakala, KDN dan kesatuan sekerja lebih menekankan kepada aspek
keselamatan dalam pengambilan pekerja asing. Pertimbangan kepada elemen ini akan
membawa kepada konflik kepentingan dalam perancangan pengambilan pekerja asing. Oleh
itu, perbincangan dalam menetapkan dasar pekerja asing perlu mencari satu titik persetujuan
bersama dan jika persetujuan tidak diperoleh berkemungkinan akan mewujudkan win-lose
situation. Segala persetujuan yang dicapai dan diputuskan dalam mesyuarat JKKPA-PATI akan
menjadi dasar dan perlu diterima pakai oleh semua peringkat agensi.
RUJUKAN
Ahmad Atory Hussain. (1990). Politik dan Dasar Awam Malaysia. Kuala Lumpur: Utusan
Publications and Distributors Sdn Bhd.
Azizah Kassim. (1997). Alien Workers in Malaysia: Their Inflow Patterns, Labour Utilization and
Consequences. In Kenji Tsuchiya and Tsuyoshi Kato (Eds), An Integrated Study on the
Dynamics of The Maritime World of Southeast Asia (pp.81-123). Kyoto University:
Center for Southeast Asia Studies, 1997.
____________. (1987). The Unwelcome Guests: Indonesian Immigrants and Malaysia Public
Responses.‖ Southeast Asian Studies 2, no.25, 265-278.
____________. (2012). Dasar Pekerja Asing di Malaysia, Bangi: Penerbit UKM.
Azizah Kassim and Ragayah Mat Zin. (2011). Policy on Irregular Migrants in Malaysia: An
Analysis of its Implementation and Effectiveness. Discussion Paper Series No.34,
Philippine Institute for Development Studies, Manila
Bilson Kurus. (2004). Regional Migrant Workers Flows: Outlook for Malaysia. In Aris Ananta and
Evi Nurvidya Arifin (Eds), International Migration in Southeast Asia, (pp. 331-350).
Singapore: Institute of Southeast Asian Studies.
284
Birkland, T. A. (2005). An Introduction to the Policy Process: Theories, Concepts and Models of
Public Policy Making 2nd Edition. New York: M.E Sharpe.
Castells, M. (1997). The Power of Identity. Oxford: Blackwell.
Castle, S. (2004). Why migration policies fail?, Ethnic and Racial Studies 27 (2), 205-227.
Cornelius, W. A & Takeyuki Tsuda. (2004). Controlling Immigration: The Limits of Government
Intervention. In edited by W.A. Cornelius et al. (Eds), Controlling immigration: A Global
Perspectives (2nd ed.), (pp.3-48). Carlifornia: Stanford University Press.
Dye, Thomas R. (1995). Understanding Public Policy 8th Edition, New Jersey: Prentice Hall.
Freeman, G. (1995). Modes of Immigration Politics in Liberal Democracies States. International
Migration Review 29 (4), 881-913.
Geddes, A. (2003). The Politics of Migration and Immigration in Europe, London: SAGE
Publication.
Hammar, T. (1985). Introduction. In Tomas Hammar (ed). European Immigration Policy: A
Comparative Study, (pp.1-16). Cambridge: Cambridge University Press.
Hollifield. J.F. (2000). The Politics of International Migration: How Can We ‗Bring the State Back
In?. In Caroline B. Brettell and James F. Hollifield, J.F, Migration Theory: Talking Across
Disciplines, (pp.137-185). New York and London: Routledge.
Hugo, G.J. (1993). Indonesian Labor Migration to Malaysia: Trends and Policy Implications.
Southeast Asian Journal of Social Sciences21 (1), 36-72
Huntington, S.P. (1965). Political Development and Political Decay. World Politics17 (3), 386-
430.
Intan Suria Hamzah dan Sity Daud. (2016). Implikasi Kemasukan Pekerja Asing di Malaysia:
Suatu Tinjauan Awal. Jurnal Sains Insani, 69-77.
Jopkke, C. (1998). Why Liberal States Accept Unwanted Immigration. World Politics50 (2), 266-
293.
Kanapathy, V. (2008). Controlling Irregular Migration: The Malaysian Experience. Conference
Proceedings. Regional Symposium on Managing Labour Migration in East Asia at
Singapore.
Kaur, A. (2004). Mobility, Labour Mobilisation and Border Controls: Indonesia Labour Migration
to Malaysia since 1900. Conference Proceedings. 15th Biennial Conference of the Asian
Studies Association of Australia.
_________. (2007).Managing The Border: Regulation of International Labour Migration and
State Policy Responses to Global Governance in Southeast Asia. Conference
Proceedings. 16th Biennial Conference of the Asian Studies Association of Australia.
McGahan, K., (2008). Managing Migration: The Politics of Immigration Enforcement and Border
Control in Malaysia, Phd Thesis, University of Wisconsin-Madison.
Meyers, Eytan. (2000). Theories of International Immigration Policy: A Comparative Analysis.
International Migration Review34 (4), 1245-1282.
Mohamad Fauzi dan Muhd Ridhwan, Negara. (2014). Undang-Undang dan Tenaga Kerja Asing:
Antara Ideal dan Realiti di Malaysia, Malaysian Journal of Society and Space 10 (1),
101-109.
Money, J. (2010). Comparative Immigration Policy. (2010). In Robert Allen Denemark (Ed), The
International Studies Encyclopedia, (pp. 1-32). West Sussex: Blackwell.
Pillai, P. (1999). The Malaysian state‘s response to migration. Sojourn, Journal of Social Issues
in Southeast Asia 14 (1), 178-197.
Ramli Dollah et al. (2003). Pendatang Islam Filipina di Sabah: Satu Perhatian Dari Sudut
Keselamatan. JATI: Jurnal Jabatan Asia Tenggara Universiti Malaya.
Ramli Dollah dan Kamarulnizam Abdullah. (2017). Wacana hegemoni dan dasar pekerja asing
di Malaysia: Kajian kes ke atas persaingan elit pemerintah dan towkays di Sabah, Jurnal
Komunikasi Borneo 5, 63-81.
285
Rohani Abdul Rahim et al. (2015). Pergerakan Bebas Pekerja Migran Dalam Penyediaan
Khidmat Bagi Menjana Ekonomi Komuniti ASEAN: Isu dan Implikasi Perundangan
Malaysia. PAHMI 9th International Conference. Yogyakarta State University.
Rudolph, C., (2003). Security and the Political Economy of International Migration, American
Political Science Review 97 (4), 603-620.
Spaan, Ernst., Naerssen, Ton Van & Gerard Kohl. (2002). Re-imaging Borders: Malay Identity
and Indonesian Migrants in Malaysia. Tijdschrift voor Economische en Sociale
Geografie, 93 (2), 160-172.
Tunde Patay. 2017. A Comparative Analysis of Migration Policies: (Best) Practices from Europe.
Acta Univ. Sapientiae, Economics and Business, 5, 139-154.
Whitaker, R. (1987). Double Standard: The Secret History of Canadian Immigration, Toronto:
Lester and Orpen Dennys.
Zarina Othman & Nor Azizan Idris. (2015). Migrasi dan Keselamatan. Kuala Lumpur: Dewan
Bahasa dan Pustaka.
Temu bual
Bahagian Dasar Sektoral III, Kementerian Perdagangan Antarabangsa dan Industri, pada 25
November 2015.
Profesor Dr. Azizah Kassim, Felo Tamu Institut Kajian Malaysia dan Antarabangsa (IKMAS),
UKM, pada 13 Januari 2015.
Pengurus Kanan, Unit Personel Binaan, Lembaga Pembangunan Industri Pembinaan, pada 25
November 2017.
Bahagian Industri Tanaman, Ternakan dan Perikanan, Kementerian Pertanian dan Industri
Asas Tani, pada 19 November 2016.
Bahagian Perdagangan Negeri, Kementerian Perdagangan Dalam Negeri, Koperasi dan
Kepenggunaan, pada 30 Oktober 2017.
Bahagian Unit Penggalakkan Inovasi dan Modal Insan, Kementerian Perusahaan Perladangan
dan Komoditi, pada 26 November 2016.
Bahagian Pengurusan Sumber Manusia, Kementerian Pelancongan dan Kebudayaan Malaysia,
pada 28 November 2016.
Pengarah Jabatan Tenaga Kerja Semenanjung Malaysia di Kementerian Sumber Manusia,
pada 17 September 2017.
-GP43-
Mediation Approach in Conducting Civil Cases in Perlis Court
Monica Joseph Gaisah1 and Malike Brahim2

1 Lower Court Kangar, Perlis, monicajg@kehakiman.gov.my
2 School of Government, Universiti Utara Malaysia, malike@uum.edu.my
Abstract
Parties engaged in conflicts are often considered to be aggressive, belligerent, irrational

and inflexible. Majority view conflict as a battle to win or a situation to be avoided. Hence,
cases of conflicts are never resolved amicably, smoothly and peacefully. Some parties become
dissatisfied, uncomfortable and feel the decision made is unfair. Due to this, issues are brought
to court for resolution and justice. Otherwise, the processes in the court are time consuming
and cost would be escalated before the announcement of any orders and judgments. Other
286
related causes that impede access to justice include inter alia delays in delivering judgments,
frequent adjournments and poor case of flow management. Today, mediation relatively relates
to the judicial system, a reform in progress such as practiced in Perlis Court. This approach will
encourage the people to select the most appropriate dispute resolution process. Thus,
increasing satisfaction for those who seek resolution regarding their disputes.
Key Words: Conflict, Disputes, Mediation, Perlis Court, Resolution
1. INTRODUCTION
In Malaysia, since many years ago in majority of jurisdictions passed, many have faced
the problems of increasing backlogs of cases, delayed justice and the escalating costs of
litigation. There is no doubt that these factors impede access to justice. However, a better
understanding of the available options for dispute resolution and the mechanics of each process
greatly assist decision-making in solving the conflicts. Thus, the researcher believes that the
use of alternative dispute resolution such as mediation is one of the significant ways in
enhancing justice within the legal aspect.
This is possible because through mediation, parties themselves are actively involved in
the resolution of their disputes. When properly managed, mediation tend to be much cheaper
and quicker than litigation. Thereby making them more affordable and accessible to many
people. Nowadays, mediation relatively relates to the judicial system, a reform in progress.
Hence, this research is conducted in order to emphasis the roles of mediation in Perlis court.
The researcher expects that this approach will encourage people in selecting the most
appropriate dispute resolution process, thus increasing satisfaction for those who seek
resolution regarding their disputes. If successful, this process will enhance the public
perception on Perlis Court and the Malaysian court as a whole. Thus, it has become the focus
for this study particularly related to Malaysian judiciary system.
2. THE ADVANTAGES OF MEDIATION
In a broad and general understanding, mediation is defined as all forms of decision-

making in which the parties concerned are assisted by an external party to the dispute. The
mediator cannot make binding decisions but can assist their decision-making in various ways. It
can be in contrast with the dispute resolution in which the external party or person is the formal
decision-maker for the parties, such as arbitration, adjudication and expert determination
(Boulle, 2001).
Mediation is relatively inexpensive and is expeditious. Seeing a case through trial is
expensive and time consuming. Mediation is not bound by strict rules. The process is simple
and sessions can be easily scheduled any time at the mutual convenience of the parties and the
mediator. Moreover, it can take place in a variety of locations. There are no complex procedural
or evidentiary rules which must be followed. Mediation allows all the involved parties to revise
and adjust the scope of their conflict. In a trial, initial pleadings and rules of procedure limit the
issues which a party can raise. In mediation, as circumstances change the topic for discussion
can also be changed. This increased flexibility makes it easier for negotiators to act as
problem-solvers instead of adversaries.
In Malaysia today, there is an active movement towards mediation as alternative dispute
resolution (ADR) to court adjudication. This process is also available in Perlis Court, but the
issue is whether the parties in conflict are aware or otherwise regard this method in solving their
problems. Lack of knowledge on mediation and ignorance to ADR is one of the factors related
287
to massive backlogs of civil cases in Perlis Court. The public are not aware of this method and
some do not have any knowledge of it at all. Probably, there is little exposure or no source in
promoting this mediation method as a way of settling matters.
If mediation can become a practice in solving civil matters, strenuous backlogs of cases in
court can be overcome. For some parties, they may think that this new method is costly even
though it is the best alternative dispute resolution. Therefore, they tend to ignore this process.
For others, they could have known this alternative but are not confident on the court result
because they fear the court‘s decision may not be in their favour. Therefore, the public need to
be informed, educated and exposed to the alternative of mediation.
For some litigants who are unable to negotiate a resolution to their dispute, problem or
conflict, they can seek the assistance of a mediator who will mediate before the cases are fixed
for hearing in the court through normal processes and procedures. They may choose to go for
mediation with or without lawyer depending on the type of problem they are facing. The
disputants may consult with an attorney prior to finalizing an agreement in ensuring that they are
aware and are fully informed of the decisions and all their rights are protected. In some
instances, this are the suggestion made by the mediators. Therefore, mediation can be used in
most conflicts ranging from disputes between consumers and merchants, landlords and tenants,
employers and employees, family members such as in the cases of divorce and so forth.
Generally, mediation has been defined as a dispute resolution process where parties
agree to voluntarily refer their disputes to an independent third party acting as a facilitator who
encourages the parties to come up with their own resolution. Kressel and Pruitt (1985) defined
mediation as the assistance by a third party, who has no authority to dictate an agreement, to
two or more conflicting parties. While Moore‘s (2003) definition of mediation emphasized the
third party‘s impartiality and neutrality in facilitating communication and negotiations between
the disputing parties. While Noone (1996), observed that mediation in general requires an
intervention of an experienced, independent and trusted third party in facilitating parties to settle
their conflict (Abdul Wahab, 2013).
3. PENDING DISPOSAL OF CIVIL CASES IN PERLIS’ COURT
Amongst hundreds of cases filed, there are few cases still delayed and pending disposal.
Most of these cases are in the small claim category and running down cases (cases involving
damages due to accident). According to the judge in charge who hears running down cases, if
there is fraud in the police report, and conflicting statement of plaintiffs and investigating officers
(the police), this will make it difficult to examine the truthfulness of the claim. Thus, the burden of
proof lies within the plaintiffs‘ lawyers handling the case. As such, ample time is needed to call
for specialist doctors as witnesses, with their written medical reports on the plaintiffs‘ and
defendants‘ injury, damages and special damages. As for the small claim cases, the claimant
or the respondents (those owing) are not allowed to be represented by counsels. They have to
conduct their own case. This is not easy as the claimants in small claim cases are not well
versed with the laws and, small claim rules and procedures.
4. DELAY IN THE DISPOSAL OF THE CASES IN PERLIS’ COURT
The reason for delayed disposal of these civil cases could be contributed the ignorance to
the law provided on the part of the claimants and defendants. Counsels are not able to provide
proper advice to their clients. As mostly would advise their client to fight to the end, as they will
acquire higher fees from their clients. They would insist on large amount of awards on claims
and not settling for less. Other reasons that delay the disposal of civil cases are lacking of
288
evidences, postponement by parties involved such as the presiding judges, counsels, witnesses
and parties in disputes.
The mediation process that has been in practiced in Perlis Court as the best ADR to
resolve conflicts among disputants. ADR such as mediation is highly practiced and encouraged
in the United State, Canada, Australia and other developed countries. It has received the most
attention for academic study. For example, in Australia, the justice community uses mediation
almost entirely. The citizen‘s awareness makes it easier for a settlement to happen and
amicably resolve dispute helps justice to be done effectively. This phenomena can also possibly
happen in Perlis Court or Malaysia as a whole.
The number of criminal and civil cases filed in court are increasing day by day. Citizen
awareness and literacy on their rights and the numbers of criminal offences are also increasing.
The concept of open justice for everyone should not stop people from seeking justice from the
court. Therefore, the Court has a duty in instituting a method case disposal to be able to handle
and dispose cases according to schedule. This is to ensure that justice can be delivered
efficiently. This can be done by implementing several cases settling method in the courts. One
of it is by going through a mediation procedure. Mediation can be done any time before a case
is scheduled for hearing. However, there are still quite a number of unsettled cases that caused
backlogs.
Undeniably, it is the prerogative of individual or institution to come to court in seeking
justice to earn fast resolution of their disputes. On the other, the court has a duty to hasten
resolution and avoid any encumbrance. Prolonging matters will only increase the public‘s
negative assumptions and scrutiny. Having matters settled fast would reduce unwarranted
perceptions from the publics. Thus, settlement of disputes is not as easy as it may seems if
both parties are having difficulties in settling the matter in hand. Hence, it requires expert that
has the know-how and way of doing it. A good, well trained mediator will be the most
appropriate.
(Source: Magistrates‘ Court of Perlis)

Figure 1: Registration, Disposal and Pending Civil Cases for Year 2017 (As of October 2017)
The data presented in Figure 1 and Figure 2 shows that there are 151 unsettled cases
in the Magistrates‘ Court and four in the Sessions‘ Court, carried forward from October 2017
to November 2017. The number of cases will increase again in November with new cases
289
being filed. Thus, this phenomena of increasing cases are never ending. This is why an
ADR such as mediation comes in handy.
(Source: Sessions‘ Court of Perlis)

Figure 2: Registration, Disposal and Pending Civil Cases for Year 2017 (As of October 2017)
The statistic indicated in Figure 3 shows that in October 2017, two cases was fixed for
mediation. Only one was disposed by mediation whereas one more was unsuccessful. The
plaintiff in this unsuccessful case did not agree to settle for less and would rather go for full trial.
Furthermore, the case involves siblings as plaintiff and defendant. The case has been fixed for
trial and witnesses will be called. Evidences has to be adduced will require months or even
years for it to be settled. This has added to the backlogs of unsettled civil cases in Perlis Court.
(Source: Magistrates‘ Court)

Figure 3: Mediation Cases in Magistrates‘ Court
Perlis Court has one Magistrate who hears criminal cases including the Road Transport
Department and Police Traffic summonses cases. The bulk of these cases filed contribute to
the lengthy trial due to enhance punitive sentence. Thus, making offenders ple ading not
guilty for fear of jail sentence and high fine. This affect the smoothness flow in mentioning or
hearing of civil cases filed in the Magistrates‘ court as the Magistrate who is supposedly
handling these cases is burdened with criminal cases. This is why the Sessions‘ Judge,
290
whom at the same time has other cases to attend has to hear cases filed in the magistrates‘
court.
Having to decide and dispose a case in Perlis Court is not easy even though the state
of Perlis is small. It is contrary to the belief that it has little or less cases compared to other
states. Another hindrance to fast disposal of civil cases in Perlis is the attitude of some
counsels handling one‘s claim. Illiteracy and ignorance on the part of the claimant is giving
these unscrupulous lawyers chances to manipulate this situation, in order to gain more fees
and payment. Attendance of counsels in every session fixed for simple mentioning of cases
such as acquiring the next date is RM100 or could be more if the counsels are fro m other
states. In some instances, the counsels will advise their clients not to settle for less because
the award given by the court will actually profit the counsels in getting more monetary
payment which 30% out from the whole judgment of the court.
Beside this, there are problems of people not being aware or simply could not be
bothered to enquire about other procedure of settlement on their claims. It has become a
tradition that whenever they wish to make a claim they have to consult a lawyer. All t hey
know is to engage a lawyer to file a claim in court not knowing that in actual fact they could
lose more in this process as their case would not be solve sooner than expected. The longer
the civil lawsuit prolong, the more the claimant have to pay to counsels and in the end the
lesser monetary award they will get especially in running down cases. Furthermore, the cost
can be wasted not only to counsels but also payments to specialized medical doctors called
as witnesses in term of their reports on injuries and damages.
5. CONCLUSION
The mediation and mediators play an important role in solving the overloading of backlogs
of civil cases in Perlis‘ Court. The benefits of mediation are so called for especially to reduce
long outstanding and overdue civil matters, reducing cost and to safeguard litigating parties from
frustrations and grudges, for future business dealings. Nevertheless, the judiciary has a duty to
expose the benefits and advantages of mediation, to reach out to people, the local communities,
litigants and court staffs by educating them on the process and procedures, through the mass
media and assisted by NGOs. It can be done by distributing pamphlets and giving talks to
enhance knowledge about mediation. The researcher believes that mediation should be fully
utilised in resolving matters fast without the fussiness of arbitration.
Mediation should be made a priority in Perlis Court. It builds up the capacity and at the
same time induces the culture by providing mutual dispute resolution. It facilitates forward an
interest based resolution between the parties involved. At the same time, such process brings a
dynamic and comprehensive remedy which is most appropriate and suitable, based on mutual
consent. The success of mediation depends on the right case being reformed at the right time.
For this purpose, it is necessary to create awareness among the legal fraternity and the litigation
practice at large. Since mediation is revolving around relationships, the local knowledge, cultural
preferences and social attitudes. It requires to be given their due importance which create
awareness as well as training.
REFERENCES
Abdul Wahab, A. (2013). Court-annexed and Judge-led Mediation in Civil Cases: The Malaysian
Experience. Ph.D. Thesis, Victoria University of Melbourne, Australia.
Boulle, L. (2001). Mediation: Skills and Techniques. Butterworths, New South Wales:
LexisNexis.
291
Dean G. Pruitt, D.G. &Kressel, K. (1985). The Mediation of Social Conflict: An Introduction.
Journal of Social Issues, Vol. 41(2): 1-10.
Moore, C.W. (2014). The Mediation Process: Practical Strategies for Resolving Conflict. San
Francisco: Jossey-Bass.
Noone, M. (1996). Mediation – Essential Legal Skills. London: Cavendish Publishing Limited.
White, N. (2010). Law Reform Commission. Alternative Dispute Resolution: Mediation and
Conciliation. Retrieved from http://www.lawreform.
44
Penggunaan m-Learning: Tinjauan Awal ke atas Pelajar Politeknik Sultan Abdul
Halim Mu’adzam Shah
Malike Brahim1 dan Musliza Mohamad2

1 Pusat Pengajian Kerajaan, UUM COLGIS, Universiti Utara Malaysia, Kedah.
Emel: malike@uum.edu.my
2 Jabatan Perdagangan, Politeknik Sultan Abdul Halim Mu'adzam Shah.
Emel: mamabah999@gmail.com
Abstrak
Penggunaan m-Learning merupakan langkah sistematik ke arah mengoptimumkan

proses pengajaran dan pembelajaran (P&P) agar lebih menarik, menyeronokkan dan
berinteraktif seiringan dengan keperluan Revolusi Industri 4.0. Melalui m-Learning, pelajar
boleh mengikuti proses P&P pada bila-bila masa dan di mana-mana sahaja. Justeru, suatu
kajian telah dijalankan untuk menilai persediaan pelajar Jabatan Perdagangan, POLIMAS
menggunakan m-Learning. Seramai 120 orang pelajar semester 2 terlibat dalam kajian ini yang
pilih melalui persampelan bertujuan bagi mendapatkan maklum balas mereka tentang m-
Learning. Soal selidik diedarkan kepada responden menggunakan aplikasi Google Form, di
mana responden menjawabnya menggunakan peranti mudah alih masing-masing. Link URL
kepada Google Form tersebut dikongsi melalui kumpulan WhatsApp pelajar dan dipantau
menggunakan senarai daftar dari Sistem Pendaftaran Maklumat Pelajar. Analisis mendapati
tahap kesedaran, kesediaan dan penerimaan pelajar POLIMAS terhadap m-Learning sebagai
medium P&P berada di tahap yang sederhana. Hal ini kerana penggunaan m-Learning masih
di peringkat awal pengenalannya di POLIMAS. Justeru, penggunaan m-Learning perlu
ditingkatkan dan diberi publisiti meluas agar dapat digunakan di semua peringkat pengajian
tinggi di Malaysia.
Kata Kunci:m-Learning, Pelajar, Pembelajaran dan Pengajaran, Politeknik.
292
1. Pendahuluan
Kemajuan teknologi maklumat dan komunikasi atau ICT telah banyak membawa
perubahan ke atas gaya hidup individu dewasa ini. Kini ICT adalah suatu keperluan bagi
menghadapi Revolusi Industri 4.0. Justeru, pemikiran, cara kerja dan tindakan manusia perlu
berubah kerana senario semasa banyak menuntut kepada aspek kepantasan, kreativiti, inovatif,
keberanian dan peningkatan produktiviti. Semua itu adalah tuntutan dalam arus modenisasi.
Arus modenisasi menyaksikan teknologi menjadi suatu keperluan terpenting melibatkan

kerja pejabat, urusan dalam ehwal keluarga, perbankan, perniagaan dan sebagainya. Jika
dahulu, teknologi hanya suatu alat perhubungan semata-mata, tetapi kini digunakan bagi
menjana pendapatan. Lantas wujud pelbagai aplikasi seperti Tik Tok, Smule, Keke Challange
dan sebagainya yang menjadi ikutan dan boleh diakses melalui telefon pintar. ICT juga telah
mengubah landskap dan pendekatan dalam proses pembelajaran dan pengajaran (P&P).
Justeru, muncul konsep pembelajaran mudah alih (mobile) atau m-Learning ke arah
pembelajaran yang lebih menarik, menyeronokkan, berinteraktif dan mengubah gaya
pembelajaran pelajar.
Jadi, kertas kerja ini membincangkan tahap kesedaran, kesediaan dan penerimaan pelajar
POLIMAS terhadap m-Learning hasil kajian yang telah dijalankan. Usaha ke arah pelaksanaan
m-Learning sebagai medium P&P baharu di Politeknik Sultan Abdul Halim Mu‘adzam Shah
(POLIMAS) telah pun dijalankan, tetapi masih di peringkat awal. Hal ini berkaitan dengan
penyediaan persekitaran P&P yang boleh disesuaikan dengan keperluan pelajar dan m-
Learning.
2. Isu Berkaitan M-LEARNING

ICT telah membawa perubahan besar kepada sistem pendidikan dan membantu para
guru, pensyarah dan pelajar dalam proses P&P. Secara jelasnya kuasa ICT khususnya melalui
komputer dan telefon mudah alih memainkan peranan besar dalam pembangunan pendidikan.
Perkembangan ini disemarakkan lagi dengan perkembangan drastik teknologi mudah alih dan
atas sebab itu m-Learning mula digunakan secara meluas termasuk di POLIMAS. Penggunaan
teknologi mudah alih sangat signifikan dengan proses P&P. Brink (2011) menyifatkan m-
Learning suatu proses pembelajaran mikro, di mana latihan yang disampaikan itu ibarat
memesan makanan ringan melalui peranti mudah alih. Dengan menggunakan peranti mudah
alih secara meluas, maka m-Learning boleh menjadi pilihan tepat dalam proses P&P.
Kemajuan ICT telah membuka banyak peluang kepada pensyarah untuk melaksanakan
P&P berasaskan m-Learning. Ini adalah suatu cabaran baharu untuk berhadapan dengan
persekitaran pembelajaran yang kompleks. Hal ini kerana penggunaan bahan dan peralatan
mesti bersesuaian dengan P&P misalnya dalam membuat keputusan yang lebih bermakna dan
meningkatkan prestasi akademik. Melalui m-Learning, proses P&P menjadi lebih menarik,
memotivasikan dan cukup bermakna dengan adanya keupayaan ICT (Kenning, 2007).
Brink (2011) membahagikan proses m-Learning kepada tiga jenis iaitu formal, tidak
formal dan kendiri (self-directed). m-Learning formal melibatkan sistem pemberitahuan dan
peringatan seperti mesej yang dihantar melalui khidmat pesanan ringkas (SMS) bertujuan
mengesahkan kehadiran atau penyertaan dalam sesuatu program dan penyiapan tugasan.
293
Pembelajaran informal pula melibatkan penghantaran mesej secara interaktif, memupuk

komunikasi dua hala dan meminta maklum balas pengguna. Penggunaan Twitter, Blog,
Facebook, dan media sosial lain adalah medium untuk pembelajaran tidak formal dalam m-
Learning. Pembelajaran self-directed melibatkan penyediaan bahan pembelajaran, rujukan dan
bahan sokongan prestasi pengguna, kandungan dan courseware, dan kandungan berasaskan
media seperti podcast atau video yang telah disediakan untuk m-Learning.
Apabila m-Learning diaplikasikan di pusat pengajian tinggi, proses pembelajaran ini

tidak lagi tertumpu dalam satu platform atau terhad dalam bilik darjah sahaja kerana m-Learning
lebih bercorak “just-in-time, just-in-case, on-the-move and on-demand” (Neyema, Ochoa, Pion
& Franco, 2012; Traxler, 2007). Ini bermaksud m-Learning boleh dilakukan bila-bila masa
sahaja tanpa mengira tempat dan bergantung kepada keperluan. Semua ini boleh dilakukan
jika ada kemudahan Internet dan peranti mudah alih seperti telefon pintar dan lain-lain.
Selain itu, pelajar perlu diberi penerangan dan tunjuk ajar untuk memahami cara
penggunaan m-Learning misalnya oleh fasilitator yang mahir berkenaannya. Hal ini kerana
kepekaan pelajar terhadap segala maklumat dan bahan pembelajaran melalui m-Learning perlu
ditingkatkan. Mereka juga perlu sensitif menggunakan kemudahan m-Learning kerana sistem
ini melibatkan aspek tempoh akhir (dateline), kapasiti memori, forum, ujian, kuiz dan lain-lain.
Pelajar perlu bersedia menggunakannya apabila m-Learning dilaksanakan bagi kursus-

kursus tertentu yang didaftar pada semester berkenaan. Isu ini menjadi tumpuan dalam kajian
tentang m-Learning melibatkan pelajar semester 2 Jabatan Perdagangan, POLIMAS. Melalui
m-Learning, pelajar menikmati proses pembelajaran yang berbeza kerana sistem ini
meletakkan mereka dalam proses pembelajaran bersifat global dan berada di luar kotak
pemikiran (Hussin, Manap, Amir & Krish, 2013).
Pembelajaran melalui teknologi mudah alih, pelajar didedahkan kepada proses “self-
directed learning” (Brink, 2011). Di Malaysia, Kementerian Pengajian Tinggi telah perkenalkan
Dasar e-Pembelajaran Negara (DePAN), di mana e-Learning dan m-Learning itu disifatkan
sebagai pedagogi dalam talian (Jadual 1).
294
Jadual 1 Pedagogi dalam Talian
Bidang Fokus Fasa 1 2015 Fasa 2 2016-2020 Fasa 3 2021-2025
Pembelajaran 30% kursus IPT 50% kursus IPT 70% kursus IPT
Teradun dikendalikan dalam dikendalikan dalam dalam bentuk
bentuk bentuk pembelajaran
pembelajaran pembelajaran teradun.
teraduan. teradun.
Kursus Terbuka Setiap IPT Setiap IPT Setiap IPT

menawarkan menawarkan menawarkan
sekurang- sekurang- sekurang-
kurangnya 3 kursus kurangnya 15 kurangnya 30
secara terbuka kursus secara kursus secara
(MOOC). terbuka (MOOC). terbuka (MOOC).
e-Pentaksiran 5% e-Pentaksiran 10% e-Pentaksiran 15% e-Pentaksiran

dalam dalam dalam
pembelajaran pembelajaran pembelajaran
teradun. teradun. teradun.
(Sumber: Kementerian Pengajian Tinggi Malaysia, 2015)
3. Perbincangan dan Dapatan Kajian

Kajian yang dijalankan bertujuan menilai tahap kesedaran, kesediaan dan pemahaman
pelajar tentang pelaksanaan m-Learning di POLIMAS. Persampelan bertujuan digunakan
dalam kajian ini bagi mengkaji secara mendalam sesuatu kumpulan yang khusus (Neuman,
2006; Northrop & Arsneault, 2008) seperti pelajar dari POLIMAS. Seramai 120 orang pelajar
semester 2 dari Jabatan Perdagangan, POLIMAS yang aktif dalam sesi pengajian Jun 2018
dipilih sebagai sampel. Soal selidik adalah instrumen utama kajian dan mengandungi lima
bahagian seperti profil demografi, kesedaran, kesediaan, penerimaan dan cadangan
penambahbaikan.
Soal selidik diedarkan secara online menggunakan aplikasi Google Form. Link URL
kepada Google Form tersebut dikongsi melalui kumpulan WhatsApp pelajar yang dipantau
menggunakan senarai daftar dari Sistem Pendaftaran Maklumat Pelajar (SPMP). Pelajar
menjawab soal selidik menggunakan peranti mudah alih. Dari segi komposisi kaum, 80.8
peratus (%) berbangsa Melayu, diikuti India (14.2%), Siam (3.3%) dan Cina (1.7%). Dari segi
agama, 80.8% beragama Islam diikuti 13.3% beragama Hindu, 5.0% Buddha dan 0.8% Bahai.
Daripada 120 responden, 69.2% adalah pelajar Diploma Pemasaran dan 30.8% Diploma
Akauntansi.
295
3.1. Kesedaran Pelajar Terhadap Penggunaan m-Learning

Kesedaran pelajar POLIMAS berkaitan pembelajaran berasaskan m-Learning seperti
ditunjukkan dalam Jadual 2 di bawah. Analisis menunjukkan kesedaran pelajar Jabatan
Perdagangan POLIMAS tentang m-Learning adalah sederhana kerana keseluruhan item yang
diukur memberikan nilai min 2.8 ke atas. Nilai min tertinggi iaitu 3.09 berkaitan gaya
pembelajaran bagi keperluan Revolusi Industri 4.0, banyak bahan pembelajaran boleh diakses
melalui sistem ini dan pelajar boleh belajar tanpa had di mana-mana dan bila-bila masa sahaja.
Sebenarnya m-Learning berkaitan dengan pembelajaran e-Learning yang telah pun
dipraktikkan sebelum ini (min 3.04).
Jadual 2: Kesedaran Pelajar Terhadap M-Learning

Bil. Item Min
1. m-Learning adalah gaya pembelajaran selaras keperluan RI 4.0. 3.09
2. Banyak bahan pembelajaran dapat diakses melalui m-Learning. 3.09
3. m-Learning membolehkan pelajar belajar di mana-mana sahaja. 3.09
4. m-Learning adalah salah satu kemudahan pembelajaran e-Learning. 3.04
5. m-Learning dapat mempercepatkan pemahaman kerana boleh

3.02
didengar dan dilihat secara berulangkali.
6. m-Learning menjadikan sesi pembelajaran menarik dan menyeronokan. 2.99
7. m-Learning memudahkan ulangkaji dalam bentuk audio visual dan

2.99
interaktif.
8. m-Learning mampu merangsang minat untuk mengulangkaji. 2.99
9. m-Learning dapat meningkatkan pencapaian akademik pelajar. 2.95
10. Pelajar pernah menggunakan m-Learning. 2.82
MIN KESELURUHAN 3.01
Analisis juga mendapati masing-masing min 2.99, di mana melalui m-Learning boleh
mewujudkan sesi pembelajaran yang menarik dan menyeronokkan, mudah mengulangkaji
berbentuk audio visual dan interaktif, di samping merangsang minat untuk mengulangkaji
pelajaran. m-Learning juga mampu meningkatkan pencapaian akademik (min 2.95) kerana
pernah menggunakan m-Learning sebelum ini (min 2.82). Berdasarkan nilai min keseluruhan
3.01, tahap kesedaran pelajar Jabatan Perdagangan, POLIMAS berada pada tahap yang
sederhana.
296
3.2. Kesediaan Pelajar Terhadap Penggunaan m-Learning

Tahap kesediaan pelajar Jabatan Perdagangan, POLIMAS terhadap penggunaan m-
Learning seperti ditunjukkan dalam Jadual 3 di bawah bagi tujuan pembelajaran dengan nilai
min tertinggi 2.99 hingga nilai min terendah 2.52. Berdasarkan min keseluruhan dengan nilai
2.84, secara keseluruhannya, boleh dikatakan bahawa kesediaan pelajar berkaitan penggunaan
m-Learning adalah sederhana. Berkaitan dengan kesediaan pelajar menggunakan m-Learning,
analisis mendapati mereka tiada masalah tiada masalah techo phobia atau techo stress dalam
menggunakan ICT dalam proses m-Learning (min 2.99). Responden juga bersedia
menggunakan m-Learning bila-bila masa dan di mana-mana sahaja (2.96) termasuklah sedia
menjawab soalan penilaian berterusan menggunakan telefon pintar atau tablet yang dimiliki
(2.94).
Jadual 3: Kesediaan Pelajar Terhadap m-Learning
Bil. Item Min
1. Tiada masalah techno phobia atau techo stress menggunakan ICT. 2.99
2. Sedia menggunakan m-Learning bila-bila masa dan di mana-mana sahaja. 2.96
3. Sedia menjawab soalan penilaian berterusan menggunakan telefon pintar

2.94
atau komputer tablet.
4. Sedia menggunakan m-Learning bagi semua kursus. 2.92
5. Sedia mengikuti sebarang kursus penggunaan m-Learning. 2.88
6. Sedia naik taraf telefon/laptop/tablet supaya m-Learning berjalan lancar. 2.78
7. Sedia melakukan pembelajaran kendiri tanpa kehadiran pensyarah. 2.75
8. Tidak menghadapi masalah capaian Internet di mana-mana sahaja. 2.52
Justeru, responden mahu dan bersedia mengikuti semua kursus dikendalikan secara m-
Learning (min 2.92) dan mengikuti sebarang kursus yang menggunakan m-Learning selepas ini
(min 2.88). Atas sebab itu, responden sanggup untuk menaik taraf telefon, laptop, tablet dan
lain-lain yang mereka miliki untuk mengikut pembelajaran secara m-Learning (min 2.78).
Berdasarkan kepada maklum balas di atas menunjukkan bahawa pelajar Jabatan
Perdagangan, POLIMAS sudah bersedia mengikuti pembelajaran kendiri tanpa pensyarah
apabila menggunakan m-Learning (min 2.75), di mana tidak berlakunya masalah Internet bagi
menggalakkan sistem pembelajaran baharu ini (min 2.52).
297
Dari segi peralatan yang dimiliki membolehkan mereka menggunakan m-Learning dalam
sesi pembelajaran, 91.7% responden memiliki telefon pintar dan 7.5% responden sahaja
memiliki hanya sebuah komputer riba. Sementara itu, 52.5% responden memiliki dua buah
peralatan seperti telefon pintar dan laptop sekaligus. Manakala, 3.3% responden memiliki tiga
buah peralatan iaitu telefon pintar, komputer riba dan tablet bagi mengikuti pembelajaran
berasaskan m-Learning. Dapatan kajian mendapati responden memiliki pelbagai akaun media
sosial. Analisis mendapati 94.2% memiliki akaun Whatsapp sebagai medium komunikasi utama
bersama rakan dan pensyarah. Sementara itu, 84.2% responden memiliki akaun Facebook dan
Instagram serta 60% responden memiliki akaun Twitter dan 7.5% memiliki akaun Tumblr.
3.3. Penerimaan Pelajar Terhadap Penggunaan m-Learning

Jadual 4 menunjukkan penerimaan pelajar terhadap m-Learning yang boleh disifatkan
sebagai tinggi berdasarkan nilai min tertinggi 3.10 hingga 2.83. Melalui m-Learning pelajar
dapat berkongsi bahan pembelajaran secara mudah (min 3.10) dan mengikuti sistem
pembelajaran ini secara santai (min 3.07). Responden mengakui m-Learning dapat
mengurangkan rasa malu bertanya dalam kelas (min 2.98) dan berpuas hati (min 2.97)
menggunakan sistem ini, di samping mudah berkomunikasi dengan pensyarah dan rakan kuliah
(min 2.93).
Dalam pada itu, responden mengharapkan m-Learning diguna pakai bagi semua kursus
(min 2.93) kerana ia merupakan gaya pembelajaran baharu yang mengujakan (min 2.93).
Sistem pembelajaran ini memudahkan pemahaman mereka tentang sesuatu kursus (min 2.90)
walaupun tidak dapat mengikuti kelas tradisional seperti biasa (min 2.88) dan responden
memberi maklum balas bahawa pelajar ketinggalan jika tidak menggunakan m-Learning (min
2.83). Berdasarkan nilai min keseluruhan 2.95, boleh disimpulkan bahawa penerimaan pelajar
terhadap kaedah pembelajaran m-Learning berada pada tahap yang sederhana.
Jadual 4: Penerimaan Pelajar Terhadap m-Learning
Bil. Item Min
1. Bahan pembelajaran dapat dikongsi lebih mudah. 3.10
2. Dapat mengulangkaji pelajaran dalam keadaan yang lebih santai. 3.07
3. Dapat atasi masalah malu bertanya di dalam kelas. 2.98
4. Berpuas hati dengan kaedah pembelajaran secara m-Learning. 2.97
5. Akan menggunakan m-Learning sebagai medium komunikasi antara

2.93
pensyarah dan rakan kuliah berkenaan pelajaran.
6. Rasa teruja untuk mencuba gaya pembelajaran baru seperti m- 2.93
298
Learning.
7. m-Learning sangat sesuai diguna pakai untuk semua kursus. 2.93
8. m-Learning memudahkan pemahaman dalam kursus diikuti. 2.90
9. Dapat teruskan sesi pembelajaran walaupun tidak dapat hadiri kuliah. 2.88
10. Rasa ketinggalan jika tidak menggunakan m-Learning. 2.83
Penggunaan m-Learning sebagai sistem pembelajaran bagi semua kursus secara

sepenuhnya masih di peringkat awal di Malaysia. Sebab itu pelaksanaannya belum
menyeluruh termasuk di politeknik. Di POLIMAS, pelaksanaan m-Learning masih di peringkat
awal dan tidak melibatkan semua kursus. Namun, pelajar (responden) memberi maklum balas
positif mengenai m-Learning. Ini menunjukkan pelajar memberikan maklum balas positif
tentang pelaksanaan m-Learning di sekolah dan IPT. Jadi, sudah tiba waktunya pembelajaran
bentuk baharu ini dijadikan medium penting dalam proses P&P.
4. Kesimpulan
Sistem baharu ini mudah diterima di POLIMAS kerana pelajar sudah terdedah dengan
ICT dan penggunaan telefon pintar, di mana menepati konsep tanpa pembelajaran mengira
masa dan di mana-mana sahaja. Ianya turut memudahkan pelajar yang tinggal berjauhan dari
kampus bagi mengikuti pembelajaran kerana boleh berkomunikasi secara terus dengan
pensyarah dan rakan sekuliah secara m-Learning jika ada masalah untuk mengikuti kelas biasa
(tradisional).
Pelajar POLIMAS sudah bersedia menggunakan m-Learning. Mereka sudah memiliki

telefon pintar, komputer riba dan tablet, di samping mempunyai pelbagai akaun media sosial.
Semua ini memudahkan mereka mengikuti m-Learning yang disokong oleh teknologi mudah
alih seperti rangkaian tanpa wayar (Wi-Fi), hotspot, telefon mudah alih 3G (third generation),
komputer riba, tablet dan sebagainya menjadi ‗kegilaan‘ bagi golongan remaja dan dewasa
termasuk pelajar IPT.
Dari segi penerimaan, pelajar POLIMAS bersedia mengadaptasi orientasi pembelajaran

baharu ini kerana sudah memahaminya. Dengan kata lain, kini pembelajaran berteraskan
elektronik kian diterima baik dan boleh memberi kesan positif ke atas pencapaian akademik
pelajar. Justeru, penggunaan m-Learning perlu dipromosi secara meluas sebagai medium
pembelajaran baharu.
Rujukan
299
Brink, J. (February 2011). M-Learning: The future of training technology. TD Magazine. Diakses
dari https://www.td.org/magazines/td-magazine/m-Learning-the-future-of-training-
technology. (31 Julai 2018).
Hussin, S., Manap, M.R., Amir, Z.,& Krish, P. (2012). Mobile learning readiness among
Malaysian Students at higher learning institutes. Asian Journal of Social Science, 8(12),
276-283. DOI: 10.5539/ass.v8n12p276.
Kenning, M. (2007). ICT and Language Learning: From Print to the Mobile Phone. London:
Palgrave Macmillan UK.
Malaysia. (2015). Dasar e-Pembelajaran Negara 2.0. Putrajaya: Jabatan Pendidikan Tinggi,
Kementerian Pendidikan Tinggi.
Neuman, W.L. (2006). Social research methods: Qualitative and quantitative approaches (6th
ed.). Boston: Pearson.
Neyema, A., Ochoa, S.F., Pino, J.A.,& Franco, R.D. (2012). A reusable structural design for
mobile collaborative applications. The Journal of Systems and Software, 85(3), 511-524.
Northrop, A.,& Arsneault, S. (2008). Sampling and data collection. Dlm. Yang, K. & Miller, G.J.
Handbook of Research Methods in Public Administration (2nd ed.) (hlm. 213-240). Boca
Raton: CRC Press Taylor & Francis Group.
Traxler, J. (2007). Defining, discussing and evaluating mobile learning: The moving writes and
having writ. International Review of Research in Open and Distance Learning, 8(2),
1492-3831.
-GP45-
Assessment of Risk Management Practices in the Public Sector of Malaysia
Jamaliah Said1, Md. Mahmudul Alam2 and Razana Juhaida Johari3

1 Accounting Research Institute, Universiti Teknologi MARA, Shah Alam, Malaysia.
Email: jamaliah533@salam.uitm.edu.my
2 School of Economics, Finance and Banking, Universiti Utara Malaysia, UUM Sintok, Malaysia.
*Email: rony000@gmail.com
3 Faculty of Accountancy, Universiti Teknologi MARA, Shah Alam, Malaysia.
Email: razana@salam.uitm.edu.my
Abstract
There is a global concern for the public sector due to the numerous crises in fraud, governance,
corruption, and inefficacy. Thus, this sector is under pressure to justify its sources and utilization
of public resources and improve its efficacy using a sound risk management system. This study
attempts to comprehend the phenomenon of the current risk management practices among the
employees of the public sector in difference service schemes in Malaysia. A questionnaire
survey with a five-point Likert scale was utilized to collect primary from 194 department heads
300
among the federal ministries in Malaysia. Descriptive statistics as well as factor analysis were
used for the purpose of analyzing the data. Finding of the study reveal that 94.7% of the
respondents agreed to practise risk management in their respective departments. Overall, the
practice of risk management is found to be the highest in the administration and finance
schemes group and the lowest in the accounting and audit schemes among the employees.
Findings from this study will assist policymakers to identify the required steps to enhance the
risk management practices in the public sector.
Key Words: Public Sector, Risk Management, Factor Analysis, Malaysia.
1. INTRODUCTION
Risk is integral in both public life and in business as it can appear in all the activities and
management of an organization (Tchankova, 2002). In general, risk is defined as the potential
danger, injury, loss, and other unwanted outcomes (Rasid, Rahman, & Ismail, 2011). Risk
appears as the environment where a business operates becomes more and more uncertain,
volatile, unpredictable, and unstable (Smallman, 1996; Abdullah et al., 2015). According to
Tummala and Achoenherr (2011), risk involves the joint potential or frequency of a stated
danger occurring and the occurrence‘s magnitude. Risk is usually linked to an unwanted or
unpredicted loss such as a negative and uncertain consequence (Tummala & Achoenherr,
2011).
The major component of the activities of an organization is risk management and the
objective is to assist all the other activities related to management to directly achieve the
organization‘s objective in an efficient manner (Tchankova, 2002). Likewise, Archbold (2005)
states in his study that risk management involves a process utilized to recognize possible
liabilities and risks which could lead to potential loss to both private and public organizations.
Thus, to deal with risks in the current atmosphere of firm scandals and the increasing global
networks, knowledge management is a major mechanism to manage risks (Neef, 2005). The
rise in scandals such as financial crises and unpredictable downfall of many organizations and
financial institutions in the US has led to dire consequences such as decreased economic
activities, public losing confidence in corporations and a volatile financial system (Ng et al.,
2013).
Worldwide legislative reforms have been seen due to the increase in concerns on
practices of risk management. The Malaysian Central Bank (BNM) has also changed some of
financial regulatory measures to incorporate values of corporate governance into the financial
services sector (Ng et al., 2013). Consequently, the risk management concept, corporate
governance, as well as internal controls are inter-related while the committee on risk
management acts as the main governance mechanism to help the management and the board
to manage risks (Ng et al., 2013).
Risk management is directly dependent on the changes that occur in an organization‘s
internal as well as external environment as the environmental changes need attention
continuously to identify and manage risks (Tchankova, 2002). In a practical manner, several
strategies in risk management are available but they vary among each other based on the type
of organization such as the management styles and organizational objectives (Archbold, 2005).
Said et al. (2016) suggest that risk management strategies that are effective are expected to
assist an organization to achieve its business goals while simultaneously improving the act of
financial reporting and maintaining a good reputation.
Although risk management strategies differ based on individual organizations, the five
stages of risk management such as identification of risk, measuring risk, assessing risk,
301
evaluating risk, as well as risk controls and monitoring are still suitable and applicable in many
kinds of organizations (Archbold, 2005). Likewise, studies carried out by Tummala and Leung
(1996), Tummala and Achoenherr (2011), and Rasid et al. (2011), reveal a similar outcome in
terms of the steps taken in risk management involving identification of risk, risk measurements,
assessment and evaluation of risk, and risk controls thus defined as the risk management
process or RMP.
This study examines the risk management practices in the public sector of Malaysia.
This study selected Malaysia due to the many recent concerns being found in the public sector
related to corruption, fraud, governance failures, poor financial management, etc. These
occurrences have raised numerous enquiries about the accountability of the public sector in its
obligation to uphold the public‘s trust. This study hopes to help the government to find out the
factors that are able to nurture and promote the accountability value using sound risk
management practices in the government sector.
2. RESEARCH METHODOLOGY
2.1. Data Collection and Sampling

Data collection was carried out by having distributing a face-to-face questionnaire survey
to department heads from 6 Malaysian federal ministries from January to June 2016. The 6
chosen ministries are the Ministry of Communication and Multimedia, the Ministry of Education,
the Ministry of Health, the Ministry of Defence, the Ministry of Agriculture and Agro-Based
Industry as well as the Ministry of Rural and Regional Development,. These ministries were
selected because they have been often reprimanded in the Report by the Auditor General for
three consecutive years from 2012 to 2014 due to issues including accountability, integrity,
ethics, as well as mismanagement.
These 6 ministries include a total of 402 sub-departments. The study targeted 210
samples by utilizing the systematic random sampling approach by taking each 2 listed
departments in every ministry. The selection was carried out beginning from a department‘s
second list, fourth list, sixth list, and so on to reach 402 and ended with 210 items in the
samples. Finally, 194 questionnaires were used in the data analysis from the 210 target
samples.
Table 1 Distribution Samples in the Malaysian Ministries and Departments
Ministries & Departments Amount of Amount of

Projected Sub- Actual Samples
departments
The Ministry of Communications and Multimedia
1. Department of Broadcasting Malaysia 13 10
2. Department of Information Malaysia 10 10
The Ministry of Education
3. Education Department of Johor 10 10
302
4. Education Department of Kelantan 10 10
5. Education Department of Labuan 10 10
6. Education Department of Pahang 10 10
7. Education Department of Perak 10 10
8. Education Department of Putrajaya 10 10
9. Education Department of Sabah 10 5
10. Education Department of Selangor 10 10
The Ministry of Health
11. Health Department of Perlis 6 6
12. Health Department of Selangor 6 6
13. Health Department of Terengganu 6 6
14. Health Department of Sarawak 6 6
15. Health Department of Kuala Lumpur 6 6
16. Health Department of Perak 6 6
17. Health Department of Melaka 6 6
18. Health Department of Kedah 6 6
The Ministry of Defence
19. Department of Veteran Affairs 7 5
The Ministry of Agriculture and Agro-based Industry
20. Fishery Department 13 10
21. Agriculture Department 12 12
The Ministry of Rural and Regional Development
22. Community Development Department 12 12
23. Rubber Industry Smallholders 15 12

Development Authority
Total 210 194
303
2.2. Measurements of Variables
The respondent was asked to provide their perspective on the practices which promote
management of risk in their departments using a five-point Likert scale ranging from 1 (strongly
disagree) to 5 (strongly agree). Table 2 shows the risk management that was measured utilizing
the 12 items adapted from Mancuso's (2012) study.
Table 2 Factors of Risk Management Measurement in the Public Sector of Malaysia
Code Description of Items
RM1 My department has a risk management policy in place.
RM2 My department consults subject matter experts and representatives from all areas of
organizations to develop risk management policy.
RM3 The policy and all the procedures and training that the department has in place are
being well documented.
RM4 My department reviews risk management policy annually/after department

changes/after experiencing a risk.
RM5 My department trained the staff and third party collaborators on the risk
management policy.
RM6 My department takes risk in seizing and exploiting new opportunities.
RM7 My department makes large, bold decisions despite uncertainty.
RM8 My department considers companies strategic are well special/ specific.
RM9 My department monitoring government priorities.
RM10 My department focusing most attention on the drive of organization success.
RM11 My department keeping up to date with international development/ technologies.
RM12 My department ensure department succession planning has been conducted
2.3 Data Analysis
The collected data was analysed using the descriptive statistics and factor analysis
techniques. Descriptive statistics is normally utilized to analyse the overall features of the data
while factor analysis is utilized to calculate data consistency in the study. In addition, the data
reliability is measured by utilizing the Cronbach‘s alpha test and data normality is examined
using the Skewness and Kurtosis tests. Lastly, the data validity is tested by using the Kaiser-
Meyer Olkin and Barlett‘s test.
304
3. FINDINGS AND DISCUSSION
3.1. Demographic Profiles
Relevant demographic information was gathered from the respondents such as ethnicity,
gender, age, academic qualification, type of qualification, job position, department, grade, as
well as working experience. A summary of the demographic information is shown in Table 3.
Table 3 Demographic Information of the Respondents
Demographic Profiles Frequency Percentage

(N=194) (%)
Gender Male 79 40.7
Female 115 59.3
Ethnicity Malay 176 90.7
India 11 5.7
Chinese 7 3.6
Age 20 – 30 years 24 12.4
31 – 40 years 64 33.0
41 – 50 years 74 38.1
51 years and above 32 16.5
Academic Qualifications Degree 100 51.5
Master 90 46.4
PhD 4 2.1
Types of Qualifications Accounting 98 50.5
Non Accounting 96 49.5
Job Position Supporting Staff 7 3.6
Management and 176 90.7
Professional
Top Management 11 5.7
Department Accounting 45 23.2
Administrative 78 40.2
Audit 10 5.2
Finance 46 23.7
Others 15 7.7
Grade 41 101 52.1
44 21 10.8
48 70 36.1
52 2 1.0
Working Experience in the Less than 1 year 11 5.7
Current Organization (no. of 1 – 3 years 10 5.2
years) 4 – 5 years 23 11.9
305
5 years and above 150 77.3
The table denotes that 59.3% of the respondents are female while 38% of them are in
the 41-50 years old age bracket with 33% being in the 31-40 years old age bracket. Majority of
the respondents are Malays at 90.7%. All the respondents possessed a basic bachelor degree
qualification.
90.7% of the respondents‘ job positions are in management and being professionals. As
much as 40% of the respondents work in the administrative job scheme while 23.7% of them
are in the financial services, and only 5.2% are in the accounting job scheme. The balance 7.7%
work in other departments as officers in the legal, tax, education, health, procurement, and
information & technology departments. A majority of the respondents at 52.1% belong to Grade
41, while Grade 48 has 36.1% respondents and Grade 44 has 10.8%. 77% have been working
for more than 5 years at the present organization while only 12% have been working for 4 to 5
years in the present organization.
3.2. Factor Analysis
The variables‘ consistency is determined by using factor analysis to establish the risk
management. All the variables‘ factor loading in this study are more than 0.6 with the exception
of items RM10 and RM12 as shown in Table 4. Therefore, following the removal of these two
variables, the values of the factor loading are from 0.6 (RM9) to 0.88 (RM7). This demonstrates
that 10 out of the 12 variables can be used to measure risk management of the public sector in
Malaysia.
3.3. Descriptive Analysis
3.3.1. Service Scheme Wise Evaluation
According to all the service scheme groups, the highest average outcome for the factors
of risk management is at 4.4, including the practices by the administration and finance schemes
group while the lowest mean score is at 4.1, including the practices by the accounting and audit
schemes group on (Table 4). Moreover, the overall average score for risk management is at 4.3.
Table 4 Risk Management Factors According to Service Schemes
Service All
RM1 RM2 RM3 RM4 RM5 RM6 RM7 RM8 RM9 RM10 RM11 RM12
Schemes Average
Accounting 4.0 4.1 4.3 4.2 4.2 4.0 3.8 4.0 4.1 4.3 4.3 4.2 4.1
Administration 4.4 4.4 4.6 4.7 4.6 4.3 4.0 4.4 4.3 4.3 4.7 4.7 4.4
Audit 4.1 4.0 4.4 4.0 4.0 3.5 3.7 4.1 4.1 4.2 4.2 4.5 4.1
Finance 4.4 4.4 4.5 4.6 4.6 4.3 4.0 4.3 4.4 4.4 4.6 4.5 4.4
Others 4.3 4.2 4.1 4.4 4.2 4.4 3.9 4.1 4.1 4.3 4.4 4.3 4.2
306
All Average 4.3 4.3 4.5 4.5 4.4 4.2 3.9 4.2 4.3 4.3 4.5 4.5 4.3
Factor
0.71 0.74 0.63 0.80 0.74 0.77 0.88 0.74 0.60 0.43 0.69 0.12
Loading
* The factor loadings of the parameters less than 0.6 are considered as not suitable to measure
risk management for Malaysian public sector
The accounting service scheme group has a total average score of 4.1, with the highest
score being at 4.3 for RM3, RM10, as well as RM11. In addition, factors RM1, RM6, and RM8
show scores that are lesser in comparison to the average total scores.
The administrative scheme group has a total average score of 4.4 with the highest score
being at 4.7 for RM4, RM11, as well as RM12, and RM7 factor has the lowest score at 4.0.
Moreover, RM6, RM9, and RM10 show scores that are lesser in comparison to the average total
scores.
The overall risk management score for the audit scheme group is at 4.1, with factors
RM6 and RM7 scores getting only 3.5 and 3.7, respectively. The RM12 factor had the highest
score at 4.5. In addition, RM7 score is lesser in comparison to the average scores.
The finance scheme group has a total average score of 4.4 with RM4, RM5, and RM11
factors having the highest scores at 4.6, while RM7 factor has the lowest score at 4.0. In
addition, RM6 and RM8 scores are lesser in comparison to the average scores.
3.3.2. Factor Wise Evaluation
This study aims to measure the practices of risk management in the public sector by
utilizing 12 variables. According to the responses from the respondents, 94.7% of them agreed
that they practice the stated factors of risk management while 2.2% responded that they do not
practice them as revealed in Table 5. All the factors of risk management reveal that factors
RM3, RM4, RM11, as well as RM12 have the highest mean score at 4.5. Meanwhile, factor
RM7 has the lowest mean score at 3.9 as revealed in Table 4.
Table 5 Frequency Scores of Risk Management Factors
All
Score RM1 RM2 RM3 RM4 RM5 RM6 RM7 RM8 RM9 RM10 RM11 RM12
Average
1 0 0 0 4 4 4 0 0 0 0 0 0 1.0
2 5 4 4 1 1 1 6 4 4 0 5 4 3.3
3 2 7 4 3 13 10 12 9 3 6 1 3 6.1
4 124 117 80 73 63 113 168 117 127 121 73 80 104.7
5 63 66 106 113 113 66 8 64 60 67 115 107 79.0
307
Disagree (1-
2) 5 4 4 5 5 5 6 4 4 0 5 4 4.3
Agree (4-5) 187 183 186 186 176 179 176 181 187 188 188 187 183.7
Disagree (1-
2) % 2.6 2.1 2.1 2.6 2.6 2.6 3.1 2.1 2.1 0.0 2.6 2.1 2.2
Agree (4-5) % 96.4 94.3 95.9 95.9 90.7 92.3 90.7 93.3 96.4 96.9 96.9 96.4 94.7
Minimum 2 2 2 1 1 1 2 2 2 3 2 2 2
Maximum 5 5 5 5 5 5 5 5 5 5 5 44 7
Std. Dev. 0.6 0.6 0.6 0.7 0.8 0.7 0.5 0.6 0.6 0.5 0.6 0.6 0.5
According to the factors of risk management practices in the public sector, 96.4% of the
respondents revealed that they have a risk management policy in place (RM1) as shown in
Table 5. The employees in the administrative and finance schemes perceived it to be the
highest while the employees from the accounting scheme regarded it as the least as shown in
Table 4. Compared to the remaining service schemes, employees from the audit scheme
perceived it as being lesser than the average score.
According to the responses from the respondents, 94.3% of them agreed that their
departments consult subject matter experts and representatives from all areas of organizations
to develop risk management policy (RM2) as demonstrated in Table 5, and employees from the
administration and finance scheme regarded it the highest while those from the audit scheme
regarded it the lowest according to Table 4. According to the results from the other service
schemes, employees from the accounting scheme perceived it to be lesser than the average.
Table 5 shows that 95.9% of the respondents agree that the policy and all the
procedures and training that the department has in place are being well documented (RM3).
The employees under the administrative scheme claim it to be the highest and employees under
the accounting scheme claim it is the least as shown in Table 4. According to the results from
the remaining service schemes, respondents from the audit scheme regard them to be lesser
than the average level.
Table 5 shows that 95.9% of the respondents agree with review risk management policy
annually/after department changes/after experiencing a risk (RM4). The respondents under the
administrative scheme perceive it to be highest and respondents from the audit scheme claim it
to be the least as shown in Table 4. According to the results from the remaining service
schemes, respondents from the accounting scheme regard them to be lesser than the average
level.
Table 5 shows that 90.7% of the respondents agree that they trained the staff and third
party collaborators on the risk management policy (RM5). The respondents under the
308
administrative and finance scheme perceive it to be highest and respondents from the audit
scheme claim it to be the least as shown in Table 4. According to the results from the remaining
service schemes, respondents from the accounting scheme regard them to be lesser than the
average level.
Table 5 shows that 92.3% of the respondents agree that they take risk in seizing and
exploiting new opportunities (RM6). The respondents under the administrative and finance
scheme perceive it to be highest and respondents from the audit scheme claim it to be the least
as shown in Table 4. According to the results from the remaining service schemes, respondents
from the accounting scheme regard them to be lesser than the average level.
Table 5 shows that 90.7% of the respondents agree that they make large, bold decisions
despite uncertainty (RM7). The employees under the administrative and finance scheme
practice it the most and respondents from the audit scheme practice it the least as shown in
Table 4. According to the results from the remaining service schemes, respondents from the
accounting scheme practice it lesser than the average level.
Table 5 shows that 93.3% of the respondents agree that companies strategic are well
special/ specific (RM8). The respondents under the administrative scheme practice it the most
and respondents from the accounting scheme practice it the least as shown in Table 4.
According to the results from the remaining service schemes, respondents from the audit
scheme practice it lesser than the average level.
Table 5 shows that 96.4% of the respondents agree that they are monitoring government
priorities (RM9). The respondents under the finance scheme practice it the most and
respondents from the accounting and audit scheme practice it the least as shown in Table 4.
Table 5 shows that 96.9% of the respondents agree that they are keeping up to date
with international development/ technologies (RM11). The respondents under the administration
scheme practice it the most and respondents from the audit scheme practice it the least as
shown in Table 4.
3.4. Diagnostic Tests
The normality testing was carried using the Skewness and Kurtosis tests. Skewness
refers to something that is out of the norm based on the curve‘s extension, whether it curves out
to the left or right. It is identified as being positively skewed if the curve extends to the right
more, and negatively skewed if it extends to the left more (Wuensch, 2014). Moreover, the
Kurtosis provides the measurement of the flatness of the symmetric distribution at the top. The
rule of thumb is that both the skewness and kurtosis are regarded as being normally distributed
if the values are between -2 to +2. The distribution of the data is regarded as being normal if the
values of the skewness and kurtosis are within this range. However, the skewness value in this
study is -1.836 and the kurtosis value is 17.5, which shows being outside the range of normality
or in other words the data is not distributed normally. Nevertheless, Field (2013) explains that
the data can be regarded as normal if it exceeds thirty and in this study the sample size is 194.
Table 6 Reliability Testing for Risk Management Factors
Cronbach's Alpha 0.896
Eigenvalue 8.23
309
Eigen % variance 82.31
% of variance 82.31
Kaiser-Meyer-Olkin Measure of Sampling Adequacy 0.662
Bartlett's Test of Sphericity Approx. Chi-Square 2866.319
Bartlett's Test of Sphericity Sig. 0.00000
The value of the Cronbach‘s alpha on risk management as shown in Table 6 is 0.896. It
proves that the items‘ reliability in the questionnaire is excellent (George & Mallery, 2016). The
eigenvalues test indicates that the factors used for risk management is able to explain 82.31%
of the variance. The Kaiser-Meyer Olkin test indicates a value higher than 0.6, at 0.662. The
Barlett‘s Test Sphericity Approx. Chi-Square indicates the significance of the value (Chi-Square
= 2866, p < 0.0000001). Therefore, the sample has been found to be adequate for continuing
with the factor analysis to calculate the risk management.
4. CONCLUSIONS AND RECOMMENDATIONS
Malaysia has envisioned reaching the status of a developed country by the year 2020;
as such, many strategies have to be utilized to enhance the level of risk management in the
public service sector. This study has attempted to calculate the current level of risk
management practices in the public sector in Malaysia through the use of 12 related factors.
In general, 94.7% of the respondents assured that they practice the stated factors of risk
management, nevertheless, various service schemes prioritized the 12 factors differently.
Overall, the practices of risk management in administration and finance schemes group was the
highest in comparison to the other scheme groups. Meanwhile, the practices of risk
management in the accounting and audit scheme group were lower in comparison to the
general average score.
The government continues to initiate programmes with the objective of promoting and
motivating the risk management practices throughout the public sector and its departments so
that they can be seen to be more transparent in performing their tasks. Nevertheless, the
anticipated effect has not been observed as reported in the Corruption Perception Index (CPI)
by Transparency International in 2014, where Malaysia only went up in ranking by three points
from 53 to 50 based on a survey of 175 countries. This indicates that the efforts and measures
taken to overcome corruption in the country are still lacking (Zainal, 2014). It shows that even
though the government has undertaken critical strategies to enhance the perception of the
public, there is still a need for more concerted effort to improve the public‘s confidence in
regards to the public sector‘s risk management practices.
It is not enough to just transform the bureaucracy‘s structure to enhance the condition.
The entire public sector must be changed to develop and efficient and dependable sector that
would assure sufficient risk management practices with an efficient assessment system.
Improving the risk management practices would certainly help in achieving the requirement of
the stakeholders to ensure accountability in the public sector. It is recommended that every
ministry and department reports and produces their risk management and ethical activities to
310
make sure that they organize and develop a good governance culture in the many departments
available in the public sector. The report should be accessible to the public to develop a sense
of awareness and to educate them on the critical steps that have been carried out to lower the
level of misconduct among the government‘s employees.
The findings of this study could be utilized to assist the different agencies and
departments in the government to enhance their risk management levels based on the
associated service schemes. Additionally, the risk management factors measures and methods
used in this study could help the government to create measurement techniques for
accountability in the public sector. However, this study also had to face some limitations that
could be managed in future researches. This study only utilized six ministries for analysis
although the Malaysian government has in all 24 ministries and the questionnaire was only
given to department heads. The levels of practices of risk management could differ based on
the specific ministries and their officers of various ranking, which could be considered in future
research.
REFERENCES
Abdullah, M., Shukor, Z. A., Mohamed, Z. M. & Ahmad, A. (2015). Risk management disclosure.
Journal of Applied Accounting Research, 16(3), 400-432. doi: 10.1108/JAAR-10-2014-
0106
Archbold, C. A. (2005). Managing the bottom line: risk management in policing. Policing: An
International Journal of Police Strategies & Managment, 28(1), 30-48. doi:
10.1108/13639510510580968
Aziz, M. A. A., Rahman, H. A., Alam, M. M. & Said, J. (2015). Enhancement of the
Accountability of Public Sectors through Integrity System, Internal Control System and
Leadership Practices: A Review Study. Procedia Economics and Finance, 163 - 169.
doi: 10.1016/S2212-5671(15)01096-5
Bianchi, C. (2010). Improving performance and fostering accountability in the public sector
through system dynamics modelling: From an ‗external‘ to an ‗internal‘ perspective.
Systems Research and Behavioral Science, 27(4), 361-384. doi: 10.1002/sres.1038
Field, A. (2013). Discovering Statistics Using IBM SPSS Statistics. 4th Edition, SAGE
Publications.
George, D., & Mallery, P. (2016). IBMSPSS Statistic 23 Step by Step: A simple guide and
reference. 14th Edition, New York: Routledge, Taylor & Francis.
Mancuso, M. (2012). Nonprofit Risk Management. The Philanthropist, 24(3), 191-197.
Neef, D. (2005). Managing corporate risk through better knowledge management. The Learning
Organization, 12(2), 112-124. doi: 10.1108/09696470510583502
Ng, T.-H., Chong, L.-L. & Ismail, H. (2013). Is the risk management committee only a procedural
compliance? The Journal of Risk Finance, 14(1), 71-86. doi:
10.1108/15265941311288112
Rasid, S. Z. A., Rahman, A. R. A. & Ismail, W. K. W. (2011). Management accounting and risk
management in Malaysian financial institutions. Managerial Auditing Journal, 26(7), 566-
585. doi: 10.1108/02686901111151314
Rasid, S. Z. A., Rahman, A. R. A. & Ismail, W. K. W. (2011). Management accounting and risk
management in Malaysian financial institutions. Managerial Auditing Journal, 26(7), 566-
585. doi: 10.1108/02686901111151314
311
Smallman, C. (1996). Risk and organizational behaviour: a research model. Disaster Prevention
and Management: An International Journal, 5(2), 12-26. doi:
10.1108/09653569610112880
Tchankova, L. (2002). Risk identification-basic stage in risk management. Environmental
Management and Health, 13(3), 290-297. doi: 10.1108/09566160210431088
Tummala, R. & Achoenherr, T. (2011). Assessing and managing risks using the Supply Chain
Risk Management Process (SCRMP). Supply Chain Management: An International
Journal, 16(6), 474-483. doi: 10.1108/13598541111171165
Tummala, V. M. R. & Leung, Y. H. (1996). A risk management model to assess safety and
reliability risks. International Journal of Quality & Reliability Management, 13(8), 53-62.
doi: 10.1108/02656719610128493
Wuensch, K. L. (2014). Skewness, Kurtosis and the Normal Curve.
http://core.ecu.edu/psyc/wuenschk/StatsLessons.htm
Zainal, H. (2014). Malaysia climbs up three places in Corruption Index, The Star, 3 December.
Retrieve from http://www.thestar.com.my/news/nation/2014/12/03/cpi-malaysia-50-
improves-two-places/
-GP46-
CABARAN PENGURUSAN PERKHIDMATAN KEPADA KANAK-KANAK DARI
SUDUT PANDANGAN KAKITANGAN BARISAN HADAPAN DI JABATAN
KEBAJIKAN MASYARAKAT
Noor Azizah Ahmad,1 Ahmad Shukri Abdul Hamid,Mariny Abdul Ghani

School of Applied Psychology, Social Work and Policy
Emel: noor1149@uum.edu.my
Abstrak
Kakitangan barisan hadapan memainkan peranan penting dalam melaksanakan tugas bagi
mencapai matlamat organisasi.Mereka bertanggungjawab mentafsirkan ketetapandan
peruntukan polisikepada khidmat yang boleh diterima oleh klien. Tindakan yang dilakukan oleh
mereka secara langsung akan mempengaruhi keberkesanan khidmat yang disalurkan. Oleh itu,
penting bagi kita untuk meneliti cabaran yang dihadapi mereka dalam menyalurkan khidmat
kepada klien. Untuk tujuan tersebut artikel ini akan meneliti pandangan mereka berkait dengan
cabaran yang dihadapiketika menyalurkan khidmat untuk menjaga kebajikan dan meningkatkan
kesejahteraan kanak-kanak di Malaysia.Penulisan ini dibuat berdasarkan temubual yang telah
dijalankan ke atas sebelas orang kakitangan barisan hadapan di Pejabat-pejabat Kebajikan
Masyarakat di kawasan Utara Semenanjung Malaysia.Maklumat yang diperolehi dari tembual
telah dianalisis secara verbatim dan menghasilkan tema-tema penting yang perlu diberi
perhatian bagi mengurangkan ketidakcekapan dan melemahkan kebekesanan penyaluran
khidmat. Tiga tema akan diperincikan dalam artikel ini merangkumi bebanan kerja,
kepelbagaian kes dan kekangan masa.
Kata kunci: Kakitangan barisan hadapan, kanak-kanak, Jabatan Kebajikan Masyarakat,

cabaran, perkhidmatan.
312
Pengenalan
Jabatan Kebajikan Masyarakat merupakan salah sebuah agensi utama yang

bertanggungjawab membantu meningkatkan kebajikan dan kesejahteraan masyarakat. Namun,
media massa sering memaparkan rasa tidak puas hati masyarakat terhadap khidmat yang
disalurkan kepada mereka.Contohnya, timbul rungutan dari segi kelewatan agensi memproses
permohonan bantuan, agensi terlepas pandang permohonan bantuan yang dipohon dan
kelewatan memberikan bantuan.Ibu bapa turut mempertikaikan kredibiliti pelindung dan
pegawai akhlak yang bertanggungjawab menyalurkan khidmat kepada kanak-kanak (Mohd
Suhaimi, Sofian, Ezarina danNorulhuda(2016). Mereka juga dikatakan tidak mempunyai
kelayakan asas dalam bidang kanak-kanak sehingga penyaluran khidmat boleh terjejas.Ketua
Pengarah Jabatan Kebajikan Masyarakat, Encik Mohd Fazari Mohd Salleh telah mengupas isu-
isu yang sering ditimbulkan oleh masyarakat berkait dengan penyaluran khidmat oleh Jabatan
Kebajikan Masyarakat kepada mereka yang memerlukan bantuan. Antara isu yang
diketengahkan ialah keupayaan kaki tangan Jabatan Kebajikan Masyarakat untuk menyalurkan
bantuan kepada 500,000 orang pemohon bantuan dengan jumlah kakitangan yang hanya
mencecah 7000 orang (Mahaizura, 2018). Selaras dengan itu, artikel ini cuba meneliti
pandangan kakitangan barisan hadapan di Jabatan Kebajikan Masyarakat tentang cabaran
yang mereka hadapi ketika menyalurkan khidmat kepada kanak-kanak.
Metodologi
Kajian ini adalah berbentuk penerokaan yang menggunakan kaedah temubual

berstruktur.Garis panduan temubual dibentuk berdasarkan kepada pandangan Lipsky (2010),
Sibanda (2013), dan Shah (2010).Persoalan yang dibangkitkan semasa temubual merangkumi
cabaran yang dihadapi oleh kakitangan barisan hadapan yang bekerja di sembilan
buahPejabat Kebajikan Masyarakat Daerah di kawasan Utara Semenanjung.kakitangan yang
dipilih untuk ditemubual merupakan mereka yang terlibat menguruskan kes melibatkan kanak-
kanak yang terdiri daripada Pegawai Pelindung, Pegawai Akhlak dan kaunselor. Temubual
telah dijalankan di tempat kerja responden setelah mendapat kebenaran dari Ketua Pengarah
Jabatan Kebajikan Masyarakat.Temubual ini telah ditranskripsi secara verbatim dan kemudian
dianalisis secara manual.Penelitian ini telah menghasilkan beberapa tema merangkumi
kekangan masa, kepelbagaian kes klien dan kekangan sumber.
Dapatan Kajian dan Perbincangan
Maklumat demografi responden kajiandipaparkan menerusi Jadual 1. Seramai sebelas

orang responden terlibat dalam temubual terdiri daripada lima orang wanita dan enam orang
lelaki. Jawatan mereka adalah Penolong Pegawai Kebajikan Masyarakat dengan enam orang
daripada mereka merupakan Ketua Unit Kanak-kanak di tempat mereka bertugas.Semua
responden bertanggungjawab menguruskan kanak-kanak sama ada berkait dengan kes akhlak
atau perlindungan. Hanya seorang responden memegang dua portfolio iaitu sebagai pelindung
313
dan juga pegawai akhlak.Tempoh paling singkat responden memegang jawatan sekarang
adalah lapan bulan dan paling lama selama 17 tahun.
Jadual 1: Demografi responden
Responden Jantina Jawatan Tempoh

Memegang
Jawatan Sekarang
R1 Wanita Penolong Pegawai Kebajikan 4 tahun
Masyarakat / Pegawai Akhlak
Masyarakat / Pegawai Pelindung
R3 Lelaki Penolong Pegawai Kebajikan 1 tahun
Masyarakat / Ketua Unit Kanak-
kanak /Pegawai akhlak
kanak / Pegawai Akhlak
Masyarakat / Pelindung
Masyarakat Kanan / Ketua Unit
Kanak-kanak / Pelindung
Masyarakat / Pelindung dan
Pegawai Akhlak
Masyarakat Kanan / Ketua Unit
Kanak-kanak / Pegawai Akhlak
Masyarakat Kanan / Pelindung
R10 Wanita Penolong Pegawai Kebajikan 8 bulan
kanak / Pelindung
kanak / Pelindung
Berdasarkan kepada penelitian hasil temubual didapati antara cabaran yang sering
diketengahkan oleh responden ialah kekangan masa, kepelbagaian kes klien dan kekangan
sumber.Petikan pandangan responden berkait dengan cabaran yang dinyatakan boleh diteliti
berdasarkan jadual-jadual di bawah.
314
Jadual 2: Pandangan responden tentang cabaran kekangan masa
Responden Pandangan Responden Tentang Kekangan Masa

R8 macamlaporan akhlak saya kena sedia kadang sampai jam 2 pagi, bawa
balik rumah. Kalau di pejabat memang tak dan. Sebab kadang di pejabat
kes mai, kes-kes tak terkawal tu kita kena layan dia sampai 2 jam kadang
nak bagi mereka puas hati, rasa seronok. Kita tak mau balik dalam keadaan
kecewa, ‗pi kebajikan pun buat apa,‘ kata dia. Kita nak bagi puas hati apa
semua, balik dalam keadaan sekurang-kurang ada satu… dia puas hati la.
Bukan senang, kadang sampai 2 jam. Kadang tengah dok buat laporan ni
tengok-tengok ada kes mai.
R1 Tak boleh nak bagi keputusan dalam masa sehari kita kena step by step
jadi lambat. Jadi…memang tak banyak kes tapi satu kes tu makan masa.
Jadi bagi macam prosedur kerja tu takdak masalah sangat la… cuma bila
dicampur ISO haa sakit kepala saya habaq terus terang.
R11 Bukan apa kalau ikut satu...satu…satu masa akan habis banyak pada satu
benda tu dan kita tertinggal benda yang lain sebab tu kami perlu kreatif la.
Kami perlu kreatif kadang-kadang benda yang patut kami buat aaa…kami
buat bukan tak buat sebab kalau tak buat kami nanti kami akan dapat
ketakakuran. Kami dapat ketakakuran kami buat tapi macam mana cara
kami buat tu mengikut kreativiti kami la
Jadual 2 di atas menjelaskan tentang kekangan masa yang dihadapi oleh

responden.Kenyataan di atas memaparkan bahawa kakitangan barisan hadapan ini secara
langsung cuba memberikan perkhidmatan yang terbaik kepada klien sehingga sanggup
membawa balik kerja ke rumah. Ada juga responden yang menyatakan bahawa mreka tiada
masalah untuk memenuhi prosedur kerja yang ditetapkan, walau bagaimanapun beban kerja
mereka bertambah disebabkan perlu melengkapkan kehendak piawaian organisasi seperti
ISO.Keadaan ini menghendaki mereka menggunakan kaedah tertentu bagi memastikan
khidmat boleh disalurkan sebagaimana yang dikehendaki.
Dari segi cabaran berkait dengan kepelbagaian kes klien pula, responden memberikan
gambaran kerja mereka seperti Jadual 3.
Jadual 3: Pandangan responden tentang kepelbagaian kes klien
Responden Pandangan Responden Tentang Kepelbagaian Kes Klien

R2 Kalau kes pertama keluarga pun tak mau nak jaga lepas tu dari segi
keadaan hidupan memang tak menjamin kalau nak ikut kan tempat terbaik
adalah institusi la. Haa…. tapi bila keluarga kata nak jaga haa banyak guna
budi bicara la sebab pada saya kesalahan kali pertama saya akan bagi
peluang
315
R6 Dia kalau kita tanya mana-mana jabatan kebajikan masyarakat bahagian

yang paling orang tak nak bahagian kanak-kanak terutamanya pelindung.
Pelindung ni on call kemudian kita ni kebanyakan kerja kita buat sorang-
sorang dan kerja-kerja untuk bantuan kita bila kita dapat satu kes, kita
siasat satu tempat ja habis pi rumah dia pi rumah tok penghulu nak dapat
maklumat tambahan. Tapi untuk kes-kes penderaan, kes-kes jenayah
kanak-kanak ni kita kena pergi semua tempat selagi mana kita tau ada
waris yang pernah jaga dia dan sebagainya selagi tu kita kena pi sebelum
kita buat keputusan.
R5 untuk berkenaan dengan bantuan kewangan ni pada dasarnya SOP tu
bagus la tapi bila bermain dengan manusia ni kita kena ada budi bicara la.
Bagi saya macam pekerja kes la pegawai siasatan dia terlalu bila ada SOP
ni dia terlalu terikat sangat ok kena hantar surat, sebab kita pakai sistem
100% surat dia ada tarikh dia
Responden sedar bahawa mereka perlu mengikut polisi, peraturan dan prosedur kerja
yang telah digariskan organisasi.Namun begitu, cabaran yang dihadapi oleh mereka ialah
situasi kes yang agak berbeza di antara klien.kepelbagaian kes klien ini secara langsung
menuntut pekerja untuk tidak terlalu terikat dengan peraturan dan prosedur kerja tersebut. Oleh
itu, pertimbangan untuk menentukan bentuk perkhidmatan yang boleh disalurkan kepada klien
sering kali dibuat berdasarkan situasi klien.Aspek ini secara langsung menghendaki responden
menggunakan budi bicara semasa membuat keputusan dalam menyalurkan perkhidmatan.
Jadual 4 memaparkan tentang cabaran dari segi kekurangan sumber yang dihadapi oleh
mereka.Dua aspek kekurangan sumber yangdiketengahkan oleh semua responden
ialahkekurangan sumber kewangan dan kakitangan.Dari segi kewangan, responden
membincangkan tentang aspek tuntutan perjalanan yang boleh mereka buat agak terhad, tidak
termasuk perbelanjaan makan kepada pengiring dan makan kanak-kanak.Mereka turut
menyatakan tiada peruntukan kewangan untuk kes-kes melibatkan klien datang dan
memerlukan bantuan segera sehingga menyebabkan mereka perlu mengeluarkan duit poket
sendiri.Selain itu, mereka turut menyentuh aspek ruang kerja yang sempit dan tidak selesa,
kemudahan komputer dan printer yang tidak mencukupi, serta talian internet yang tidak stabil
menyebabkan kerja mereka terpaksa ditangguhkan terutama kerja yang melibatkan
penggunaan sistem atau program yang telah ditetapkan.
Jadual 4: Pandangan responden tentang kekurangan sumber
Responden Pandangan Responden Tentang Kekurangan Sumber

R10 Banyak jugak la masa saya kat Langkawi dulu kesan jugak la sebab
perjalanan tu jauh kan…. kena hantar ke STB mana-mana kan, Marang ka
... Melaka ka… memang la boleh claimtapi setakat mana ja…memang
316
banyak jugak la guna duit poket sendiri…. tapi tak pa la kata masa kita ada
kan. Tapi kekangan dia hat tu la sebab duit jenis peruntukan hat walk in tu
tak dak la….. Kalau bawa kes pun ada pengiring kan takkan depa nak
belanja pulak kita ajak kan jadi kita kena belanja la semua. Tapi kita tak
boleh claim yang belanja tu kan
R9 Tak cukup dia bebanan kerja ni macam pelindung… kita ada unit-unit lain
tau bukannya macam pegawai akhlak buat akhlak saja perlindungan buat
perlindungan saja, tak. Saya kena buat jugak macam taska pusat jagaan
R5 Macam kami memang kekurangan staf kan jadi memang tak boleh nak lari
la yang tu
R7 Kan…kes beribu. Jadi cabaran tu pertama sekali kalau dari segi kerja tu
makna kata memang kita ni kebanyakan sosial ni memang kena
tambah…lebih dan kita kena ada nisbah macam negara…kita tak mintak
macam Jepun 1:30 kes sorang kita tak mintak macam Australia 30 kes tak.
Bagi 200 pun clear, baik dari segi bantuan baik dari segi apa jenis bantuan
skim, baik dari segi perkhidmatan kanak-kanak dan sebagainya la untuk
support.
Kesimpulan
Artikel ini telah meneliti pandangan kakitangan barisan hadapan di Pejabat Kerbajikan
Masyarakat tentang cabaran yang dihadapi oleh mereka semasa menyalurkan khidmat kepada
kanak-kanak.Temubual yang dilakukan ke atas sebelas orang responden yang terdiri daripada
Pegawai Pelindung, Pegawai Akhlak dan Kaunselor mendapati cabaran utama yang dihadapi
oleh mereka ialah dari segi bebanan kerja disebabkan oleh kesuntukan masa, kepelbagaian
kes klien, kekurangan sumber kewangan dan sumber tenaga kerja. Keadaan ini secara tidak
langsung boleh menjejaskan keberkesanan penyaluran perkhidmatan kepada kanak-
kanak.Untuk menangani cabaran ini, responden telah mengunakan pelbagai kaedah termasuk
menggunakan budi bicara. Walau bagaimanapun, tidakan sewajarnya perlu diambil supaya
cabaran ini tidak membebankan dan menjejaskan motivasi kerja kakitangan yang seterusnya
boleh memberi kesan kepada aktiviti penyaluran khidmat.
Rujukan
Lipsky, M. (2010).Street-level bureaucracy: Dilemmas of the individual in public services. 30th
anniversary expended edition. New York: Russell Sage Foundation.
Mahaizura Abd Malik (31 Februari 2018) Perlu urus 500,00 penerima bantuan.
https://www.hmetro.com.my/utama/2018/02/313919/perlu-urus-500000-penerima-
bantuan-serentak-metrotv
Mohd Suhaimi Mohamad, Sofian Brahim, Ezarina Zakaria & Norulhuda Sarnon @ Kusenin
(2016). Kelestarian praktis kerja sosial ke arah kesejahteraan hidup kanak-kanak
terpinggir di Malaysia.Prosiding PERKEM ke-11, 112-120.
317
Shah, T. (2010).The experience of new workers in the field of child welfare.MASW thesis. Wilfrid
Laurier University, Canada.
Sibada, S. (2013).Challenges faced by social workers working in child protection services in
implementing the Children‟s Act 38 of 2005. MSW thesis. University of Pretoria, South
Africa.
-GP47-
KELANGSUNGAN SUMBERJAYA PELANCONGAN NEGARA MELALUI
PENERAPAN KONSEP PELANCONGAN LESTARI: ASPEK UNTUK
PERTIMBANGAN
Mohamad Zaki Ahmad1, Johan Afendi Ibrahim1, Norria Zakaria 2, Malike Brahim 3
1
Pusat Pengajian Pengurusan Pelancongan, Hospitaliti & Acara, UUM COLGIS
2
Pusat Pengajian Pengurusan Perniagaan, UUM COB
3
Pusat Pengajian Kerajaan, UUM COLGIS
Universiti Utara Malaysia (UUM)
06010 Sintok, Kedah Darul Aman.
zaki.ahmad@uum.edu.my
Abstrak
Perkembangan industri pelancongan yang amat besar saban tahun memberikan indikasi
bahawa pelancongan selayaknya menerima pengiktirafan sebagai antara penyumbang terbesar
ekonomi sejagat. Pelbagai impak yang tercetus sebelum, semasa dan selepas aktiviti berkaitan
pelancongan ini dijalankan menunjukkan bahawa industri manusia (people industry) ini adalah
bersifat dinamik dan mampu mensejahterakan umat manusia sekiranya dibangunkan dalam
konteks dan ruang lingkup yang memberikan penekanan terhadap pembangunan sahsiah insan
dan manusia sejagat. Keupayaan pelancongan yang berpotensi menyumbang kepada impak
negatif juga perlu diberi tumpuan dan dipertimbangkan sewajarnya oleh pihak berkepentingan.
Kenyataannya, kebanyakan tarikan utama pelancongan adalah berkaitan dengan elemen alam
semulajadi dan warisan yang sememangnya tidak dapat diperbaharui; justeru, usaha
pemeliharaan dan pemuliharaan sumberjaya yang berkenaan adalah amat diperlukan dan perlu
dilaksanakan secara berterusan. Pendekatan pembangunan pelancongan lestari bagi setiap
perancangan pelancongan adalah amat diperlukan kerana sekiranya sumberjaya pelancongan
dimusnah atau dimansuhkan, maka sesebuah kawasan atau destinasi pelancongan itu tidak
lagi dapat menarik pelancong dan akhirnya pelancongan di kawasan berkenaan akan gagal.
Justeru, kertas konseptual ini membincangkan beberapa aspek berkenaan pelancongan lestari
dalam membantu usaha kelangsungan sumberjaya pelancongan negara untuk terus dinikmati
oleh generasi hari ini dan masa hadapan.
Katakunci: Pelancongan, sumberjaya, pelancongan lestari, kriteria dan tanda aras kelestarian
318
1. PENGENALAN: PELANCONGAN DAN SUMBERJAYA (ALAM SEKITAR)
Isu penurunan kualiti alam sekitar seringkali menjadi fokus lensa dan tajuk perdebatan di
seluruh dunia. Di peringkat antarabangsa, perhatian dan tumpuan banyak diberikan terhadap
isu-isu seperti penipisan lapisan ozon, hujan asid dan fenomena pemanasan global. Walaupun
pembangunan pelancongan bukanlah penyebab utama kepada masalah alam sekitar, namun di
beberapa buah negara yang berkaitan ianya telah dan sedang menjadi penyumbang utama
kepada masalah berkenaan. Tanpa tindakan dan amalan pengurusan yang baik dan
bersesuaian dalam menagani masalah alam sekitar tersebut, pelancongan akan ‗menderita‘.
‗Alam sekitar‘ merujuk kepada persekitaran fizikal yang merangkumi komponen

semulajadi dan buatan (built) (Lickorish dan Jenkins, 1999). Dalam hal ini, ‗persekitaran
semulajadi‘ adalah apa yang wujudsecara semulajadi di sekeliling kita termasuk suhu dan
cuaca, ciri-ciri air, tanah dan topografi, flora dan fauna dan sebagainya; manakala ‗persekitaran
buatan‘ merupakan ciri fizikal buatan manusia terutamanya semua jenis bangunan dan struktur-
struktur binaan yang lain. Faktor sosiobudaya dan ekonomi juga turut terlibat dalam analisis
persekitaran komprehensif. Walaubagaimanapun, ianya agak sukar untuk memisahkan
komponen sosiobudaya dan ekonomi dalam konteks persekitaran semulajadi atau alam sekitar.
Memandangkan pelancongan merupakan industri terbesar dunia pada ketika ini, alam sekitar
dan sumberjaya semulajadi menjadi isu utama dan terpenting dalam pembangunan
pelancongan. Sebagaimana ianya menjadi kuasa ekonomi yang berkuasa, pelancongan juga
turut menjadi faktor utama dalam persekitaran fizikal. Persekitaran atau alam sekitar
merupakan tunjang atau teras utama kepada kebanyakan produk pelancongan memandangkan
keuntungan melalui pelancongan adalah bergantung kepada aspek pengekalan ciri-ciri menarik
untuk dilihat dan dialami bagi sesebuah destinasi sebagaimana yang diinginkan pengunjung
atau pelancong yang melawat destinasi berkenaan. Pelancongan dapat ‗menjana‘ kedua-dua
impak positif dan negatif dalm konteks persekitaran dan alam sekitar bergantung kepada
bagaimana cekap dan berkesannya sesuatu pembangunan pelancongan itu dirancang dan
dikawal. Impak-impak berkaitan tidak akan berlaku semuanya di sesebuah destinasi atau
kawasan memandangkan ianya hanya akan berlaku bergantung kepada jenis dan skala
pembangunan pelancongan dan ciri-ciri alam sekitar di kawasan berkenaan.Banyak ciri alam
sekitar yang menjadi tarikan kepada para pelancong memandangkan hubungan yang amat
rapat antara alam sekitar dan pelancongan itu sendiri. Pelancongan mempunyai ‗kuasa untuk
membangun dan menambahbaik‘ persekitaran, memelihara budaya dan sejarah, menyediakan
dana untuk pemuliharaan sumberjaya, merangka dan menetapkan ‗had penggunaan lestari‘
(sustainable use limits) dan melindungi tarikan alam semulajadi. Namun, pelancongan juga
turut mempunyai ‗kuasa untuk memusnah dan merosakkan‘ persekitaran. Sekiranya
pelancongan tidak dirancang dan dilaksanakan secara baik dan sesuai, ianya boleh
merosakkan tumbuh-tumbuhan, menimbulkan masalah kesesakan dan sampah sarap
berlebihan, masalah pembinaan berlebihan dan tidak terkawal, masalah pencemaran, masalah
perumahan, masalah saliran dan pembentungan serta mengenepikan keperluan dan struktur
319
penduduk setempat atau masyarakat ‗tuan rumah‘. Melalui kesedaran global terhadap alam
sekitar, para perancang pelancongan masa kini lebih menyedari dan memahami
tanggungjawab mereka terhadap generasi masa depan melalui ‗penggunaan‘ sumberjaya
semulajadi secara terancang dan lebih berhati-hati (Lickorish dan Jenkins, 1999).
Memandangkan trend peningkatan dan pertumbuhan positif pelancongan dunia, maka
pembangunan pelancongan lestari adalah pendekatan dan kaedah yang akan diperlukan.
Tanpa sumberjaya, pembangunan pelancongan tidak akan berlaku dengan sempurna.

Justeru, usaha penjagaan sumberjaya secara tersusun dan terancang bagi mengatasi
kerosakan dan kemusnahan, atau ‗melambatkan‘ proses kemusnahan atau kerosakan
sumberjaya perlu diberi perhatian yang amat serius oleh pihak berkepentingan terutamanya
masyarakat setempat. Dengan memahami kepentingan sumberjaya dalam pelancongan serta
kepentingan pemeliharaan dan pemuliharaan sumberjaya pelancongan, adalah diharapkan
agar masyarakat setempat lebih menghargai keunikan sumberjaya sedia ada dan seterusnya
dapat bersama-sama memastikan agar sumberjaya pelancongan dapat dikekalkan untuk satu
tempoh masa yang panjang demi kelangsungan pembangunan pelancongan yang bermanfaat
kepada semua.
2. MEMAHAMI PELANCONGAN LESTARI: SEPINTAS LALU
Dalam mendidik dan meningkatkan kesedaran masyarakat terhadap peri pentingnya

usaha menghargai, memelihara dan seterusnya memulihara sumberjaya pelancongan, terlebih
dahulu masyarakat perlu difahamkan secara jelas apakah yang dimaksudkan dengan konsep
atau istilah ‗pelancongan lestari‘ itu.Maka dalam konteks pengurusan alam ini, manusia sama
sekali dilarang daripada melakukan sesuatu tindakan yang boleh merosakkan alam seterusnya
mewujudkan suasana yang tidak harmoni, kacau bilau dan menggugat ketenteraman di
kalangan manusia lain. Sesungguhnya penciptaan manusia itu adalah sebaik-baik kejadian
berbanding makhluk Allah yang lain. Allah SWT menganugerahkan kesempurnaanakal fikiran,
spiritual dan fizikal bagi mengangkat darjat dan seterusnya membolehkan manusia dilantik
sebagai khalifah yang dipertanggungjawabkan untuk memakmur dan mensejahterakan alam
(sumberjaya) dengan makruf lagi bijaksana.
Beberapa firman Allah membincangkan tentang penciptaan alam yang merupakan

rahmat Allah SWT yang tidak ternilai kepada makhluk, terutamanya umat manusia
sebagaimana yang dijelaskan oleh surah al-Baqarah ayat 164.
Sesungguhnya pada kejadian langit dan bumi; dan (pada) pertukaran malam dan siang; dan
(pada) kapal-kapal yang belayar di laut dengan membawa benda-benda yang bermanfaat
kepada manusia; demikian juga (pada) air hujan yang Allah turunkan dari langit lalu Allah
hidupkan dengannya tumbuh-tumbuhan di bumi sesudah matinya, serta Ia biakkan padanya
320
dari berbagai-bagai jenis binatang; demikian juga (pada) peredaran angin dan awan yang
tunduk (kepada kuasa Allah) terapung-apung di antara langit dengan bumi; sesungguhnya
(pada semuanya itu) ada tanda-tanda (yang membuktikan keesaan Allah kekuasaanNya,
kebijaksanaanNya, dan keluasan rahmatNya) bagi kaum yang (mahu) menggunakan akal
fikiran.
Bagi kebanyakan kes, pengembaraan atau aktiviti pelancongan manusia di atas muka
bumi ini amat didorong oleh sumberjaya berteraskan alam yang pada hakikatnya bersifat ‗tidak
dapat diperbaharui‘ (non-renewable). Terdapat banyak lagi ayat al-Quran dan hadis Rasulullah
SAW yang menceritakan tentang rahsia, manfaat dan keistimewaan alam samada yang tersurat
atau tersirat yang perlu diterokai dan dialami sendiri oleh umat manusia. Rasulullah SAW
bersabda:
Dunia ini hijau dan cantik dan Tuhanmu telah melantik kamu sebagai
pengurusnya. Dia melihat apa yang kamu lakukan (Riwayat Muslim)
Bagi menjadikan pembangunan pelancongan lebih bermakna terutamanya kepada

penduduk atau komuniti setempat serta memastikan tahap kepuasan pelancong di sesebuah
destinasi, pendekatan pembangunan yang praktikal dan berkesan perlu dilaksanakan. Dalam
hal ini pembangunan pelancongan lestari sering kali dipilih sebagai satu kaedah atau
pendekatan yang amat bersesuaian. Realiti hari ini yang jelas menunjukkan tentang
kemerosotan sumberjaya sebenarnya memerlukan semua pihak termasuk komuniti setempat
memikirkan tentang masa depan industri pelancongan kerana secara fitrahnya kebanyakan
sumberjaya pelancongan yang digunakan adalah bersifat tidak dapat diperbaharui. Memang
tidak dapat dinafikan bahawa pelancongan merupakan industri yang berkembang pesat. Oleh
itu, kemasukan pelancong ke sesebuah negara, wilayah ataupun sesebuah komuniti
pelancongan akan meninggalkan sama ada kesan positif atau negatif kerana di sebalik
manfaat, pembangunan pelancongan juga boleh menyebabkan kerosakan alam sekitar yang
seterusnya boleh membuatkan pelancong tidak lagi mengunjungi destinasi tersebut bagi satu
tempoh yang agak panjang.
Secara umumnya pembangunan pelancongan lestari bermaksud mencapai kemajuan atau

pembangunan dalam ertikata yang tidak mengganggu gugat atau merosakkan persekitaran
semulajadi dan persekitaran ―buatan‖ pada masa sama memelihara aspek budaya masyarakat
setempat. Pertubuhan Pelancongan Dunia pula mendefinisikan pelancongan lestari sebagai
―memenuhi keperluan semasa pelancong dan destinasi pada masa sama melindungi dan
meningkatkan peluang-peluang untuk masa hadapan... menuju kepada pengurusan semua
sumberjaya yang berkaitan melalui cara di mana keperluan ekonomi, sosial dan estetika
dapat dipenuhi sementara mengekalkan integriti budaya, proses ekologi penting,
kepelbagaian biologi, dan sistem sokongan hidup‖ (WTO, 2013).
Pelancongan lestari atau pelancongan mampan turut merujuk kepada ‗semua jenis
pembangunan, pengurusan dan aktiviti pelancongan yang mengekalkan integriti ekonomi, alam
sekitar dan sosial serta memastikan keadaan alam semulajadi, binaan dan sumberjaya warisan
terpelihara untuk selamanya‘ (FNNPE, 1993). Jadi, untuk mencapai tahap lestari atau mapan
bagi mana-mana pembangunan pelancongan, prinsip-prinsip pembangunan pelancongan
lestari perlu digunapakai dan diberi perhatian sepenuhnya. Dalam hal ini, pelancongan lestari
adalah berdasarkan kepada prinsip-prinsip pembangunan pelancongan yang:
 menyokong penggunaan piawaian etika di dalam operasi dan meminima impak negatif
sosial;
 meningkatkan ekuiti sosial;
321
 menggunakan alam sekitar dan warisan secara sensitif dan mempromosikan

pemeliharaan dan pemuliharaan kepada kawasan pembangunan;
 meminimakan penggunaan sumber yang tidak boleh diperbaharui;
 menyedari tampungan alam sekitar, menggunakan alam sekitar secara sensitif dan
memantau kesan secara efektif; dan
 menggalak perubahan secara langsung dan tidak langsung sikap individu dan ahli
perniagaan ke arah perancangan dan pengurusan yang memberikan pertimbangan
terhadap alam sekitar.
Konsep pembangunan pelancongan lestari dapat meningkatkan pengiktirafan dan

kesedaran terhadap pentingnya pengurusan lestari bagi sumberjaya pelancongan yang terhad
yang seterusnya mewujudkan produk pelancongan berkualiti melalui usaha-usaha
pemeliharaan dan pemuliharaan sumberjaya. Pembangunan pelancongan lestari dapat
memenuhi keperluan ekonomi, sosial, dan estetika di samping mengekalkan keutuhan dan
integriti kebudayaan serta proses-proses ekologi. Ia juga memberi dan menyediakan
pelancong dan host (tuan rumah) peluang yang sama dalam melindungi serta memelihara
sumberjaya sedia ada.
Pelancongan lestari membenarkan pengunaan sumberjaya budaya dan semulajadi

untuk menjana keuntungan ekonomi, namun pada masa yang sama, perlu ―menjamin‖ agar
sumberjaya ini tidak berkurangan atau dimusnahkan. Tambahan pula, pelancongan juga
turut dianggap sebagai pemacu atau pendorong utama untuk mewujud dan mengukuhkan
usaha perlindungan alam sekitar dan pemuliharaan nilai budaya. Dua pendekatan utama
dalam skop pemeliharaan alam sekitar boleh dikenal pasti di kalangan entiti perniagaan
pelancongan. Pendekatan yang pertama ialah pengurusan pengunjung/pelawat yang berfungsi
untuk mengurangkan kesan negatif pelancongan terhadap ekosistem dan kepelbagaian bio.
Manakala, pilihan yang kedua pula ialah pembiayaan usaha pemuliharaan melalui kaedah
kewangan secara langsung atau tidak langsung yang dijana melalui pelancongan.
Pembangunan pelancongan lestari memberikan tumpuan terhadap usaha meminimakan

impak negatif ekologi melalui pengurusan sumber yang lebih cekap seperti praktis pengurangan
penggunaan sumber, pengurusan sisa secara teratur dan penggunan bahan yang mesra alam.
Kaedah saintifik dan teknologi harus digunapakai dalam keadaan-keadaan tertentu. Mengenai
sumber budaya dan bukan material yang lain, pendekatan yang bersifat ―bertanggungjawab‖
dan sesuai adalah perlu. Ini bermaksud, budaya tempatan harus dihormati dan dipulihara
dengan sentiasa mengekalkan aspek keasliannya.Konsep pembangunan pelancongan lestari
dapat meningkatkan pengiktirafan dan kesedaran terhadap pentingnya pengurusan lestari bagi
sumberjaya pelancongan terhad yang seterusnya dapat mewujudkan produk pelancongan yang
berkualiti melalui usaha pemeliharaan dan pemuliharaan sumberjaya.
3. KRITERIA DAN TANDA ARAS KELESTARIAN PEMBANGUNAN PELANCONGAN
Kriteria dan tanda aras kelestarian yang dicadangkan oleh Ahmad (2017) menjadi
garispanduan yang dapat diguna pakai dalam membantu memastikan kelangsungan
sumberjaya pelancongan yang terlibat terutamanya dalam proses perancangan, pemantauan
dan penilaianprojek pembangunan pelancongan yang bakal dibangunkan. Secara umumnya,
kriteria tersebut menyediakan jawapan kepada persoalan: Apakah sebenarnya yang hendak
dicapai melalui pembangunan pelancongan lestari? Justeru, tujuan utama cadangan
pembentukan kriteria dan tanda aras kelestarian tersebut adalah untuk membantu semua pihak
berkepentingan dalam pembangunan pelancongan di destinasi (kawasan) yang berkenaan
322
memahami dengan lebih baik mengenai kelompok atau kumpulan kriteria kelestarian yang
diterima pakai secara umum yang boleh disepadukan dan dipraktikkan dalam proses
perancangan sesebuah pembangunan yang berkenaan. Tambahan pula, kriteria kelestarian itu
sendiri adalah satu mekanisme yang penting dan amat sesuai dalam membuat jangkaan
implikasi pembangunan projek pelancongan di destinasi yang berkenaan.
Pembangunan pelancongan di sesebuah destinasi bakal memberikan pertimbangan

terhadap aspek seperti aktiviti yang ditawarkan kepada pelancong atau pelawat, impak-impak
yang bakal dijana, penggunaan dan pengurusan sumberjaya di destinasi dan pelbagai
pertimbangan lain yang berkaitan. Justeru, dalam membangunkan sebarang projek
pelancongan yang lestari, setiap projek atau perancangan yang berkaitan adalah perlu
dipastikan agar ianya mematuhi prinsip kelestarian yang berkaitan dengan bidang dan ruang
lingkup pelancongan.
Bagi tujuan kawalan dan pemantauan yang lebih praktikal terhadap aktiviti berkaitan
pembangunan projek dan memastikan kejayaannya, penjelasan menyeluruh tentang kriteria
umum yang disarankan untuk diterima pakai dalam perancangan dan pembangunan
pelancongan di destinasi adalah amat penting untuk dilakukan. Ini adalah kerana cadangan ini
bakal menjadi garispanduan yang akan diguna pakai terutamanya dalam proses perancangan,
pemantauan dan penilaian projek yang bakal dibangunkan. Malahan, cadangan ini dapat
membantu memastikan sumberjaya pelancongan terpelihara dan dapat dikekalkan untuk
tempoh masa yang panjang dengan memberikan pertimbangan kepada faktor berikut:
 Pelancongan bukan penyebab kepada kemusnahan sumberjaya.
 Pelancongan membantu usaha penjagaan dan pengekalan sumberjaya yang berkaitan.
 Pelancongan sebagai alat untuk mendidik dan menyemai perasaan menghargai sumberjaya
sedia ada untuk terus dikekal demi perkongsian dengan generasi masa hadapan.
Secara umumnya, ―kriteria‖ menekankan tentang matlamat yang cuba dicapai melalui
pembangunan pelancongan lestari. Kriteria juga turut menggambarkan sesuatu keadaan
dan/atau penambahbaikan ciri-ciri sesuatu kawasan destinasi pelancongan, produk
pelancongan atau pembangunan pelancongan secara umum. Maka, dapat diandaikan bahawa
sekiranya kriteria ini dipenuhi atau dibuktikan benar, maka bolehlah dikatakan bahawa
pelancongan tersebut telah dibangunkan secara lestari. Dalam menentukan jika sesuatu
kriteria itu dipenuhi, penanda aras tertentu boleh diguna pakai. Dalam konteks ini, penanda
aras merupakan ciri-ciri atau figures yang menunjukkan keadaan atau perubahan keadaan
sedia ada sesuatu kriteria. Setiap kriteria harus mempunyai sekurang-kurangnya satu atau
seboleh-bolehnya lebih daripada satu penanda aras yang boleh diukur dengan cara yang diakui
secara saintifik dan sebaik-baiknya dengan cara yang objektif. Untuk menukar tahap
kepentingan suatu kriteria, ianya boleh diimbangi kepada taraf yang bersesuaian dalam menilai
tahap atau takat peningkatan sesuatu kriteria dengan secukupnya.
Dalam menggambarkan sesuatu tanda aras, bukan sahaja ciri-ciri atau angka (nilai)
sahaja yang patut dijelaskan, tetapi kaedah ukuran yang digunapakai juga seharusnya
dihuraikan untuk menjelaskan lagi kaedah kutipan data bagi tujuan penilaian pelancongan yang
betul. Adalah amat penting untuk mengambil kira angka-angka (nilai) yang diukur melalui tanda
aras di mana ianya perlu ditafsir secara keseluruhan oleh pakar bebas yang berkelayakan.
Memandangkan rangka kerja pelancongan dan keadaan sosioekonomi antara satu kawasan
dengan kawasan yang lain adalah berbeza, angka-angka ―umum‖ ini sebenarnya mampu
membuktikan secara memuaskan sama ada sesuatu kriteria itu dapat dipenuhi atau sebaliknya.
323
Rajah 1: Kriteria dan tanda aras kelestarian dalam pembangunan pelancongan
Walau bagaimanapun, adalah penting untuk menyedari bahawa walaupun senarai

kriteria yang dihuraikan untuk pembangunan pelancongan lestari secara amnya boleh
digunapakai untuk semua bentuk dan jenis pelancongan yang wujud di segenap tempat
(destinasi) di serata dunia; namun, set tanda aras bagi kriteria tertentu harus dipilih secara teliti
dan perlu diselaraskan mengikut keadaan tertentu di kawasan di mana kelestarian pelancongan
bakal dinilai atau diaplikasikan dalam perancangan untuk pembangunan pelancongan baharu.
Oleh yang demikian, tanda aras seperti yang dicadangkan ini tidak mewakili senarai penuh
tanda aras dan tidak seharusnya dianggap sebagai satu senarai yang mutlak, tetapi hanya
sebagai contoh untuk menggambarkan dimensi suatu kriteria sahaja yang dijangka dapat
membantu merealisasikan pembangunan pelancongan lestari di destinasi berkenaan sahaja.
Secara ringkasnya, kriteria dan tanda aras kelestarian adalah seperti yang ditunjukkan dalam
Rajah 1.
4. KESIMPULAN
Sumberjaya pelancongan yang wujud dalam pelbagai bentuk dan kategori merupakan
‗bahan utama‘ yang dapat menentukan kejayaan sesebuah destinasi atau tarikan pelancongan.
Secara fitrahnya sebahagian besar daripada tarikan pelancongan adalah dalam bentuk
sumberjaya berteraskan alam sekitar serta elemen lain yang berkaitan. Kemerosotan kualiti
atau rosaknya sumberjaya pelancongan berkenaan bakal merencatkan ‗kerancakan‘ aktiviti
pelancongan di destinasi berkenaan. Masyarakat setempat termasuk pelancong perlu dididik
melalui pendekatan pelancongan lestari tentang peri pentingnya usaha penjagaan sumberjaya
pelancongan ini. Atas kesedaran menjaga dan terus mengekalkan sumberjaya pelancongan
untuk sama-sama dinikmati oleh generasi sekarang dan generasi masa hadapan tanpa
324
mengorbankan nilai-nilai setempat, penerapan nilai-nilai kelestarian dalam setiap bentuk

pembangunan pelancongan adalah merupakan antara alternatif dan jalan penyelesaian yang
terbaik.Dalam hal ini, pematuhan dan pertimbangan terhadap kriteria dan tanda aras kelestarian
dalam membangunkan sebarang projek pelancongan adalah satu langkah yang berupaya
menjamin kelangsungan sumberjaya pelancongan negara.
RUJUKAN
al-Quran kareem
Ahmad, M. Z (2017). Persepsi masyarakat nelayan terhadap pembangunan pelancongan di
Kuala Kedah: ke arah pembangunan lestari. Tesis PhD. Bangi: Universiti Kebangsaan
Malaysia.
Allen, L. R., Long, P. T., Perdue, R. R. and Kielselbach, S. (1988). The impacts of tourism
development on residents perceptions of community life. Journal of Travel Research,
26(1), 16-21.
Andereck, K. L., Valentine, K. M., Knopf, R. C. & Vogt, C. A. 2005. Residents‘ perceptions of
community tourism impacts. Annals of Tourism Research 32(4): 1056-76.
Ap, J. (1992). Residents‘ perceptions on tourism impacts. Annals of Tourism Research, 19(4),
665-690.
Asmak, A., & Fatimah, S. (2010). Pelancongan dari perspektif Islam. In M. A. Yakob, H. Ismail,
& T. Ibrahim (Eds.), Prosiding Seminar Pengurusan Perhotelan & Pelancongan Islam
2010 (pp. 52–63). Shah Alam: Universiti Teknologi Mara.
Duman, T. (2011). Value of Islamic tourism offering: Perspectives from the Turkish experience.
International Institute of Advanced Islamic Studies (IAIS) Malaysia. Retrieved March 12,
2012, from http://www.iais.org.my/e/attach/ppts/12-13JUL2011-WITF/ppts/Assoc Prof Dr
Teoman Duman.pdf
Federation of Nature and National Parks of Europe (1993). Loving them to death? Sustainable
tourism in Europe‟s nature and national parks. Belgium, FNNPE.
Garrod, F. and Fyall 1998. Beyond rhetoric of sustainable tourism? Tourism Management,
19(3), 199-212.
Griffin, T. and Boele, N. 1997. Alternative Paths to Sustainable Tourism: Problems, Prospects,
Panaceas and Pipe-dreams. In: Go, M. Frank and Jenkins Carson L.(eds.), Tourism and
Economic Development in Asia and Australasia. London: Cassell.
Gursoy, D., Jurowski, C. and Uysall, M. (2002). Resident attitudes: a structural modeling
approach, Annals of Tourism Research, 29, 79-105.
Hasan, B., Mohammad Mahyuddin, K., & Mohd Ahsrof Zaki, Y. (2010). Pelancongan dari
perspektif Islam: Analisis pendekatan fiqh. In Y. Mohd Asmadi, I. Huzaimah, & I.
Takiyuddin (Eds.), Prosiding Seminar Pengurusan Perhotelan & Pelancongan Islam 2010 (pp.
1–17). Shah Alam: Universiti Teknologi Mara.
Henderson, J. C. (2009). Islamic tourism reviewed. Tourism Recreation Research, 34(2), 207–
211.
Lickorish, L. J. and Jenkins, C. L. (1999). An introduction to tourism. London: Butterworth-
Heinemann.
Nunkoo, R. (2015). Tourism development and trust in local government. Tourism
Management, 46, pp.623-634.
Saarinen, J. (2013). Critical sustainability: Setting the limits to growth and responsibility in
tourism. Sustainability, 6(1), pp.1-17.
Saufi, A., O'Brien, D. and Wilkins, H., (2014). Inhibitors to host community participation in
sustainable tourism development in developing countries.Journal of Sustainable
Tourism, 22(5), pp.801-820.
325
Shakiri, A. S. (2006). Islamic tourism, for whom? Islamic Tourism Magazine. Retrieved from
www.islamictourism.com
UNWTO. (2013). Sustainable Tourism for Development Guidebook: ―Enhancing capacities for
Sustainable Tourism for Development in Developing Countries, World Tourism
Organization (UNWTO), Madrid: Spain.
Waligo, V.M., Clarke, J. and Hawkins, R. (2013). Implementing sustainable tourism: A multi-
stakeholder involvement management framework. Tourism Management, 36, pp.342-
353.
Rujukan Internet:
http://azamhusni.blogspot.com/2010/10/sebaik-baik-pelancongan_06.html?m=1
http://birokerohanianjpp.blogspot.com/2008/12/jadikan-melancong-sebagai-satu-
ibadah.html?m=1
http://cf.cdn.unwto.org/sites/all/files/docpdf/glossaryenrev.pdf
http://mutiarakata-bintang.blogspot.com/2010/12/melancong-dapat-memberi-hidayah.html
-GP49-
CABARAN YANG DIHADAPI OLEH PENDUDUK DALAM MEREALISASIKAN
KELESTARIAN AKTIVITI KITAR SEMULA DI NEGERI KEDAH
Wahida Ayob
Email: wahida@uum.edu.my
ABSTRAK
Peningkatan sisa pepejal domestik masih kekal menjadi salah satu daripada masalah
alam sekitar yang serius baik di negeri Kedah mahupun di Malaysia. Isirumah memainkan
peranan penting dalam mengurus sisa pepejal domestik ini. Pelbagai jenis bantuan diagihkan
kepada penduduk seperti tong kitar semula dan sangkar kitar semula. Kajian ini bertujuan
untuk mengenalpasti masalah dan cabaran yang dihadapi oleh penduduk untuk terlibat dalam
aktiviti kitar semula di negeri Kedah. Kaedah penyelidikan kualitatif menggunakan pendekatan
temubual dan perbincangan dalam kumpulan fokus digunakan untuk mengkaji aktiviti kitar
semula di negeri Kedah. Seramai 37 orang responden termasuk 9 orang pegawai dari setiap
Majlis Daerah (Majlis Bandaraya Alor Setar, Majlis Perbandaran Sungai Petani, Majlis Daerah
Yan, Majlis Daerah Pendang dan Environment Idaman) turut terlibat dalam kajian ini. Dapatan
kajian ini menunjukkan bahawa antara cabaran yang dihadapi oleh penduduk ialah kekurangan
kemudahan, harga belian barang kitar semula yang rendah, kurang promosi, kurang maklumat
dan tiada pendidikan tidak formal mengenai aktiviti kitar semula. Bagi menjayakan aktiviti kitar
semula, pihak berkuasa tempatan perlu memberi tumpuan kepada aspek pendidikan,
penubuhan persatuan, penyediaan kemudahan dan mengaktifkan pondok kitar semula yang
terbiar. Aktiviti kitar semula juga perlu diurus secara bersepadu yang melibatkan gabungan
pihak kerajaan, swasta, Badan Bukan Kerajaan (NGO) dan orang ramai agar aktiviti kitar
semula boleh dijalankan dalam skala yang besar dan dapat menjadi budaya hidup kepada
masyarakat keseluruhannya.
326
Pengenalan
Dalam kehidupan seharian, aktiviti kitar semula adalah sangat penting untuk menjamin
pengurusan sisa pepejal yang cekap. Namun begitu, masalah sisa pepejal di Malaysia masih
lagi menjadi masalah kepada negara iaitu dengan peningkatan berterusan setiap tahun. Setiap
hari, sebanyak 33, 000 tan sampah dihasilkan di Malaysia (Sinar Online, 2017). Salah satu
sebabnya ialah sikap masyarakat yang kurang prihatin serta kurangnya pendidikan serta
hebahan awam tentang pengasingan sisa pepejal menyebabakan isu lambakan sisa pepejal di
pusat pelupusan terus menjadi isu alam sekitar. Permasalahan ini menjadi antara salah satu
daripada cabaran kelestarian aktiviti kitar semula.
Kelestarian aktiviti kitar semula perlu berdasarkan kepada strategi untuk

memperkukuhkan penglibatan isi rumah untuk meningkatkan tahap kesedaran alam sekitar
yang tinggi dan kewajipan sosial yang tinggi dalam kalangan masyarakat. Isirumah adalah
salah satu kelompok penyumbang kepada pengurusan sisa pepejal, oleh itu kejayaan
pengurusan sisa pepejal bergantung kepada tingkahlaku dan sikap positif mereka. Kajian ini
memberi fokus kepada cabaran yang dihadapi oleh penduduk dalam merealisasi kelestarian
aktiviti kitar semula di negeri Kedah. Hal ini kerana kajian-kajian lepas menunjukkan bahawa
terdapat pelbagai masalah yang dihadapi oleh orang ramai dalam melakukan aktiviti kitar
semula.Seiring dengan kepesatan proses pembangunan, negeri Kedah juga menyaksikan
permasalahan yang sama dengan negeri-negeri lain di Malaysia terutamanya yang berkaitan
dengan pelupusan sisa, kemudahan, faktor jarak, jumlah sisa yang semakin meningkat dan
sikap masyarakat. Sehubungan itu, kajian ini bertanggungjawab untuk mendapatkan asas
pemahaman yang jelas dan komprehensif baik di pihak orang ramai dan Pihak Berkuasa
Tempatan tentang cabaran-cabaran yang dihadapi dalam merealisasikan kelestarian aktiviti
kitar semula di negeri Kedah.
Kadar Penjanaan Sisa Pepejal Dan Aktiviti Kitar Semula Di Negeri Kedah
Kajian ini dijalankan di negeri Kedah Darul Aman sebuah negeri yang terletak di utara
Semenanjung Malaysia dengan keluasan 9 426 km persegi. Keluasan negeri Kedah juga
merangkumi 2.9 peratus keluasan Malaysia. Kedah mempunyai 12 daerah pentadbiran iaitu
Baling, Bandar Baharu, Kota Setar, Kuala Muda, Kubang Pasu, Kulim, Padang Terap,
Pendang, Pulau Langkawi, Sik, Yan, Pokok Sena. Penduduk negeri Kedah semakin bertambah
mengikut tahun daripada 2, 082, 200 orang pada tahun 2014 kepada 2, 144, 600 orang pada
tahun 2016 (Portal Terbuka Malaysia (2016).
Jadual 1: Jumlah Sisa Pepejal Yang Dikitar Semula Mengikut Negeri di Negeri Kedah
Pada Tahun 2012-2013
Daerah Jumlah sisa pepejal yang dikitar semula (kg)
2012 2013
Kota Setar 52, 030.40 75, 888.57
Kuala Muda 63, 313. 00 75, 004.73
Kulim 49, 855.40 34, 598.39
327
Langkawi 7, 527.90 8, 457.09
Kubang Pasu 22, 905.40 31, 240.51
Baling 1, 974.40 3, 236.74
Yan 2, 502.00 2, 381.28
Sik 1, 132.00 934.85
Padang Terap 1, 132.00 920.25
Pendang 4, 872.00 8, 521.20
Bandar baharu 641.20 813.05
Jumlah 207, 556.9 242, 996.66
Sumber: PPSPPA, 2014
Jadual 1 menunjukkan jumlah sisa pepejal yang dikitar semula mengikut daerah di
negeri Kedah pada tahun 2012 dan 2013. Jumlah sisa pepejal yang dikitar semula pada tahun
2012 ialah 207, 556.90 dan meningkat kepada 242, 996. 66 kg pada tahun 2013. Antara daerah
yang menunjukkan kadar kitar semula yang tinggi adalah daerah Kota Setar, Kuala Muda,
Kulim, Kubang Pasu dan Langkawi. Ini menunjukkan tahap kesedaran terhadap kitar semula
sudah semakin meluas dan masyarakat Kedah semakin mempraktikkan amalan kitar semula
ini. Namun demikian, terdapat daerah yang menunjukkan kadar kitar semula yang menurun
seperti daerah Kulim, Yan dan Padang Terap (PPSPPA, 2014).
Program kitar semula dijalankan pada beberapa peringkat iaitu kitar semula di peringkat
komuniti, peruncit, bank kitar semula di sekolah dan rebat ke atas cukai tafsiran Pihak Berkuasa
Tempatan. Keempat-empat peringkat ini merupakan projek untuk aktiviti kitar semula secara
umum. Program 3R adalah salah satu program kitar semula yang paling popular dijalankan
pada masa ini. Program kitar semula memberikan penekanan kepada program 3R (Reduce,
Reuse, Recycle). Program 3R ini bertemakan ‗membudayakan amalan 3R‘. Program ini
dijalankan di negeri Kedah oleh syarikat Environment Idaman. Syarikat Environment Idaman ini
bertanggungjawab untuk memberikan kesedaran tentang program kitar semula di negeri Kedah.
Selain itu, syarikat ini juga bertanggungjawab untuk mengasingkan sisa pepejal (Jabatan
Pengurusan Sisa Pepejal dan Pembersihan Awam, 2012).
Perbadanan Pengurusan Sisa Pepejal dan Pembersihan Awam (SWCorp) Negeri Kedah
telah menetapkan matlamat sifar aduan awam daripada orang awam menjelang hujung tahun
2018. Matlamat tersebut termasuk dalam inisiatif bagi menjadikan Kedah bebas daripada sisa
pepejal. Matlamat tersebut dapat dicapai kerana hanya menerima kurang daripada lima aduan
tentang kutipan sejak pertengahan tahun 2017. Pada tahun 2010, Kedah pernah dikatakan
sebagai Darul Sampah tetapi kini tidak lagi apabila Kerajaan Persekutuan telah mengambil alih
328
untuk penswastaan. Kejayaan menjadikan Kedah bebas daripada sisa pepejal pada tahun lalu
mendapat perhatian agensi lain seperti Dewan Bandaraya Kuala Lumpur (DBKL) yang mahu
menjadikan contoh cara pengurusan sisa pepejal. Bagaimanapun, tahap kesedaran reduce,
reuse dan recycle masih belum memuaskan. Peratusan kitar semula hanya serendah 12
peratus berbanding 1,400 tan sisa pepejal yang dijana setiap hari (Adie Sufian, 2018). Ini
menunjukkan tahap kitar semula di Kedah juga tidak memuaskan dan tidak mencapai sasaran
yang ditetapkan oleh kerajaan. Kajian yang dilakukan oleh Hamidi et.al (2004) dalam kawasan
Majlis Perbandaran Kota Setar (MPKS) mengenai amalan kitar semula penduduk mendapati
wujud beberapa masalah seperti kekurangan kemudahan kitar semula seperti tong kitar
semula, jarak tempat pembuangan sisa pepejal yang tidak sesuai dan kurang agen pengumpul
sisa pepejal yang merupakan antara sebab yang menjadi penghalang penglibatan penduduk
dalam program ini.
Kelestarian Aktiviti Kitar Semula
Kemapanan secara umumnya membawa maksud pengekalan sesuatu perkara atau

keadaan. Ini bermakna, kemapanan ada kaitannya dengan usaha mengekalkan serta
memelihara keaslian (Azrina, 2008). Kemapanan bermaksud keadaan yang tidak berubah
seperti semua pihak perlu mengamalkan kemapanan ekosistem dengan mengamalkan
kemapanan aktiviti alam sekitar. Asas kemapanan ialah keupayaan untuk meneruskan amalan
kitar semula untuk memastikan pengurusan aktiviti kitar semula secara berterusan. Kemapanan
pengurusan aktiviti kitar semula dapat dicapai apabila semua benda yang berada di bumi boleh
hidup dengan baik tanpa menjejaskan kualiti hidup generasi akan datang. Amalan kitar semula
secara lestari diharap dapat menyederhanakan gaya hidup pengguna dan meningkatkan
kesejahteraan alam sekitar.
Kemapanan adalah berdasarkan kepada prinsip yang mudah iaitu semua yang
diperlukan dalam hidup dan kesejahteraan hidup sama ada secara langsung atau tidak
langsung terhadap alam semulajadi. Untuk meneruskan kemapanan adalah untuk mewujudkan
dan mengekalkan syarat-syarat hubungan antara manusia dan alam semulajadi boleh wujud
dalam keadaan harmoni dan produktif untuk menyokong generasi masa kini dan generasi akan
datang (United States Environmental Protection Agency, 2015).
Kelestarian aktiviti kitar semula perlu dilihat daripada tiga aspek utama iaitu kecekapan
pengurusan sisa pepejal. Penglibatan positif masyarakat dan daripada aspek penggunaan
lestari, penggunaan hijau, sisa sifar yang akan menyumbang kepada kejayaan aktiviti
ini.Sasaran utama dalam kelestarian aktiviti kitar semula ialah bagaimana untuk meningkatkan
penglibatan isi rumah dalam aktiviti ini. Selain itu langkah untuk mengurangkan penggunaan
barang yang banyak menghasilkan sisa pepejal juga adalah penting. Untuk mencapai hasrat ini
masyarakat perlu dididik tentang penggunaan lestari yang sangat berperanan dalam usaha
untuk meningkatkan aktiviti kitar semula. Penggunaan secara lestari merujuk kepada tindakan
menggunakan barangan dan perkhidmatan untuk memenuhi keperluan asas ke arah mencapai
kualiti hidup yang lebih baik dan pada masa yang sama meminimumkan penggunnaan sumber
329
asli, bahan toksik dan pengeluaran barangan dan bahan pencemar supaya tidak menjejaskan
persekitaran (Laily et.al, 2004).
Masalah Dan Cabaran Kitar Semula
Perbincangan mengenai dapatan kajian dibuat berdasarkan isu dan cabaran yang
dihadapi oleh penduduk di negeri Kedah.
Kurang kemudahan kitar semula
Hasil kajian bahagian kualitatif menunjukkan penduduk sepakat menyatakan mengenai

kekurangan kemudahan yang disediakan oleh PBT untuk memudahkan mereka melakukan
aktiviti kitar semula. Secara idealnya, kerajaan mahukan penglibatan orang ramai secara
maksimum dalam melakukan aktiviti kitar semula tetapi ini adalah mustahil untuk dicapai tanpa
persediaan kemudahan awam di mana rakyat boleh melakukan kitar semula dengan selesa.
Pelaburan untuk projek sisa pepejal menelan belanja yang amat besar misalnya pada
tahun 2000 sahaja sebanyak RM 7.9 juta dibelanjakan oleh Kemeterian Perumahan Dan
Kerajaan Tempatan (KPKT) bagi tujuan pelaksanaan kitar semula seperti mengadakan
Program Kesedaran Awam dan perbelanjaan untuk menyediakan tong kitar semula, maka
usaha itu untuk memastikan kejayaan pengurusan sisa pepejal melalui kaedah kitar semula
berjaya amat penting untuk mengurangkan kos pengurusan. Pada tahun 2002, terdapat hanya
280 tong kitar semula dibekalkan di negeri Kedah tetapi jumlah penduduk Kedah pada tahun
2010 mencecah 2, 044, 188 orang. Ini bermakna, kiraan kasar bagi nisbah penduduk dan tong
kitar semula adalah rendah iaitu 1 tong bagi 7300 penduduk. Sebanyak 13 pusat pengumpulan
kitar semula dibina pada tahun 2002 namun ia tidak berfungsi sepenuhnya contohnya lima
pusat pengumpulan di kawasan pentadbiran Majlis Daerah Kubang Pasu yang terletak
dikawasan perumahan Universiti Utara Malaysia (UUM), Pasar Changlon, Pekan Jitra, Taman
Ehsan dan Bandar Darulaman.
Faktor jarak letakan kemudahan kitar semula
Kemudahan kitar semula merupakan aspek yang penting dalam menyokong aktiviti kitar
semula kerana ia dapat membantu memudahkan aktiviti kitar semula. Kebanyakan kemudahan
kitar semula terletak di kawasan bandar. Ini memberi kesulitan kepada penduduk luar bandar
kerana jarak yang jauh. Jarak antara kediaman ke tempat kemudahan turut mempengaruhi
keupayaan penduduk untuk melakukan kitar semula dengan selesa dan sempurna. Penemuan
kajian mendapati purata jarak bagi penduduk untuk ke tempat kitar semula adalah melebihi lima
kilometer.
Pusat pengumpulan yang jauh dari kawasan kediaman tidak menggalakkan isirumah
untuk terlibat dalam kitar semula. Menurut Gonzalez-Torre & Adenso-Diaz (2005) memberi
komen bahawa penduduk yang prihatin terhadap alam sekitar mempunyai tong kitar semula
berdekatan dengan rumah mereka, oleh itu mereka kerap kitar semula daripada perlu berjalan
330
jauh dan mengambil masa untuk membuang sisa pepejal dan ini mendatangkan
ketidakselesaan kepada mereka kerana terpaksa membawa muatan yang banyak. Lagi jauh
pusat pengumpulan ia tidak menggalakkan isirumah untuk terlibat dalam kitar semula. Ini
kerana hasil kajian yang dilakukan oleh Nor Azizan dan Zaini (2003) menunjukkan penduduk
bersetuju bahawa kewujudan pusat belian balik di lokasi kediaman penduduk akan menarik
lebih ramai penduduk untuk menyertainya.
Kurang maklumat dan hebahan mengenai kemudahan kitar semula
Program kitar semula memerlukan maklumat yang perlu disampaikan secara berterusan
kepada masyarakat agar mereka akan memperolehi pengetahuan yang berguna. Langkah ini
akan dapat membantu meningkatkan tahap kesedaran dan meningkatkan penglibatan dalam
kitar semula. Pembinaan pondok kitar semula bukan satu langkah yang praktikal untuk
meningkatkan kadar kitar semula dalam kalangan masyarakat kerana tanpa hebahan dan
maklumat membuatkan masyarakat tidak mengetahui tujuan dan fungsi pondok tersebut. Ini
sebaliknya mendatangkan pembaziran kerana tidak digunakan sebaliknya dijadikan tempat
letak motor dan kegunaan-kegunaan lain yang tidak berfaedah.
Harga barangan kitar semula
Harga barangan yang rendah merupakan salah satu masalah yang dihadapi oleh
responden terutamanya jika menjual kepada agen pembeli. Terdapat saranan daripada
penduduk agar harga semasa barangan yang boleh dikitar semula perlu dipaparkan dalam
media agar masyarakat akan dapat mengetahui harga barangan jualan semasa. Ini akan dapat
membantu masyarakat untuk menjual barangan kitar semula pada harga berpatutan.
Kurang penyaluran maklumat kitar semula
Memang tidak dapat dinafikan saluran media memainkan peranan yang penting dalam
menyalurkan maklumat termasuklah berkaitan dengan program kitar semula. Ini
memandangkan jika isirumah yang menerima maklumat kitar semula secara langsung melalui
media akan mempunyai kesan positif ke atas penglibatan kitar semula. Ini bermakna media
merupakan medium yang efektif dalam menyalurkan mesej untuk meningkatkan penglibatan
isirumah dalam kitar semula (Vicente & Reis 2008). Penduduk yang mendapat maklumat
bagaimana untuk kitar semula lebih cenderung untuk terlibat dalam kitar semula berbanding
mereka yang kurang mendapat maklumat (Austin et.al, 1993, Thorgersen, 1994 & Nyamwange,
1996)
Komunikasi kepada umum tentang sisa pepejal mempunyai impak besar ke atas
komitmen individu untuk kitar semula. Penyampaian maklumat akan menyumbang mesej
penting tentang komitmen pihak berkuasa terhadap kitar semula. Ini menunjukkan penyertaan
dalam kitar semula boleh ditingkatkan di mana pihak berkuasa tempatan memberi promosi
secara berterusan mengenai skim kitar semula. Namun, sejak akhir-akhir ini maklumat kurang
331
disalurkan melalui media. Penduduk juga menyatakan keperluan untuk mendapatkan maklumat
secara berterusan tentang alam sekitar dan kitar semula.
Oleh itu, saluran media perlu digunakan seperti TV, radio, suratkhabar untuk
meningkatkan penglibatan isirumah dalam kitar semula dan meningkatkan kesedaran mereka.
Penyaluran maklumat yang baik akan meningkatkan kesedaran orang ramai, maka program
kitar semula akan berjaya dilaksanakan. Tanpa maklumat yang baik dan peningkatan
kesedaran orang ramai, program kitar semula akan gagal mencapai matlamatnya.
Pemberian maklumat adalah penting untuk meningkatkan pemahaman individu terhadap

aktiviti kitar. Dalam melakukan aktivit kitar semula, pengetahuan penduduk penting dalam
menentukan ketersediaan mereka dalam melakukan aktiviti kitar semula. Kini, banyak iklan
tidak diputarkan oleh media disebabkan oleh kekangan kos. Menurut Austin et.al (1993),
Thorgersen (1994) dan Nyamwange (1996) dimana isi rumah yang kurang mendapat maklumat
akan kurang mengitar semula berbanding dengan isirumah yang banyak mendapat maklumat.
Hasil kajian turut menjelaskan bahawa penglibatan PBT, PPSPPA, Environment Idaman
dan pihak NGO di peringkat komuniti dalam meningkatkan pengetahuan penduduk berkaitan
aktiviti ktar semula adalah kurang memuaskan. Secara tidak langsung ia mencerminkan
bahawa pendedahan dan pengetahuan berhubung aktiviti kitar semula bergantung kepada
inisiatif penduduk sendiri. Ini membawa implikasi yang besar sekiranya tiada panduan dan
bimbingan yang khusus daripada agensi yang terlibat akan mengakibatkan pemahaman dan
pengetahuan yang diterima oleh penduduk akan tersasar daripada konsep yang sebenarnya.
Cadangan Langkah Untuk Mengatasi Permasalahan Yang Dihadapi Oleh Penduduk
Sepertimana dapatan yang diperolehi, adalah perlu untuk mengadakan program

pengurusan sisa dan kitar semula bagi isirumah di negeri Kedah. Pendekatan ini merupakan
satu pendekatan yang terbaik dalam usaha untuk mencapai kelestarian aktiviti kitar semula.
Pada masa yang sama, keputusan kajian menunjukkan bahawa penduduk tetap melakukan
aktiviti kitar semula biarpun dalam skala yang kecil.
Isirumah mempunyai pengaruh yang besar dalam aktiviti kitar semula. Justeru, golongan
ini perlu dididik agar menjadi pengitar semula yang konsisten di masa depan serta dapat
merealisasi hasrat tersebut yang seiring dengan proses pembangunan yang dilalui oleh negara.
Langkah ini penting untuk mendapatkan kehidupan yang sejahtera, persekitaran yang bersih
dan selamat (Wahida, 2016).
Usaha untuk mencapai kelestarian aktiviti kitar semula perlu dilakukan secara
berterusan. Isirumah perlu mendapatkan maklumat, menyedari dan mengamalkannya atas
pilihan sendiri. Aktiviti kitar semula memerlukan pembaikan secara berterusan dari semasa ke
semasa iaitu perlu ada peningkatan daripada segi perancangan, pelaksanaan, polisi dsb. Ini
memandangkan gaya hidup yang semakin berubah dan ke arah penggunaan yang semakin
332
meningkat wajar dipastikan bahawa apa sahaja usaha yang ingin dilakukan perlu bersesuaian
dan selaras dengan perubahan yang berlaku (Wahida, 2016)
Walaubagaimanapun, bagi pembuat dasar , tumpuan bukan hanya diarahkan kepada

sama ada orang awam tahu bagaimana untuk mengasingkan sisa pepejal dan menjual kepada
agen pembeli tetapi juga bagaimana untuk memotivasikan mereka untuk mengasingkan sisa
dan melakukan kitar semula secara berterusan untuk menyelamatkan alam sekitar. Hasil kajian
juga menunjukkan responden yang berpendapatan rendah cenderung untuk melakukan kitar
semula. Ini menunjukkan ganjaran kewangan adalah motivasi utama untuk bertindak secara
positif untuk lakukan kitar semula. Elemen ekonomi sepatutnya difokuskan untuk menggalakkan
penglibatan terutamanya apabila negara sedang berada dalam krisis kemelesetan ekonomi dan
kenaikan kos sara hidup. Ganjaran ekonomi ini akan menggalakkan isirumah untuk melakukan
kitar semula
Dapatan kajian berkaitan pendedahan responden terhadap program kitar semula

menunjukkan isi rumah kurang terdedah dengan kursus dan seminar serta pendidikan di mana
responden mengakui mereka tidak pernah mendapat pendidikan berkaitan dengannya, tidak
pernah terlibat dalam persatuan dan tidak pernah menghadiri kursus kitar semula. Kurang
pendedahan terhadap kursus mengakibatkan isi rumah kurang pengetahuan berkaitan kitar
semula. Oleh itu, majoriti responden mengharapkan agar program pendidikan secara tidak
formal, persatuan, kursus serta seminar boleh diadakan oleh pihak berkuasa. Mereka juga tidak
menolak kemungkinan untuk berusaha mendapatkan maklumat dan perkhidmatan yang
ditawarkan.
Kelestarian aktiviti kitar semula mempunyai perimbangan yang baik untuk menjana
pendapatan, pemeliharaan kualiti alam sekitar dan prasarana yang baik. Oleh itu, asas
kelestarian aktiviti kitar semula adalah dengan menggabungkan aktiviti kitar semula dengan
pertimbangan alam sekitar dan ekonomi dalam usaha untuk meningkatkan kualiti hidup
masyarakat dan kesejahteraan persekitaran. Pengurusan aktiviti kitar semula lestari sangat
bergantung kepada kebolehan dan kebijaksanaan pentadbir/PBT dalam mencorakkannya. Di
sini suatu urustadbir yang lebih dinamik perlu bagi membolehkan semua pihak yang
berkepentingan sepert PBT, PPSPPA dan Environment Idaman dapat memberikan peranan
dan tanggungjawab masing-masing.
Kesimpulan
Perbincangan yang dilakukan menunjukkan terdapat pelbagai cabaran dalam usaha

merealisasikan kelestarian aktiviti kitar semula di negeri Kedah. Namun begitu, setiap individu
perlu menyedari bahawa kitar semula adalah satu isu negara dan seharusnya ia memerlukan
komitmen padu dan usaha berterusan daripada orang ramai agar dapat dilaksanakan dengan
sempurna samaada dalam jangka masa pendek ataupun jangka masa panjang. Untuk memacu
kejayaan kitar semua, segala usaha perlu kolektif dan konsisten dan kitar semula perlu
dilakukan dalam skala yang besar. Aktiviti kitar semula mampu dijayakan dan perlu disokong
dengan sistem kemudahan, penubuhan persatuan, pemberian pendidikan tidak formal, taklimat,
333
ceramah, seminar dsb. Aspek pengurusan kitar semula yang betul, sistematik, efisien dan
memudahkan pengguna turut menyumbang kepada kejayaan aktiviti ini.
Rujukan
Adie Sufian Zulkefli (2018). SWCorp Kedah sasar sifar aduan kutipan sampah. Diakses pada
1 Oktober 2018. Dimuat turun daripada http://www.astroawani.com/
Austin, J., Hatfield, D., Gridle, A & Bailey, J. (1993). Increasing recycling in office
environments-the effect of specific informative cues. Journal of Environmental Systems.
6, 355-368.
Azrina Sobian. (2008). Pengurusan sisa pepejal di Malaysia dan masalahnya. Capaian pada 8
Oktober daripada http://www.ikim.gov.my/index.php/en/artikel/7193-pengurusan-sisa-
pepejal-di-malaysia-dan-masalahnya.
Gonzalez-Torre, B & Adenso-Diaz, P.L. (2005). Influences of distances on the motivation and
frequency of household recycling, Int.J.Waste. Management, 5, 15-23.
Hamidi Ismail, Rohana Yusof, Tuan Pah Rokiah Syed Hussain & Wahida Ayob. (2004).
Amalan kitar semula (pengurusan sisa pepejal) penduduk kediaman Majlis Perbandaran
Kota Setar. Laporan Penyelidikan. Universiti Utara Malaysia.
Jabatan Alam Sekitar. (2008). Laporan Kualiti Alam Sekeliling 2007. Kuala Lumpur.
Kementerian sains, teknologi dan Alam Sekitar.
Laily, P., Sharifah Azizah, H., Nurizan, Y., Aini, M.S., Naimah, S. & Norhasmah, S. (2004).
Pembentukan indeks keprihatinan persekitaran. Malaysian Journal of Consumer and
Family Economics, 7, 29-53.
Nor Azizan Idris & Zaini Sakawi. (2003). Konflik dan kefahaman terhadap pengurusan alam
sekitar: tinjauan awal terhadap cadangan pembinaan incinerator. Prosiding persidangan
kebangsaan Pusat Pengajian Sosial, Pembangunan dan Persekitaran, 12-13
September. Universiti kebangsaan Malaysia. Bangi
Nyamwange, M. (1996). Public perception of strategies for increasing participation in
recycling programs. The Journal Of Environmental Education, 27, 19-22.
Perbadanan Sisa Pepejal Dan Pembersihan Awam. (2012). Apakah itu 3R. Diakses pada 25
Mac 2014 di laman web www.ppsppa.gov.my/index.php/3r/pengenalan.
Perbadanan Sisa Pepejal Dan Pembersihan Awam. (2014). Diakses 4 Februari 2014 daripada
http://www.sisa.my/sisamy/index.php?option=com_content& view=article &
id=61&itemid=55.
Portal Data Terbuka Malaysia (2016). Pecahan penduduk negeri Kedah mengikut daerah.
Diakses pada 28 September 2018. Dimuat turun daripada http://www.data.gov.my
Sinar Online. (2017). Jumlah sisa pepejal dijangka meningkat 22 peratus. Diakses pada 1
Oktober 2018. Dimuat turun daripada http://www.sinarharian.com.my/
Thogersen, J. (1994). Monetary incentives and environmental concern. Effects of a
differentiated garbage fee. Journal of Consumer Policy. 17, 407-442.
United States Environmental Protection Agency. (2015). Learn about sustainability. Dicapai
pada 9 Oktober 2015 daripada http://www2.epa.gov/sustainability/learn-about-
sustainability#what
Vicente, P & Reis, E. (2008). Factors influencing households participation in recycling.
Journal of Waste Management and Research. 26: 140 http://wmr.sagepub.com/
-GP50-
University Students And Entrepreneurial Intention
334
Kamal Izzuwan Ramli1, Noor Suhaila Yusof 2 and Mohd Sharafie Zulkifli 3
1 School of Tourism, Hospitality and Event Management, UUM, izzuwan@uum.edu.my
2 School of Tourism, Hospitality and Event Management, UUM, nsuhaila@uum.edu.my
3 School of Tourism, Hospitality and Event Management, UUM, sharafie16@gmail.com
Abstract
Entrepreneurship has been seen as one of the major contributor a country‘s economy and
one way of solving unemployment issues. Numerous studies have found the link between
perception and intention towards entrepreneurship and the effect that is have on the
involvement of students in entrepreneurship activities. This study intended to explore university
students‘ attitudes and perception towards entrepreneurship as well as the factors that the
students viewed as barriers for them to become entrepreneurs. Results showed that these
students have positive attitudes towards entrepreneurship and they also are keen to start up
their own businesses. However, there are also several factors that hinder them from getting
involved in such activities.
KeyWords: Entrepreneur, Entrepreneurial Intention, University Students
1. INTRODUCTION
The issue of entrepreneurship and entrepreneurial intention has been extensively debated
in the past years. Universities have been carrying out efforts to equip their graduates with the
knowledge and skills necessary to start their own businesses. However, only a small number of
students are opting for self-employment after graduate or while studying in campus. Issues such
as lack of exposure (Piperopoulos, 2012) and lack of confidence (Boyd and Vozikis, 1994;
Shane, 2008) have been found to be some of the answers of why these students did not choose
to be entrepreneurs. As becoming entrepreneur can be one of the options, their intention on
becoming self-employed had prompted researcher to investigate particularly on the influence of
entrepreneurial characteristics and entrepreneurial intention among undergraduates towards
entrepreneurial activities.
Becoming entrepreneur requires courageous attitude as part of their personality. In
addition, lack of business skills is attributed to failure of business owned by young people
(Papulova & Mokros, 2007). Besides, past studies has considered the difficulties, obstructions,
troubles, deterrents confronted by entrepreneurs working together and has disregarded the
general population why should willing make new businesses. Attitude towards entrepreneurship
and self-efficacy have been found to be the significant factors influencing entrepreneurial
intention as well as identifying entrepreneur success (De Noble, Jung & Ehlrich, 1999).
Entrepreneur psychological has attempted to characterize important variables such as
personality, attitudes, demography, and behaviour as important measurement in the real
entrepreneur practices (McClelland, 1961).
In addition, personality traits have direct impact on many entrepreneurial activities
including the intention to launch a new business, success in business, and enhance
entrepreneurial set up (Shaver & Scott, 1991). Inclination towards entrepreneurship is
commonly associated with several personal characteristics (values and attitudes, personal
goals, creativity, risk taking propensity and locus of control) that might be expected to be
influenced by a formal program of education (Lee et al., 2012). There is also preliminary
evidence that entrepreneurial attributes can be positively influenced by educational programs
and that many entrepreneurship programs and courses are able to build awareness of
335
entrepreneurship as a career option and to encourage favourable attitudes towards

entrepreneurship (Gorman, Hanlon & King, 1997). In relation to this, Sama-Ae, (2009)
suggested that it is important to determine the entrepreneurial characteristics among students
and which characteristics might influence them to be entrepreneurs.
Previous studies showed that most of the respondents who selected also come from
diverse backgrounds such as businessman, managers and manufacturers, but only a few
studies that emphasize student at the tertiary level to start this business. There are some
obstacles that may affect the student to open a business even though they have had knowledge
of the business and all the theories taught while studying. Therefore, the researcher needs to
search out either these three factors: attitude toward the behaviour; personal traits; perceived
barriers that might encourage the students to start-up business.
Rao (2014) pointed out that many of the successful entrepreneurs of today started their
businesses on the university campus. However, to start a business while still in their studies
require great effort and will be more pressure on them, except to those who wish to do
business. It is an advantage for students who will make a full-time entrepreneur as a career
after graduating. However, it is not easy because they think where obstacles in doing business
that cannot be avoided. There are many obstacles faced by graduates to become
entrepreneurs and a thorough understanding needed to formulate effective policies to curb
graduate unemployment, (Sandhu , Sidique & Riaz 2011). This study was carried out to
investigate the factors that influence the students‘ intention to involve in entrepreneurship
activities when they were studying at the campus. This study will be doing in UUM. Since, this
study is only conduct in UUM then the finding cannot be the assumption for all student in
Malaysia.
2. LITERATURE REVIEW
2.1. Entrepreneurship and entrepreneurial intention
Many theories have explained why some people want to be an entrepreneur while others
do not. Entrepreneur can be made, even most of the people think an entrepreneurs are born.
Many studies done in the past have reached a consensus where entrepreneurs can be made
and are not genetically inherited (Barringer & Ireland, 2010). Everyone has the potential to
become entrepreneur especially for those who have undergone educational process in
universities (Ooi, Selvarajah, & Meyer, 2011). Entrepreneurship is the art of turning ideas into a
business (Barringer & Ireland, 2010) where they always search for change, respond to it, and
exploits it as an opportunity (Drucker, 1985). Entrepreneur is someone who exercises activity
by organizing a business to take advantage of an opportunity and, as the decision maker,
decides what, how, and how much of a good or service will be created. Entrepreneurship is the
process by which individual pursue opportunities regardless to the resources they currently
control (Barringer & Ireland, 2010). Entrepreneurship is also defined as the process of
conceptualising, organising, launching and through innovation, nurturing a business opportunity
into a potentially high growth venture in a complex and unstable environment (Rwigema &
Venter, 2004).
The main factor in differentiating the entrepreneurs from employed workers was the
uncertainty and risk taken by the former (Cantillion, 1975). Risk-taking propensity refers to
individual‘s orientation of making decision in uncertain contexts (Nishantha, 2009).
Entrepreneurs with high education possess higher risk propensity and tolerance for uncertainty
than non-entrepreneurs (Carland III, Carland Jr, Carland & Pearce, 1995). Entrepreneurs tend
to choose high-risk opportunities to exploit due to cognitive biases, whereby they cannot
336
recognize the risks engaged in a given entrepreneurial activity (Simon, Houghton & Gurney,
1999).
Many studies have been carried out to apply the Theory of Planned Behavior (TPB) with
entrepreneurial intention (Krueger and Carsrud, 1993; Elfving, Brännback, and Carsrud 2009;
Tsordia and Papadimitriou, 2015). The theory of planned behaviour is an extension of the theory
of reasoned action (Ajzen & Fishbein, 1980; Fishbein & Ajzen, 1975). The TPB (Ajzen, 1991,
2005) is a psychological model, which very influential on entrepreneurship research for many
years before. The theory of planned behaviour (Ajzen, 1985) was developed to account for the
process by which individuals decide on, and engage in, a particular course of action. Moreover,
it states that the entrepreneurial behaviour is determined by the entrepreneurial intentions,
which has been categorised into three antecedents. For the purpose of this study, threeof the
factors are examined to see the reasons of why the students to be or not to be an entrepreneur
which are attitude towards behaviour, personality traits and perceived barriers.
2.2. Entrepreneurial Intention
Intention is the immediate antecedent of behaviour (Azjen, 199). He stated that behaviour
is not performed mindlessly but follows reasonably and consistently from the behaviour-relevant
information and behaviour reinforced by rewarding events and weakened by pushing events.
Entrepreneurial intention is defined as willingness of individuals to perform entrepreneurial
behaviour, to engage in entrepreneurial action, to be self-employed, or to establish new
business (Dell, 2008; Dohse & Walter, 2010). An individual may have the potential to be
entrepreneur but not make any transition into entrepreneurship unless they have such intentions
(Ismail et al., 2009).
There are many key factors that motivate people to entrepreneurial intention. One of it is
motivation towards entrepreneurship. According to Kirkwood (2009), individuals have various
motivations for becoming an entrepreneur and that there are four drivers of entrepreneurism, (1)
desire for independence; (2) monetary motivation; (3) motivation related to work such as
unemployment, redundancy, a lack of job or career prospect; and (4) family related motivations.
Motivation of entrepreneurs came into four distinct categories which is extrinsic rewards,
independence/autonomy, intrinsic rewards and family security (Robichaud, McGraw, & Roger,
2001). Carter et al. (2003) discovered that the most popular motivating factor is desire for an
individual to achieve financial security. Chu, Benzing, and McGee, (2007) stated that increasing
their income and creating job for themselves are the leading factors motivating people to
become business owners.
2.3. Attitude Towards Behaviour
Attitudes are based on the total set of the person‘s salient beliefs and the evaluations
associated with those beliefs (Hewstone, 2011). Trevelyan (2009) indicated that behaviour of a
person solely depends upon individual‘s beliefs and attitudes, and those beliefs and attitudes
play a very important role in determining individual‘s action. Individual‘s perceptions on ability to
perform specific tasks increase the likelihood of attitude converting into intention and
subsequent behaviour. Attitude toward the behaviour as the extent to which a person has a
positive or negative valuation towards the behaviour (Ajzen, 1991). It is also defined as the
individual‘s attractiveness towards being self-employed (Li, 2007).
Dell (2008) mentioned that the desire to become an entrepreneur is the measure of
individual‘s attitude toward entrepreneurship. He recommended that through information signal
from previous experience and role model, attitude can be developed and strengthened. By
external information signal (availability of resources) and internal (individual‘s perception on
their capability and task specific knowledge), it will enhance entrepreneurial self-efficacy and in
337
turns, strengthen their attitude toward entrepreneurship. Authors such as Kolvereid and
Tkachev (1999) and Dohse and Walter (2010) found that the attitude toward the behaviour has
direct and positive effect on entrepreneurial intentions. Therefore, education and training should
focus on changing personal attitudes than providing technical knowledge about business
because the effects could be more significant to the process of business creation and to
overcome the perceived barriers to entrepreneurship.
2.4. Personal Traits
According to Cunningham & Lischeron (1991) personal traits consist of personal value
such as honesty, duty, responsibility and ethical behaviours, risk-taking, and need for
achievement. According to Sagie and Elizur (1999), McClelland's need for achievement theory
highlighted that need for achievement is one of the strongest psychological factors influencing
entrepreneurial behaviour. Someone who have a high desire to be successful are more likely to
be an entrepreneur. Individuals with high need for achievement will contribute more in
entrepreneurial activity (Tong, Tong & Loy, 2011). They are able to perform better in challenging
tasks and discover innovative ways to enhance their performance (Littunen, 2000).
2.4 Perceived Barriers
Entrepreneurial barriers relate to ―precipitating events‖, moderating the link between

entrepreneurial intentions and actual efforts to start an enterprise (Krueger, 2008; Shapero and
Sokol, 1982). The concept of ―precipitating event‖ refers to the appearance of a perceived
facilitating factor, or removal of a perceived inhibiting factor (Shapero and Sokol, 1982). There
are five major groups of barriers based on a pre-defined list: lack of capital, lack of skills, high
risk, lack of confidence and compliant costs (Choo and Wong, 2006) Moreover, lack of financial
resources were a major inhibiting factor to business start-up (Robertson et al, 2003). Based on
a sample of 2093 students from five different countries (USA, China, India, Belgium and Spain),
there are five major categories of barriers (1) lack of support structure and high fiscal and
administrative costs, (2) lack of knowledge and experience, (3) economic climate and lack of
entrepreneurial competencies, (4) lack of self confidence, and (5) risk aversion (Giacomin et al,
2011).
3. RESEARCH METHOD
This study was carried out by distributing questionnaire to undergraduate students in

Universiti Utara Malaysia. The questionnaire consists of five sections, which are demographic,
attitudes towards entrepreneurial behaviour, personal traits, entrepreneurial intention and
perceived barriers to entrepreneurship. Other than the demographics information, the questions
were measured using a five-point likert scale; 1-Strongly disagree, 2- Disagree, 3-Neither, 4-
Agree, and 5-Strongly agree. In term of respondents, out of 150, 54 respondents (36%) are
male and 96 respondents (64%) are female and all of the students are in the range of 22 to 25
years old. In term of their studies, 59 respondents (39.3%) are from College of Business (COB),
36 respondents (24%) from College of Art and Science (CAS), and 55 respondents (36.7%)
from College of Law, Government, and International Studies (COLGIS).
4. FINDINGS
4.1 Attitude towards entrepreneurial behaviour
338
Respondents were asked to answer a 5-point likert scale questionnaire. Table 1 shows
the result about respondents‘ attitudes towards entrepreneurial behaviour. Results showed that
Statement 3, ―If I had the opportunity and resources, I like to start a firm‖ has the highest mean,
which is 3.90. 57.3% of the respondents agreed with the statement while 20% of them strongly
agreed with the statement. This is followed by "A career as entrepreneur is attractive for me‖
which has the second highest mean, 3.83. 52% of respondents agreed with this statement and
18% of the respondents strongly agreed. On the other hand, Statement 5 ―I believe that if I were
to start my business, I will certainly be successful‖ has the lowest mean 3.71. 52.7% of the
respondents agreed with this statement while 12.7% of them strongly agreed on that. Overall,
this shows that the students have high intention of involving themselves in entrepreneurial
activities if they were given the chance to start up their own business even not all of them think
that being successful is business is the major motivational factor that encouraged them to
involve in entrepreneurial activities.
Table 1 Attitudes towards entrepreneurial behaviour

Mea
Statement 1 2 3 4 5 Rank
n
27.3 51.3 16.7
1 I rather be a boss than have a secure job 0% 4.7 3.80 4
% % %
A career as entrepreneur is attractive for 24.7 52.0 18.0
2 0% 5.3% 3.83 2
me % % %
If I had the opportunity and resources, I 15.3 57.3 20.0
3 0% 7.3% 3.90 1
like to start a firm % % %
Being an entrepreneur would entail great 20.7 59.3 14.0
4 0% 6.0% 3.81 3
satisfactions for me % % %
I believe that if I were to start my 28.7 52.7 12.7
5 0.7% 5.3% 3.71 5
business, I will certainly be successful 5% % %
4.2 Personal traits and entrepreneurial intention

This section reports the results about the personal qualities of the students and whether it
influenced the entrepreneurial intention in them (Table 2). On the positive side, 42.7% of the
respondents agreed with the statement ―I like to start up a business because I like to try new
things‖ while 38.7% of them strongly agreed with this statement. This is followed by Statement 2
―Business is good for me because I like to do my best in whatever work I undertake‖ which has
the second highest mean of 3.91. There are 66.0% of respondents agreed with this statement
and 14.7% of the respondents strongly agreed. On the other hand, the statement ―I have mental
maturity to be an entrepreneur‖ is the least agreed upon by the students where the mean score
is only 3.50, which is the lowest as compared to the other five statements.
Table 2 Personal traits

Mea
Statement 1 2 3 4 5 Rank
n
1 I like to start up a business because I like 17.3 42.7 38.7
0% 1.3% 4.19 1
to try new things % % %
2 Business is good for me because I like to 15.3 66.0 14.7
0% 4.0% 3.91 2
do my best in whatever work I undertake. % % %
3 I will start my own business if I discover 20.0 61.3 15.3
0.7% 2.7% 3.88 3
an opportunity. % % %
4 I am confident of my skills and abilities to 38.0 44.7 10.7
0% 6.7% 3.59 4
start a business. % % %
339
5 I have leadership skills that are needed to 35.3 50.7

0% 6.7% 7.3% 3.59 4
be an entrepreneur. % %
6 I have mental maturity to be an 40.7 42.7
0% 8.7% 8.0% 3.50 6
entrepreneur. % %
4.3 Entrepreneurial Intention

This part of the study was intended to explore the student‘s intention of being an
entrepreneur. From the results (Table 3), it shows that the students agreed that they prefer to
become an entrepreneur rather than working for someone else. The results showed that this
statement scored the highest rank. This is followed by the mean score for the statement ―I will
make every effort to manage my own firm‖ where 51.3% of respondents agreed with this
statement and 16.0% of the respondents strongly agreed. Results from this part proved that the
students have the intention of becoming an entrepreneur. However, the next section will show
the result of why or what are the factors that may hinder them to become an entrepreneur.
Table 3 Entrepreneurial intention

Statement 1 2 3 4 5 Mean Rank
1 I prefer to be an entrepreneur rather than 30.0 42.0 22.7
1.3% 4.0% 3.81 1
to be an employee in a company. % % %
2 My professional goal is to become an 12.0 30.7 38.0 18.0
1.3% 3.59 5
entrepreneur. % % % %
3 I‘m determined to create a firm in the 11.3 24.0 54.7
0.7% 9.3% 3.61 4
future. % % %
4 I will make every effort to manage my own 23.3 51.3 16.0
0% 9.3% 3.74 2
firm. % % %
5 I have a very serious thought in starting 11.3 25.3 50.0 13.3
0% 3.65 3
my own firm. % % % %
4.4 Perceived barriers to entrepreneurship

Table 4 shows the statements that represents the perceived barriers that may hinder the
students from getting involved in entrepreneurial activities. Results showed that, the number
one perceived barrier of becoming an entrepreneur is that the students do not have any idea of
what kind of business that they can start. This can be seen where this is the highest mean score
with 42% of them agreed with this statement while 11.3% stated that they strongly agree with
the statement. The second highest mean score is that they thought that they may not have the
suitable characteristics of becoming an entrepreneur. This is followed by statements which are
―I am not social enough to be successful in any entrepreneurial activity‖ (3.33) and ―My
presentation and communication skills are not good enough for the activities‖ (3.29). These
statements are representing the social skills that the students may have and most of them
agreed that the lack of these social skills are among the barriers that made them reluctant to be
involved in business. On the other hand, the statement that the students perceived as the least
to discourage them from involving in entrepreneurial activities is the statement number 2 where
they did not think that busy schedule when in campus is an excuse of not involving in any
business activities. Furthermore, the best explanation of this may be because the students are
not planning to start any businesses until they have fully completed their studies at the
university.
Table 4 Perceived barriers to entrepreneurship

Statement 1 2 3 4 5 Mean Rank
340
1 I do not have the skills and knowledge to

39.3
participate in any entrepreneurial 1.3% 20.0 31.3% 8.0% 3.33 3
%
programs or activities.
2 I have a very busy schedule. I cannot
26.7 24.0
participate in entrepreneurial activities in 9.3% 38.0% 2.0% 2.83 8
% %
campus.
3 I cannot assemble a complete team for
22.0 37.3
entrepreneurial activities. All my friends 2.7% 30.0% 8.0% 3.26 5
% %
are not knowledgeable in business.
4 Entrepreneurial programs and activities
19.3 31.3
are very difficult for me. I do not think I 4.0% 36.7% 8.7% 3.21 6
% %
can make any success out of them.
5 It will take a long time and great effort
26.0 22.7
before I can accomplish any significant 1.3% 47.3% 2.7% 2.99 7
% %
result from entrepreneurial activities.
6 I do not have entrepreneurial ideas. 14.0 42.0 11.3
2.7% 30.0% 3.45 1
% % %
7 I am not social enough to be successful 20.0 40.7
1.3% 30.7% 7.3% 3.33 3
in any entrepreneurial activity. % %
8 My presentation and communication
18.7 43.3
skills are not good enough for the 2.0% 32.0% 4.0% 3.29 4
% %
entrepreneurial activities.
9 My character may not be suitable for the 14.7 40.7 10.0
3.3% 31.3% 3.39 2
entrepreneurial activities. % % %
5. DISCUSSION AND CONCLUSION
This study was conducted to explore UUM student‘s view about their possibility of
becoming an entrepreneur, in terms of the factors that encouraged them to be involved in
business and also the perceived barriers that demotivates them from engaging in such
activities. In term of attitudes towards entrepreneurial behaviour, it seemed that the students are
fairly confident and somewhat have a positive perception about becoming entrepreneur. This
can be seen where most of them agreed that they would like to open a new business if they
were given the opportunity to do so. Other than that, they also perceived that being an
entrepreneur as ―attractive‖ and would lead to great satisfaction. As suggested by Kirkwood
(2009), Robichaud et al, (2001), these are some of the factors that may nurture the students‘
intention to start up their businesses. This intention is very important because according to
Mohammad Ismail et al. (2009), without intention, there is less likely for a person to become an
entrepreneur. The second findings from this study showed that these students have the drive to
do whatever it takes to be successful in their life. According to Cunningham & Lischeron (1991)
factor suc as high need for achievement can be related to the strongest psychological factors
influencing entrepreneurial behaviour, as suggested by Sagie and Elizur (1999). And also,
according to Tong, Tong & Loy (2011), individuals with high need for achievement will contribute
more in entrepreneurial activities. In relation to the intention of becoming entrepreneurs, it was
found that the strongest motivation for these students to become and entrepreneur is to have
financial stability and not becoming someone else‘s employee. They also agreed they are willing
to do whatever it takes to becomes successful in their future business. This is very important to
drive them to become entrepreneur because according to Azjen (1991), an individual‘s
perceptions on ability to perform specific tasks increase the likelihood of attitude converting into
intention and subsequent behaviour. However, this study also found that there are also factors
that the students perceive as barriers that discouraged them from becoming an entrepreneur.
Even though these student have a positive perception about being an entrepreneur, most of
341
them agreed that they do not have any entrepreneurial ideas, while some of them thought that
they do not have suitable characteristics to become an entrepreneur. This confirms with the
study by Giacomin et al, (2011) where lack of self-confident was found to be one of the barriers
of becoming an entrepreneur.
The overall findings from this study highlights the facts the university students have
positive perception of entrepreneurship. Not only that they viewed entrepreneurship as one of
the career alternatives but they also show some inclination of becoming an entrepreneur after
graduating from the university. Therefore, it is important for the university to nurture these
talents through their educational programs and not discouraging them from becoming
entrepreneurs. As suggested by Piperopoulos (2012), because of inadequate exposures, some
of the university entrepreneurial programs were found to deteriorate students‘ interest in
entrepreneurship. Also, it is important to highlight here that, developing well-targeted skills,
capacities, knowledge and ideas related to entrepreneurship as suggested by Tsordia and
Papadimitriou (2015), it is very important in supporting these students‘ intention and interest to
become entrepreneurs when they leave the university.
REFERENCES
Ajzen, I. (1991). The theory of planned behavior. Organizational Behavior and Human Decision
Processes,
50, 179-211.
Ajzen I, and Fishbein, M. (2005) The Influence of Attitudes on Behavior. In: Albarracin D,
Johnson B, and Zanna, M. (eds.) The Handbook of Attitudes. Lawrence Erlbaum Associates,
Mahwah, pp. 173–221.
Barringer, B. R., & Ireland, R. D. (2010). Entrepreneurship: successfully launching new
ventures (3rd ed.). New Jersey: Pearson.
Boyd N, and Vozikis, G. (1994). The Influence of Self-Efficacy on the Development of
Entrepreneurial Intentions and Actions. Entrepreneurship Theory and Practice. 18: 63–77.
Carland III, J. W., Carland Jr, J. W., Carland, J. A. C., & Pearce, J. W. (1995). Risk Taking
Propensity Among Entrepreneurs, Small Business Owners and Managers. Journal of
Business and Entrepreneurship, 7(1), 15-23.
Chu, H. M., Benzing, C. and McGee, C. (2007). ―Ghanaian and Kenyan Entrepreneurs: A
Comparative Analysis of Their Motivations, Success Characteristics, and Problems‖. Journal
of Development Entrepreneurship. 12(3). Pp. 295-322.
De Noble, A., Jung, D., & Ehlrich, S. (1999). Entrepreneurial self-efficacy: The development of a
measure and its relationship to entrepreneurial action. Frontiers of Entrepreneurship
Research. Wellesley, MA: Babson College.
Dell, M. S. (2008). An investigation of undergraduate student self-employment intention and the
impact of entrepreneurship education and previous entrepreneurial experience. Doctor of
Philosophy, School of Business University Australia.
Dohse, D., & Walter, S. G. (2010). The role of entrepreneurship education and regional Context
in forming entrepreneurial intentions. Working Paper present at Document de treball de l‟IEB
2010/18.
Drucker, P. F. (1985). Innovation and Entrepreneurship. London: Pan Books Ltd.
Elfving, J. Brännback, M. and Carsrud, A. (2009). Toward A Contextual Model of
Entrepreneurial Intentions in Carsrud, A.L. and Brännback M. (eds.), Understanding the
Entrepreneurial Mind, 23 International Studies in Entrepreneurship. Finland: Springer
Fishbein, M., & Ajzen, I. (1975). Belief, Attitude, Intention, and Behavior: An Introduction to
Theory and Research. Reading, MA: Addison-Wesley.
342
Giacomin, O., F. Janssen, J.-L. Guyot, and O. Lohest (2011): Opportunity and/or Necessity
Entrepreneurship? The Impact of the Socio-economic Characteristics of Entrepreneurs.
MPRA (Munich Personal RePEc Archive) Working Paper 29506.
(PDF) Defining Opportunity Versus Necessity Entrepreneurship: Two Components of Business
Creation. Available from:
https://www.researchgate.net/publication/323928856_Defining_Opportunity_Versus_Necessi
ty_Entrepreneurship_Two_Components_of_Business_Creation [accessed Oct 09
2018].Gorman, G., Hanlon, D. & King, W. (1997). Some research perspectives on
entrepreneurship education, enterprise education and education for small business
management: A ten-year literature review. International Small Business Journal, 15(3), 56-
77.
Hewstone, M. (2011). Understanding Attitudes to the European Community: A Social-
Psychological in four member states. Cambridge University Press
Ismail, M., Khalid, S.A., Othman, M., Jusoff, H. K., Rahman, N. A., Kassim, K. M., & Zain, K. M.
(2009). Entrepreneurial intention among Malaysian Undergraduates. International of
Business and Management, 4(10). Pp. 54-60.
Krueger, N.F. and Carsrud, A.L. (1993) Entrepreneurial intentions: Applying theory of planned
behaviour. Entrepreneurship and Regional Development 5. Pp. 315–330.
Kirkwood, J. (2009). Motivational factors in a push-pull theory of entrepreneurship. Gender in
Management: An International Journal. 24(5). Pp. 346-364.
Kolvereid. L., & Tkachev. A. (1999). Self- employment intention among Russian students.
Entrepreneurship & Regional Development. 11(3). Pp. 269-280.
Lee W.N, Lim B.P, Lim L.Y, Ng H.S, & Wong J.L. (2012). Entrepreneurial intention: A study
among students of higher learning institution. Universiti Tunku Abdul Rahman.
Li, W. (2007). Ethnic Entrepreneurship: Studying Chinese and Indian Students in the United
States. Journal of Developmental Entrepreneurship. 12(4). Pp. 449-466.
Littunen, H. (2000). Entrepreneurship and the characteristics of the entrepreneurial personality.
International Journal of Entrepreneurial Behavior & Research. 6(6). Pp. 295-309.
McClelland, D. C. (1961). The achieving society. Princeton: Van Nostrand.
Nishantha, B. (2009). Influence of Personality Traits and Socio-demographic Background of
Undergraduate Students on Motivation for Entrepreneurial Career: The Case of Sri Lanka.
Euro Asia Management Studies Association (EAMSA) Conference held on 5th December
2008 at Doshisha Business School, Kyoto, Japan
Ooi, Y, K., Selvarajah, C., & Meyer, D. (2011). Inclination towards entrepreneurship among
university students: An empirical study of Malaysian university students. International Journal
of Business and Social Social Science. 2(4). Pp. 206-220.
Papulova, Z. and Mokros, M. (2007). Importance of managerial skills and knowledge in
management for small entrepreneurs. E-Leader
Piperopoulos, P. (2012). Could higher education programmes, culture and structure stile the
entrepreneurial intentions of students? Journal of Small Business and Enterprise
Development. 19(3). Pp. 461–483.
Rao, D. (2014). Should Universities Become Entrepreneurial Campuses? Retrieved from
http://www.forbes.com/sites/dileeprao/2013/11/18/should-universities-become-
entrepreneurial-campuses/#./?&_suid=1399281862602030538910424623633
Robichaud, Y., McGraw, E., & Roger, A. (2001). Toward the Development of a Measuring
Instrument for Entrepreneurial Motivation. Journal of Developmental Entrepreneurship. 6(1).
Pp. 189-202.
Robertson, M., Collins, A., Medeira, N. and Slater, J. (2003). Barriers to start-up and their effect
on aspirant entrepreneurs. Education and Training. 45(6). Pp. 308-310.
Rwigema, H., & Venter, R. (2004). Advanced entrepreneurship. Cape Town: Oxford University
Press Southern Africa.
343
Sagie, A., & Elizur, D. (1999). Achievement motive and entrepreneurial orientation: a structural
analysis. Journal of Organizational Behavior, 20(2). Pp. 375-387.
Sama-Ae, T. (2009). An Examination on The Entrepreneurial Intention Among Thai Students at
Universiti Utara Malaysia (UUM). University Utara Malaysia: Unpublished Thesis
Sandhu, S. M., Sidique, F. S., & Riaz, S. (2011). Entrepreneurship barriers and entrepreneurial
inclination among Malaysian postgraduate students. International Journal of Entrepreneurial
Behaviour & Research, 17(4). Pp. 428-449.
Shane, S. (2008). The Illusions of Entrepreneurship. Yale University Press, New Haven
Shapero, A., & Sokol, L. (1982). The Social Dimensions of Entrepreneurship, In C. Kent, D.
Sexton, and K. H. Vesper (eds.) The Encyclopedia of Entrepreneurship. Englewood Cliffs,
NJ: Prentice-Hall. 72-90.
Shaver, K. G., & Scott, L. R. (1991). Person, Process, Choice: The Psychology of New Venture
Creation. Entrepreneurship Theory & Practice, 16(2). Pp. 23-45.
Simon, M., Houghton, S. M., & Gurney, J. (1999). Succeeding at Internal Corporate Venturing:
Roles needed to balance autonomy and control. Journal of Applied Management Studies,
8(2). Pp. 145-159.
Tong, X. F., Tong, D. Y. K., & Loy, L. C. (2011). Factor Influencing Entrepreneurial Intentions
among University Students. International Journal of Social Sciences and Humanity Studies.
3(1). Pp. 487-496.
Trevelyan, R. (2009). Entrepreneurial attitudes and action in new venture development.
Entrepreneurship and Innovation, 10(1). Pp. 21-32.
Tsordia, C. and Papadimitriou, D. (2015). The Role of Theory of Planned Behavior on
Entrepreneurial Intention of Greek Business Students. International Journal of Synergy and
Research. 4(1). pp. 23–37.
-GP51-
Determinant an individual’s usage on different level of online income tax
services
Muslimin Wallang, Ph.D

School of Government, College of Law, Government and International Studies
University Utara Malaysia, muslimin@uum.edu.my
Abstract
Recently, many developing and developed countries have been considering investing
more of their gross domestic product (GDP) in the development of e-government. The
reasons for investing in e-government are quite diverse and shifting the public sector
operation from a system based on traditional methods could reduce the operation cost.
Although the use of e-government services by citizens (G2C) has been widely
examined, the differential usage of e-government services by an individual citizen has
not yet been examined. Therefore, this study will investigate the factors that may lead
an individual choice of online e-tax service usage.
Keywords: e-government, technology usage, e-services , UTAUT, adoption, online tax
1. Introduction
344
E-government has become a part of government‘s development programmes throughout

the world. With the availability of e-government, public services can be accessed 24 hours a
day, 7 days a week. The main challenge in the implementation of e-government in developing
countries is not merely the technology. The success of e-government is determined by whether
citizens use the services or not(Gautrin, 2004). Governments have put a lot of effort and money
into implementing e-government platforms. However, despite all the efforts, the e-government
services offered by government agencies often remain underutilised by most citizens (Maizatul
Haizan Mahbob, Mohammed ZinNordin, Ali Salman, Wan Idros Wan Sulaiman & Mohd. Yusof
Abdullah, 2011). This study will extend knowledge on e-government (refer to online income tax
service) use to better understand how people choose to use or not use of e-government
services according to the level of services.It is hoped that this study could help to identify the
main determinants that influence the patterns of individuals‘ usage of online income tax service
with the overall aim to optimise the successful implementation of e-government and to ensure
that resources and costs are not expended in vain.
2. Inland Revenue Board of Malaysia – e-Filing service
The e-filing system in Malaysia was launched in 2006, and is monitored by the IRBM.
Initially, the objectives of e-filing were to facilitate tax compliance and to allow individuals to
conduct transactions through the Internet. E-filing refers to the submitting of tax forms
electronically as an alternative to the manual-paper method. In the early stage of its
implementation, only 4,500 taxpayers used this system (Hamid, 2007). However, the number of
users increased rapidly. In 2012, 2.1 million taxpayers filed their income tax form through this
system (Inland Revenue Board of Malaysia, 2012). In order to encourage citizens to pay their
income tax through Internet banking, collaboration with local banks has also been taken by the
IRBM. This initiative allows citizens to pay their income tax through online banking.
3. Determinant of e-government usage
Many theories have been used to explain an individual‘s use of technology. For example,
the Theory of Reasoned Action (TRA)(Fishbein & Ajzen, 1975), the Theory of Planned
Behaviour (TPB)(Ajzen, 1991), TAM (F. Davis, 1989), Motivational Model (MM) (Davis, Bagozzi
& Warshaw, 1992), Difussion of Innovation (Rogers, 1995), the Model of PC Utilisation (MPCU)
(Thompson, Higgins, & Howell, 1991), and the Unified Theory of Acceptance and Use of
Technology (UTAUT)(Venkatesh, Morris, Davis, & Davis, 2003)have all attempted to identify
and explain the factors that affect an individual‘s use of technology.
Venkatesh et al. (2003) created the UTAUT model to present a more complete picture of
the acceptance towards technology compared to previous models. UTAUT emerged from eight
previous models, which have been discussed frequently in Information Systems Research
literature. Several authors have argued that the UTAUT model is suitable, valid, and reliable in
understanding technology adoption (Chang, Wang, & Yang, 2009; Dajani & Yaseen, 2016;
Hung, Chang, & Yu, 2006; Nurdin, Stockdale, & Scheepers, 2011). Although most of the
previous studies used and integrated the TAM, TRA, and TPB models to explain technology
acceptance among people, none of these models are better than the UTAUT model in terms of
explanatory power—to predict the acceptance of technology (Venkatesh et al, 2003). The
345
UTAUT model can be explained by four direct main variables. Performance Expectancy is
defines as the degree to which an individual believes that using the system will help him or her
to attain gains in job performance. This construct is similar to perceived usefulness in the TAM
model. Effort Expectancy is the degree of ease associated with the use of the system. Social
Influence is defiens as the degree to which an individual perceives that important others believe
he or she should use an information system. Meanwhile, Facilitating Conditionsis a degree to
which an individual believes that provider of the e-services is responsible to provide the
technical support for the use of the system.
3.1 Understanding of technology adoption
The most important element for successful e-government service implementation is the
willingness of the public to adopt the systems(Shareef, Archer, Sharan, & Kumar, 2010). Vast
reviews of literature have previously been carried out to explore the factors that influence an
individual‘s usage of online services (Al-shafi & Weerakkody, 2010; AlAwadhi & Morris, 2009;
Rana, Dwivedi, Williams, & Weerakkody, 2016). Perceived ease of use (PEOU) and perceived
usefulness (PU) are the most influential factors recognised by scholars to explain an individual‘s
use of technology(Al-shafi & Weerakkody, 2010; AlAwadhi & Morris, 2008; F. D. Davis, 1989;
Israel & Tiwari, 2011; Kumar, Mukerji, Butt, & Persaud, 2007; Warkentin, Gefen, Pavlou, &
Rose, 2002). An empirical review of the literature has found that an individual‘s decision to use
or not to use e-government services is influenced by several factors that were excluded in the
UTAUT model(AlAwadhi & Morris, 2008; Rana, Dwivedi, & Williams, 2013). Therefore, trust in
the internet and government, security concerns and quality of website design are among the
significant factors in e-government adoption, and this study recognises these factors as being
important that will influence an individual‘s usage on e-government services.
3.2 Trustworthinessand security concerns
Despite PU and PEOU, recent studies on citizen adoption of e-government services

asserted that trust, security and privacy were key issues that would significantly influence e-
government adoption(Gefen, Karahanna, & Straub, 2003; Kaur & Rashid, 2008; Kim, Ferrin, &
Rao, 2008; Tolbert & Mossberger, 2006). For example,Kim et al.(2008)proposed a theoretical
framework that describes the trust-based decision-making to the consumer when making a
purchase online. Empirical studies by Hung et al.(2006)and (Phang, Li, Sutanto, & Kankanhalli,
2005)in Taiwan and Singapore respectively, revealed security and privacy indirectly influenced
a person‘s trust in the internet in two developed countries.
Besides the issue of trust in the internet, trust in the government has also been identified
as an important factor in influencing e-government service adoption(Bélanger & Carter, 2008;
Welch, Hinnant, & Moon, 2005). An increasing lack of confidence in the government‘s capability
to implement e-government may cause lack of support from the community. For example, an
empirical study in Jordan showed that lack of collaboration among government agencies to draft
laws and regulations that related to ICT usage led to low numbers of people using the e-
government services(Alomari, Sandhu, & Woods, 2010).
The relationship between trust and perceived security has also been widely explained by
Pavlou(2003) and Al-Adawi, Yousafzai, & Pallister, (2005)whose studies concluded that where
there is trust, the security concerns decreases.Security concerns and misuse of personal
346
information are among the factors that can cause people to be reluctant to use e-government
(Carter & Belanger, 2005). Failure to obtain the citizen‘s privacy and security in government
portals, information and other aspects of e-government will result in the objective of providing a
fully electronic service delivery not being met (Belanger & Carter, 2008).
3.3 Quality of website
The G2C relationship requires the government to provide e-services that are replete with
a high quality of services so as to fulfil the citizens‘ demands. Some scholars believe that quality
of government websites has become one of the most important factors influencing the success
of e-government adoption (Carter and Belanger, 2003; 2005; Pavlou, 2003). A study by
Zeithaml, Berry, and Parasuraman, (1996)and Adams, Nelson, and Todd, (2012) found that the
quality of government websites is commensurate with user satisfaction with e-government
services. For instance, Barnes and Vidgen(2000)conducted a survey to examine the
relationship of quality of the website and resultant user satisfaction. The results showed that the
quality of the government website is significantly related to user satisfaction and will therefore
determine if users continuously use the website.
The interaction between humans and technology is different between traditional services
and e-services, where user interface and web designs are absent in traditional services. Kumar
et al., (2007)and Rotchanakitumnuai(2008) revealed that PEOU has a significant relationship
with user adoption if the website visited is easily accessible, user-friendly and safe. These
features encourage users to continue using the e-service and could potentially enhance
adoption of e-services among the users (Kumar et al., 2007).
4. Methodology
The study was conducted in Malaysia, and the IRBM was used to recruit participants. The
IRBM played the role as single gatekeeper due to its ownership of the e-filing database. As e-
filing had the highest number of users in Malaysia, it was reasoned that if the individual used the
e-filing system, they were likely to have used other e-government systems such as the e-
payment of property tax and traffic fines. Since such databases are strictly confidential and
highly protected, the involvement of an agency such as the IRBM was necessary in order to
access a relevant sample of e-government users while maintaining the users‘ confidentiality.
The target population of this study was Internet users who had used e-filing in the past two
years. This criterion was set because the main objective of this study is to understand the main
determinants influencing an individual‘s pattern of using e-government services. The sampling
method for this study was purposive sampling.
The respondents for the online survey in the present study were recruited in the State of
Selangor. This State was selected for several reasons. In 2011, the population of Selangor was
estimated to be 7.5 million, with 2.8 million registered workers(Department of Statistics, 2014).
The 2014 Household Use of the Internet Survey (Malaysian Communications and Multimedia
Commission, 2015)showed that Selangor, at 79.5%, had the highest percentage of broadband
subscriptions and the second highest Internet penetration rate in the country.A web-based
survey was utilised in the present study, as this method can be used to survey a large number
of people(Elling, Lentz, de Jong & van den Bergh, 2012; Umbach, 2005). A web-based survey
can also help to reduce the number of incomplete responses, provides the advantages of speed
and accuracy in data collection.
347
According to Pallant(2007), there are two kinds of regression analysis tests: (1) simple
regression, which includes one independent variable only; and (2) multiple regressions, which
includes more than one independent variable. As the main objective of this study is to determine
the relationship between independent and dependent constructs, the multiple linear regressions
was utilised to analyse each e-government service in order to predict the probability of
technology use. In this study, the regression test was done with the same set of
predictors.Therefore, from the results, the patterns of usage were identified according to the
level of services (transactional and informational).
5. The proposed conceptual framework
The research identified from the literature a range of factors that may explain an individual‘s use
or non-use of specific e-government services. Figure 1 displays the conceptual framework
which incorporates the factors that may be expected to be associated with an individual‘s usage
of e-government services. The factors were derived from the UTAUT model as well as trust in
the government and the trust in the Internet, security concerns, and quality of the website.
Besides the factors mentioned above, the model shows that an individual‘s usage of e-
government services was also related to the level of services.
Figure 1: The proposed conceptual framework
6. Conclusion
The main objective of this paper is to investigate the factors that will influence an
individual‘s usage on different e-government services. The study used the UTAUT model, and
integrated with several factors that retrieved from extant literature to design the conceptual
framework. In order to respond to the research questions, to investigate the pattern of usage on
different e-government services, the types of services and level of services also included. This
research contributes to theoretical knowledge in that finding from correlation analysis, it could
identify the main determinants that lead to the individual decisions making on e-government
usage. The adoption rate is very low in e-government usage and perhaps, having this
knowledge will bring out a new dimension to all tiers of governments to improve their services
and increase the adoption rate. Besides that, future study, particularly the interview approach
has to be undertaken to re-evaluate or test the proposed framework.
348
References
Adams, D. A., Nelson, R. R., & Todd, P. A. (2012). Perceived usefulness, ease of use, and
usage of information technology: A replication. MIS Quarterly, 16(2), 227–247.
Ajzen, I. (1991). The theory of planned behavior. Organizational Behavior and Human Decision
Process, 50, 179–211;
Al-Adawi, Z., Yousafzai, S., & Pallister, J. (2005). Conceptual model of citizen adoption of e-
government. In The Second International Conference on Innovations in Information
Technology (IIT‟05) (pp. 1–10).
Al-shafi, S., & Weerakkody, V. (2010). Factors affecting e-government adoption in the state of
Qatar. In European and Mediterranean Conference on Information Systems 2010 (Vol.
2010, pp. 1–23).
AlAwadhi, S., & Morris, A. (2008). The use of the UTAUT model in the adoption of e-
government services in Kuwait. In Proceedings of the 41st Annual Hawaii International
Conference on System Sciences (HICSS 2008) (pp. 219–219). Ieee.
https://doi.org/10.1109/HICSS.2008.452
AlAwadhi, S., & Morris, A. (2009). Factors Influencing the Adoption of E-government Services.
Journal of Software, 4(6), 584–590. https://doi.org/10.4304/jsw.4.6.584-590
Alomari, M. K., Sandhu, K., & Woods, P. (2010). Measuring social factors in e-government
adoption in the Hashemite Kingdom of Jordan. International Journal of Digital Society, 1(2),
123–134.
Barnes, S., & Vidgen, R. (2000). WebQual : An exploration of website quality. In European
Conference on Information Systems (ECIS) (p. 74).
Belanger, F., & Carter, L. (2008). Trust and risk in e-government adoption. Journal of Strategic
Information Systems, 17, 165–176. https://doi.org/10.1016/j.jsis.2007.12.002
Bélanger, F., & Carter, L. (2008). Trust and risk in e-government adoption. The Journal of
Strategic Information Systems, 17(2), 165–176. https://doi.org/10.1016/j.jsis.2007.12.002
Chang, H. H., Wang, Y.-H., & Yang, W.-Y. (2009). The impact of e-service quality, customer
satisfaction and loyalty on e-marketing: Moderating effect of perceived value. Total Quality
Management & Business Excellence, 20(4), 423–443.
https://doi.org/10.1080/14783360902781923
Dajani, D., & Yaseen, S. G. (2016). The applicability of technology acceptance models in the
Arab business setting. Journal of Business and Retail Management Research (JBRMR)
Www.Jbrmr.Com A Journal of the Academy of Business and Retail Management, 10(3),
46–57.
Davis, F. (1989). Perceived usefulness, perceived ease of use, and user acceptance of
information technology. MIS Quarterly, 13(3), 319–339.
Davis, F. D. (1989). Perceived usefulness, perceived ease of use and user acceptance of
information technology. MIS Quarterly, 13(3), 319–340.
Department of Statistics. (2014). Labour Force Survey Report 2013.
Elling, S., Lentz, L., de Jong, M., & van den Bergh, H. (2012). Measuring the quality of
governmental websites in a controlled versus an online setting with the ‗Website Evaluation
Questionnaire.‘ Government Information Quarterly, 29(3), 383–393.
https://doi.org/10.1016/j.giq.2011.11.004
Fishbein, M., & Ajzen, I. (1975). Belief, attitude, intention, and behavior: An introduction to
theory and research. Reading, MA: Addison-Wesley.
Gautrin, H. F. (2004). Connecting Quebec to its citizens. Report on E-Government for Verdun,
Parliamentary Assistant to the Premier.
Gefen, D., Karahanna, E., & Straub, D. W. (2003). Trust and TAM in online shopping: An
349
integrated model. MIS Quarterly, 27(1), 51–90.

Hamid, H. (2007). New IRB chief on mission to improve tax compliance.
Hung, S.-Y., Chang, C.-M., & Yu, T.-J. (2006). Determinants of user acceptance of the e-
Government services: The case of online tax filing and payment system. Government
Information Quarterly, 23(1), 97–122. https://doi.org/10.1016/j.giq.2005.11.005
Inland Revenue Board of Malaysia. (2012). Annual Report 2012.
Israel, D., & Tiwari, R. (2011). Empirical study of factors influencing acceptance of e-
government services in India. Proceedings of the 5th International Conference on Theory
and Practice of Electronic Governance - ICEGOV ‟11, 141.
https://doi.org/10.1145/2072069.2072093
Kaur, J., & Rashid, N. D. (2008). Malaysian electronic government adoption barriers. Public
Sector ICT Management Review, 2(1), 38–43.
Kim, D. J., Ferrin, D. L., & Rao, H. R. (2008). A trust-based consumer decision-making model in
electronic commerce: The role of trust, perceived risk, and their antecedents. Decision
Support Systems, 44(2), 544–564. https://doi.org/10.1016/j.dss.2007.07.001
Kumar, V., Mukerji, B., Butt, I., & Persaud, A. (2007). Factors for successful e-Government
adoption: A conceptual framework. The Electronic Journal of E-Government, 5(1), 63–76.
Mahbob, M. H., Nordin, M. Z., Salman, A., Sulaiman, W. I. W., & Abdullah, M. Y. (2011).
Government to citizen: Advocacy of government on-line systems and their acceptance
among citizens. The Innovation Journal: The Public Sector Innovation Journal, 16(3), 2–14.
Malaysian Communications and Multimedia Commission. (2015). Communications and
Multimedia: Pocket Book of Statistics.
Nurdin, N., Stockdale, R., & Scheepers, H. (2011). Understanding organizational barriers
influencing local electronic government adoption and implementation: The electronic
government implementation framework. Journal of Theoretical and Applied Electronic
Commerce Research, 6(3), 5–6. https://doi.org/10.4067/S0718-18762011000300003
Pallant, J. (2007). Survival Manual a Step By Step Guide to Data Analysis using SPSS for
Windows. New York: Open University Press.
Pavlou, P. (2003). Consumer acceptance of electronic commerce: Integrating trust and risk with
the technology acceptance model. International Journal of Electronic Commerce, 7(3), 69–
103.
Phang, C. W., Li, Y., Sutanto, J., & Kankanhalli, A. (2005). Senior citizens‘ adoption of e-
government: In quest of the antecedents of perceived usefulness. In System Sciences,
2005. HICSS‟05. Proceedings of the 38th Annual Hawaii International Conference on (p.
130a–130a). IEEE.
Rana, N. P., Dwivedi, Y. K., & Williams, M. D. (2013). Evaluating alternative theoretical models
for examining citizen centric adoption of e‐ government. Transforming Government:
People, Process and Policy, 7(1), 27–49. https://doi.org/10.1108/17506161311308151
Rana, N. P., Dwivedi, Y. K., Williams, M. D., & Weerakkody, V. (2016). Adoption of online public
grievance redressal system in India: Toward developing a unified view. Computers in
Human Behavior, 59, 265–282. https://doi.org/10.1016/j.chb.2016.02.019
Rogers, E. M. (1995). Diffusion of Innovations (4th ed.). New York: Free Press.
Rotchanakitumnuai, S. (2008). Measuring e-government service value with the E-GOVSQUAL-
RISK model. Business Process Management Journal, 14(5), 724–737.
https://doi.org/10.1108/14637150810903075
Shareef, M. A., Archer, N., Sharan, V., & Kumar, V. (2010). Critical factors for adoption of e-
government: Validity of adoption model in Indian context. In C. G. Reddick (Ed.),
Comparative E-Government, Integrated Series in Information Systems (Vol. 25, pp. 371–
388). New York, NY: Springer New York. https://doi.org/10.1007/978-1-4419-6536-3
Tolbert, C. J., & Mossberger, K. (2006). The effects of e-government on trust and confidence in
government. Public Administration Review, (May-June), 354–369.
350
Umbach, P. D. (2005). Web surveys: Best practices. New Directions for Institutional Research,
(121), 23–38.
Venkatesh, V., Morris, M. G., Davis, G. B., & Davis, F. D. (2003). User acceptance of
information technology: Toward a unified view. MIS Quarterly, 27(3), 425–478.
Warkentin, M., Gefen, D., Pavlou, P. A., & Rose, G. M. (2002). Encouraging citizen adoption of
e-government by building trust. Electronic Markets, 12(3), 157–162.
https://doi.org/10.1080/101967802320245929
Welch, E. W., Hinnant, C. C., & Moon, M. J. (2005). Linking citizen satisfaction with e-
government and trust in government. Journal of Public Administration Research and
Theory, 15(3), 371–391.
Zeithaml, V. A., Berry, L., & Parasuraman, A. (1996). The Behavioral Consequences of Service
Quality. Journal of Marketing, 60(2), 31–46.
-GP52-
ISU DAN CABARAN URUS TADBIR KEWANGAN SEKOLAH
Mohd Faiz Mohd Yaakob

Pusat Pengajian Pendidikan dan Bahasa Moden, Universiti Utara Malaysia
mohd.faiz@uum.edu.my
Abstrak
Kertas kerja ini membincangkan isu dan cabaran tadbir urus kewangan di
sekolah.Tadbir urus yang baik mampu mengurangkan ketirisan dan bertindak sebagai aspek
yang cekap dan berkesan.Hal ini kerana, sekolah merupakan bangunan yang disediakan oleh
kerajaan sebagai institusi awam yang dipertanggungjawabkan untuk melaksanakan program
pendidikan negara berlandaskan dasar dan falsafah yang diimpikan.Pembiayaan pendidikan di
Malaysia adalah tanggungjawab kerajaan pusat melalui Kementerian Pendidikan Malaysia
(KPM).Pada peringkat sekolah, kerajaan pusat menyalurkan peruntukan tahunan melalui
Jabatan Pendidikan Negeri ataupun melalui Ketua Bahagian Kementerian Pelajaran Malaysia.
Pengurusan kewangan organisasi sekolah adalah proses penggunaan wang secara optimum
supaya organisasi itu dapat mencapai objektif pendidikan yang ditetapkan. Bagi memastikan
objektif ini tercapai Pengetua dan Guru Besar sepatutnya mengurus kewangan sekolah
mengikut panduan yang dinyatakan dalam Buku Panduan Kewangan Sekolah, arahan
perbendaharaan, surat-surat pekeliling yang dikeluarkan oleh bahagian kewangan,
Kementerian Pendidikan Malaysia dan Jabatan Pendidikan Negeri.
Pendahuluan
Isu dan cabaran kewangan sekolah kini menjadi polimik dalam pentadbir pendidikan.
Kini, berita di akhbar melaporkan pelbagai kes salah laku dan penyelewengan yang melibatkan
institusi pendidikan terutama melibatkan kewangan seperti duit RMT dan duit Zakat.
Penyediaan pendidikan kepada masyarakat merupakan tanggungjawab utama kerajaan
persekutuan. Kerajaan memberifokus yang tinggi terhadap bidang pendidikan yang
merupakan pemacu pembentukan modal insanyang berinovatif dan berdaya saing menjelang
wawasan 2020.
Dalam konteks sekolah, Zaidatol Akmaliah (2001) menyatakan guru besar selaku
pentadbir sekolah bertanggungjawabdalam menentukan pengurusan kewangan sekolah
secara cekap dan berkesan.Manakala, menurut Suriyati Baharin & Suhaida Abdul Kadir
351
(2013) pengurusan kewangan di sekolah rendahkerajaan melibatkan aspek perancangan,

penggunaan sumber kewangan, penerimaan sumber kewangan, perbelanjaan, perolehan
dan pengurusan asset.Setiap tahun kerajaan Malaysia menyalurkan peruntukan yang
besar untuk menjalankan pelbagai aktiviti dan program sekolah.
Urus Tadbir Kewangan oleh Pengetua dan Guru Besar
Urus tadbir kewangan oleh pengetua dan guru besar (PGB) semakin hari semakin
menarik untuk dikaji. Kajian lepas yang dibuat oleh A. Hamid Hussian, (2012) yang dijalankan
keatas enam orang guru besar di daerah Kota Tinggi, Johor, mendapati masalah dan
kelemahan yang wujud dalam pengurusan kewangan sekolah disebabkan oleh faktor-faktor
berikut iaitu kawalan dalaman yang lemah, urusan diserahkan kepada pembantu tadbir
kepercayaan, guru besar tidak faham prosedur kewangan, kurang latihan dan kepakaran dan
tidak cukup masa dalam pengurusan kewangan
Pengurusan kewangan yang cekap di peringkat sekolah sangat penting kerana pihak
sekolah menerima pelbagai jenis peruntukan dan bantuan dari kerajaan antaranya ialah
bantuan geran per kapita (PCG) Dalam mengurus wang ini, guru besar sebagai penyelia
sekolah adalah individu yang diberi tanggung jawab untuk mengurus setiap ringgit yang
diberikan kepada sekolah melalui geran PCG. PGB perlu mahir dalam kedua-dua bidang
pengurusan pentadbiran dan pengurusan kewangan sekolah.Pengurusan kewangan yang
dijalankan oleh PGB harus mengikut perancangan dan mematuhi peraturan yang telah
ditetapkan olehKementerian Pendidikan Malaysia (KPM). PGB perlu mengurus kewangan
sekolah mengikut panduan yang dinyatakan dalam Buku Panduan Kewangan Sekolah,
arahan perbendaharaan, surat-surat pekeliling yang dikeluarkan oleh Bahagian Kewangan,
Kementerian Pendidikan Malaysia dan Jabatan Pelajaran Negeri bagi memastikan objektif
KPM tercapai (Husaina Banu,Ranjeetham & Muhammad Faizal, 2015).
Norfariza, Muhammad Faizal, Saedah Siraj dan Mojgan Afshari (2012) telah
menjalankan kajian tentang membuat keputusan bertujuan mensentralisasikewangan di
sekolah-sekolah Malaysia yang menjurus kepada strategi perlaksanaan berkesan. Kajian
tersebut menemui strategi penting yang diperlukan oleh pihak yang bertanggungjawab dalam
memastikan perlaksanaan pengurusan kewangan berasaskan sekolah di Malaysia iaitu guru
besar mahupun pengetua sekolah.
Kajian tersebut yang menggunakan kaedah kualitatif secara temu bual dengan sepuluh
orang pengetua terpilih menunjukkan terdapat beberapa strategi penting yang perlu diberi
keutamaan oleh semua sekolah agar berjaya menguruskan kewangan sekolah. Bagi
merealisasikannya, kerjasama, usaha dan perbincangan dari semua pihak dapat membawa
transformasi terhadap sekolah berasaskan pengurusan kewangan.Justeru itu, seorang guru
besar seharusnya mempunyai sikap akauntabiliti dan autoriti yang dimiliki dalam
menguruskan kewangan sekolah. Akauntabiliti kewangan sekolah bermaksud satu proses yang
melibatkan guru besar dan warga sekolah dalam merancang, mengagih, dan
menggunakan sumber manusia, wang tunai, harta awam dan perkhidmatan bagi mencapai
matlamat organisasi Manakala autoriti ialah kuasa mutlak yang dimiliki oleh ketua. Selain itu,
tahap kesedaran etika yang rendah tentang tanggungjawab yang diberikan oleh pihak
atasan kepada pihak yang bertanggungjawab merupakan faktor utama berlakunya masalah
mengagihkan kewangan. Hal ini berlaku kerana kebanyakan pihak pengurusan tidak
mengetahui ilmu menguruskan kewangan yang betul (Syed Ismail & Ahmad Subki 2010).
352
Agihan peruntukan kewangan sekolahsangat bergantung kepada caraPGB membuat

keputusan sendiri. Ini menyebabkan kepincangan berlaku dalam pengurusan kewangan
sekolah.Tahap kesedaran etika yang rendah tentang tanggungjawab mengagihkan
peruntukan kewangan. Isu ini disokong oleh Mohamed Mahmood (2007), pengurusan
kewangan yang kurang mahir adalah salah satu masalah utama dalam pengurusan kewangan
sekolah di Malaysia.
Dasar Kerajaan
Dasar kerajaan sentiasa positif dalam mengagih dana kepada sektor pendidikan. Setiap
tahun kerajaan Malaysia menyalurkan peruntukan yang besar untuk menjalankan pelbagai
aktiviti dan program sekolah. Hal ini kerana tanpa peruntukan kewangan, sukar untuk setiap
sekolah menjalankan aktiviti-aktiviti dalam bidang pendidikan. Walau bagaimanapun,
kerajaan memberikan bantuan kewangan sekolah mengikut bilangan murid, bukannya
berdasarkan keperluan sekolah. Mengikut Surat Pekeliling Bilangan 8 tahun 2012
peruntukan bantuan persekolahan adalah berdasarkan enrolmen murid (Bahagian Kewangan,
2012).
Perancangan Pembangunan Pendidikan Malaysia (PPPM) telah dilaksanakan pada

tahun 2013 untuk mencapai perubahan dalam rangka kerja arahan Malaysia. Melihat kepada
laporan PPPM pada 2013-2025, untuk menghasilkan perubahan yang seiring dengan
zaman pemodenan pada tahun semasa, laporan tersebut telah menggariskan 9 bidang
keutamaan serta 11 anjakan yang perlu di ikuti.
Di antara anjakan yang diketengahkan di dalam laporan tersebut ialah mengenai

pengurusan kewangan yang cekap bagi memaksimumkan pulangan bagi setiap ringgit yang
telah dibelanjakan. Untuk memastikan anjakan ini tercapai dan berjaya, pihak sekolah
memainkan peranan yang sangat penting sebagai sebuah organisasi yang menghubungkan
guru-guru dengan murid-murid.
Oleh yang demikian, pihak sekolah mempunyai tanggungjawab yang besar bagi
memastikan setiap sumber pendapatan dan kewangan sekolah diuruskan dengan baik oleh
teraju kepimpinan utama sekolah iaitu guru besar. Selain itu, pihak sekolahjuga hendaklah
memastikan setiap peraturan urusan kewangan dipatuhi dan di ikuti oleh semua kakitangan-
kakitangan agar mencapai penggunaan yang cekap dan unggul.
Pendidikan memainkan peranan utama bagi pertumbuhan ekonomi dan

pembangunan sesebuah Negara. Kerajaan Malaysia telah mengekalkan tahap
pelaburan yang tinggidalam pendidikan sejak Negara mancapai kemerdekaan (Husaina
Banu Kenayathulla, 2014). Berdasarkan Pelan Pembangunan Pendidikan Malaysia (2013-
2025), sistem pendidikan Negara menyaksikan kemajuan besar sejak 1957. Ketika
Negara mencapai kemerdekaan, lebih separuh daripada populasi tidak mendapat
pendidikan formal, hanya 6% kanak-kanak menerima pendidikan peringkat menengah dan 1%
sahaja mendapat pendidikan tertiari. Pada tahun 2011, enrolmen di peringkat pendidikan
rendah telah hampir sejagat, iaitu 94% dan peratusan murid yang tercicir daripada pendidikan
rendah menurun secara signifikan (daripada 3% pada 1989 kepada 2% pada 2011).
Kadar enrolmen di peringkat menengah rendah (Tingkatan 1 hingga 3) meningkat

kepada 87%. Peningkatan terbesar berlaku di peringkat menengah atas (Tingkatan 4 hingga
5), dengan enrolmen meningkat hampir dua kali ganda daripada 45% pada 1980-an kepada
78% pada 2011.ada Oktober 2011, KPM telah melancarkan kajian semula sistem
pendidikan Negara secara menyeluruh dalam usaha membangunkan Pelan Pembangunan
353
Pendidikan Malaysia yang baharu (Pelan Pembangunan Pendidikan Malaysia,

2013-2025). Keputusan melaksanakan kajian semula sistem pendidikan dibuat dalam
konteks standard pendidikan antarabangsa yang kian meningkat, peningkatan aspirasi
Negara dalam mempersiapkan generasi muda untuk menghadapi keperluan abad ke 21,
dan peningkatan harapan ibu bapa serta masyarakat terhadap dasar pendidikan
Negara. Pelan ini melakarkan visi sistem pendidikan dan aspirasi murid yang dapat
memenuhi keperluan Negara pada masa depan.
Pelan ini juga mencadangkan 11 anjakan strategi dan operasi yang perlu
dilaksanakan oleh Kementerian bagi mencapai visi yang dihasratkan.Berdasarkan Pelan
Pembangunan Pendidikan Malaysia (2013-2025), anjakan pertama menekankan
kesamarataan akses kepada pendidikan berkualiti bertaraf antarabangsa. Dengan tahap
pembelajaran yang terbaik berdasarkan standard sistem pendidikan berprestasi tinggi,
murid-murid Malaysia mampu bersaing di peringkat global. Selain itu, akses kepada
bantuan yang bersesuaian dengan keperluan menjamin kejayaan mereka di sekolah.Manakala
anjakan 10 pula menyatakan memaksimumkan keberhasilan murid bagi setiap ringgit.
Berdasarkan anjakan tersebut bajet pendidikan Malaysia dilihat sebagai sebahagian
daripada KDNK juga merupakan satu daripada bajet tertinggi di dunia. Namun,
perpindahan sejumlah besardana kepada sistem pendidikan tidak mungkin akan
berlaku.Sebaliknya Kementerian perlu meningkatkan kecekapan dan keberkesanan dalam
perbalanjaan dan peruntukan dananya (Pelan Pembangunan Pendidikan Malaysia, 2013-
2025).
Menurut Shahril Marzuki (2005), bantuan persekolahan kerajaan adalah

berdasarkan bilangan murid sesebuah sekolah. Sekolah yang mempuyai kurang murid
mengahadapi masalah dalam jumlah peruntukan yang diterima kerana peruntukan diberi
berdasarkan bilangan murid .Pada masa yang sama, kadar pemberian perkapita bukan
matapelajaran berdasarkan bilangan murid juga mempengaruhi kekurangan peruntukan di
sekolah bantuan kerajaan.
Peruntukan kewangan yang disalurkan adalah berdasarkan bilangan murid di

sekolah. Ini menyebabkan sekolah-sekolah yang kurang murid tidak menerima peruntukan
yang mencukupi untuk perkhidmatan seperti pusat sumber sekolah dan perkhidmatan
kaunseling.
Urus Tadbir Kewangan Pendidikan Di Luar Negara
Sebahagian besar pembiayaan Kerajaan Australia untuk sekolah-sekolah kini

disediakan di bawah sekolah-sekolah Kebangsaan dengan tujuan pembayaran tertentu
(Sekolah Kebangsaan SPP), yang mempunyai dua komponen iaitu satu untuk sekolah-
sekolah kerajaan dan satu lagi untuk sekolah-sekolah bukan kerajaan. Terdapat juga
dana tambahan yang disediakan melalui Perkongsian Kebangsaan (NPS) dan program-
program pendidikan sekolah lain yang dibiayai melalui peruntukan tahunan (Harrington,
2011).
Dalam kebanyakan negara-negara membangun, fokus pembiayaan pendidikan

adalah masih untuk menangani isu ekuiti (Husaina Banu Kenayathulla & Mohammed Sani
Ibrahim, 2013). Sekolah-sekolah di negara membangun dibiayai sepenuhnya oleh
kerajaan. Kebanyakan Negara membangun memberi peruntukan berdasarkan enrolmen
murid di sekolah. Di samping itu, peruntukan diberi berdasarkan peraturan yang ditetapkan
oleh kerajaan Negara tersebut. Masih juga terdapat ketidakcukupan dan ketidaksamaan
dalam peruntukan diberi kepada sekolah. Dari segi sejarah, hubungan antara kekayaan
354
harta bagi setiap murid dan pendapatan daerah menyebabkan ketidaksamaan dalam sistem
kewangan sekolah (Barton, 2013).
Di sesetengah daerah, keupayaan menjana pendapatan menyebabkan sesetengah

daerah lebih berupaya untuk menyalurkan pembiayaan pendidikan berbanding
dengandaerah yang lain.Terdapat juga negara yang memberi penumpuan terhadap murid
yang kurang bernasib. Sekolah daerah yang bersepadu di mana semua murid yang
kurang bernasib baik dari segi ekonomi menerima kira-kira 36 peratus lebih banyak
pendapatan bagi setiap murid daripada murid yang dari segi ekonomi yang tinggi (Rose
&Weston, 2013).
Justeru, peralihan yang berlaku di dalam kewangan sekolah daripada ekuiti kepada
kecukupan, memastikan semua pelajar menerima tahap pendidikan yang mencukupi
(William H.Clune, 1994). Di Indonesia walaupun, kerajaan negeri dan daerah telah
menyediakan dana operasi sekolah namun masih banyak cabaran yang dihadapi dalam
pelaksanaannya di peringkat sekolah seperti pembiayaan yang terhad, kemudahan
yang kurang lengkap, dan kekurangan buku (Ahmad, Andriani, Lokman Mohd. Tahir, &
Bambang Sumintono, 2013).
Kesimpulan
Rumusan daripada kertas kerja ini berjaya membincangkan isu dan cabaran utama yang
dihadapi oleh institusi kewangan dalam sektor pendidikan.Isu utama yang dikemukakan ialah
tadbir urus daripada PGB, dasar kerajaan dan tadbir urus kewangan pendidikan di negara luar
sebagai perbandingan.Walau bagaimanapun, pengurusan kewangan di Malaysia perlu dibentuk
dengan acuan kita sendiri.Namun, persoalan pokok kepada tadbir urus kewangan terutama
intergriti dan akauntabiliti mesti menjadi tunjang kepada setiap urusan yang melibatkan
kewangan.Tadbir urus ini juga selari dengan kehendak Islam.Malaysia selaku negara yang
mengamalkan tadbir urus berlandaskan elemen-elemen ini juga perlu menyedari elemen ini
yang dikehendaki oleh agama dan keperluan dunia.
Rujukan
A. Hamid Hussian. ( 2012).Amalan pengurusan kewangan sekolah guru besar sekolah-

sekolah kebangsaan.Kertas Projek Sarjana Pendidikanyang tidak tidak diterbitkan.
Universiti Teknogi Malaysia.
Ahmad, Andriani, Lokman Mohd. Tahir, & Bambang Sumintono. (2013). Analisis cabaran
bantuan operasi sekolah di Indonesia: Kajian kes di SMP Kebangsaan Makassar
Provinsi Sulawesi Selatan, Indonesia. Kertas kerja dibentangkan dalam 2nd
International Seminar on Quality and Affordable Education, 324-336.
Bahagian Kewangan. (2012). Surat Pekeliling Kewangan Bilangan 8 Tahun 2012.
Kementerian Pendidikan Malaysia. Kuala Lumpur. Online diperolehi daripada
http://spkws.moe.gov.my/download/SPK%208%202012.pdf
Barton, D. S. (2013, May).Texan Tech University Libraries.An assessment of Texas school
finance reform: The health of school funding since 2006: http://repositories.tdl.org/ttu-
ir/handle/2346/50716
Harrington, M. (2011).Australian Government funding for schools explained.Australia:Parliament
of Australia.
355
Husaina Banu Kenayathulla.(2014).Future treands in the management of school

finance: A documentary analysis. Malayisan Online Journal Of Eduacation Management
(MOJEM), Vol 2, Issue 4, 89 –110.
Husaina Banu Kenayathulla, Ranjeetham Subramaniam & Muhammad Faizal A. Ghani.
(2015). Pengurusan kewangan di sekolah jenis kebangsaan tamil diKuala Kangsar,
Perak: Satu kajian kes. Jurnal Kepimpinan Pendidikan, 1(4), 23-30.
Mohamed Mahmood. (2007). Pentadbiran kewangan sekolah: Satu tinjauan amalan pengetuadi
sekolah menengah daerah Kuala Selangor. Kertas projek sarjana yang tidak
diterbitkan, Univeriti Malaya, Kuala Lumpur.
Norfariza et al. (2012). Financial decentralization in Malaysian schools: strategies for
effective implementation. The Malaysian Online Journal of Educational Science,1(3), 34-
40.
Pelan Pembangunan Pendidikan Malaysia.(2013-2025). Pendidikan Prasekolah hingga
lepas menengah.Kementerian Pendidikan Malaysia.Putrajaya Malaysia.
Rose, H.& Weston, M. (2013). California school district revenue and student
poverty.California: Public Policy Institute of California.
Suriyati Baharin&Suhaida Abdul Kadir.(2013).Kompentensi guru dalam pengurusan
kewangan sekolah. seminar pasca siswazah dalam pendidikan.Kementerian
Pendidikan Malaysia, 106-110.
Syed Ismail & Ahmad Subki Miskon. (2010). Guru dan cabaran semasa. Selangor
DarulEhsan: Penerbitan Multimedia Sdn. Bhd.
Zaidatol Akmaliah Lope Pihie. (2001). Pentadbiran pendidikan.Kuala Lumpur: Fajar Bakti
Sdn. Bhd. Online diperolehi daripada http://www.worldcat.org/title/pentadbiran-
pendidikan/oclc/420758824.
-GP53-
Platform Pembelajaran Sosial Edmodo: Kajian Domain Interaksi Dalam
Menyokong Pembelajaran Berpusatkan Pelajar
Farah Mohamad Zain

School of Education and Modern Languages, Universiti Utara Malaysia, mz.farah@uum.edu.my
Abstrak
Kajian ini mengkaji pola interaksi dalam pengajaran dan pembelajaran menerusi platform
pembelajaran sosial Edmodo (PPSE).Sejumlah 42 orang pelajar Tahun 1 dari Pusat Pengajian
Teknologi Industri, Universiti Sains Malaysia yang mengikuti kursus IMK 209-Sifat-sifat Fizikal
Makanan terlibat dalam kajian ini. Dapatan kajian menerusi pemantauan berterusan dan
analisis deskriptif menunjukkan bahawa majoriti interaksi yang berlaku dalam PPSE adalah
berpusatkan pelajar iaitu pelajar sendiri memainkan peranan penting dalam proses penjanaan
pengetahuan mereka melalui penyertaan yang meningkatkan proses reflektif dan kognitif
sekaligus menggalakkan pembelajaran aras tinggi. Dapatan ini membuktikan bahawa PPSE
diterima sebagai platform pembelajaran yang berupaya menggalakkan interaksi dalam
pengajaran dan pembelajaran.
Kata Kunci: Edmodo, Interaksi, Berpusatkan Pelajar
356
1. PENGENALAN
Rangkaian sosial dianggap sebagai aplikasi yang berupaya meluaskan interaksi dan
berkongsi ruang untuk berkolaborasi, hubungan sosial dan pertukaran maklumat dalam
persekitaran berasaskan web. Definisi ini memberi kefahaman tentang reka bentuk pengajaran
dan pembelajaran (P&P) yang menggunakan pelbagai alatan dan aktiviti yang tersedia dalam
rangkaian tersebut. Edmodo merupakan salah satu alat Web 2.0 dan juga aplikasi rangkaian
sosial berasaskan web yang sesuai untuk dijadikan platform pembelajaran. Pada Mac 2015,
Noodle telah mengiktiraf Edmodo sebagai salah satu ‗The 32 Most Innovative Online
Educational Tools‘.Selain itu, Edmodo juga tersenarai dalam ‗Top 100 Tools for Learning 2015‘
dan berada di tangga ke-39.
Platform pembelajaran sosial Edmodo (PPSE) memiliki ciri-ciri pendidikan yang sesuai
sebagai medium pengajaran untuk semua peringkat pendidikan dan latihan. Ia adalah percuma
untuk digunakan dan pensyarah mempunyai kawalan sepenuhnya untuk menghubungkan
pensyarah-pensyarah lain dan juga pelajar. Di samping itu, PPSE menyediakan persekitaran
yang selamat serta berfungsi sebagai sumber pembelajaran, alat penilaian dan komunikasi.
Salah satu ciri utama yang terdapat pada PPSE adalah ketersediaan papan forum (forum
board) untuk pelajar berkolaborasi bagi membantu menjelaskan isu-isuyang berkaitan dengan
bahan dan aktiviti pembelajaran. Alat ini membolehkan teks dihantar berulang-alik antara dua
orang atau lebih walaupun berada dilokasi yang berbeza.Pertukaran teks ini membolehkan ahli-
ahli dalam kumpulan untuk bekerjasama dalam satu komuniti pelajar, meneroka setiap
pengetahuan dan ideayang lain di samping memberikan sokongan sosial.Selain itu, papan
forum juga membolehkan ahli untuk melihat sumbangan ahli yang lain pada aktiviti yang
dijalankan dan memberi respon segera, sekaligus mewujudkan interaksi, menjana persekitaran
pembelajaran yang berkolaboratif dan interaktif (Healey danBryan-Kinns, 2000). Di samping itu,
pelajar juga boleh membaca berulangkali teks yang dihantar sehingga pengetahuan terbina
(Robinson, 2001) bertujuan mengulangkaji dan meningkatkan kefahaman.
Paradigma P&P mengalami perubahan daripada pembelajaran berpusatkan guru kepada
pembelajaran berpusatkan pelajar di mana interaksi pelajar-pelajar adalah penting dalam
komuniti atas talian yang menyokong kepuasan dan secara tidak langsung berupaya membina
kemahiran menyelesaikan masalah dan kebolehan berfikir secara kritikal. Menurut Romiszowski
dan Mason (1996), interaksi tidak wujud tetapi perlu direka supaya ia bergantung pada
frekuensi penyertaan, sumbangan oleh ahli-ahli dan sifat mesej yang dihantar. Oleh itu, dalam
memastikan keberkesanan interaksi, peranan pensyarah berubah kepada fasilitator, penasihat,
penilai, penyelidik, fasilitator konten, pakar teknologi, pereka bentuk dan pengurus pentadbiran.
Pelajar yang mengambil bahagian dan berinteraksi dengan rakan sebaya atau pensyarah
dalam perbincangan bukan hanya semata-mata untuk mendapatkan maklumat dan penjelasan
berkaitan kursus, tetapi juga bertujuan untuk pertukaran dan perkongsian pengetahuan. Definisi
interaksi menurut Thurmond dan Wambach (2004) ialah penglibatan pelajar dengan konten,
pelajar lain, pensyarah dan teknologi yang digunakan sebagai medium dalam kursus ini.
Interaksi sebenar dengan pelajar lain, pensyarah dan teknologi menghasilkan pertukaran timbal
balik maklumat. Pertukaran maklumat ini berupaya meningkatkan pembangunan pengetahuan
dalam persekitaran pembelajaran. Kesimpulannya, matlamat interaksi adalah untuk
meningkatkan pemahaman e-konten atau penguasaan matlamat yang telah ditetapkan. So dan
Brush (2008) pula mentakrifkan interaksi sebagai proses komunikasi timbal balik antara
manusia dengan manusia atau manusia dengan bukan manusia (manusia-komputer). Wegner,
Holloway dan Garton (1999) pula berpendapat bahawa interaksi adalah peristiwa dua hala yang
memerlukan sekurang-kurangnya dua objek dan dua tindakan. Interaksi berlaku apabila objek
dan peristiwa saling mempengaruhi antara satu sama lain. Menurut Su, Bonk, Magjuka, Liu,
357
dan Lee (2005), interaksi lebih berorientasikan proses serta memberi tumpuan kepada tindakan
dinamik.
2. SOROTAN KAJIAN
Bilangan kursus dalam talian terus berkembang dalam sektor pendidikan tinggi (Allen &
Seaman, 2006). Salah satu bidang yang telah dikenal pasti sebagai faktor penting yang
mempengaruhi pembelajaran pelajar dalam persekitaran atas talian ialah interaksi pelajar (Lyan
& Scot, 2011). Interaksi dalam pembelajaran merupakan suatu proses yang perlu dan asas
untuk pemerolehan pengetahuan dan pembangunan kognitif (Barker, 1994). Justeru itu, ia telah
lama menjadi fokus penyelidikan pereka pengajaran (Hannafin, 1989). Teknologi atas talian
seperti forum asinkronous menyediakan peluang kepada pelajar untuk melibatkan diri dalam
interaksi sosial dengan membaca dan memberi maklum balas kepada rakan-rakan dan
pensyarah (Gallini dan Barron, 2002). Bagaimanapun, menurut Tallent-Runnels et al., (2006)
kedalaman interaksi atau perbincangan secara atas talian tidak sama dengan sesi kelas secara
tradisional. Sifat dan kedalaman interaksi pelajar dalam persekitaran atas talian adalah berbeza
daripada secara bersemuka di bilik darjah (Kearsley, 2000). Ini kerana pelajar dalam bilik darjah
boleh berinteraksi secara bersemuka atau di luar kelas manakala pelajar yang mengikuti kursus
secara atas talian hanya boleh berinteraksi dengan rakan-rakan atau pensyarah melalui
teknologi komputer seperti e-mel, ruangan berbual atau forum perbincangan. Walaupun
teknologi asinkronous membenarkan pelajar untuk membandingkan kemajuan dengan orang
lain, meneroka topik, dan melakukan refleksi dengan lebih mendalam (Johnson dan Aragon,
2003), pelajar lain perlu berkongsi jawapan mereka sendiri untuk merealisasikan potensi
komunikasi secara atas talian (Lapadat, 2002). Oleh kerana pembelajaran atas talian
memerlukan pelajar saling bergantung (Palloff dan Pratt, 1999) dan pelajar perlu menguruskan
masa dan ruang sendiri (Bannan-Ritland, 2003), mengekalkan interaksi secara atas talian
adalah satu tugas yang mencabar.
Menurut Trentin (2000), keperluan memahami interaksi pelajar secara atas talian adalah
penting kerana interaksi mempengaruhi kualiti pembelajaran pelajar. Ini disokong oleh
Flottemesch (2000) bahawa pelajar cenderung untuk menilai kualiti pendidikan jarak jauh
berdasarkan interaksi mereka dalam kursus pendidikan jarak jauh. Di samping itu, interaksi di
kalangan pelajar dalam persekitaran atas talian memotivasikan mereka untuk memberikan
komitmen dalam pembelajaran (Gabriel, 2004; Rovai dan Barnum, 2003). Pelajar bermotivasi
untuk menjadi sebahagian daripada interaksi dan menyumbang kepada interaksi atas talian
(contohnya, perbincangan atas talian) kerana ia membantu mereka untuk berkolaborasi dengan
rakan-rakan mereka (Gabriel, 2004; Song dan Hill, 2009).
Wang, Sierra dan Folger (2003) mencadangkan bahawa interaksi pelajar dalam rangkaian
sosial menjadi lebih mudah kerana profil setiap pelajar bertindak sebagai ‗icebreaker‘ untuk
interaksi. Stacy (2002) mendapati bahawa pembentukan kumpulan-kumpulan belajar yang lebih
kecil dalam ruang tidak formal kondusif untuk kemajuan pelajar. Komunikasi yang berasaskan
komputer melalui peralatan yang memudahkan komunikasi dan kolaborasi boleh meningkatkan
interaksi sosial (Anastopolou, Sharple, Ainsworth, Crook, O'Malley, dan Wright, 2011; Arrigo,
Gentile, Taibi, Chiappone dan Tegolo, 2004; Capuano, Gaeta, Miranda dan Pappacena, 2004;
Guzdial dan Turns, 2000).
Robson (1996) mengklasifikasi interaksi kepada dialog pertukaran antara guru dan pelajar
yang menekankan keperluan untuk menangani isu-isu pedagogi dalam memaksimumkan
interaksi dalam persekitaran pembelajaran berasaskan web. Garrison dan Cleveland-Innes
(2005) mendapati bahawa reka bentuk kursus mampu memberi kesan yang besar ke atas sifat
interaksi sama ada pelajar mendekati pembelajaran secara mendalam dan bermakna atau
sebaliknya. Harasim (1997) mencadangkan bahawa penglibatan aktif pelajar, interaksi di
358
kalangan pelajar dalam kumpulan dan pertukaran intelektual yang berkualiti tinggi membantu
pelajar menyesuaikan diri dengan kursus dalam talian serta berperanan dalam menentukan
kejayaan dan keberkesanan pembelajaran atas talian.
Thurmond dan Wambach (2004) mendefinisikan interaksi sebagai penglibatan pelajar
dengan konten, pelajar lain, pensyarah dan medium teknologi dalam kursus tersebut. Interaksi
berkesan dengan pelajar, pensyarah dan teknologi berupaya memperoleh pertukaran
maklumat. Pertukaran maklumat ini bertujuan untuk meningkatkan pembinaan pengetahuan
dalam persekitaran pembelajaran. Akhirnya, matlamat interaksi adalah bertujuan untuk
meningkatkan pemahaman terhadap konten atau menguasai matlamat pembelajaran dan
mencapai objektif pembelajaran yang telah ditentukan.
PPSE berupaya menggalakkan interaksi antara pelajar dan pensyarah.Interaksi
membolehkan pelajar untuk menerima maklum balas, membuat pembetulan yang sesuai dan
menyemak semula konsep yang dibincangkan. Oleh itu, interaksi berupaya melibatkan pelajar,
menggalakkan mereka untuk memikirkan idea dan membuat jangkaan. Kajian interaksi antara
L-C/G, L-S, S-L, S-S dan S-C/G terutamanya dalam e-Pembelajaran telah menarik minat ramai
penyelidik (Samar, Zain, Kamar, dan Sahimi, 2009; Pham, Thalathoti dan Dakich, 2014; Teoh,
Ping, Cheng, dan Manoharan, 2010). Clements dan Nastasi (1988) menyatakan bahawa
interaksi memainkan peranan yang penting dalam menggalakkan operasi intelektual pelajar dan
proses berfikir. Oleh itu, lebih kerap dan mendalam interaksi antara mereka, maka lebih tinggi
pencapaian sesuatu hasil pembelajaran.
Perbincangan di papan forum serta aktiviti yang berlangsung dalam PPSE menyokong
pendekatan pembelajaran berasaskan teori konstruktivisme. Konstruktivisme merupakan teori
pembelajaran yang berasaskan kepada pembinaan pengetahuan oleh pelajar sendiri secara
aktif dan pensyarah pula menjadi pembimbing kepada proses tersebut. Melalui kaedah ini,
pelajar tidak hanya menyerap secara pasif sebarang maklumat dan pengetahuan yang
disampaikan oleh pensyarah tetapi menggabungkan maklumat baru dengan pengetahuan sedia
ada dalam proses membentuk pengetahuan baru melalui proses kolaborasi bersama-sama
rakan dan pensyarah. Dalam teori ini, penekanan tertumpu kepada peranan pelajar berbanding
peranan pensyarah sekaligus membentuk proses P&P yang berpusatkan pelajar.
Swan (2002) mengenal pasti bahawa interaksi pelajar-pensyarah dan interaksi pelajar-
pelajar secara positif mempengaruhi kejayaan pelajar. Ini kerana penjelasan dan perbincangan
di kalangan pelajar menyumbang kepada kejayaan pelajar serta membayangkan betapa
pentingnya kualiti interaksi pelajar-pelajar dalam perbincangan atas talian. Vrasidas & McIsaac
(1999) mendapati struktur kursus, saiz kelas, maklum balas dan pengalaman sebelumnya
mempengaruhi interaksi yang berlaku dalam kursus secara atas talian.
3. KERANGKA KONSEPTUAL
Wujud pelbagai teori interaksi untuk mengkaji keberkesanan interaksi dalam P&P. Bates (1995)
mengkategorikan interaksi kepada masa interaksi dan konteks interaksi: asinkronous vs
sinkronous dan interaksi peribadi vs interaksi sosial. Beliau juga menegaskan bahawa objektif
pendidikan dan keperluan yang berbeza memerlukan interaksi yang berlainan. Paulsen (1995)
pula membahagikan interaksi kepada empat jenis iaitu interaksi seorang diri, satu-sama-satu,
satu-sama-banyak dan interaksi banyak-sama-banyak. Moore (1989) menjelaskan perbezaan
interaksi iaitu pelajar-bahan pembelajaran, pelajar-guru dan pelajar-pelajar. Kesemua interaksi
ini boleh berlaku secara asinkronous atau sinkronous. Hillman, Willis dan Gunawardena (1994)
menambah interaksi pelajar-antara muka apabila mereka berinteraksi dengan medium.
3.1. Model Interaksi Oliver dan McLoughlin (1997)
359
Dalam kajian ini, model yang dicadangkan oleh Oliver dan McLoughlin (1997) iaitu model yang
turut juga digunakan dalam kajian Fong et al., (2005) dan Othman et al., (2005) digunakan
sebagai kerangka teori. Dalam pertukaran dialog, pada dasarnya wujud dua pihak yang terlibat
dalam interaksi iaitu pemula dan responden. Pemula dan responden ini mungkin adalah
pensyarah, pelajar atau kelas. Oleh itu, Oliver dan McLoughlin (1997) mencadangkan domain
interaksi diklasifikasikan kepada lima kategori seperti dalam Jadual 1.
Jadual 1 Kategori pertukaran dialog

Kategori Pertukaran Penerangan
Lecture – Class (L-C) Pensyarah sebagai pemula dan ditujukan kepada
seluruh kelas.
Lecturer – Student (L-S) Pensyarah sebagai pemula dan ditujukan kepada pelajar
tertentu sahaja.
Student – Lecturer (S-L) Pelajar sebagai pemula dan ditujukan kepada
pensyarah.
Student – Student (S-S) Pelajar sebagai pemula dan ditujukan kepada pelajar
lain.
Student – Class (S-C) Pelajar sebagai pemula dan ditujukan kepada seluruh
kelas.
Rajah 1: Kerangka Konseptual

Dalam kajian ini, penyelidik memantau interaksi yang berlaku dalam PPSE sepanjang P&P
berlangsung dan kategorikan setiap posting mengikut Model Interaksi Oliver dan McLoughlin
(1997) iaitu Lecturer-Student (L-S), Lecturer-Group/Class (L-G/C), Student-Lecturer (S-L),
Student-Student (S-S) dan Student-Group/Class (S-G/C) (Rajah 1). Seterusnya, penyelidik
mengkaji kategori pertukaran interaksi yang dominan semasa proses P&P berlangsung dalam
PPSE. Oleh itu, penyelidik mencadangkan persoalan kajian berikut:
Apakah corak interaksi pelajar berdasarkan domain interaksi dan kategori pertukaran dialog di
papan forum PPSE?
4. METODOLOGI
Penyelidik menggunakan kaedah pemantauan untuk menjawab persoalan kajian ini.

Untuk itu, penyelidik memantau setiap posting pelajar di papan forum PPSE dan kategorikan
interaksi kepada lima domain iaitu Lecturer-Student (L-S), Lecturer-Group/Class (L-G/C),
Student-Lecturer (S-L), Student-Student (S-S) dan Student-Group/Class (S-G/C).
360
Sampel yang dipilih adalah pelajar yang mengikuti kursus IMK 209 di Pusat Pengajian
Teknologi Industri, Universiti Sains Malaysia. Seramai 42 orang pelajar yang mendaftar kursus
ini dan semuanya terlibat sebagai sampel penyelidikan.
4.1. Domain Interaksi
Interaksi yang berlaku dalam PPSE dipantau sepanjang proses P&P berlangsung iaitu
selama 14 minggu. Pemantauan ini bertujuan untuk mengkaji domain interaksi yang berlaku
dalam PPSE dan domain interaksi yang dominan. Dalam kajian ini, penyelidik mengkategorikan
interaksi kepada lima domain iaitu Lecturer-Student (L-S), Lecturer-Group/Class (L-G/C),
Student-Lecturer (S-L), Student-Student (S-S) dan Student-Group/Class (S-G/C). Penyelidik
menghitung domain interaksi yang berlaku dalam PPSE secara manual mengikut Model Oliver
dan McLoughlin (1997). Rajah 2 dan Rajah 3 menunjukkan domain Lecturer-Student (L-S) dan
Lecturer-Group/Class (L-G/C).
Rajah 2: Domain Lecturer-Student (L-S)
Rajah 3: Domain Lecturer-Group/Class (L-G/C)

Rajah 4 hingga Rajah 6 menunjukkan interaksi yang berlaku antara pelajar iaitu Rajah 3
melihatkan domain Student-Lecturer (S-L) manakala Rajah 4 dan Rajah 5 menunjukkan domain
Student-Student (S-S) dan Student-Group/Class (S-G/C).
Rajah 4: Domain Student-Lecturer (S-L)
361
Rajah 5: Domain Student-Student (S-S)
Rajah 6: Domain Student-Group/Class (S-G/C)
5. KEPUTUSAN DAN PERBINCANGAN
5.1. Demografi Pelajar
Jadual 2 menunjukkan maklumat demografi pelajar. Keputusan mendapati sebahagian

besar pelajar berbangsa Melayu (71.4%) dan hanya 28.6% pelajar berbangsa Cina. Tiada
bangsa India atau lain-lain yang mendaftar dengan kursus ini. Majoriti pelajar yang mendaftar
kursus ini berjantina perempuan (81%) manakala 19% sahaja pelajar berjantina lelaki. Separuh
daripada pelajar (50%) gemar dengan gaya pembelajaran berpandukan visual manakala
separuh lagi (50%) dengan bentuk ‗hands-on‘. Ini bersesuaian dengan PPSE yang
menyediakan bahan pembelajaran berbentuk visual dan ‗hands-on‘. Keputusan juga
menunjukkan 64.3% pelajar memperoleh gred PNGK antara 2.00-3.00 manakala 35.7% pelajar
362
mendapat gred PNGK antara 3.00-4.00. Hanya 26.2% pelajar berpendapat bahawa kelajuan
Internet di Universiti Sains Malaysia (USM) sangat memuaskan manakala kebanyakan pelajar
berpendapat sebaliknya (40.5%). Rata-rata pelajar menganggap bahawa bahan pembelajaran
mudah diakses di PPSE manakala 9.5% pelajar pula beranggapan bahawa sukar untuk
mengakses bahan pembelajaran.
Jadual 2 Demografi pelajar

Bilangan (n=42) Peratus (%)
Bangsa
Melayu 30 71.4
Cina 12 28.6
Jantina
Lelaki 8 19.0
Perempuan 34 81.0
Gaya Pembelajaran
Visual 21 50.0
Hands-on 21 50.0
Nilai PNGK
2.00-2.50 13 31.0
2.50-3.00 14 33.3
3.00-3.50 12 28.6
3.50-4.00 3 7.1
Kelajuan Internet
Sangat Memuaskan 11 26.2
Memuaskan 14 33.3
Tidak Memuaskan 17 40.5
Kemudahan mengakses bahan pembelajaran

Sangat Mudah 28 66.7
Mudah 10 23.8
Tidak Mudah 4 9.5
5.2. Domain Interaksi
Oliver dan McLoughlin (1997) mengemukakan lima domain dalam interaksi iaitu Lecturer-
Group/Class (L-G/C), Lecturer-Student (L-S), Student-Lecturer (S-L), Student-Student (S-S) dan
Student-Group/Class (S-G/C).Jadual 3 mendapati interaksi S-G/C paling dominan berbanding
interaksi yang lain dengan merekodkan sumbangan sebanyak 40.3% diikuti oleh interaksi S-S
dengan 26.7% dan interaksi S-L dengan 20.9%. Interaksi L-G/C dan L-S masing-masing
mencatatkan 6.1% dan 5.9%. Penyelidik dapat membuat kesimpulan bahawa majoriti interaksi
yang berlaku dalam PPSE melibatkan interaksi pelajar sesama sendiri (87.9%) manakala
peranan pensyarah (12%) hanya untuk memudahcara kolaborasi (Rajah 7).
Jadual 3Domain interaksi

Domain Bilangan Peratus (%)
363
Interaksi
L – G/C 84 6.1
L–S 81 5.9
S–L 285 20.9
S–S 365 26.7
S – G/C 551 40.3
Jumlah 1366 100
Rajah 7: Domain Interaksi

Ini menunjukkan wujudnya pembelajaran berpusatkan pelajar di mana pelajar terlibat
dalam proses P&P manakala pensyarah kursus hanya bertindak sebagai fasilitator.
Pembelajaran yang berpusatkan pelajar ini menekankan potensi individu, sosial dan akademik,
menumpu pada kerjasama kumpulan serta perakuan kreatif. Pensyarah kursus
berkemungkinan menggunakan teknik-teknik seperti simulasi, inkuiri-penemuan, penyelesaian
masalah, pembelajaran koperatif yang dapat menarik perhatian pelajar untuk berinteraksi
sesama mereka seterusnya membina kemahiran berfikir aras tinggi.
Menurut Newby, Stepich, Lehman & Russell (2000), pembelajaran berpusatkan pelajar
mengubah peranan pensyarah daripada mengarahkan pelajar melakukan latihan langkah demi
langkah supaya semua mencapai keputusan yang sama kepada menggalakkan individu
menggunakan inovasi dan kreativiti sendiri untuk menyelesaikan masalah.
Menurut Stanberry (2000), peningkatan interaksi mampu meningkatkan pencapaian, sikap
dan motivasi (Hillman, Willis & Gunawardena, 1994). Ini kerana interaksi menyebabkan pelajar
perlu memikirkan idea-idea serta jangkaan mereka terhadap topik yang dibincangkan. Ini
disokong oleh Clements dan Nastasi (1988) yang berpendapat bahawa interaksi menggalakkan
proses berfikir di kalangan pelajar.
Teoh, Ping, Cheng, dan Manoharan (2010)dalam kajiannya yang membandingkan pelajar
ijazah dan pelajar lepasan ijazah juga mendapati bahawa pelajar ijazah menunjukkan interaksi
L-G/C mencatatkan peratusan tertinggi iaitu 49% manakala bagi pelajar lepasan ijazah
menunjukkan S-G/C mencatatkan peratusan tertinggi iaitu 50%. Namun begitu, interaksi L-S
mencatatkan peratusan yang terendah bagi kedua-dua kumpulan pelajar ini.
Wu Bing & Teoh (2008) dalam kajiannya yang membandingkan pelajar di Universiti TV
Shanghai dan Universiti Terbuka Wawasan mendapati di Universiti TV Shanghai, interaksi S-T
(45.1%) mendominasi interaksi lain diikuti interaksi S-G (28.1%), S-CC (20.7%), T-G (4.8%),
CC-G (1.1%) dan terakhir sekali interaksi T-S (0.2%). Berbeza dengan dapatan di Universiti
Terbuka Wawasan di mana interaksi T-G (54.6%) muncul sebagai interaksi yang dominan
diikuti S-G (22.1%), S-T (10.9%), CC-G (8.8%), S-CC (3.6%) dan akhir sekali interaksi T-S
(0.0%).
364
6. KESIMPULAN
Penyelidikan ini mengemukakan data yang menunjukkan domain interaksi pelajar yang
menyokong pembelajaran berpusatkan pelajar menerusi PPSE sebagai alat tambahan dalam
menyokong P&P secara bersemuka. PPSE berupaya menggalakkan pembelajaran secara
kolaboratif, konstruktivis dan generatif. Teori pembelajaran yang berpusatkan pelajar ini mampu
meningkatkan kefahaman pelajar, keyakinan diri pelajar, motivasi pelajar seterusnya penjanaan
pengetahuan pelajar.
Implikasi daripada penyelidikan ini dapat membantu pihak-pihak yang berkepentingan dalam e-
pembelajaran terutamanya pada bahagian pentadbiran, tenaga pensyarah, pereka bentuk
pengajaran, pakar e-Konten serta golongan teknologi maklumat untuk lebih memahami tentang
proses penerimaan kepentingan interaksi antara pelajar-pelajar dan pelajar-pensyarah. Selain
itu, kajian ini mampu meningkatkan keberkesanan proses pembelajaran, pendekatan kolaborasi
mampu membina kemahiran sosial, kemahiran berkomunikasi, leadership, kerja berpasukan
serta kemahiran menyelesaikan masalah.
RUJUKAN
Allen, I.E, & Seaman, J. (2006). Making the grade: online education in the United States,
Needham, MA: Sloan Consortium.
Anastopolou, S., Sharples, M., Ainsworth, S., Crook, C., O‘Malley, C., & Wright, M. (2011).
Creating personal meaning through technology-supported science inquiry learning across
formal and informal settings. International Journal of Science Education, 34(2), 251-273.
Arrigo, M., Gentile, M., Taibi, D., Chiappone, G., & Tegolo, D. (2004). mCLT: An application for
collaborative learning on a mobile telephone. Mobile learning anytime everywhere: A book
of papers fromMLEARN 2004.
Bannan-Ritland, B. (2003). The role of design research: the integrative learning design
framework. Educational Researcher, 32(1), 21-24.
Barker, P. (1994). Designing interactive learning. In T. de Jong & L. Sarti (Eds.). Design and
production of multimedia and simulation-based learning material (1-30). Dordrech: Kluwer
Academic Publishers.
Bates, A.W. (1995). Technology, open learning and distance education. New York: Routledge.
Capuano, N., M. Gaeta, M., S. Miranda, S., & L. Pappacena, L. (2004). A system for adaptive
platform-independent mobile learning. In Attewell, J., & Savill-Smith, C. (Eds.)., Mobile
learning anytime everywhere: A book of papers from MLEARN 2004 (pp. 15-19).
[Electronic version], London, UK: Learning and Skills Development Agency.
Clements, D. H. & Natasi, B. K. (1988). Social and cognitive interactions in educational
environments. American Educational Research Journal, 25(1), 87-106.
Flottenmesch, K. (2000). Building effective interaction in distance education: A review of the
literature. Educational Technology, 40(3), 46-51.
Foong, S. K., Rahman, Z.A., Atan, H., Mohamad, A.H., Hamdan, Z. & Idrus, R. M. (2005). The
distance education electronic portal: A study of the communicative dimensions in an
asynchronous Forum Board. Proceeding of the Ed-Media 2005-World Conference on
Educational Multimedia, Hypermedia & Telecommunication, pp 955-959.
Gabriel, M. A. (2004). Learning together: Exploring group interactions online. Journal of
Distance Education, 19(1), 54-72.
Garrison, D. R., & Cleveland-Innes, M. (2005). Facilitating cognitive presence in online
365
learning: Interaction is not enough. The American Journal of Distance Education, 19(3),
133-148.
Guzdial, M., & Turns, J. (2000). Computer-supported collaborative learning in Engineering: The
challenge of scaling-up assessment. In M. J. Jacobson & R. B. Kozma (Eds.), Innovations
in science and mathematics education: Advance design for technologies of learning (pp.
227-257). Mawah, NJ: Erlbaum.
Hannafin, M. J. (1989). Interaction strategies and emerging instructional technologies:
Psychological perspectives. Canadian Journal of Educational Communication, 18(3), 167-
179.
Harasim, L. (1997). Interacting in hyperspace, in University of Maryland System Institute for
Distance Education and International University Consortium Conference on Learning,
Teaching Interacting in Hyperspace: The potential of the Web.
http://umuc.edu/ide/potentialweb97/harasim.html
Healey, K. & Brayn-Kinns, B. (2000). Analyzing asynchronous collaboration. Proceeding of the
HCI 2000.
Hillman, D. C., D. J. Willis & C. N. Gunawardena (1994). Learner-interface interaction in
distance education: an extension of contemporary models and strategies for practioners.
The American Journal of Distance Education 8(2), 30-42.
Johnson, S. D., & Aragon, S. R. (2003). An instructional strategy framework for online learning
environments. New Directions for Adult and Continuing Education, 100, 31-43.
Kearsley, G. (2000). Online education: learning and teaching in cyperspace. Belmont, CA:
Wadsworth Press.
Lapadat, J.C. (2002). Written interaction: A key component in online learning. Journal of
Computer-Medicated Communication, 7(4). Retrieved from
http://jcmc.indiana.edu/vol7/issue4/lapadat.html
Moore, M. G (1989). Three types of interaction. The American Journal of Distance Education,
3(2), 1-6.
Newby, T., Stepich, D., Lehman, J., & Russell, J. (2000). Instructional technology for teaching
and learning: designing instruction, integrating computers and using media (2nd ed.).
Colombus, OH: Prentice-Hall.
Oliver, R. & McLoughlin, C. (1997b). Interactivity in telelearning environments: Using
communications and dialogue meaningfully in the learning process.
http://elrond.scam.ecu.edu.au/oliver/docs/97/ODLAA2do.pdf
Palloff, R. M., & Pratt, K. (1999). Building learning communities in cyberspace: Effective
strategies for the online classroom. San Francisco, CA: Jossey-Bass Publishers
Paulsen, M.F. (1995). The online report on pedagogical techniques for computer-mediated
communication. http://www.hs.nki.no/-morten/cmcped.htm
Pham, T., Thalathoti, V., & Dakich, E. (2014). Frequency and pattern of learner-instructor
interaction in an online English language learning environment in Vietnam. Australasian
Journal of Educational Technology, 30(6), 686–698.
Othman, S.A.S., Atan, H. & Guan, C. K. (2005). The Open University learning management
system: A study of interaction in the asynchronous Forum Board. International Journal of
Instructional Technology & Distance Learning, 2(11), 3-10.
Robinson, K. M. (2001). Unsolicited narrative from the internet: A rich source of qualitative data.
Qualitative Health Research, 11(5), 706-714.
Robson, J. (1996). The effectiveness of teleconferencing in fostering interaction indistance
education. Distance Education, 17(2), 304-334.
Romiszowski, A.J., & Mason, R. (1996). Computer-mediated communication. In D.H. Jonassen,
Handbook of educational communications and technology, (pp. 438-456). New York:
Macmillan Library Reference.
Rovai, A. P., & Barnum, K. T. (2003). On-line course effectiveness: An analysis of student
366
interactions and perceptions of learning. Journal of Distance Education, 18(1), 57-73.

So, H., & Brush, T. (2008). Student perceptions of collaborative learning, social presence and
satisfaction in a blended learning environment: Relationships and critical factors.
Computers & Education, 51(1), 318–336. http://doi.org/10.1016/j.compedu.2007.05.009
Samar, N., Zain, F. M., Kamar, N. A. N., & Sahimi, S. M. (2009). the Online Problem Based
Learning : the Effect of Collaboration Towards the Construction of Knowledge. Computers
in Education, 371–375.
Song, L. & Hill, J. R. (2009). Understanding adult learners‘ self regulation in online
environments: A qualitative study. International Journal of Instructional Media, 36(3), 263-
274.
Stacy, E. (2002). Social presence online: Networking learners at a distance. Education and
Information Technologies, 7(4), 287-294.
Stanberry, A.M. (2000). Modifying the teaching/learning process in the interactive video
network: A system analysis approach. Online Journal of Distance Learning Administration,
3(4).
Su, B., Bonk, C. J., Magjuka, R. J., Liu, X., & Lee, S. (2005). The importance of interaction in
web-based education: A program-level case study of online MBA courses. Journal of
Interactive Online Learning, 4(1), 1–19. Retrieved from
http://actxelearning.pbworks.com/f/4.1.1.pdf
Swan, K. (2002). Building learning communities in online courses: The importance of
interaction. Education. Communication & Information, 2(2), 23-49.
Tallent-Runnels, M.K., Thomas, J.A., Lan, W.Y., Cooper, S., Ahern, T.C., Shaw, S.M., & Liu, X.
(2006). Teaching courses online: A review of the research. Review of Educational
Research, 76(1), 93-135.
Teoh, B., Ping, A., Cheng, A. Y., & Manoharan, K. (2010). Students Interaction in the Online
Learning Management Systems : A Comparative Study of Undergraduate and
Postgraduate Courses. The 24th AAOU Annual Conference, (54), 1–14.
Thurmond, V. & Wambach, K. (2004). Understanding interactions in distance education: A
review of the literature. Interational Journal of Instructional Technology and Distance
Learning. http://itdl.org/journal/Jan_04/article02.htm
Trentin, G. (2000). The quality-interactivity relationship in distance education. Educational
Technology, 40(1), 17-27.
Vrasidas, C., & Mclsaac, M. (1999). Factors influencing interaction in an online course. The
American Journal of Distance Education, 13(3), 22-36.
Wang, M., Sierra, C., & Folger, T., (2003). Building a dynamic online learning community among
adult learners. Education Media International, 49(1-2), 49-61.
Wegner, S., Holloway, K. & Garton, E. (1999). The effects of internet-based instruction on
student learning. Journal of Asynchronous Learning Networks, 3(2), 98-106.
Wu, B. & Teoh, A. P. (2008). A comparative analysis of learners' interaction with online content
in the web-based learning management systems towards learners' performance.
Proceedings of 22nd Annual Conference of Asian Association of Open Universities.
-GP54-
Differences of 3G Wireless Networks and 4G Wireless Networks
Mohd Affendy bin Chi’ Nong 1, Masburah binti Mustaffa 2

1
Department Electrical Engineering, PoliteknikTuankuSultanahBahiyah, Kulim, 09000, Malaysia;
mohd_affendy@ptsb.edu.my
2
masburah@ptsb.edu.my
367
Abstract
3G and 4G are standards for mobile communication. Standards specify how the airwaves must
be used for transmitting information (voice and data). 3G (or 3rd Generation) was launched in
Japan in 2001. As recently as mid-2010, the networks for most wireless carriers in the U.S.
were 3G. 3G networks were a significant improvement over 2G networks, offering higher
speeds for data transfer. The improvement that 4G offers over 3G is often less pronounced.
This paper will make a comparison between third generation (3G) wireless network and fourth
generation (4G) wireless network and to discuss about the data transmission rate (performance
delivered) between third generation (3G) wireless network and fourth generation (4G) wireless
network
Keywords: 4G, 3G, Network, Wireless
1. INTRODUCTION
Mobile telecommunication is the use of cellular phones or other user devices or terminals to
make calls, exchange sms, transmit data, use of multimedia service such as video call, MMS
and etc. over a distance. Many of this service were not available when the 1G mobile networks
where developed; as shown on the above figure 1, mobile telecommunication evolved gradually,
with the first 1G standard that was analog and supported only voice, and as networks
developed, more modern standards emerged, like the ones currently available, 3G, 4G that
support more than just voice and have incorporated multimedia and other services.
Figure 1. Mobile evolution: From Analogue to digital 1G, 2G, 3G, 4G
The history and evolution of mobile service from the 1G (First generation) to fourth generation is
discussed in this section.
First generation
The process began with the designs in the 1970s that have become known as 1G.
Almost all of the systems from this generation were analog systems where voice was
considered to be the main traffic. The first generation wireless standards used plain TDMA and
368
FDMA. These systems could often be listened to by third parties. Some of the standards are
NMT, AMPS, Hicap, CDPD, Mobitex, DataTac, TACS and ETACS.
2G (Second generation)
The 2G (second generation) systems designed in the 1980s were still used mainly for
voice applications but were based on digital technology, including digital signal processing
techniques. These 2G systems provided circuit- switched data communication services at a low
speed. All the standards belonging to this generation were commercial centric and they were
digital in form. The second generation of wireless mobile communication systems was a huge
success story because of its revolutionary technology and the services that it brought to its
users. Besides high-quality speech service, global mobility was a strong and convincing reason
for users to buy 2G terminals. The second generation standards are GSM, iDEN, D-AMPS, IS-
95, PDC, CSD, PHS, GPRS, HSCSD, and WiDEN.
Table 1. Series of mobile generations and their features.
2.5G
2.5G is the intermediate generation between 2G and 3G cellular wireless technologies.
This term is used to describe 2G-systems that have implemented a packet switched domain in
addition to the circuit switched domain. 2.5G is not an officially defined term rather it was
invented for marketing purpose. 2.5G provides some of the benefits of 3G (e.g. it is packet-
switched) and can use some of the existing 2G infrastructure in GSM and CDMA networks (ref.
to fig. 2).
3G (Third generation)
To meet the growing demands in network capacity, rates required for high speed data
transfer and multimedia applications, 3G standards started evolving. The systems in this
standard are essentially a linear enhancement of 2G systems. They are based on two parallel
369
backbone infrastructures, one consisting of circuit switched nodes, and one of packet oriented
nodes. The third generation (3G) has been launched in several parts of the world, but the
success story of 2G is hard to repeat.
4G (Fourth Generation)
4G stands for the fourth generation of cellular wireless standards. Currently there are
two types of 4G data networks developed in the USA,one of which is WiMax, which is
developed by Sprint and its partners and another is LTE which is an extension of the GSM
network used by Verizon, T-Mobile and AT&T. 4th Generation mobile networks are supposed
to provide many value added features. In addition to all the 3G facilities, data transmission is
believed to go through the roof with speeds ranging between 100MBPs to 1GBPS. This means
it actually allows for networking, conferencing, chatting, happy talking, surfing, partying, or
whatever you want to do on your mobile phone.
4G technologies are Wi-Max, HSPA+ and LTE, due to their use of the MIMO (Multiple
Input/Multiple Output) standard. This allows cell phones to receive and transmit data
simultaneously across multiple frequencies, increasing speeds significantly. In 2012, average
4G speeds could range between 3.5 and 13 megabits, depending on the network in your area.
The purpose of the 4th-generation network is to dramatically increase data transmission speed.
Contrasting previous networks, it concentrates on data transmission rather than voice
transmission. That in itself is outstanding, because it means the shift from voice focused mobile
networks towards data focused mobile networks. It also is a potential threat for cable Internet
providers, because 4G speed can potentially be just as fast as optical fiber. Its current
applications include video conferencing, mobile web access, cloud computing, 3D television,
gaming services, high definition mobile TV and IP telephony.
2. COMPARISION BETWEEN 3G AND 4G
The main difference between 3G and 4G is speed. 4G speeds can be up to 10 times

faster than 3G, similar to the speed difference between DSL and high-speed cable modem.
Average download speed on a 3G network is between 600 Kbps and 1.4 Mbps with peak
download speed of up to 3.1 Mbps. On a 4G network the average download speed is 3-6 Mbps
with peak download speed of more than 10 Mbps. This speed difference is significant enough
for people to completely abandon 3G mobile broadband as soon as there is sufficient 4G
network coverage.
3G Network 4G Network Data Throughput Up to 3.1 Mbps with an average speed range
between 0.5 to 1.5 Mbps Practically, 2 to 12 Mbps but potential estimated at arrange of 100 to
300 Mbps. Peak Download Rate 100 Mbps 1 Gbps Peak Upload Rate 5 Mbps 500 Mbps
Frequency Band 1.8-2.5 GHz 2-8 GHz Services and Applications CDMA 2000, UMTS, EDGE
etc. Wimax2 and LTE-Advance Forward Error correction (FEC) 3G uses Turbo codes for error
correction Concatenated codes are used for error corrections in 4G Switching Technique Packet
Switching Packet Switching, Message Switching Network Architecture Wide Area Cell Based
Integration of wireless LAN and WAN.
370
Table 2. Comparison Between 3G and 4G
3. SPEED
Since the introduction of digital technology in telecommunications, it has been possible

to develop new services that have constantly been driving the evolution of mobile telephony, as
this service are implemented and its usage by user increases, further development is needed to
support for those trends. 4G provides an opportunity for a greater advance in the mobile
telecoms sphere; it opens the possibility to have various services to be provided to the users as
well as new avenues of revenue for the key player in the mobile industry.
The research measured the performance of 4G and 3G services on smartphones from the
four main mobile operators. The findings are also expected to encourage providers to improve
their performance. The research compared the performance of 4G and 3G services overall and
highlighted variations between operators across four key measures:
 Download speed - the speed it takes to download data from the web.
 Upload speed - how long it takes to upload content such as pictures or videos.
 Web browsing speed - the time it takes to load a standard web page.
 Latency - the time it takes data to travel to a third-party server and back, which is
important to reduce delays when making video calls, for example.
371
In making choices, it is critical for consumers to assess what their priorities are. For example,
faster download and upload speeds are important when accessing high volumes of data from a
small number of sites, like when sharing images over social media, or downloading video files to
watch on the move.
But for streaming video, while it is important that the download speed is sufficient to
deliver adequate quality, once this threshold is met it is likely that the total capacity available
within a mobile contract's data cap is more important. For customers browsing the web with
multiple tabs open, or making video calls, browsing speed and latency are important for better
responsiveness and reduced delays.
For better performance we have to make 3G as IP based which will allow higher data
transmission rate. We have to use only packet switching so that we can achieve higher internet
speed eliminating circuit switching which makes internet speed slow. To have the better
performance we have to use OFDM technology withQPSK and 16 QAM modulation rather than
simple QAM modulation technology. The 3G should be integrated with the IP based technology
so that it can have the tremendous data transmission and support VoIP as well. We have to
increase the band width of the 3G networks by using technology such as orthogonal frequency
division. If we are able to integrate it with the wireless LAN for better quality of service. At an
early stage the Flash-OFDM (Fast low-latency access with seamless handoff orthogonal
frequency division multiplexing(Flash-OFDM), also referred to as F-OFDM) system was
expected to be further developed into a 4G standard.8. No source suggests peak download and
upload rates of more than the 1 Gbpsto be offered by ITU-R's definition of 4G systems. If any
further generation appears, and reflects these prognoses, the major difference from a user point
of view between 4G and next Generation techniques must be something else than increased
maximum throughput; for example lower battery consumption, lower outage probability (better
coverage), high bit rates in larger portions of the coverage area, cheaper or no traffic fees due
to low infrastructure 8Arun Kumaretaldeployment costs, or higher aggregate capacity for many
simultaneous users (i.e. higher system level spectral efficiency)
Download Speed
Average 4G and 3G download speeds by network
The average mobile broadband download speed on 4G (15.1Mbit/s) was more than
twice as fast as 3G (6.1Mbit/s) across all the networks.
The research found that performance varied by operator. EE and O2 offered faster than
average 4G download speeds at 18.4 Mbit/s and 15.6Mbit/s respectively. Vodafone delivered an
average 4G download speed of 14.3Mbit/s and Three, 10.7Mbit/s.
Three was the last operator to roll-out 4G services in the UK and offers the service to all
customers that have 4G-enabled handsets.
372
EE and Vodafone delivered the fastest average 3G download speeds - at 6.8Mbit/s and
6.7Mbit/s respectively. This compared with average 3G speeds of 5.6Mbit/s for O2 and
5.2Mbit/s f
Upload speeds
Uploading content, such as photos or videos, takes significantly less time on 4G. The
data shows that 4G mobile upload speeds were more than seven times faster than for 3G
(12.4Mbit/s compared to 1.6Mbit/s).
EE's (14.7Mbit/s) and O2's (13.0Mbit/s) 4G upload speeds were above average,
followed by Vodafone and Three with 11.4Mbit/s and 11.1Mbit/s respectively. Three achieved
the fastest average 3G upload speed (1.7Mbit/s)
Average 4G and 3G upload speed by network
Web browsing
It takes less than a second for a basic web page to load on a smartphone using a 4G
mobile connection (0.78 seconds on average across all networks), according to the research.
This compares to 1.06 seconds on average across all networks using a 3G mobile connection.
373
Three offers the fastest web-browsing experience both on 4G (0.62 seconds on average
to load a web page) and on 3G connections (0.93 seconds on average to load a web page). EE
provided the second fastest web-browsing experience on 4G (0.76 seconds on average to load
a web page) and on 3G connections (1.05 seconds, on average).
It takes customers of O2 and Vodafone 0.82 seconds to load a web page on 4G

connections. Web pages also took longer to load on O2's 3G service (1.17 seconds) compared
with the other providers.
Average time taken to load a web page by network (lower is better)
Latency
Lower latency will give a customer better responsiveness and reduced delays -
important for web browsing and video calling. The results showed 4G services had lower
latency and are more responsive than 3G services. This makes 4G more suitable for video
calling or running apps where a fast response time is needed. Average 4G latency across all
networks was 55.0 milliseconds (ms), compared with 66.7ms on 3G.
Three took the least time to deliver data (lowest latency), both on 4G (47.6ms) and 3G
(53.8ms). O2 had the highest levels of latency (62.7ms on 4G and 86.4ms on 3G).
Average 4G and 3G latency by network (lower is better)
374
Difference between Cities
The research also revealed differences in performance between the five cities analysed.
Download speed
 The highest average download speeds for 4G and 3G were recorded in Edinburgh
(16.8Mbit/s and 7.8Mbit/s respectively). London had the lowest average 4G (13.1Mbit/s)
and 3G (4.1Mbit/s) download speeds.
Upload speed
 Manchester had the highest average 4G upload speed (13.2Mbit/s), while Glasgow and
London had the lowest (11.8Mbit/s and 12.0Mbit/s respectively). The highest average
3G upload speeds were recorded in Edinburgh and Glasgow (both 1.7Mbit/s), while the
lowest were found in London (1.4Mbit/s).
Web browsing
 London had the fastest 4G web-browsing speed, taking an average of 0.72 seconds to
load a standard web page. Web pages took the longest to load in Glasgow (0.82
seconds on average). 3G web-browsing was quickest in Manchester (1.01 seconds on
average to load a web page) and slowest in London (1.2 seconds on average).
Latency
 Latency on 4G was lowest in London (48.8ms on average) while Birmingham had the
lowest levels on 3G (63.6ms). Edinburgh had the highest average levels of latency for
both 4G and 3G with readings of 60.3ms and 69.4ms respectively.
4G and 3G coverage by operator
375
4G coverage varies across the UK, but has increased rapidly since the service was
launched in autumn 2012. While the research was conducted in cities where both 4G and 3G
were available, 4G is currently available from at least one operator in around 70% of UK
premises.
Mobile operators have indicated they intend to match O2's 98% indoor coverage
obligation for 4G mobile services by 2015. This will extend mobile broadband coverage into
many areas still underserved by 3G.
All four operators meet the 90% coverage obligation for 3G under the terms of their
licences. However, this research uses more demanding criteria, in line with consumers'
expectations. Ofcom's methodology assesses coverage where operators have busier networks,
higher take-up of 3G services and deliver 3G at faster speeds.
4G and 3G coverage for the four national operators: June 2014 and October 2014
Note: Ofcom's methodology estimates premises with coverage, based on operator signal
strength predictions. 3G and 4G data for EE, O2 and Vodafone, and 3G data for Three, are
based on the operators' submissions, checked against Ofcom's own field measurements. In the
time available it was not possible to resolve differences between Three's data and Ofcom's field
measurements on 4G coverage, leading to its omission from this report. However, while not
reporting estimates, Ofcom notes recent data, collected and published by OpenSignal, shows
Three has the lowest 4G coverage of the four national operators.
Ed Richards, Ofcom Chief Executive, said: 'Having fast, reliable broadband on the move
is vital for many consumers and businesses across the UK. Today's research shows 4G is
providing a significantly enhanced mobile broadband experience to customers, which we expect
to be available to 98% of the UK population by 2017 at the latest.
'Improving mobile quality of service is an important area of Ofcom's work. Our research both
incentivizes mobile providers to offer a higher quality of service, while helping consumers
choose a mobile package that best suits their needs.'
376
Ofcom is making progress on its plan to support improved mobile coverage in the UK
and provide consumers with reliable information on mobile quality of service.
Ofcom is also supporting the Government's £150m mobile infrastructure project, which is
funding mobile phone masts in uncovered areas. Ofcom is also providing technical support to
the Department for Transport and Network Rail on improving mobile services on railways.
Ofcom will continue to monitor and report on how mobile service quality develops over
time. The second phase of this research is under way and we expect to publish in spring 2015.
Since the introduction of digital technology in telecommunications, it has been possible

to develop new services that have constantly been driving the evolution of mobile telephony, as
this service are implemented and its usage by user increases, further development is needed to
support for those trends. 4G provides an opportunity for a greater advance in the mobile
telecoms sphere; it opens the possibility to have various services to be provided to the users as
well as new avenues of revenue for the key player in the mobile industry.
4. CONCLUSION
4G seems to be a very hopeful invention of wireless communication that will change the
life of people and the whole world to the wireless system. There are many remarkable features
anticipated for 4G which ensures global roaming and a very high data rate. New thoughts are
being introduced by researchers throughout the whole world, but new ideas and thoughts bring
in new challenges. There are numerous issues yet to be solved like efficient billing system,
smooth hand off mechanisms, incorporating the mobile world to the IP based core network etc.
Now, the whole world is looking ahead for the most intellectual communication network that
would connect the entire globe. Multiple 3G principles are the reason that makes it difficult for
3G devices to be truly global. In the future 4G networks may replace all existing 2.5G and 3G
networks, possibly even before a full deployment of 3G.
REFERENCES
TSGRAN wg4 tr25.942 version 1.0.0, wireless intelligent network ,March2004.

J.thorner ,-Intelligentnetwork,Artech House ,1994.
Hassan Gobjuka , ―4G wireless Networks Opportunities andchallenges― Verizon ,919
Hidden Ridge Irving ,TX75038.
Prasad ,R and Munoz ,L.‖ WLAN and WPANs towards4G Wireless‖ArtechHouse
March 2003
J.thorer,-Intelligent network ,Artech House ,1994.
S.Tabbane ,‖An alternative strategy for location tracking‖ IEEE.J select Areas commun ,vol.13
no.5 June1995,pp,880-892.
TRA, ―3G Network Aspects,‖ Understanding 3G Wireless Mobile Communications Proceedings,
1998.
377
S. Bali, and J. Korah, ―Quality of Service in 3G Wireless Networks,‖ a project paper submitted to
ECE5556, Virginia Tech, 2001.
R. Prasad, T. Ojanpera, ―An Overview of CDMA Evolution toward Wideband CDMA,‖
IEEE Communications Surveys, vol. 1, no. 1, Fourth Quarter 1988 pp. 2-28
Young Kyun, Kim; Prasad, Ramjee. 4G Roadmap and Emerging Communication Technologies.
Artech House 2006, pp 12-13. ISBN 158053-931-9.
JiveshGovil, JivikaGovil, ―An Empirical Feasibility Study of 4G‘s Key Technologies‖, 978-1-
4244-2030-8/08/ 2008 IEEE.
Jawad Ibrahim, ―4G Features‖ Bechtel Telecommunications Technical Journal, December 2002.
K.R.Santhi, Prof.V.K.Srivastava, G.SenthilKumaran, ―Goals of True Broad band‘s Wireless Next
Wave (4G-5G)‖ 0-7803-7954-3/03/2003 IEEE.
Simone Frattasi, HananeFathi, Frank H.P Fitzek, and Ramjee Prasad, Aalborg University,
Marcos D. Katz, Samsung Electronics, ―Defining 4G Technology from the User‘s Perspective‖,
IEEE Network • January/February 2006.
Suk Yu Hui and Kai Hau Yeung, City university of Hong Kong, ―Challenges in the Migration to
4G Mobile Systems‖.
JiveshGovil, JivikaGovil, ―4G : Functionalities development and an Analysis of Mobile Wireless
Grid‖, First International Conference on Emerging Trends in Engineering and
Technology.
Simone Frattasi, HananeFathi, Frank H.P Fitzek and Ramjee Prasad, Aalborg University;
Marcos D. Katz, Samsung Electronics, ―Defining 4G Technology from the User‘s Perspective.‖
IEEE Network January/ February 2006.
K.R.Santhi, G. Senthil Kumaran, ―Migration to 4 G: Mobile IP based Solutions‖ Proceedings of
the Advanced International Conference on Telecommunications and International
Conference on Internet and Web Applications and Services (AICT/ICIW 2006).
Robert Berezdivin, Robert Breinig, and Randy Topp, Raytheon, ―NextGeneration Wireless
Communications Concepts and Technologies‖ 0163-6804/02/2002 IEEE, IEEE
Communications Magazine • March 2002
Elias Aravantinos And M. HoseinFallah, Ph.D., Wesley J. Howe School Of Technology
Management, Stevens Institute Of Technology, Hoboken, NJ 07030 ―Potential Scenarios
And Drivers Of The 4g Evolution‖,
Hsiao-Hwa Chen, National Sun Yat-Sen University, Yang Xiao, University Of Memphis, Jie Li,
University Of Tsukuba, Romano Fantacci, University Of Firenze, ―The OCC-CDMA/Os
For 4G Wireless‖, IEEE Vehicular Technology Magazine, September 2006.
-GP55-
Differences Between 3G and 4G Technology
Masburah binti Mustaffa1, Mohd Affendy bin Chi’ Nong2

1
Department Electrical Engineering, Politeknik Tuanku Sultanah Bahiyah, Kulim, 09000, Malaysia;
masburah@ptsb.edu.my
2
mohd_affendy@ptsb.edu.my
378
Abstract
Mobile communication is one of the hottest areas and it is developing extremely fast in present
times, thanks to the advances of technology in all the fields of mobile and wireless
communications. Nowadays the use of 3G mobile communication systems seem to be the
standard, while 4G stands for the next generation of wireless and mobile communications. This
comparative study between 3G & 4G tells about the background and the vision for the 4G. We
first present a review on the development history, characteristics, status of mobile
communication and related 3G - 4G perspectives. An overall 4G framework features, having the
basic keys (diversity and adaptability) of the three targets (terminals, networks, and
applications). We present it in both external and internal diversity of each target to illustrate the
causes and solutions of the adaptability feature. Then, the 4G domain of each feature in the
framework is discussed from technical point, showing techniques and possible research issues
for sufficient support of adaptability. At the end, a summary on 4G visions and some of the
issues this new technology may face.
Keywords: OFDM, HSPA, LTE, MIMO, MC-CDMA, WCDMA, UMB
1. INTRODUCTION
Mobile broadband is becoming a reality, as the Internet generation grows accustomed to

having broadband access wherever they go, and not just at home or in the office. Out of the
estimated 1.8 billion people who will have broadband by 2012, some two-thirds will be mobile
broadband consumers — and the majority of these will be served by HSPA (High Speed Packet
Access) and LTE (Long Term Evolution) networks.
People can already browse the Internet or send e-mails using HSPA-enabled
notebooks, replace their fixed DSL modems with HSPA modems or USB dongles, and send and
receive video or music using 3G phones. With LTE, the user‘s experience will be even better. It
will further enhance more demanding applications like interactive TV, mobile video blogging and
advanced games or professional services.
LTE offers several important benefits for consumers and operators: Performance and
capacity - One of the requirements on LTE is to provide downlink peak rates of at least
100Mbit/s. The technology allows for speeds over 200Mbit/s and Ericsson has already
demonstrated LTE peak rates of about 150Mbit/s. Furthermore, RAN (Radio Access Network)
round-trip times shall be less than 10ms. In effect, this means that LTE — more than any other
technology — already meets key 4G requirements.
2. DIFFERENTIATION BETWEEN 3G & 4G
3G is currently the world‘s best connection method when it comes to mobile phones,
IJCSI International Journal of Computer Science Issues, Vol. 8, Issue 5, No 3, September 2011
ISSN (Online): 1694-0814 www.IJCSI.org 256and especially for mobile Internet. 3G stands for
379
3rd generation as it just that in terms of the evolutionary path of the mobile phone industry. 4G
means 4th generation. This is a set of standard that is being developed as a future successor of
3G in the very near future.
The biggest difference between the two is in the existence of compliant technologies.
There are a bunch of technologies that fall under 3G, including WCDMA, EV-DO, and HSPA
among others. Although a lot of mobile phone companies are quick to dub their technologies as
4G, such as LTE, WiMAX, and UMB, none of these are actually compliant to the specifications
set forth by the 4G standard. These technologies are often referred to as Pre-4G or 3.9G.
4G speeds are meant to exceed that of 3G. Current 3G speeds are topped out at
14Mbps downlink and 5.8Mbps uplink. To be able to qualify as a 4G technology, speeds of up to
100Mbps must be reached for a moving user and 1Gbps for a stationary user. So far, these
speeds are only reachable with wired LANs.
Another key change in 4G is the abandonment of circuit switching. 3G technologies use

a hybrid of circuit switching and packet switching. Circuit switching is a very old technology that
has been used in telephone systems for a very long time. The downside to this technology is
that it ties up the resource for as long as the connection is kept up. Packet switching is a
technology that is very prevalent in computer networks but has since appeared in mobile
phones as well. With packet switching, resources are only used when there is information to be
sent across. The efficiency of packet switching allows the mobile phone company to squeeze
more conversations into the same bandwidth. 4G technologies would no longer utilize circuit
switching even for voice calls and video calls. All information that is passed around would be
packet switched to enhance efficiency.
1. 3G stands for 3rd generation while 4G stands for 4th generation.

2. 3G technologies are in widespread use while 4G compliant technologies are still in the
horizon.
3. 4G speeds are much faster compared to 3G.
4. 3G is a mix of circuit and packet switching network while 4G is only a packet switching
network.
3. Features of 3G
3G telecommunications, is a generation of standards for mobile phones and mobile

telecommunication services fulfilling the International Mobile Telecommunications2000 (IMT-
2000) specified by the International Telecommunication Union.] Application services include
widearea wireless voice telephone, mobile Internet access, video calls and mobile TV, all in a
mobile environment. To meet the IMT-2000 standards, a system is required to provide peak
data rates of at least 200 kbit/s. Recent 3G releases, often denoted 3.5G and 3.75G, also
provide mobile broadband access of several Mbit/s to smart phones and mobile modems in
laptop computers.
The following standards are typically branded 3G:
380
 the UMTS system, first offered in 2001, standardized by 3GPP, used primarily in
Europe, Japan, China (however with a different radio interface) and other regions
predominated by GSM 2G system infrastructure. The cell phones are typically UMTS
and GSM hybrids.
Several radio interfaces are offered, sharing the same infrastructure:
 The original and most widespread radio interface is called W-CDMA.

 The TD-SCDMAradio interface, was commercialized in 2009 and is only offered in
China.
 The latest UMTS release, HSPA+, can provide peak data rates up to 56 Mbit/s in the
downlink in theory (28 Mbit/s in existing services) and 22 Mbit/s in the uplink.
4. Features of 4G
4G a range of new services and models will be available. These services and models
need to be further examined for their interface with the design of 4G systems. Figures 1 and 2
demonstrate the key elements and the seamless connectivity of the networks.
Figure 1. 4G Mobile Communication
Figure 2. 4G Vision
381
4.1. Terminals
Till date the ―terminal‖ for accessing mobile services has been the mobile phone. With the
advanced 3G and also the 4G in future, we can also expect to see a broadening of this concept.
User interfaces of terminals will vary from traditional keyboard, display, and tablet, to new
interfaces based on speech, vision, touch, soft buttons, etc. These will be general-purpose
computing and communication devices, and devices with more specific purposes to serve
particular marker segments. There will still be recognizable mobile phones. But many of these
will have larger screens to display Internet pages or the face of the person being spoken to.
There will be smaller "smart-phones" with limited web browsing and e-mail capabilities. The
addition of mobile communication capabilities to laptop and palmtop computers will speed up
the Convergence of communication and computing, and bring to portable computing all the
functions and features available on the most powerful desktop computers. There will be
videophones, wrist communicators, palmtop computers, and radio modem cards for portable
computers. Innovative new voice based interfaces will allow people to IJCSI International
Journal of Computer Science Issues, Vol. 8, Issue 5, No 3, September 2011 ISSN (Online):
1694-0814 www.IJCSI.org 258 control their mobile communication services with voice
commands.
4.2. Networks
Worldwide roll-out of 3G networks are delayed in some countries by the enormous Costs of
additional spectrum licensing fees. In many parts of the world 3G networks do not use the same
radio frequencies as 2G, requiring mobile operators to build entirely new networks and license
entirely new frequencies. So that a number of spectrum allocation decisions, spectrum
standardization decisions, spectrum availability decisions, technology innovations, component
development, signal Processing and switching enhancements and inter-vendor cooperation
have to take place before the vision of 4G will materialize.
4.3. Applications
The emerging applications for 3G and 4G wireless systems typically require highly
Heterogeneous and time varying quality of service from the underlying protocol layers. So
adaptability will be one of the basic requirements to the development and delivery of new mobile
services. Promising techniques and possible topics may include: Mobile application should refer
to a user‘s profile so that it can be delivered in a way most preferred by the subscriber, such as
context-based personalized services. This also brings the applications with adaptability to
terminals that are moving in varying locations and speeds. Techniques such as adaptive
multimedia and unified messaging take the terminal characteristics into account and ensure that
the service can be received and run on a terminal with the most suitable form to the host type.
The 4G technology will be able to support Interactive services like Video Conferencing (with
more than 2 sites simultaneously), Wireless Internet, etc. The bandwidth would be much wider
(100 MHz) and data would be transferred at much higher rates. The cost of the data transfer
would be comparatively very less and global mobility would be possible. The networks will be all
382
IP networks based on IPv6. The antennas will be much smarter and improved access
technologies like OFDM and MC-CDMA (Multi Carrier CDMA) will be used. Also the security
features will be much better.
Long-Term (Radio) Evolution or LTE is also part of 3G technology. It‘s a 3GPP its research item
for Release 8. It‘s also known as 3.9G or ―Super 3G‖ by some researchers. It‘s planned to
commercialize in 2009. It was aims at peak data rates of 200 Mbps (DL) and 100 Mbps (UL).
The WiMAX lobby and the people who are working with the WiMAX technology are trying to
push WiMAX as the 4G wireless technology. At present there is no consensus among people to
refer to this as the 4G wireless technology. I do not think this is popular with the researching
community. WiMAX can deliver up to 70 Mbps over a 50Km radius. As mentioned above, with
4G wireless technology people would like to achieve up to 1Gbps (indoors). WiMAX does not
satisfy the criteria completely. AlsoWiMAX technology (802.16d) does not support mobility very
well. To overcome the mobility problem, 802.16e or Mobile WiMAX is being standardized. The
important thing to remember here is that all the researches for 4G technology is based around
OFDM. WiMAX is also based on OFDM. This gives more credibility to the WiMAX lobby who
would like to term WiMAX as a 4G technology. Since there is no consensus for the time being,
we have to wait and see who would be the winner.
5. MULTIPLE ACCESS TECHNIQUES
3G wireless multiple access techniques are widely based on CDMA and WCDMA. But 4G
demands a better multiple access technique for reducing the MAI (Multiple Access Interference)
and ISI (Inter Symbol Interference) and thus improve the bit error rate performance. MC-CDMA
is the best candidate that would satisfy the demands of 4G wireless systems. Moreover,
adaptive modulation techniques have been proposed for 4G, where the modulation scheme is
changed dynamically based on the current channel estimates. MCCDMA is the hybrid
combination of OFDM (Orthogonal Frequency Division Multiplexing) and CDMA. MC-CDMA
with adaptive modulation promises to meet the demands of 4G regarding high data rate with a
lower BER (Bit Error Rate).
OFDM has the capability to cancel multipath distortion in a spectrally efficient manner. Rapid
variation in channel characteristics are caused by multi-path and Doppler spread (due to the
different speeds of mobile). Sometimes these time varying channels are characterized by very
good SNR (Signal to Noise Ratio), but worse SNR at other times. So a fixed modulation
technique cannot achieve the best Spectral efficiency as the system has to be built with a
modulation scheme considering the worst case scenario. Hence during good channel
conditions, the system would not be able to obtain the best possible spectral efficiency. This is
where adaptive modulation shows its role. Adaptive Modulation techniques takes advantage of
the time varying channel characteristics and adjust the transmission power, data rate, coding
and modulation scheme for the best spectral efficiency.
MC-CDMA
383
The basic idea of CDMA is to maintain a sense of orthogonality among the users in order to
eliminate the MAI. This is done by employing orthogonal spreading codes to spread the data
sequence. In MC-CDMA these spreading codes are defined in the frequency domain. Pseudo
orthogonal codes can be used instead of orthogonal codes, thus increasing the number of users
that can be accommodated. But pseudo orthogonal codes can increase MAI since the
spreading codes are not fully orthogonal.
Figure 3: MC-CDMA Transmitter
Fig 3 shows the configuration of an MC-CDMA transmitter for user. It takes 3 the input data
stream and converts into parallel data sequences each parallel data Sequence is multiplied with
the spreading code. A guard interval in inserted between the symbols to eliminate ISI caused by
multi-path fading.
Figure 4: MC-CDMA receiver
384
In MC-CDMA receiver the received data are first coherently detected and then multiplied with
the gain to combine the energy of the received signal scattered in the frequency domain. The
system model for adaptive MC-CDMA is shown in the below fig 8.
Figure 8: System model for adaptive MCCDMA
6. MULTIMEDIA – VIDEO SERVICES
4G wireless systems are expected to deliver efficient multimedia services at very high data
rates. Basically there are two types of video services: bursting and streaming video
Services. Streaming is performed when a user requires real time video services, in which the
server delivers data continuously at a playback rate. Streaming has little memory requirement
as compared to bursting. The drawback of streaming video is that it does not take advantage of
available Bandwidth. Even if the entire system bandwidth is available for the user, streaming
video service will transmit data only at a particular playback rate. Bursting is basically file
downloading using a buffer and this is done at the highest data rate taking advantage of the
whole available bandwidth. The flaw with this type of transmission is that it demands a large
memory requirement. So work is being done to come up with a new scheme that limits the
memory requirements and can exploit the available bandwidth of the system. The simulation
details and comparison of streaming and bursting video comparison.
7. APPLICATION OF 4G
Virtual Presence: This means that 4G provides user services at all times, even if the user is off-
site. Virtual navigation: 4G provides users with virtual navigation through which a user can
access a database of the streets, buildings etc. of large cities. This requires high speed data
transmission.
Tele-Medicine
385
4G will support remote health monitoring of patients. A user need not go to the hospital instead
a user can get videoconference assistance for a doctor at anytime and anywhere.
Tele-reprocessing applications
This is a combination of GIS (Geographical Information System) and GPS (Global Positioning
System) in which a user can get the location by querying.
Crisis management
Natural disasters can cause breakdown in communication systems. In today‘s world it might
take days or weeks to restore the system. But in 4G it is expected to restore such crisis issues
in a few hours.
Education
For people who are interested in lifelong education, 4G provides a good opportunity. People
anywhere in the world can continue their education through online in a cost effective manner.
8. Wi-Fi vs. WiMAX
Comparing WiMAX to Wi-Fi is akin to comparing apples to oranges. Initially it‘s easy to see why
the comparison would exist, as most people think WiMAX is merely a more robust version of Wi-
Fi. Indeed they are both wireless broadband technologies, but they differ in the technical
execution and ultimately their business case is very different. In addition to the technical
differences that exist, the marketplace difference is that equipment is more or less non-existent
for WiMAX and certainly not geared towards a residential environment with very high pricing to
be expected. It will take at least 2 years to see equipment of mass market uptake pricing.
WiMAX could not be commercially available until the second half of 2005, and even then at a
very controlled level. This is primarily due to standardization issues. In fact, it could not be until
2006 that a robust production and implementation would happen due to the ramp-up period for
manufacturers. This is certainly one challenge to the widespread adoption of WiMAX.
Additionally, WiMAX will have issues of pricing, and will remain far more expensive than Wi-Fi.
WiMAX will be primarily adopted by businesses to replace or displace DSL, and offices that
want to cover a lot of territory without entering the world of endless repeaters that are necessary
with the 802.11 technologies. It will take
some time (2 years) for WiMAX to significantly reduce its price-point for residential uptake.
WiMAX will not displace Wi-Fi in the home because Wi-Fi is advancing in terms of speed and
technology. Each year brings a new variant to the 802.11 area with various improvements.
Additionally, for commercial deployment, frequency allocation will be an issue. With the three
dominant communications players controlling the best frequencies, it will be hard to get the type
of traction needed with the remaining companies operating in the frequencies available. WiMAX
will become extremely robust and displace Wi-Fi as the deployment of choice for commercial
386
deployments, but that could not even begin until the end of 2006. Based upon the number of
public hotspots already deployed, WiMAX will not be chosen to replace those as they are up
and running adequately and personnel involved understand how to work with the technology.
The business case does not exist at the hotspot level. Where it may exist is for wider free use
deployments such as city deployments (free ones) and other government sponsored or carrier
sponsored (with ultra-inexpensive pricing for consumers) deployments. If this happens then it‘s
only Wi-Fi that will be displaced, but also cable and DSL will also lose a percentage of their
subscriber base. What will cause the displacement is the consumer‘s proven desire for a
bundled package.
9. CONCLUSION
4G seems to be a very promising generation of wireless communication that will change the
people‘s life to wireless world. There are many striking attractive features proposed for 4G
which ensures a very high data rate, global roaming etc. New ideas are being introduced by
researchers throughout the world, but new ideas introduce new challenges. There are several
issues yet to be solved like incorporating the mobile world to the IP based core network, efficient
billing system, smooth hand off mechanisms etc. 4G is expected to be launched by 2010 and
the world is looking forward for the most intelligent technology that would connect the entire
globe.
Someday 4G networks may replace all existing 2.5G and 3G networks, perhaps even before a
full deployment of 3G. multiple 3G standards and springing up that would make it difficult for 3G
devices to be truly global.
REFERENCES
B.G. Evans and K. Baughan, ―Visions of 4G,‖ Electronics & Communication Engineering
Journal, Vol. 12, No. 6, pp. 293–303, Dec. 2000. 2. C. R. Casal, F. Schoute, and R.
Prasald,
C. R. Casal, F. Schoute, and R. Prasald, ―A novel concept for fourth generation mobile
multimedia communication,‖ in 50th Proc. IEEE Vehicular Technology Conference,
Amsterdam, Netherlands, Sep. 1999, Vol. 1, pp. 381–385.
S. Y. Hui, K. H. Yeung, ― Challenges in the migration to 4G mobile systems,‖ Communications
Magazine, IEEE , Volume: 41 , Issue: 12 , Dec. 2003, pp:54 – 59
A.Bria, F. Gessler, O. Queseth, R. Stridh, M. Unbehaun, J. Wu, J. Zander, ―4thgeneration
wireless infrastructures: scenarios and research challenges,‖ Personal Communications,
IEEE [see also IEEE Wireless Communications], Volume:8, Issue:6, Dec.2001, pp:25 –
31 [6] U. Varshney, R. Jain, ―Issues in emerging 4G wireless networks,‖Computer,
Volume:34, Issue:6, June2001, pp:94 – 96
K. R. Santhi, V. K. Srivastava, G. SenthilKumaran, A. Butare, ―Goals of true broad band's
wireless next wave (4G5G),‖ Vehicular Technology Conference, 2003. VTC 2003-Fall.
2003 IEEE 58th , Volume: 4 , 6-9 Oct. 2003, Pages:2317 - 2321 Vol.4
L. Zhen, Z. Wenan, S. Junde, H. Chunping, ―Consideration and research issues for the future
387
generation of mobile communication,‖ Electrical and Computer Engineering, 2002. IEEE

CCECE 2002. Canadian Conference on , Volume:3, 1215May,2002 , pp:1276 - 1281
vol.3
S. Chatterjee, W. A. C Fernando, M. K..vasantha, ―Adaptive modulation based MCCDMA
systems for 4G wireless consumer applications,‖ Consumer Electronics, IEEE
Transactions on , Volume: 49 , Issue:4, Nov.2003, pp:995 – 1003
J. B. Chia, ―Video services over 4G wireless networks: not necessarily Streaming,‖ Wireless
Communications and Networking Conference, 2002. WCNC2002. 2002 IEEE , Volume:
1 , 17-21 March 2002 , pp:18 - 22 vol.1
-GP56-
Corporate Real Estate Asset: Importance and Principles
Farahiyah Fadzil
Department of Planning and Property Development, School of Government, Universiti Utara Malaysia,
farahiyah@uum.edu.my
Abstract
The importance of Corporate Real Estate (CRE) to a business organisation is
undeniable, given that CRE represents a large percentage of the total asset of the company.
However, this study identified some of issues arise and problems faced by CRE which originate
from the company‘s top management, including senior managers and corporate managers. On
the other hand, the discussion of the CRE importance is deemed incomplete if only analyses
real estate as a percentage of total assets. Thus, this paper also reveals the importance of real
estate as a percentage of total cost. The next part of this paper explored on the Principles of
Corporate Real Estate which become a prerequisite for every corporate organisation to
strengthen their understanding regarding standard, fundamental things, and general law of
CRE.
Key Words: Corporate Real Estate, Asset, Cost, Principle
1. CORPORATE REAL ESTATE SCENARIO IN MALAYSIA
Several local researches have illustrated the real scenario of CRE practises in Malaysia
(Iskandar, 1996; Hwa, 2003; Hwa, 2005; Zaiton, 2006; Zaitonet al., 2008; Marwani and Zaiton,
2012; Nurul Nabila et al., 2015).Based on the study by Zaitonet al. (2008), 76% of Malaysian
companies adopt CRE strategies that are in line with the Nourse and Roulac framework (Nourse
and Roulac, 1993). This illustrates the emergence of a trend encouraging CRE practices among
these corporations. There are also evidences indicating that CREs are important assets in a
company‘s balance sheet, as shown in Hwa (2005). This study was conducted on the real
estate wealth of listed, non-property companies in Malaysia, and found that 35% of market
capitalizations for Bursa Malaysia are sourced from CRE. This amounts to a value of
approximately RM216 billion. Besides that, corporate real estate also contributed to 36% of the
net tangible assets, 34% of the shareholder‘s equity, 27% of total capital employed, and 19% of
total tangible assets for public listed companies for the period of 1995-2001 (Hwa, 2005).
Besides, the discussion on the importance of CRE is not limited to focusing on the CRE
allocation in a company‘s asset. CRE importance can be further examined by looking at the
roles of CRE through a different and more interesting angle. Krumm and De Vries (2003) as
388
well as Joroffet al. (1993) claimed that land, physical structure, and offices are some of the
significant and crucial CRE elements in every company‘s strategic planning and they must be
properly managed to ensure that the company‘s monetary and operational goals can be
achieved. Previously, Joroffet al., (1993) revealed that senior managers agree that CREs can
be strategic assets that support a company‘s finance, work environment and operational
requirement. Besides that, CREs are known as the secondary resources for business
organisations. This shows the need to improve efficiency and effectiveness in economical or
organisational aspects has driven firms to focus on their supplementary resources, such as real
estates and facilities management (Lindholm, 2008). For example, one of the Support Business
for Telekom Malaysia Berhad (TM) is the Strategic Business Unit (SBU), which is related to real
estates. Property Management (PM) plays a role as TM‘s in-house land and building advisor
and based on the TM Annual Report for the year ending in 2011, TM‘s support business
recorded an increase of its total income, which was up by RM 23.3 million from the previous
year. This is largely attributed to the increase in rentals of office spaces managed by PM. In
addition to creating value from the properties owned by TM, PM also reviews the options for
cost savings, particularly in the use of utilities and property taxes. This evidence is suitable in
describing the roles of CREs as strategic assets in supporting a company's finance.
However, the study identified some of problems faced by CRE which originate from the
company‘s top management, including senior managers and corporate managers. According to
Nelson et al. (1999), corporate managers often underestimate the importance of real estate
assets while those in corporate relations always overlook the existence of CRE in a company.
Iskandar (1996) revealed a common CRE scenario in Malaysia, where even though operational
real estate make up a large portion of a company‘s total asset, which is about 39 per cent, the
majority of large organisations and public entities in Malaysia do not fully utilise the operational
real estates they own.
Joroffet al. (1993) and Rodriguez and Sirmans (1996) found that corporate
managements do not emphasise on the importance of CRE function as the main corporate
resources, compared to the other four corporate resources; capital, human resource, technology
and information. Senior managers only focus on a few specific CRE functions, such as
improving operational efficiency and cost minimisation. For example, an article published in the
Economy section of the BeritaHarian newspaper dated 17th March 2008 reported that Telekom
Malaysia Berhad itself has proposed a cost reduction plan by selling their physical assets
including buildings. It was stated that there are corporations that build and then sell or lease
their own headquarters as this approach is apparently more cost effective. Undoubtedly, the
cost control approach taken is very useful in ensuring that the group will continue to have a
competitive advantage and is able to compete in both local and international markets. However,
when the talking about issues regarding CRE contribution towards a company‘s financial
performance, the majority of past studies tend to only focus on approaches to cut costs and to
save capital. Consequently, there is an apparent gap on literature that discusses CRE functions
in generating income to increase revenue and provide financial profit to the company.
2. THE IMPORTANCE OF CORPORATE REAL ESTATE
Real estate assets represent an important proportion of corporate value (Nelson et al.,
1999). CRE acts as a substantial asset base and a significant cost factor has been generally
acknowledged (Krumm and Vries, 2003).There are two approaches used to reflect the role of
real estate holding on the balance sheet of a company; real estate as a percentage to total
assets or as a percentage of firm market value (Nelson et al., 1999). Hence, it is not surprising
that most of the former and current researchers and academicians are prone to describe the
importance of CRE by revealing the portion that is represented by the CRE from the company‘s
389
costs or total assets. From a research perspective, various authors from all over the world;
Malaysia (Iskandar, 1996; Hwa, 2008), Singapore (Liow, 1999; Liow and Ooi, 2004); Unites
States of America (Rodriguez and Sirmans (1996); Europe (Currie and Scott, 1991; Laposa and
Charlton, 2001); Australia (Seek, 1991); Nigeria (Olodokun, 2010), are always committed in
reporting the latest development of corporate real estate ownership from time to time. Thus,
this matter has demanded and stirred the author‘s curiosity to study the CRE importance to the
corporations in Malaysia. However, a general overview regarding the subject must be obtained
in advance.
2.1. Real Estate as a Percentage of Total Assets
The importance of corporate real estate as an important asset in the balance sheet of
the public listed companies in Malaysia is undeniable; this has been proven through research
conducted by Hwa (2008). Based on a study conducted on 500 non-property companies listed
on Bursa Malaysia in 2001, 24% of total tangible assets are represented by CRE. Moreover,
20.7% of total market capitalisation (RM465 billion) in Bursa Malaysia is also contributed by real
estate asset (Hwa, 2008). Earlier, Iskandar (1996) reported that 39% of the total assets for the
non-listed property organisations in Malaysia consist of operational properties.
Rodriguez and Sirmans (1996) estimated that real estate represents about one-quarter
of corporate wealth in USA business firms. Meanwhile, in the United Kingdom, on average of
30-40 per cent of total assets and 100 per cent of capital in the balance sheets of industrial
companies represented by real estate assets (Currie and Scott, 1991). According to Laposa
and Charlton (2001), the holding of real estate has been part of the corporate culture practised
in the UK and several other countries in Europe. This statement is also supported by a study
conducted by DTZ (2003), when it is estimated that nearly 70 percent of businesses in Europe
are involved in the real property holding. So, it is not surprising that the CRE percentage for
non-property companies in Europe is greater than the CRE portion for non-property companies
in the US (Brounenet al., 2005).
However, a study conducted by Liow (1999) also revealed that the corporate firms for
non-property companies in the Asian have property holding intensity (i.e. percentage of property
held as total tangible assets) higher than firms in the US and Europe. In the UK, the real
property holding is often associated with corporate culture. The same thing happens to most of
the large business firms in Asian; they believe that corporate image can be further enhanced
through the acquisition of its own prestigious administrative headquarters. The closest and
accurate example to describe the CRE situation is depicted by the neighbouring country,
Singapore. Real estate emerged as the largest asset in Singapore business firms when they
tend to spend at least 40 per cent of their corporate resources in real estate (Liow, 1999).
In general, the CRE importance is illustrated by the percentage of its representation of
the company total assets. It is different for every country worldwide, and this also applies to any
business industry (Hwa, 2005). According to Weatherhead (1997), ―those industries that trade
with the public from real estate, such as retailing and the hotel industry will usually have a
greater proportion of real estate as a proportion of their assets”. This statement is consistent
with the research findings conducted in China by Du and Ma (2012) on six business industries,
which consists of 340 non-property firms. The retail sector outperformed other sectors, with the
highest CRE percentage in average (30.6%) of the company total assets in 2003-2008. In
addition, the study conducted by Hwa (2008) also found that the hotel and agriculture sectors
have the highest average mean value with each worth more than RM400 million per year, for
the property owned by the nine business sectors. The rationale; the two sectors (hotel and
agriculture) are absolutely dependent on land and building for their output and services.
2.2. Real Estate as a Percentage of Total Cost
390
The discussion of the CRE importance is deemed incomplete if only analyses real estate
as a percentage of total assets. Therefore, it is necessary for the researchers to also reveal the
importance of real estate as a percentage of total cost. The role of real estate as one of the four
main production factors is undeniable, but indeed real estate is also synonymous with the term
―expensive‖ (Weatherhead, 1997) and ―costly‖ (Hwa, 2005).In addition, according to Rodriguez
and Sirmans (1996) and Olodokun (2010), occupancy and real estate cost is the second largest
expense of organisations after staff salary and human resources. Earlier, a study conducted by
Gale and Case (1989) found that 90% of organisations in the US show that there is no
difference in terms of handling (treated) of properties as compared to other factors of production
such as labour and equipment.
According to a study done by Bannock and Partners (1994), land and buildings
represent 16-17% of total costs for most of the large firms in the UK. Meanwhile, 10-20% of
operating expenses consist of occupancy of corporate space (Manning and Roulac, 1999;
Veale, 1989). However, Trundle (2005) argued the transparency level of the overall CRE
occupancy costs on the company financial statements, thus questioning the real value in the
company accounts. There are several issues pertaining to property costs have arisen. Among
the issues were raised by Bannock and Partners (1994) and Avis and Gibson, 1995), in which
they reiterated that most companies have limited idea regarding property cost, level of interest
and their value. The negative ideology is ingrained in most of corporate organisations,
rendering them with the idea that the real property acquired by them is considered as liability to
be borne by the company. Therefore, most of the corporate organisations tend to focus on cost
reduction efforts from the real estate resources,rather than working on the initiative to manage
them strategically (Zaiton, 2006). However, the limited idea in managing real estate costs
should not be a reason to negate the CRE importance within a company. Therefore, it has
become a prerequisite for every corporate organisation to strengthen their understanding
regarding standard, fundamental things, general law, which is better known as the Principles of
Corporate Real Estate.
3. PRINCIPLES OF CORPORATE REAL ESTATE (CRE)
There are 10 principles of Corporate Real Estate Management (CREM) developed by

Bon (1994) which can be clarified as follows:
i. The first principle of CREM consist three important elements which are the definition of
CREM, activities of CREM and the role of Chief Real Estate Officer (CREO). The whole
activities concerning portfolio of buildings and land holdings were covered by CREM.
The activities involved investment planning and management, financial planning and
management, construction planning and management, and facilities planning and
management. The CREO is responsible to integrate all of these activities into a rational
strategy.
ii. The second principle of CREM is property strategy should be parallel with organisation‘s
business goal.
iii. The structure of the portfolio should reflect alternative courses of action that apply to
different classes of real property. For example, when it involves decision either to
dispose or to make a significant reconstruction which is one of the contingency planning
for that properties.
iv. The fourth principle emphasised on the relationship between real property cycle and
other strategic cycles. Even though CREM focuses on the utilisation and operation
stage, it is also concerned with the whole property cycle of each property in the portfolio.
v. The fifth principle of CREM stresses on two point. The first point is CREM tools need to
be applied as early in the real property cycle as possible. While the second point
391
highlights that each organisation needs to develop and maintain a database with
information specific to that organisation.
vi. The main operational task of CREM is to provide approaches and tools that facilitate the
formation and maintenance of a feedback loop between real property performance
across the portfolio and managerial action. The consequences of their actions on real
property performance give a direct impact on the overall performance of the
organization.
vii. CREM requires effective monitoring of property performance by means of a system of
property performance indicators.
viii. Statistical quality control (SQC) in property performance is to ensure that actual property
performance is within the desired quality. But, there are some aspects that should be
considered in the quality control. Normally, problems will arise when a comparison of
buildings due to their heterogeneity and comparisons of the same building at different
points in time are done.
ix. The ninth principle focuses on three aspects of CREM which are physical, financial, and
organisational that needs to be integrated by the CREO into a coherent property
strategy.
x. The last principle enlightens about the improvement on the overall performance of the
portfolio by shifting the typical performance in the direction of improvement, in addition to
constrict the variation around that typical performance.
According to the Principles of CRE outlined by Bon (1994), there are some crucial points
that need to be address towards the effectiveness of corporate real estate management:
a) The role to be held by Corporate Real Estate Officer (CREO) in executing the
corporate real estate functions; by combining these three important aspects:
physical (i.e. building structure), financial and organisational aspects, so that the real
estate strategies are more comprehensive.
b) An effective and efficient monitoring of the property performance.For instance, one
of the indicators to assess the property performance is via the measurement of
financial performance (i.e. measure the contribution of CRE operation to the
companies‘ net profit income)
c) The real estate strategy that is coordinated should be at par with the company‘s
business objective to maximise shareholder wealth.
4. CONCLUSION
Discussion in this paper is divided into three major parts.This study began with a review
of the real scenario of CRE practices in Malaysia by focuses on the CRE allocation in a
company‘s asset.Then, CRE importance has been further examined by looking at the roles of
CRE through a different and more interesting angle. However, the study identified some of
problems faced by CRE management. This led to further discussions of the CRE importance in
the second part of this paper. The focus is placed on the percentage that is represented by
CRE from companies‘ total asset and total cost, to identify the scenario of the importance of
asset via review of local and international studies. In short, in Malaysia, 20-40% of total assets
are represented by CRE (Iskandar, 1996; Hwa, 2008). Meanwhile, land and buildings represent
16-17% of total costs for most of the large firms in the UK (Bannock and Partners, 1994).Next,
the basic understanding of CRE is reinforced by exploring Principles of CRE by Bon (1994),
where there are some crucial points that need to be address towards the effectiveness of
corporate real estate management.
REFERENCES
392
Avis, M., Gibson, V.A. and Watts, J. (1989). Managing Operational Property Assets, University of
Reading, Reading, UK.
Bannock, G and Partners (1994), ―Property in the Boardroom: A New Perspective‖ Hillier Parker and
Graham Bannock and Partners.
Bon, R. (1994), ―Ten Principles of Corporate Real Estate Management‖, Facilities, Vol. 12, No. 5, pp. 9-
10.
Brounen, D., Colliander, G. and Eichholtz, P.M.A. (2005), ―Corporate Real Estate and Stock Performance
in the International Retail Sector‖, Journal of Corporate Real Estate, Vol. 7, No. 4, pp. 287-99.
Currie, D. and Scott, A. (1991). The Place of Commercial Property in the UK Economy, Centre for
Economic Forecasting, London Business School, January.
Hwa, T.K. (2008), Corporate Real Estate Investment and Ownership: Empirical Evidence from Bursa
Malaysia Ownership. University of Technology MARA
Hwa, T.K. (2005), Corporate Real Estate of an Emerging Market: Evidence from Bursa Malaysia, 12th
Annual European Real Estate Society (ERES) Conference, Dublin, Ireland.
th
Hwa, T.K. (2003), The Reorganisation and Restructuring of Corporate Real Estate, 9 Pacific Rim Real
Estate Society Annual Conference, Brisbane, Queensland, Australia 20 - 22 January 2003.
Iskandar, I (1996), ―The Operational Property Management Process in Large Non-Property Organisations
in Malaysia: An Organisational Perspective‖, Unpublished PhD Thesis, Faculty of Urban and
Regional Studies, University of Reading, UK.
Joroff, M., Lourgand, M., Lambert, S. and Becker, F. (1993), ―Strategic Management of the Fifth
Resource: Corporate Real Estate‖, September/ October, Vol. 162, No. 5, pp.14-19.
Krumm, P.J.M.M. and De Vries, J. (2003), ―Practice Briefing: Value Creation through the Management of
Corporate Real Estate‖, Journal of Property Investment & Finance, Vol. 21, No. 1, pp. 61-72.
Laposa, S. and Charlton, M. (2001), ―European versus US Corporations: A Comparison of Property
Holdings‖, Journal of Corporate Real Estate, Vol. 4, No. 1, pp. 34-47.
Lindholm, A.-L. (2008), ―A Constructive Study on Creating Core Business Relevant CREM Strategy and
Performance Measures‖, Facilities, Vol. 26, No. 7-8, pp. 343-358.
Liow, K.H. and Ooi, J.T.L. (2004), ―Does Corporate Real Estate Create Wealth for Shareholders?‖,
Journal of Property Investment & Finance, Vol. 22, No. 5, pp. 386-400.
Liow, K.H. (1999), ―Corporate Investment and Ownership of Real Estate in Singapore: Some Empirical
Evidence‖, Journal of Corporate Real Estate, Vol. 1, No. 4, pp. 329-42.
Manning, C.A, and Roulac, S.E. (1999), ―Corporate Real Estate Research within the Academy‖, Journal
of Real Estate Research, Vol. 17, No. 3, pp. 265-79.
Marwani, M.R. and Zaiton, A. (2012), ―Determining Factors of Corporate Real Estate (CRE) Strategy
Implementation in the Malaysian Business Corporations‖, International Journal of Real Estate
Studies, Vol. 7, No. 1.
Nelson, T.R., Potter, T. and Wilde, H.H., (1999) "Real Estate Assets on Corporate Balance Sheets",
Journal of Corporate Real Estate, Vol. 2, pp.29 – 40.
Nourse, H.O. and Roulac, S.E. (1993), ―Linking Real Estate Decisions to Corporate Strategy‖, Journal of
Real EstateResearch, Vol. 8, No. 4, pp. 475–94.
Nurul Nabila, S., Mohd Lizam, M.D., Ahmad Kaseri, R., Abdul Jalil, O. and Asmahani, A. (2015),
st
Corporate Real Estate Performance in Malaysian Public Listed Companies, 21 Annual Pacific-
Rim Real Estate Society Conference, Kuala Lumpur, Malaysia, 18-21 January 2015.
Oladokun, T. (2010), ―Towards Value-Creating Corporate Real Estate Assets Management in Emerging
Economies‖, Journal of Property Investment & Finance, Vol. 28, No. 5, pp. 354-364.
Rodriguez, M. and Sirmans, C.F. (1996), ―Managing Corporate Real Estate: Evidence from the Capital
Markets‖, Journal of Real Estate Literature, Vol. 4, No. 1, pp. 13-33.
Seek, 1991)
TM Annual Report for the year ending in 2011,
Trundle, M.B. (2005), ―Capturing Hidden Value for Your Shareholders‖, Journal of Corporate Real Estate,
Vol. 7, No. 1, pp. 55-71.
Veale, P.R. (1989) ―Managing Corporate Real Estate Assets: Current Executive Attitudes and Prospects
for an Emergent Management Discipline‖, Journal of Real Estate Research, 4 (3), pp 1-22.
Weatherhead, M. (1997) Real Estate in Corporate Strategy, Macmillan Press Ltd, London.
Zaiton, A., McGreal, S. and Adair, A. (2006), ―Corporate Real Estate Strategy in the UK and Malaysia‖,
Journal of Corporate Real Estate, Vol. 8, No. 4, pp. 168-177.
393
Zaiton, A., McGreal, S., Adair, A. and Webb, J. (2008), ―Corporate Real Estate Strategy: The
Malaysian Perspective‖, Journal of Real Estate Literature, Vol. 16, No. 1, pp. 33-54.
-GP57-
MANAGING RIVER TOURISM ATTRIBUTES: INTEGRATING RIVER NATURAL
FEATURES AND INFRASTRUCTURE COMPONENTS
Dani Salleh1, Noni Harianti Junaidi2 and Mazlan Ismail3

1 Dept. of Planning and Property Management, School of Government, Universiti Utara Malaysia, Kedah.
Email: dani@uum.edu.my
2 Faculty of Administrative Science and Policy Studies, Universiti Teknologi MARA, UiTM (Sarawak).
Email: noniehj@sarawak.uitm.edu.my
3 Dept. of Planning and Property Management, School of Government, Universiti Utara Malaysia, Kedah.
Email: lan1441@uum.edu.my
Abstract
The objective of this paper is about the important of the planning aspect of river infrastructure
development as tourism attributes. The role of river development was to facilitate future
development of a river in a way they can preserve and conserve the river environment naturally.
However, since the river areas was one of the most valuable assets in sustaining urban
development, the infrastructure have to be designed to mitigate the natural functions of river and
have be formulated as a domain useable sculptures and where by functioning as one of
attributes in the local tourisms products. Therefore emphasis must be given by the local
authorities in managing urban-river water management into river based infrastructure
development plans in order to promote river-based infrastructure design as a tourism products.
The discussions in this paper also explain the country‘s experience as a case study, outlines
development of urban water management and the efforts by respective authorities towards
preparing integrated water management in the country.
Key Words:River Management, Infrastructure Provision, Tourism Development.
1. INTRODUCTION
The rapid increase of urban size of population critically brings about the rise of water
demand and this gives rise to the necessity of water resources development and it would
create a serious urban river hydrological problems. The increase of population density and
increase the building density also increase the quantity of waterborne wastes. This contributes
to the deterioration of storm water quality. Malaysia has experienced various problems due to
rapid industrialization and urbanization, particularly through a period of high economic growth.
During that period, actions for intensified countermeasures by respective authorities
commenced regarding each problem. Today appropriate adjustments and combinations of
such various measures are required to efficiently achieve the urban water management
through the approach of ‗Integrated Urban Water Management‘. Major problems related to
urban water management were shortage of water, pollution of water bodies, deterioration of
environments surrounding rivers, lack of available water for emergencies and urban flood
disasters.
394
2. URBANIZATION AND RIVER DEVELOPMENT
2.1. The Profiles of River
Malaysia is formed by 13 sates varying in size from 244 sf. km (Federal Territory Kuala
Lumpur) to 124,449 sq. km (Sarawak) (see Figure 1). With a present estimated total of 21
million people, the Malaysia population is becoming more concentrated into cities, towns and
industrial zones (over 50%), with the highest figure in Kuala Lumpur at 1.4 million. Kuala
Lumpur started as a village in 1860, became capital of the United Malaysia Sate in 1896, and
was turned into capital of Malaysia in 1863. It was subsequently upgraded to a city status
in 1974 and now stands as the most urbanised and populated zone in Malaysia with a projected
population of 1.85 and 2.4 million in 2020 and 2050, respectively (EPU, 2000).
Like many other developing countries, Malaysia is striding to upgrade its social well-
being by alleviating ever-increasing flash-flood, water and pollution problems. In mitigating the
flood problem, river features was identified as one of the vital elements to mitigate flood
problem. It has some of 150 rivers in Peninsular Malaysia and 50 rivers in Sabah and Sarawak.
Rivers have played an important role in shaping and influencing Malaysia‘s development and
almost towns in the country are located beside a river. It offers tremendous recreational
opportunities to the local communities by sharing a wide variety of flora and fauna. From the
viewpoint of the urban storm water management or water resources, this situation means that
planning for the future in Malaysia must envisage a continued increase in population growth in
urban areas.
2.2. Development and River Infrastructure
Urban growth creates demands for various development projects as accelerated by

strong growth in industrial sector and reinforced by dynamic property market sectors. The
concentration of urban population and expansion of existing development areas requires rapid
implementation of various types of infrastructure projects. The large scale development project
has produced greater challenge to local authorities to balance the issues regards to river basin
environmental sustainability and livability. However, improper execution of the projects,
especially those located in sensitive development areas, would be harmful to river basins.
Various countermeasures have been identified to monitor urban river basins. Meanwhile, the
adequate provision of infrastructure has to be provided and at the same time it has to protect
the natural and built environment.
Some of the planned residential development was given hope to river environment with
the concept of river become the main focus of the development. By integrating the river features
(fauna and flora) into the match-design of mitigation measures (man-made structure) of the
river, river nowadays have been part of the river component functioning as infrastructure to
mitigate any uncertainty within river basin. This can be rephrased in environmental terminology
as landscaping exercises. Where the man-made structure used to mitigate the river bank from
erosion, landslide or sedimentation consequences must be symbioses with the surrounding. At
the designing stage, all related professionals currently engaged in such development should
therefore accept the new concept and challenge roles of not only designing satisfactory of flood
395
mitigation structures but they have also to look forwards of how this river infrastructure (man-
made structure) can be integrated to the river basin development.
2.3. Issues in River Management
The rapid growth through land development, urbanisation and industrialisation has
created a considerable consequence to the environment. Rivers however, have directly receives
such negative impacts from development. Some of rivers which located in many major urban
centres in the country are now at an alarming stage, due to improper monitoring by relevant
authorities. As reported by Department of Irrigation and Drainage (2000), the problems being
encountered by some of the river in the country are; flash flood, mud flows due to construction
activities, water pollution and ecological damage, river bank failures, sedimentation, surcharges
and overflow from wastewater facilities and garbage and floating litters. The areas which are
prone to experience these problems include urbanised and urbanising centres in the Klang
Valley, Kuala Lumpur International Airport (KLIA), Penang, Linggi River Basin and other new
socio-economic growth areas which most then located in West Coast of Malaysia.
Based on a study conducted by Department of Irrigation and Drainage (2010),
summarised the problems associated with rivers are:
i. Water Shortage - Rapid economic growth coupled with prolonged drought has brought the
problems of water imbalance into development which is concentrated in 'water-stress' regions.
The main problem in this particular scenario, the number of population is not-proportionate with
the capacity of what a river basin can support in that region.
ii. Flooding - With the rapid growth of industrialisation and with improper monitoring of
urbanisation, was led to the increase of flash flood problem in some major urban areas. Since
then many newly developed areas which had no previous flood records were subjected to
severe flooding. Two primary reasons can be identified as the causes of urban flood disasters,
likely the expansion of urbanization areas and flooding of downstream areas caused by the
increase of flood discharge due to upstream urbanization.
iii. River and Water Pollution - In the most cases, the river water polluted and becomes
discoloured after human use. The deterioration of river water quality is synonymous with
development. The main source of pollution was discharged from domestic and industrial
sewage, rubber factories, effluent from palm oil mills and animal husbandry activities.
iv. River Sedimentation - The sedimentation of river normally occurred in the lower stretches
with heavy silt loads especially after heavy rains. Whereas in urban areas, the sedimentation
take place as the direct consequence of extensive land clearing for projects such as housing,
industry and highways and the subsequent severe erosion caused by heavy rains. In urbanised
areas, land clearance for construction project contributes 90% of sediment load to river.
v. Squatters - Another major contributor to urban river pollution came from the presence of
squatters settlements. The problem is detrimental to the river in a number of ways. The
settlement was not adequately provided with sewerage and rubbish disposal facilities. Most of
396
the sewage and water generated within the area find their way directly into rivers. As an
example in the Klang Valley, it was estimated that between 20,000-40,000 squatters population
still living on the river reserves. The area was poorly managed and rubbish is generally
disposed to a common dumping area on the banks of the river, which invariably gets washed
down to the river.
Lack of Lack of political

Inadequate
awareness support and will and poor
capacity building coordination
Pressure on
Depletion of Increasing water
domestic, industrial
biodiversityand and agricultural
demand
deterioration River water water supply
pollution Water Shortage
of river water quality
River
Sedimentation
River corridor
Floods and reserve
encroachment
Improper land
conversion /
expansion of Squatters
Unclear linkages
urbanization
between land
use and
Poor land use
protection
management
Inadequate
of river
protection of
forest and green
area/poor
monitoring
Figure 1: Issues in Urban River Development
Source: Adopted from Noh (2003)
397
3. RIVER FEATURES AS INFRASTRUCTURE AND LANDSCAPE COMPONENTS
The main purpose of river based infrastructure development is to control flooding as

efficiently as possible by incorporating the plants as the main components. The growing public
concern demands the utilization of plants (fauna and flora) for recreational purposes. In
response, a development concept themed ‗Development Facing River‘ which using plants as
the main component was welcomed by most local planning authorities in the country. Social and
economic growth has long been associated with river water control by means of mitigation of
flood damage to people‘s lives and diversification of river water utilization.
Generally river has three main functions for flood mitigation, water utilisation and
environmental aspects.
i. Flood mitigation - The function of flood mitigation is for safeguarding and preventing flood
disasters and this is more fundamental function of the river to be held. Diversified utilisation of
the river water, have been recognized quite importantly from old days along with growing and
high expansion of social and economic activities.
ii. Water utilisation - During rapid economic growth, witnessed a large scale population
migration to cities (e.g. industrial areas) from rural areas causing rapid urbanization and
sparks heavy demand on existing water supplies. At the present most of the states was
established an independent state water management (e.g. SADA, SYABAS etc.) to develop
and manage the water supply to the respective states (which replacing the previous State
Water Authority) and also responsible to step up a comprehensive and interdisciplinary
development and legitimate utilization of water resources.
iii. Environmental aspects - In recent years, the environmental function of the river in urban
area has become relatively to recognize its importance. For instance, pollution level of river
water was increase resulted from improper control of economic and urbanisation activities,
and the river itself faces over saturation in self-purification capacity. Pollution of natural
waterways through effluent discharges from factories and businesses began to be noticed in
during the rapid industrialization period. The function of environment is more wide range of
aspects such as acquiring spaces for recreational, sports activities and walkways,
amelioration of microclimate condition, inhabitation of aquatic fauna and flora. Some rivers
have characters which influenced by topographic and climatic condition.
3.1. River Improvement and River Landscaping
Landscaping of river is somewhat results of human motivation with background of social

value and consensus to the river, and this idea becomes to reality of landscaping. The function
of river could be more conceptual and flexible in form of design. Therefore, the landscaping of
the river should be integrated with surrounding elements such as the urban conditions and the
character of social demand and activities to be performed
Meanwhile, the main purpose of river improvement is to control flood as efficiently as
possible. These measures generally gave rise to straight and lined river channels, which were
not aesthetically pleasing. At the same time a growing public concern demanding utilisation of
public water bodies for recreational purposes was initiated some local authorities in the
country to promote a river development concept termed ‗Development Facing River‘ which
well received by most local planning authorities in the country. These include expanding
greenery and beautification of urban rivers.
Another aspect of urban water requirements made it necessary to integrate urban
water management strategies. During the last decade public concern for environment issues
398
has included demands to revert the rivers back to their natural look. In this context the river
beautification programmes have been expanded to cover the full length of the river. Under
these projects preservation and improvement of river are given a high priority in any large
property development related projects in the country. Major urban river management
measurements had taken place during the last decade. These measures include the Water
Pollution Control law, Comprehensive Flood Control Measures plan, River Friendly Projects
etc. The direction of these measures over the years is towards the management of both flood
and ordinary flow in rivers, by integrating planning and management of urban development.
The development plans has issued policies for the river development. The policy
imposes strict gives very strong requirement in improving the river and its corridors. Among
these requirements are;
i. To improve the environmental quality of the river and its corridor.
ii. To improve access and circulation to the river and its corridor,
iii. To realise the potential of the river and the corridor for recreation and amenity.
3.2. Landscape Components of River
The river has many aspects of landscape components in relation with human activities
and the nature. The natural characteristics of the river are usually having quite diversified
forms and dynamics within the riverine spaces (Cals and Drimmelen, 2001). By referring to
Figure 2, the landscape components of the river are generally divided into to two categories
which are attributed the space within the river and surrounding space of the river.
- River channel - Planer form of channel, longitudinal form and form of high water river bed, etc.
Space within the River
- Micro topographic condition of river channel - Sand bank bar, river bed material and so on.
- Water surface - River flow condition, water quality, reflected scenery on the water surface, etc.
- River structures and facilities - River banks, revetments and water gates, etc.
- Installed facilities within river space - Playgrounds and recreational facilities, information and
Landscape Components of River
signboards, sitting and resting facilities such as benches and stools.

- Riverine vegetation - Row of trees, preservation trees and shrubs, groves, grass land and etc.
- Road devices - Signage boards, poles and roadside plantings, etc.

- Building facilities - Building, huts, drainage facilities and structures, water access stairs, etc.
- Wild life - Territorial fauna such as riverine animals, birds, insects,
- Aquatic fauna such as fishes and turtle
Surrounding
- Human activities - Figure of peoples, automobiles, bicycles, boats, etc.

River
- River crossing facilities - Variety of bridges, water supply pipes, electric transmission cables, etc.
- Natural phenomenal components - Seasonal changes, weather changes, daily duration and time
changes.
- Traffic route - Bicycle routes and networks, pedestrian paths and networks, service roads, etc.
- Open spaces - Parks, plazas, game courts, etc.
- Long distance scenery - Natural elements such as mountain ranges, hills and slopes, groves and
thickets, Artificial elements, Sky line of urban buildings, high rise buildings, transmission towers,
etc.
Figure 2: Landscape Components of River
399
4. TOWARDS INTEGRATED RIVER DEVELOPMENT
The major problems related to urban river development include, the pollution of water
bodies, urban flood hazards and deterioration of the environment surrounding rivers. To date a
piecemeal approach has been adapted to solving the problems. The previously piecemeal and
segmented efforts are needed in order to achieve efficient and environmentally sustainable
function of urban river. However, the efforts must be appropriately integrated, especially by
integrating land use planning to achieve multiple uses for urban land.
The concept of ‗Integrated Urban Water Management‘ consists of two main components,
which are structural and plant component. The concept creates a wide range of aspects such as
acquiring spaces for recreational, sports activities and walkways, amelioration of microclimate
condition, inhabitation of aquatic fauna and flora. Rivers in some states in Malaysia have
characteristics affected by topographic and climatic conditions; historically floods have often
occurred when towns and settlements are established within flood prone areas. Under these
circumstances, flood mitigation has always been considered a social necessity. The river has
many aspects of landscape components in relation to human activities and nature. The natural
characteristics of rivers are diversified form and dynamics within the riverside areas. The
landscape (plants) components of the river are generally divided into two categories which are
attributed to the area within the river and the area surrounding area of the river.
4.1. River Improvement Guidelines
Together with the future riverside park areas, spaces of the river reserve it are become
valuable open space as utilized recreational cores with pedestrian walks. These series of space
along the river can be made well-harmonized environment to represent effective façade of the
urban area. Functional services of these spaces are pedestrian walks, rest place and plazas
with landscaping, and these new environmental function of the riverside spaces is quite
effective. The existing landscape condition will be changed to be more attractive environmental
situation through these improvements of the riverside development works.
An idealised goal for urban water management would be the restoration to its natural
level. To achieve this goal, the objectives of urban river management should take into
consideration some important components; i)to enhance the urban landscape; ii) to optimise the
land available for urbanisation; and iii) to minimise the environmental impact of urban runoff on
water quality.
As for considering the riverside improvement schemes of river systems, following
improvement guidelines may be suggested for the river corridor landscaping.
i. Qualitative improvement of river revetments as means of improving the riverside
landscape.
ii. Efficient projection of riverside walkway improvement in conjunction with nearby
development of some strategic commercial and business.
iii. Keeping a clean condition of the river reserve.
iv. Improving the river reserve and establishing recreational open space usage of the river
reserve.
v. Providing some attractive observation places and plazas, resting core areas at strategic
riverside points.
vi. Providing the sequential walkways system along river side and establishing aesthetic
space for each bridge brinks.
vii. Conservation of valuable natural vegetation along environmentally sensitive areas.
400
Most local authorities were promoting a river development concept termed Development
Facing River. By integrating the river features (fauna and flora) into the match-design of
mitigation measures (man-made structure) of the river, river nowadays have been part of the
river component functioning as infrastructure to mitigate any uncertainty within river basin. This
used to mitigate the river bank from erosion, landslide or sedimentation.
The management of the river environment should be included with other responsible
agencies because management of the river environment could be closely related to other
functions. Therefore, the range of river management actually covers the following functions;
i Promotion of river environment project; To meet various river environmental requests,
river environment improvement projects (water quality, recreation, etc.) should be
promoted.
i. Integrated control by river management agency; Integration of flood control and water
utilization policies
ii. Long-term and wide-ranging management; Present and future generations in the river
basin
iii. Regulation and utilisation; Disaster prevention in urban area, rivers should be utilised as
the natural recreational zones with water and the precious urban open space.
iv. Management for individual river basin; among other components to be considered
includes; natural environment, human habitat, industrial and economic activity, social
and cultural conditions.
4.2. Land Use Planning, River Development and River Management
While development projects generate economy activities, the increasing of urbanization

will strain the capacities of roads, built-up areas and natural environment such as the
atmosphere, rivers and streams. Improper monitoring of such activities would contribute to the
deterioration of environmental quality due to the high building density, traffic-flow, increase
soil/land erosion, underground erosion. (E.g. site project water-waste, domestics, hill erosion
etc.). Hence, environmental aspects of planning and monitoring of development projects
requires a comprehensive development control mechanism to guide development. In order to
fulfil this requirement, Town and Country Planning Act 1976 (Act 172) imposed several
requirements to guide such projects become more 'environmental friendly development
projects‘.
In Malaysia the related legitimate land use plans (e.g. Structure Plans and Local Plans)
has been formulated in order to regulate the balance development in public interest. Therefore it
has a positive role to play towards the achievement of an orderly urban development pattern by
guiding appropriate development. It must make adequate provision for development of housing,
employment, infrastructure and recreational need and at the same to protect the natural and
built environment.
Now, how to relate the role of planning system in river infrastructure development? The
existing and future condition of rivers is closely associated with the existing and future land use
patterns. The different density of land use will significantly influence the volume and rate of
runoff and the quantity and quality of river pollutants carried from the land surface to the rivers
system. River related development must be guided by the deep understanding of the
interdependence of land use planning exercise and the nature of river system. Integrated
development plans must be geared towards taking river system as significant components of
the land use planning system. Development must be guided by a coordinated approach
401
associated with catchment-based planning and management, integrated urban land use
planning, infrastructure provision and also last but not least these components must be
furnished with appropriate landscaping plan just to symbioses the natural feature and the man-
made structure.
With the combination of the above functions, various aspects are required to be
incorporated in the formulation of proper management of the river environment (see Figure 3).
Efficient comprehensive management of water quantity and
The scope of function Promotion of water environment improvement projects

of River Management
Promotion of preservation and utilization of river space
-Promotion of river space improvement projects
-Special consideration of lakes and minor rivers in urban

Figure 3: Proposed Scope of Function of Urban River Management
areas
-Other policies related to river environment management

4.3. Proposed Setting Up of River-Based Infrastructure Development
The rapid urban development causes many wetlands were reclaimed for residential
development, forests cut down for highland resorts development, or new highways. Some of
virgin rivers diverted or impounded for construction huge scale of hydropower plants and the
most obvious practice where rivers used as industrial or domestic waste discharge points. For
many years the cumulative effects of the practice being felt much to the detriment of the
environment. To prevent further deterioration, efforts for more innovative and integrative
approaches aimed at bringing nature back to rivers have to be formulated and promoted by
respective approval authorities.
To proceed with, an integrated development and management of river identified the
most efficient approach. Since quite number of new development projects was and will take
places nearby to river basin, the construction of river infrastructure to mitigate the
consequences impacts must be address accordingly to the environmental measures. In the
Figure 4, the recommendation was made to elaborate further the idea of how the development
of river basin should be carrying out by identifying elements connected to each element in
Figure 3.
Integrated River Management is the coordinated management of resources in natural
environment based on river basin with the aim to ensure the environmental sustainability. The
concept is geared towards integrating and coordinating professional capability and increased
the capacity and implementing all the key elements. With rapid urbanization and
industrialization, problems and issues related to rivers and the river environment are expected
to intensify. River basins need to be managed in a holistic approach by integrating and
incorporating all the components as illustrated in Figure 4. However, corresponding authorities
and legal changes are needed, coupled with and effective administrative framework.
402
Enforcement - There is invariably lack of resources to carry out

the enforcement. Therefore, there is a need for
comprehensive framework enforcement to deal with the
fragmented sectoral functions of different authorities in rive
matters.
River Maintenance - This include physical cleaning of the river
and providing sewerage treatment works have been
River Basin Authority implemented and will continue to be undertaken to
Fragmented functions of rehabilitate and improve the river water quality. Then the
different established mitigation are also need to be implemented. Since in
planning and implementing such curative measures are costly and time
enforcement authorities consuming, however the public sector would do the best
further with lack of well- practice by involving private sector via several type of
defined jurisdiction has Legal framework
maintenance - Laws generally
and services contractsgovern the use
(e.g. lease rather than
contracts for
become a definite the protectionetc.).
maintenance of the resources. Conflicts and overlaps are
obstacle to sustainable therefore common. There is a need for a more comprehensive
resource development and contemporary river/water law and this process
and management. admittedly is time consuming.
Mitigation measures - It requires regulatory action and hence
Therefore, River Basin
the need to ensure enforcement, when necessary, through
Authority has to be set up
appropriate legal instruments. Preventive measures are cost-
to integrate and co-
effective and offer long term solutions.
ordinate activities within Source of finance - Finance is a critical resource common for
a river basin. Once it was all the elements mentioned above. Service charges are
has since been currently widely used in many countries and are relevant also
established, charged with for adoption in Malaysia. Privatization is not new in Malaysia.
the responsibility to plan It is an option to consider for service provision in the
and regulate land and implementation of both development and recurrent operation
water development and and maintenance programmes. All it need is a program would
activities in an integrated entail both direct and indirect costs and benefits.
manner at the river basin Planningframework - A comprehensive manual which consists
level. In managing of guidelines are required to ensure a balance implementation
individual sectors, the of river development (e.g. river infrastructure). Planning
need to distinguish the guideline (including Master Plans or Zoning Plans) should
regulatory and service function in addition to being proactive and preventive.
provider roles is essential However, also should be appropriate standards set which
for effectiveness and conform
Stakeholderto best practices. - The participatory approach and
involvement
greater efficiency involvement of all stakeholders in the entire project/program
cycle is a key element to ensure success and sustainability in
the long term.
Figure 4: Towards the integrated river infrastructure development
5. CONCLUSIONS
The main concern of river development was to facilitate future development of a river in
a way they can preserve and conserve the river environment naturally. Since the river areas
was one of the most valuable assets in sustaining urban development, the river mitigation
measures formulated should not discourage the development to take place. However it must be
strictly safeguarded by proper controlling and monitoring mechanism by the relevant approval
authorities. Hence, the systematic preservation and restoration of urban rivers environment, the
responsible agency for river management should play main role in establishing the plan for river
environment management. With better planning and urban management, with greater creativity,
innovativeness in environmental aspects of planning, our dream of making our future cities truly
environmentally friendly will one day be realised. There is a need to ensure that the planning
403
input must be considerably undertaken to resolve issues surrounding urban river management.
Urban river system needs to be integrated into the urban system with other relevant river
environment components to avoid potential negative consequences. Design guidelines could be
developed for problematic land use and development activities. Development must be guided
by a coordinated approach associated with catchment-based planning and management,
integrated urban land use planning, infrastructure provision and also last but not least these
components must be furnished with appropriate landscaping plan just to symbioses the natural
feature and the man-made structure.
REFERENCES
Bruton, M. J. (1982). The Malaysian Planning System, in : Third World Planning Review, Vol. 4.
No. 4.
Cals, M.J.R., and Drimmelen, Van (2010). Space for the river in coherence with landscape
planning in the Rhine-Meuse delta. In River Restoration in Europe: Pratical Approaches
Proceeding, Conference on River Restoration, Wageningen, The Netherland 2001.
Clark, G. L., and Evans, J. (1998). The private Provision of Urban Infrastructure : Financial
Intermediation Through Long-Term Contracts, in : Urban Studies, pp. 301-319.
Clarke, G. (1992). Towards appropriate forms of urban spatial planning. In Habitat International.
Vol. 16, pp.146-166.
Dani Salleh (2000). The legislative framework of urban planning and development in Malaysia, a
paper presented at the World Conference of Urban Future 2000 at the University of
Witwatersrand, Johannesburg, South Africa on 10-14 July 2000.
_________ (2002). Strengthening Environmental Management at Local Authority Level :
Structure Plans And Local Plans. A Paper Presented At Southeast Asean Natural
Resources and Environmental Management Conference (SANREM), Sabah. Organised
by Unit of Science and Technology, State Government of Sabah and University
Malaysia Sabah.17-20 October 2002.
_________ (2002). Urban Planning And River Environment Management : Towards Integrated
River Basin Development In Malaysia. A paper presented at The 3rd. International
Conference on Disaster Management : Strengthening The National Security Capabilities,
Kuching : 5-6 May 2002
Dani Salleh and Asan-Ali Golam-Hassan (2001). Urbanisation And Development: The Role Of
Development Planning In Malaysia, A papers presented at The International Planning
Research Conference 2001, Co-Organised by Liverpool University And Liverpool John
Moores University, 2001.
Ennis, F., (1997). Infrastructure provision, the negotiating process and the planner‘s role, in :
Urban Studies, pp. 1935-1954.
Federal Department of Town and Country Planning, (1993). Manual for Development Plans
Preparation, Kuala Lumpur.
Glennie, C. (1982). A Model for the Development of a Self-Help Water Supply Program, World
Bank Technical Paper No. 2, (Technology Advisory Group of the World Bank,
Washington, DC.
Government of Malaysia (1976). Town and Country Planning Acts, Act 172.
404
Guy, S. and Marvin, S., (2014). Infrastructure provision, development process and the co-
production of environment value, in : Urban Studies, pp. 2023-2036.
Municipal Council Penang Island (1985), MPPP Report of Survey.
Ostdahl, T., et al. (2001). Stakeholder attitudes to river modification and restorationa. In River
Restoration in Europe: Pratical Approaches Proceeding, Conference on River
Restoration, Wageningen, The Netherland 2001.
Steinberg, F. (1991). Urban infrastructure development in Indonesia. In Habitat International,
Vol. 15, pp. 3-26.
-GP58-
INOVASI DALAM SEKTOR AWAM
Sabarani bin Ghazali

Pusat Pengajian Kerajaan, Kolej Undang-Undang, Kerajaan dan Pengajian Antarabangsa
sabarani@uum.edu.my
Abstrak
Inovasi merupakan agenda utama dalam mana-mana organisasi untuk berdaya saing
dalam sebarang situasi. Keupayaan berinovasi mmbolehkan organisasi menghasilkan berbagai
produk serta perkhidmatan baru. Dalam sektor awam juga inovasi mampu menghasilkan
perkhidmatan terbaik yang dapat memacu negara menuju negara maju. Sebarang masalah
berkaitan pembangunan negara mampu ditangani melaui dasar-dasar yang inovatif, baik
diperingkat penggubalan, perlaksanaan serta penilaian. Kertas kerja ini membincangkan
bagaimana dengan menggunakan Pendekatan Interaksi Person-Situasi inovasi diwujudkan
dalam sektor awam. Dibincangkan juga langkah-langkah serta cabaran-cabaran yang perlu
ditangani.
Kata kunci: Kreativiti; Inovasi; Pengurusan Sumber Manusia; Sektor Awam
MEMAHAMI INOVASI
Kreativiti merupakan satu istilah positif yang selalu dikaitkan sebagai punca pencapaian
seseorang atau organisasi. Dengan inovasi seseorang atau organisasi mampu berdaya saing
serta memenuhi segala kehendak dan keperluan pelanggan pada tahap tertinggi. Istilah
kreativiti dan inovasi selalu digunakan dalam konteks yang sama. Kreativiti membawa maksud
keupayan untuk menghasilkan idea-idea baru, manakala inovasi membawa maksud keupayaan
untuk menterjemahkan idea-idea baru tersebut ke dalam produk atau perkhidmatan yang baru
atau yang dibuat penyesuaian untuk memenuhi keperluan serta permintaan pasaran. Kreativiti
berlaku di peringkat individu, manakala inovasi berlaku diperingkat organisasi.
Dalam konteks kertas kerja ini, istilah kreativiti dan inovasi boleh digunakan serta saling
melengkapi.
PETUNJUK KEPADA KEWUJUDAN INOVASI
405
Banyak petunjuk yang memberitahu kita tentang kewujudan atau ketiadaan inovasi
dalam mana-mana organisasi kerja. Petunjuk utama ialah prestasi, samada yang dicapai di
peringkat individu mahukan prestasi di peringkat organisasi.
Di peringkat organisasi, prestasi ditunjukkan melalui dua perkara, iaitu;
a. Prestasi kewangan.
b. Prestasi bukan kewangan
Manakala di peringkat individu pula, prestasi dapat dilihat dalam aspek-aspek berikut;
a. Produktiviti dan kualiti kerja individu berkenaan.

b. Kepuasa kerja individu tersebut, dan
c. Dinamiknya sesebuah kumpulan kerja.
Dalam sektor awam, kewujudan inovasi dapat dilihat melalui;
a. Kewujudan dasar-dasar yang inovatif.

b. Perlaksanaan dasar-dasar berinovatif
c. Penilaian dasar yang kreatif.
Kemajuan sesebuah negara banyak bergantung kepada dasar-dasar yang digubal.

Dasar-dasar yang berinovatif datangnya dari pemikiran kreatif anggota sektor awam yang
mampu berfikiur secara kreatif dan inovatif. Dasar-dasar tersebut mampu menjadi halatuju
negara yang sesuai dengan keperluan serta keadaan negara pada sesuatu masa. Dasar-dasar
yang berinovatif memerlukan pelaksanaan yang kreatif dan inovatif juga. Perlaksanaan dasar
berbentuk operasi harian yang dapat dilihat melalui tatacara kerja yang kreatif. Anggota sektor
awam melaksanakan segala dasar melalui pendekatan-pendekatan sedia ada serta
pendekatan-pendekatan baru yang timbul ekoran penikiran kreatif mereka. Sebarang masalah
diselesaikan melalui berbagai percubaan berbagai pendekatan yang memberi impak yang
optimum. Begitu juga setiap keputusan dibuat secara kreatif.
Lantaran itu, secara keseluruhannya, petunjuk inovasi yang paling utama ialah
kemajuan serta kemakmuran yang dinikmati oleh sesebuah negara. Sekali lagi diulangi,
kreativiti dan inovasi perlu menjadi agenda sepanjang hayat kepada organisasi serta individu
pekerja.
PROSES INOVASI
Pendekatan Interaksi Person-Situasi merukana asas kepada proses kreativiti serta

inovasi kerja. Terdapat dua perkara yang mencetuskan inovasi berdasarkan pendekatan ini,
iaitu;
a. Person.
b. Situasi.
Person merupakan insan-insan yang terdapat di dalam organisasi. Insan-insan ini perlu
mempunyai sifat-sifat dalaman diri yang istimewa seperti personaliti, EQ, motivasi, ilmu,
pengetahuan, kemahiran serta potensi. Sifat-sifat ini memang sedia terbentuk bagi sebahagian
406
individu. Bagi sebahagian individu pula sifat-sifat ini perlu dibantu pembentukannya. Dengan
adanya sifat-sufat begini, makan kewujudan serta rangsangan kepada inovasi mudah berlaku.
Manakala situasi pula merujuk kepada keadaan perskitaran kerja yang melingkungi para
pekerja di dalam sesebuah organisasi. Persekitaran tersebut antaranya ialah kepimpinan,
strategi, struktur, teknologi, budaya, rekabentuk kerja, rakan sekerja dan sebagainya lagi.
Perkara-perkara ini memberi kesan secara langsung kepada kemunculan inovasi pekerja.
Banyak kajian menerangkan tentang hubungan positif sertai perkara tersebut dengan motivasi
pekerja sehingga menghasilakn kreativiti serta inovasi.
Sila rujuk Rajah 1 di bawah.
Ciri-ciri Individu
Tingkahlaku
Individu Berinovasi
Ciri-ciri Persekitaran
Rajah 1: Pendakatan Interaksi Person-Situasi.
Pengurusan idea yang baik menjadi asas kepada kreativiti serta inovasi dalam
organisasi. Pekerja perlu dirangsangkan untuk menghasilkan idea-idea dalam berbagai perkara
berkaitan pekerjaan, pelanggan serta organisasi mereka. Idea-idea ini perlu disalurkan secara
sistematik kepada pihak pengurusan untuk dipertimbangkan perlaksanaannya. Sebelum itu
pengurus serta pentadbir perlu menyediakan saluran-saluran penyampaian idea secara lisan
dan bukan lisan.
HALANGAN INOVASI
Pendekatan Interaksi Person-Situasi menjelaskan tentang segala perkara yang berlaku

di dalam dunia ini, termasuklah kewujudan inovasi dalam organisasi. Pendekatan Person
mewakili sifat-sifat yang terdapat di dalam diri sesorang pekerja. Manakala situasi ialah apa
yang terdapat dan berlaku di dalam organisasi. Untuk menghasilan sesuatu yang positif (seperti
inovasi), person perlulah positif dan situasi juga perlulah positif. Pertembungan person dan
situasi ini sekiranya berlaku secara positif akan mencetuskan inovasi. Sebaliknya, sekiranya
hanya salah satu bersifat positif, atau kedua-duanya (person atau situasi) negatif, maka
pertembungan ini tidak akan menghasilkan inovasi samada luaran atau dalaman.
Kedua-dua perkara inilah yang menjadi menghalang atau perangsang kepada

kewujudan inovasi di dalam organisasi. Makan, tindakan-tindakan sewajarnya perlu di ambil.
407
APAKAH TINDAKAN PENGURUS?
Manusia merupakan aktor utama dalam menghasilkan kreativiti dan inovasi. Lantaran itu
sumber manusia di dalam dan di luar organisasi perlu diuruskan melalui paradigm baru.
Pengurus dan pentadbir perlu melihat pekerja melalui dimensi baru yang berbeza dari apa yang
dilihat sekarang dan sebelum ini. Amalan-amalan pengurusan sumber manusia (HRM) juga
perlu berbeza dari dahulu. Manusia perlu dilihat sebagai aset yang bernilai tinggi, bukan lagi
sebagai liabiliti yang memberi masalah kepada sektor awam dan negara.
Di sini, sektor awam memerlukan pengurus dan pentadbir yang mempunya keupayaan
pengurusan yang bersofistikasi tinggi. Apakah yang dimaksudkan dengan keupayaan
pengurusan yang bersofistikasi tinggi atau High Sophisticated Managerial Capabilities? Secara
umumnya, ia bermaksud organisasi-organisasi awam memerlukan pengurus dan pentadbir
yang berkebolehan dan berpengetahuan tinggi serta luar biasa dalam menguruskan organisasi,
aset serta insan di dalamnya bagi mencapai hasil yang optimum. Mereka perlu menguasai
ilmu-ilmu pengurusan secara mendalam. Keupayaan menterjemah segala konsep serta teori
pengurusan dalam pekerjaan menjadi satu kemestian bagi seorang pengurus dan pentadbir
yang bersofistikasi tinggi.
Terdapat dua perkara yang perlu dilakukan oleh pengurus-pengurus dalam membentuk
inovasi dalam kalangan anggota sektor awam.
a. Pendekatan pengurusan.
b. Pendekatan Akademik
Dalam konteks pendekatan pengurusan
a. Para pengurus perlu mempunyai pengetahuan mendalam berkaitan amalan pengurusan

sumber manusia (HRM) yang positif. Amalan HRM tidak hanya terikat kepada
pengambilan pekerja melalui ststem yang canggih, memberi latiah kemahiran berkaitan
pekerjaan pekerja, menilai prestasi, membayar gaji serta upah dan sebagainya.
IPengurus perlu bersifistikasi tinggi dengan memahami serta mempraktiskan amalan-
amalan HRM menjangkaui apa yang dipraktiskan sekarang. Amalan HRM yang
bersofistikasi tinggi mempu mengiktiraf pekerja, mengenalpasti potensi, mengcungkil
potensi dan akhirnya menggunakan potensi tersebut untuk faedah organisasi,
pelanggan, kerajaan serta pekerja itu sendiri.
b. Menyediakan persekitaran emosi yang sesuai bagi merangsang motivasi luaran dan
dalaman yang merupakan asas kepada kreativiti dan inovasi. Semua kajian tentang
kreativiti dan inovasi meletakkan motivasi, terutamanya motivasi dalaman sebagai
pembolehubah utama. Maka itu pengurus dan pentadbir perlu melakukan sesuatu untuk
membangkitkan motivasi dalaman pekerja mereka. Rekebantuk kerja yang kompleks
serta berautonomi antara punca yang mencetuskan kreativiti dan inovasi.
c. Mencungkil segala potensi yang terdapat dalam diri setiap pekerja sektor awam. Prinsip
bahawa setiap manusia mempunyai potensi diri yang mampu menghasilkan sesuatu
yang berbeza serta berguna perlu dipegang kukuh. Segalam amalan-amalan tentang
408
Teori Y perlu dilempar jauh ke belakang. Pengurus perlu mampu mengcari jalan
bagaimana mengoptimumkan segala bakat, kebolehan, kreativiti serta inovasi pekerja
mereka sehingga boleh digunakan untuk membuat keputusan serta menyelesaikan
berbagai masalah.
d. Fator terpenting ialah bagaimana setiap idea dalam bentuk kreativiti dapat
diterjemahkan kepada produk atau perkhidmatan atau tatacara bekerja yang baru yang
menjadikan organisasi lebih produktif. Pengurus dan pentadbir perlu mempunyai
keupayaan tersebut, yang disifatkan sebagai bersofistikasi tinggi.
Manakala dalam konteks akademik, pengurus dan pentadbir perlu manjalankan kajian-
kajian ilmiah berkaitan isu-isu inovasi dalam sektor awam. Masih terlalu kurang penyelidikan
ilmiah dilakukan bagi memahami inovasi di Malaysia dalam pelbagai sudut. Antara perkara-
perkara yang boleh dikaji ialah;
a. Mengkaji pengetahuan, kemahiran dan sikap para pengurus dan pentadbir berkaitan
kebolehan kepengurusanan mereka. Difahami sektor awam mengambil para pengurus
dari berbagai latar belakang akademik, tidak terhad kepeda mereka yang berkelulusan
pengurusan dan pentadbiran. Maka itu para pengurus dan pentadbir menjalankan
operasi pengurusan mereka berdasarkan pertimbangan dan kewajaran tersendiri.
Kebanyakan tindakan serta amalan tidak menepati prinsip-prinsip pengurusan
organisasi dan manusia.
b. Mengkaji aspek psiko-sosial anggota-anggota sektor awam berkaitan sifat-sifat diri serta
persepsi terhadap kreativiti dan inovasi. Kajian-kajian begini perlu untuk lebih
memahami fenomena yang merangsang atau menghalang kewuduan pemikiran serta
sifat inovatif dalam kalangan anggota sektor awam dalam persekitaran budaya timur,
terutamanya budaya Malaysia.
c. Mengkaji aspek-aspek organisasi dan persekitaran yang berhubungkan dengan inovasi

pengurus dan pekerja. Kajian seperti ini diperlukan untuk memahami bagaimakan
system pengurusan yang diamalkan, sumber-sumber organisasi distrukturkan,
dikoordinasikan, bagaimana rekabentuk kerja serta budaya organisasi terbentuk serta
kaitannya dan pengarauhnya terhadap inovasi pekerja. Secara umumnya, kajian ini
boleh memahami hubungan birokasi dengan kreativiti dan inovasi.
Bagi melaksanakan fungsi penyelidikan ilmiah ini para pengurus serta pentadbir perlu
mempunyai kebolehan yang tinggi dalam kaedah penyelidikan. Namun, sekiranya perlu,
kerjasama dengan institusi-institusi akademik boleh dilakukan.
PENUTUP
Kretiviti dan inovasi merupakan keperluan dalam menentukan kemajuan organisasi,

perniagaan dan juga sector awam. Sektor awam yang inovatif mampu mencapai segala misi
serta visi yang termaktub dalam berbagai agensi awam. Ini akan menyelesaikan berbagai
masalah rakyat, meningkatkan kualiti hidup rakyat serta mampu meletakkan Malaysia dalam
kalangan negara-negara maju. Lantaran itu, inovasi perlu menjadi agenda utama setiap rakyat,
409
penjawat awam serta keseluruhan sektor awam. Langkah-lang sistematik perlu diambil untuk
memacu inovasi pada tahap yang tertinggi.
-GP59-
Policy Implementation and Governance: The Missing Link
Zalinah Ahmad
School of Government, Universiti Utara Malaysia
zalinah@uum.edu.my
Abstract
The concept of policy implementation is the administration process which might
involves various actors, organizations, procedures and techniques, and how these
aspects are put together or synchronise to achieve the desired outcome. Policy
implementation can be thought as a process when one focuses on decision and action
that are taken into an affect. The implementation as an output focuses on the support
given by part of the government to achieve the goals of policy and finally,
implementation as an outcome refers to the changes that can be measured within the
programme once the decision is implemented. Therefore, the importance of policy
implementation is undeniable because the policies will not implement themselves. In
other words, the implementation of the policies indicates what really government has
put an effort to overcome the problem. On the other hand, the governance is the
concept that is always being promoted by the government. The government initiates
efforts to incorporate the concept in their daily activities. Therefore, this paper will
explore the models of policy implementation and how the models can be linked to the
concept of good governance in government policies.
Keywords: policy implementation; implementation models; governance;
INTRODUCTION
Public in general usually ask for better services from the provider regardless the
providers are government or private sectors. Since the public choose the government
by voting through fair election, the responsibilities of chosen government to provide
better services to public at large. Changing of the economic and political environment
nowadays has created the scenario for public sector to responds efficiently and
effectively towards their ways of delivering services to public.The policy implementation
is the process of operating the decision that has been made. The implementation
begins after the relevant stakeholders make a decision on the issue or after agreeing on
the policy solution for a given problem. Therefore, the importance of policy
implementation is undeniable because the policies will not implement themselves. This
paper will discuss the models of policy implementation and how the models can be
linked to the concept of good governance in government policies.
CONCEPT OF POLICY IMPLEMENTATION
410
Policy implementation can be described as the following:
―Despite the many obvious differences in our communities, school

desegregation, coastal protection, or any other programmes undertaken
by government, they share one important feature: Knowing the
objectives set for the programme by Congress, the Supreme Court, or
the president usually gives only a general hint of what will actually be
done by the agency responsible for carrying out the programme and
how successful it will be at winning the cooperation and compliance of
persons affected by it. To understand what actually happens after a
programme is enacted or formulated is the subject of policy
implementation: those events and activities that occur after the issuing
of authoritative public policy directives, which include both the effort to
administer and substantive impacts on people and events‖
(Mazmanian& Sabatier, 1989, pp 3-4)
The above quotation states that policy implementation occurs when the decision made
by group of policy-makers is executed by responsible agency and how the agency
manages to get compliance and cooperation from those involve with the policy decision.
Lane (1997) points out that implementation is not merely a simple process of executing
the policy decision; in fact, whether the implementation does or does not achieve the
policy intention should also be considered. In addition, Lane offers formal definition of
implementation which is the function of intention, output and outcome, meaning that
implementation refers to ―bringing about, by means of outputs, of outcomes that are
congruent with the original intention(s)‖ (1997, pp297).
Another view on implementation is offered by Mazmanian and Sabatier (1989, pp xx).

They suggest three perspectives on policy implementation namely, the centre, the
periphery, and the private actors who are the beneficiary or the target groups of the
programmes. These three groups of people have different perspectives on the
implementation process. For instance, the centre will view the implementation process
as the process of obtaining compliance from the periphery in order to implement the
programmes designed to provide service to target group. On the other hand, the
peripheral actors have different views on implementation in which they look the
implementation as providing the response to disruptions within the policy environment
where they operate. Finally, the target group views the implementation of programmes
have changed or improved their lives or not.
Besides the mutual adaptation that exists in implementation, the implementation also is
the learning process which is known as ―learning-to-learn‖ process (Browne
&Wildavsky, 1984: pp 238). There is a double-loop process in which there is one-to-
one correlation between stimulus and a change in behaviour and policy implementation
is a hypothesis-testing which is exploratory in nature (1984, pp254). Other scholars
look at implementation process as having a policy-action relationship. This view
proposed by Barrett and Fudge (1981) who look at the implementation from three
411
different understandings. The first understanding is putting policy into effect which is
basically dependent on knowing what to do; the availability of required resources; ability
to control resources to achieve the end; and communication with others involved. The
second understanding is implementation as a negotiating process which requires
compliance and consensus in policy implementation. This process will involve
negotiation, bargaining, and compromise as well as persuasion and power games. The
second understanding emphasises the interaction between policy-makers and
implementers which includes the process of bargaining, and compromise. Therefore,
the implementation process can be considered as policy and action continuum where
the negotiation and interactive process exists over time (Barret & Fudge, 1981: pp20-
25). The third understanding is looking at implementation as action and response. This
understanding looks at groups of actors involved, the agency they operate and factors
that might influence their behaviour (Barret & Fudge, 1981: pp26).
MODELS OF POLICY IMPLEMENTATION
The top-down model emphasises the importance of clear hierarchy of roles and
responsibilities between policy formulators and policy implementers. The policy is
designed in such a way that has very clear goals and strategies to be implemented by
the administrators. The study by Pressman and Wildavsky (1984) on federal
programme of economic development in Oakland, California, serves as a pioneer in the
implementation studies. Their study is concerned with the successful implementation
that depends on the linkages between different organisations and departments at the
local level. This model looks at the policy makers who have a capacity to control and
make those implementers comply with their intentions in designing the policy at the first
place. Discussion provided by Hogwood and Gunn (1984) also looks at the policy
failure as a problem and distinguish between the non-implementation and unsuccessful
implementation. They highlight that the reasons for policy failure are mainly two which
are bad execution, bad policy or bad luck, while another reason is bad policy that has
been less emphasised. The bad policy execution shows that the policy is ineffectively
implemented by implementing agencies and bad luck might mean the policy is not
delivered due to external factors that may influence the implementation process. In
addition, they suggest that perfect implementation is not doable or unattainable unless
the following ten preconditions have been satisfied. The preconditions as cited by
Hogwood and Gunn (1984, pp199-206) are
i. there is no external constraints that may challenge the
implementing agencies to execute the decision
ii. there is adequate time and sufficient resources to
implementing agencies that will run the programme
iii. required combination of resources for each stage in
implementation process will actually be available at
disposal
iv. there should be a valid theory on cause and effect about
the policy that is being implemented in which there should
be predicted consequences based on the initial cause
412
v. the cause and effect relationship is direct with fewer

intervening links that may influence the implementation
process
vi. there will be fewer number of agencies involve and this
might contribute to the minimum dependency relationship
vii. there should be complete understanding and agreement
on the objectives of the policy throughout the whole
implementation process
viii. there should have specific sequences and complete
details on how to achieve the desired policy goal in
designing the tasks to implement the policy
ix. there is perfect communication and coordination among
the various agencies involve in the implementation
process, and finally,
x. the authority can demand and obtain perfect compliance
in which there is no resistance to any command within the
administrative system
Sabatier and Mazmanian (taken from Sabatier, 1986, pp23-25) have identified six
conditions that are necessary in order to get effective implementation which are
i. having clear and consistent objectives that have been
considered as providing a standard of evaluation and
important legal resources to implementing officials
ii. having adequate causal theory in which the policy
intervention is aiming at accomplishing social change and
this provide the adequacy jurisdiction to implementing
officials as means to ascertain causal assumption
iii. implementation process is structured to enhance
compliance by implementing officials and target groups
and this indicate the number of veto points, the sanctions
and the incentives that can be used to overcome any
resistance, creating special agencies that will be
supportive to the implemented programmes
iv. having committed and skilful officials since they will
commit to the policy objectives and utilize their skills to
fully use the resources at their disposal. Yet, they have to
use some discretion in their daily implementing activities
as well.
v. getting support from the interest groups and sovereigns
toward policy that involves the long implementation
process. The political support is necessary to get better
results, and, finally
vi. changes in socio-economic conditions will not deteriorate
the political support even though these conditions might
reflect the whole implementation process.
413
The bottom-up model focuses on individuals and organisations at the implementation

stage. The model suggests that the implementing actors have an influence on the
programmes that have been designed by policy makers. Therefore, staff at the
periphery level may distort or interpret differently the initial intention of the policy
makers. The introduction of the concept of street-level bureaucrats proposed by Lipsky
(1980) highlights the importance of these actors at the periphery level. As cited by
Lipsky (1980) ―the decisions of street-level bureaucrats, the routines they establish, and
the devices they invent to cope with uncertainties and work pressures, effectively
become the public policies they carry out‖ (pp xii).
Another scholar focuses on bottom-up model are Hjern and Porter (1997). They
suggest ―administrative theory with ‗implementation structures‘ as the core unit of
analysis to fill [the] gap‖ (cited in Hill, 1997, pp226). The implementation structure
refers to as a ―subsets of members within organisations which view a programme as
their primary (or an instrumentally important) interest‖ (cited in Hill, 1997, pp230). They
argue that the structures should be less formal and have fewer authoritative relations;
the social structures within the cluster of organisations should be more dynamic and
shifting since there is no legally defined entity which represents their building or
corporate charter; and, the decision of the cluster of organisations to participate in the
programme should be based on consent and negotiation. The programmes‘ success is
highly dependent on the skills of specific individuals in local implementation structures
rather than looking upon the efforts of governmental officials at the central level.
Another study is done by Barrett and Fudge that stress the importance of policy-action
relationship. This relationship, as they proposed, is not a simple as it is, like
transmitting from one stage to another. However, the relationship is more complex,
involves many different priorities and interests of who involve in the process. The
process is more ―interactive and recursive‖ (1981, pp 251). The interaction between
actors which involve negotiation and examination of organisations, and administrative
linkages in implementation process are important focus in the study of policy-action
relationship. In fact, the policy is dynamic in such a way that ―it is mediated by actors
who may be operating with different assumptive worlds from those formulating the
policy, and, inevitably, it undergoes interpretation and modification and, in some cases,
subversion‖ (Barret & Fudge, 1981: pp251).
The third model, synthesis models (top-down/bottom-up), is trying to combine the useful
features of both top-down and bottom-up models. The study done by Elmore (1979)
has combined the approach of what he refers to as backward mapping and forward
mapping. According to Elmore (1979), the policy-makers need to consider both the
policy instruments and other resources at their disposal (forward mapping) and the
incentive structure of ultimate target groups (backward mapping) because the outcomes
of the programmes really emphasises or dependent on the ability to interlock these two
elements which are policy instruments and target group. According to him, forward
mapping is
414
The strategy that comes most readily to mind when one thinks about
how a policymaker might try to affect the implementation process.It begins at
the top process, with as clear a statement as possible of the policymaker‟s
intent, and proceeds through a sequence of increasingly more specific steps
to define what is expected of implementers at each level. At the bottom
process, one states, again with as much precision as possible, what a
satisfactory outcome would be, measured in terms of the original statement of
intent (Elmore, 1979, pp602).
Contrast to forward mapping, since he used the mixed methods, backward mapping
begins the process at the lowest level of implementation. This method assumes that
―the closer one is to the sources of problem, the greater is one‘s ability to influence it;
and the problem-solving ability of complex systems depends not on hierarchical control
but on maximizing discretion at the point where the problem is most immediate‖
(Elmore, 1979, p605).
While Elmore looks at the interaction between policy-makers and policy implementers,
Goggin et al‘s communication model of intergovernmental policy implementation also
combines the top-down and bottom-up models as well. This model is based on the
assumption that organisational management issues are the primary implementation
problem. The model conceptualises the ―intergovernmental policy making as an
implementation subsystem which full of messages, messengers, channels, and targets
are operating within a broader communications system‖ (Cline, 2000, pp554). This
model looks at the state-level implementation as a product of inducement and
constraints from national, state and local levels.
CONCEPT OF GOVERNANCE
The governance, as viewed by Abdul Halim Ali (2000), comprises of the ―mechanisms,
processes and institutions through which citizens and groups articulate their interests,
exercise their; legal rights, meet their obligations, and mediate their differences (pp4).
There involves not only government sectors, but also includes other sectors such as
private and citizens. In addition, he added that governance is defined as policy
formulation and implementation through synergistic participation of private and third
sector (pp4). According to the United Nation Economic and Social Commission for Asia
and the Pacific (ESCAP), the concept of governance is ―as old as human civilisation,‖
indicating that ―[it is] the process of decision making and the process by which the
decisions are implemented or not implemented.‖(UNESCAP, pp1). If we look at both
given definition, the governance involves process of decision-making and the process of
how the decision is being materialised. The involvement of many policy actors, either
formal or informal, also is a part of governance. We tend to relate governance with good
governance. Good governance is the ‗process of policy formulation and implementation
through consensus building among the various concerned sectors with the aim of
improving the overall quality of life of all citizens‖ (Abdul Halim Ali, p 4).
415
Taken from UNESCAP, good governance has 8 major characteristics which are
1. participatory,
2. consensus oriented,
3. accountable,
4. transparent,
5. responsive,
6. effective and efficient,
7. equitable and inclusive, and
8. follow the rule of law.
The following figure simplifies the characteristics of good governance.
Figure 1 Characteristics of good governance
Source: copied from

http://www.unescap.org/pdd/prs/ProjectActivities/Ongoing/gg/governance.pdf.
DISCUSSION
All models do have positive and negative contributions towards policy implementation. Even
though the models have been practiced for many years, they are still relevant in the current
context. The models also relate to the concept of governance. By taking example on Malaysia,
elements of participation, consensus oriented, and equity and inclusiveness can be drawn from
the initiatives taken by government in policy implementation objective of the programme that
needs to be achieved. Based on the explanation from UNESCAP, the following is the
interpretation of these three elements.
i. Participation: the participation is from men and women; it could be either direct or through
legitimate intermediate institutions or representatives; it needs to be informed and
organised. This means freedom of association and expression on the one hand and an
organised civil society on the other hand.
ii. Consensus oriented: Many actors involve and give viewpoints in a given society; there is
a mediation of the different interests in society to reach a broad consensus in society on
what is in the best interest of the whole community and how this can be achieved.
416
iii. Equity and inclusiveness: the members of society feel that they contribute to the nation
and not feel excluded from the mainstream of society. This requires all groups, but
particularly the most vulnerable, have opportunities to improve or maintain their wellbeing.
Bottom-up model seems to apply the governance concept since the involvement of society in
making the decision. Even though in theory, the models apply towards implementing agent,
current scenario encourages the society as a whole to be a part of implementation process.
CONCLUSION
This paper summarises the models of policy implementation and each model has its strength
and weaknesses that can be drawn from the analysis done by the scholars. The models also
link towards the concept of governance even though bottom-up and synthesis models do have
clear linkages. Therefore, the initiatives of government to promote governance in their
implementation process are highly needed for the development of the nation
REFERENCES
Barrett, Susan & Fudge, Collin. (1981). Examining the policy-action relationship. In Barrett,
Susan & Fudge, Collin (Eds.), Policy and Action: Essays on the Implementation of Public Policy
(pp3-32). London: Methuen.
Hjern, Benny & Porter, David O. (1997). Implementation structures: a new unit of administrative
analysis. In Hill, Michael (Ed.), The Policy Process: A Reader. (pp 226-240). London : Prentice
Hall/Harvester Wheatsheaf.
Hogwood, Brian W & Gunn, Lewis A. (1984).Policy Analysis for the Real World. Oxford: Oxford
University Press.
Lane, Jan-Erik.(1997). Implementation, accountability and trust.In Hill, Michael (Ed.), The Policy
Process: A Reader. (pp 296-313). London :Prentice Hall/Harvester Wheatsheaf.
Lipsky, Michael. (1980). Street-level Bureaucracy: Dilemmas of the Individual in Public Services.
New York: Russel Sage Foundation.
Majone, Giandomenico&Wildavsky, Aaron. (1984). Implementation as evolution. In Pressman,

Jeffrey L and Wildavsky, Aaron. Implementation (pp163-180). Berkeley: University of California
Press.
Mazmanian, Daniel A & Sabatier, Paul A. (1989).Implementation and Public Policy. Lanham:
University Press of America.
Ryan, N. (1996). A comparison of three approaches to programme implementation.International

Journal of Public Sector Management, 9(4), 34-41.
Sabatier, Paul A. (1986). Top-down and bottom-up approaches to implementation research: a

critical analysis and suggested synthesis. Journal of Public Policy, 6(1), 21-48.
Abdul Halim Ali (2000). Leadership and good governance.In Samsudin Osman,
ZulkarnainAwang, and Sarojini Naidu (Eds).Good Governance: Issues and Challenges. Kuala
Lumpur: National Institute of Public Administration (INTAN).
417
Barrett, Susan & Fudge, Collin. (1981). Examining the policy-action relationship. In Barrett,
Susan & Fudge, Collin (Ed.), Policy and Action: Essays on the Implementation of Public Policy.
London: Methuen.
Barrett, Susan. (2004). Implementation studies: time for a revival? Personal reflections on 20
years of implementation studies.Public Administration, 82(2), pp 249-262.
Browne, Angela &Wildavsky, Aaron.(1984). Implementation as mutual adaptation. In Pressman,

Jeffrey L and Wildavsky, Aaron. Implementation. Berkeley: University of California Press.
Browne, Angela &Wildavsky, Aaron.(1984). Implementation as exploration. In Pressman, Jeffrey

L and Wildavsky, Aaron. Implementation.Berkeley: University of California Press.
deLeon, Peter &deLeon, Linda. (2002). What ever happened to policy implementation? an
alternative approach. Journal of Public Administration Research and Theory,12(4), 467-492.
Elmore, Richard F. (1979). Backward mapping: implementation research and policy decisions.
Political Science Quarterly, 94(4), 601-616.
Elmore, Richard F. (1985). Forward and backward mapping: reversible logic in the analysis of
public policy. In Hanf, Kenneth &Toonen, Theo A.J (Ed). Policy Implementation in Federal and
Unitary Systems (pp33-70). Dordrecht: MartinusNijhoff Publishers.
Exworthy, Mark, Berney, Lee & Powell, Martin. (2002). ‗How great expectations in Westminster
may be dashed locally‘: the local implementation of national policy on health inequalities. Policy
& Politics, 30(1), 79-96.
Exworthy, Mark & Powell, Martin. (2004). Big windows and little windows: implementation in
the‘congested state.‘ Public Administration, 82(2), 263-281.
Hjern, Benny & Porter, David O. (1997). Implementation structures: A new unit of administrative
analysis. In Hill, Michael (Ed.), The Policy Process: A Reader. (pp 226-240). London : Prentice
Hall/Harvester Wheatsheaf.
Hill, Michael. (2002). ImplementingPublic Policy: Governance in Theory and in Practice.

London: Sage Publications.
Hill, Michael &Hupe, Peter (2003). The multi-layer problem in implementation research.Public
Management Review, 5(4), 472-490.
Hill, Heather C. (2003). Understanding implementation: street-level bureaucrats‘ resources for

reform. Journal of Public Administration Research and Theory, 13(3), 265-282.
Lipsky, Michael (1997). Street level bureaucracy: An introduction. In Hill, Michael (Ed.), The
Policy Process: A Reader. (pp 389-392). London : Prentice Hall/Harvester Wheatsheaf.
Lane, Jan-Erik.(1997). Implementation, accountability and trust.In Hill, Michael (Ed.), The Policy
Process: A Reader. (pp 296-313). London :Prentice Hall/Harvester Wheatsheaf.
418
Llyod, Jane E, Wise, Marilyn J & Weeramanthri, Tarun. (2008). Changing shape: Workforce and
the implementation of Aboriginal health policy. Australian Health Review, 32(1), 174-185.
Majone, Giandomenico & Wildavsky, Aaron. (1984). Implementation as evolution. In Pressman,

Jeffrey L and Wildavsky, Aaron. Implementation. Berkeley: University of California Press.
Matland, Richard E. (1995). Synthesizing the implementation literature: the ambiguity-conflict

model of policy implementation.Journal of Public Administration Research and Theory, 5(2),
145-174.
Maynard-Moody, Steven, Musheno, Michael & Palumbo, Dennis. (1990). Street-wise social
policy: resolving the dilemma of street-level influence and successful implementation. The
Western Political Quarterly, 43(4), 833-848.
Mazmanian, Daniel A & Sabatier, Paul A. (1989).Implementation and Public Policy. Lanham:
University Press of America.
Palumbo, Dennis J & Harder, Marvin A.(Eds).(1981). Implementing Public Policy. Lexington:
LexingtonBooks.
Sabatier, Paul A. (1986). Top-down and bottom-up approaches to implementation research: A

critical analysis and suggested synthesis. Journal of Public Policy, 6(1), 21-48.
Schofield, Jill. (2001). Time for a revival? Public policy implementation: A review of the literature
and an agenda for future research. International Journal of Management Reviews, 3(3), 245-
263.
Schofield, Jill. (2004). Model of learned implementation.Public Administration, 82(2), 283-308.
UNESCAP (2012). What is good governance. Retrieved on 20 April 2012, from

http://www.unescap.org/pdd/prs/ProjectActivities/Ongoing/gg/governance.pdf
-GP60-
Kepuasan Penghuni Terhadap Kualiti Perumahan Penjawat Awam 1Malaysia
(PPA1M): Kajian Kes Wilayah Persekutuan Putrajaya
Faizal Md Hanafiah1, Nur Athirah Abdullah Tahir2, Mohamad Ghozali Hassan3,

Nor Azura A. Rahman4. Mohd Azril Ismail5..
1.2 4
Pusat Pengajian Kerajaan, Pusat Pengajian Antarabangsa.
Kolej Undang-Undang, Kerajaan dan Pengajian Antarabangsa. Universiti Utara Malaysia.
3, 5
Pusat Pengajian Pengurusan Teknologi dan Logistik.
Kolej Perniagaan, Universiti Utara Malaysia, 06010 UUM Sintok Kedah, Malaysia.
1 2 3
hfaizal@uum.edu.my , naat9296@gmail.com , ghozali@uum.edu.my ,
4 5
nrazura@uum.edu.my , azril@uum.edu.my .
Abstrak
419
Perumahan merupakan agenda utama bagi sesebuah negara. Hal ini demikian kerana
perumahan merupakan struktur fizikal yang member perlindungan kepada penghuninya dan
merupakan keperluan asas dalam kehidupan manusia. Oleh itu, banyak projek perumahan di
bawah program perumahan mampu milik telah disediakan oleh kerajaan Malaysia. Namun
kajian ini sangat terbatas kepada satu jenis program perumahan mampu milik sahaja iaitu
program Perumahan Penjawat Awam 1Malaysia (PPA1M). Kajian bertujuan untuk melihat tahap
kepuasan penghuni terhadap kualiti PPA1M Larai, Putrajaya. Oleh yang demikian, kajian ini
berhasrat untuk mengenal pasti tahap kepuasan penghuni terhadap kualiti ciri-ciri fizikal
perumahan, kualiti ciri-ciri persekitaran perumahan dan kualiti kemudahan fasiliti permahanan di
kawasan kajian. Kajian ini menggunakan kaedah kuantitaif. Sampel kajian melibatkan penghuni
PPA1M Larai, Putrajaya. Sejumlah313 orang respondenterlibat dalam kajian ini.Hasil daripada
kajian ini dapat memberi pandangan kepada bakal-bakal penyelidik baru dan penjawat awam
yang berminat untuk memiliki PPA1M.
Kata kunci:Kepuasan, penghuni, kualiti, Perumahan Penjawat Awam 1Malaysia
1.0 Pengenalan
Perumahan merupakan salah satu agenda utama setiap negara di dunia kerana
perumahan merupakan struktur fizikal yang bertujuan memberi perlindungan kepada
penghuninya. Kerajaan Malaysia mengiktiraf perumahan sebagai keperluan asas untuk setiap
rakyat (Tze San Ong, 2013). Menurut Haryati Shafii (2012), keperluan perumahan yang selesa
merupakan aspek penting untuk menjamin kualiti hidup penghuni. Selaras dengan usaha itu,
kerajaan komited dalam menyediakan perumahan mampu milik yang berkualiti dan mencukupi
mengikut keperluan golongan tertentu (Zainol Ariffin, 2011).Wan Rafyah Wan Muhd Zin (2006),
menyatakan matlamat pelaksanaan program perumahan mampu milikbertujuan membantu
rakyat Malaysia yang kurang berkemampuan untuk memiliki rumah sendiri. Perkara ini
dizahirkan dalam Rancangan Malaysia Kesepuluh (RMKe-10), kerajaan ingin memastikan
akses kepada pembangunan perumahan mampu milik berkualiti tinggi dan mesra alam sekitar
yang mampan untuk rakyat. Perumahan ini akan dibina dengan mengambil kira aspek
penawaran dan permintan daripada rakyat (Unit Perancang Ekonomi, 2011).
Umumnya, telah banyak pembinaan perumahan yang berkonsepkan mampu milik dan
berkualiti tinggi dilaksanakan di seluruh dunia. Sebagai contoh, Dr. Sukhdave Singh selaku
Gabenor Bank Negara menyifatkan rumah mampu milik di Singapura dan Korea Selatan antara
yang terbaik untuk dihuni oleh golongan yang berpendapatan rendah dan sederhana
rendah(Mstar, 2016). Manakala, di Malaysia perumahan ini sangat dititikberatkan dalam agenda
pembangunan negara. Laporan Tahunan 2015 yang dikeluarkan oleh Bank Negara Malaysia
menganggarkan sebanyak 202,571 buah rumah mampu milik perludi bina setiap tahun bermula
tahun 2016 sehingga tahun 2020 (Astro Awani, 2016).Salah satu projek perumahan di bawah
program perumahan mampu milik ialah projek Perumahan Penjawat Awam 1Malaysia
(PPA1M). Peruntukan projek PPA1M yang diperkenalkan ini menampakkan keprihatinan
kerajaan dalam membantu penjawat awam yang berpendapatan rendah dan sederhana untuk
memiliki rumah sendiri. Misalnya, kerajaan telah menetapkan sejumlah 100,000 unit PPA1M
akan dibina menjelang akhir tahun 2018 (Bernama, 2016).
Namun, setiap projek pembinaan perumahan di bawah program pembangunan mampu

milik seringkali dikaitkan dengan kualiti yang kurang baik. Peribahasa melayu ada menyebut
―Rumah siap, pahat berbunyi‖ menggambarkan ketidakpuasan hati dalam kalangan penghuni
terhadap kualiti perumahan yang dibeli. Kualiti perumahan adalah masalah yang kerap berlaku
dan sering kali dipersoalkan oleh penghuni perumahan. Aspek fizikal, persekitaran dan fasiliti
420
perumahan menjadi indikator pengukur terhadap kualiti sesebuah projek perumahan. Beberapa
masa lalu, isu terhadap kualiti perumahan telah diberi perhatian meluas oleh negara-negara di
dunia. Misalnya, kajian yang telah dilakukan dibeberapa buah negara seperti di United Kingdom
yang dijalankan oleh Sommerville dan McCosh (2006), di Turki oleh Kazaz dan Birgonul (2005),
dan di Hong Kong oleh Tam et al (2000), mengkaji tentang kualiti perumahan yang dibina dari
sudut kerosokkan dan kecacatan perumahan meliputi aspek fizikal dan fasiliti perumahan.
Di Malaysia, pelbagai inisiatif dilakukan bagi mengatasi permasalahan ini seperti

menerapkan polisi kualiti dalam pembangunan perumahan dan mewujudkan penggunan sistem
pengurusan kualiti pada setiap projek pembinaan perumahan (Noraini Hamzah, 2014).
Disamping itu, Lembaga Pembangunan Industri Pembinaan Malaysia (CIDB) telah mewujudkan
CIDB‘s D.I.Y. (Do It Yourself), Skema 1SO 9001 dan QLASSIC (Quality Assessment System in
Contruction) yang bertujuan untuk menyokong produk pembinaan perumahan yang berkualiti
(Azman Abdul Jamal, 2017; Nadia Hamid & Nora Mahpar, 2017). Inisiatif tersebut
diimplimentasikan dengan harapan kualiti rumah yang dibina dapat ditingkatkan.Ukuran tahap
kepuasan penghuni membabitkan isu perumahan adalah sangat penting dalam menentukan
keselesaan penghuni terhadap rumah yang dibeli. Kepuasan penghuni terhadap kualiti
perumahan merupakan refleksi daripada pembinaan perumahan tersebut. Oleh itu, adalah
wajar bagi penghuni bersuara sama ada perumahan yang dihuni berkualiti atau sebaliknya
kerana permasalahan ini akan mempengaruhi kualiti hidup mereka.
2.0 Penyataan Masalah
Di Malaysia perkembangan pembangunan industri perumahan yang berlaku sejak awal

tahun 1970-an telah menjadikan sektor perumahan bergerak progresif dan cukup mengesankan
selari dengan pembangunan ekonomi negara. Namun, apabila pembangunan perumahan yang
berlaku hanya mementingkan kuantiti semata-mata tanpa memikirkan kualiti sedikit sebanyak
menjejaskan industri perumahan negara. Malah, menimbulkan rasa ketidakpuasan hati dalam
kalangan penghuni perumahan terbabit. Pembangunan perumahan yang dihasilkan dengan
mengabaikan kualiti dalam pembinaan akan memberi kesan kepada hasilnya apabila
perumahan siap dibina. Walaupun perjanjian jual beli diselitkan dengan tempoh liabiliti selama
24 bulan selepas Penyerahan Pemilikan Kosong untuk penghuni atau pembeli membuat aduan
berkenaan dengan isu kecacatan, namun perkara ini masih tidak dapat menjamin akan tidak
berlakunya masalah dalam tempoh terebut (Hafiz Ithnin, 2016).
Menurut Salleh (2011), terdapat banyak kecacatan dalam projek perumahan dibawah
program perumahan mampu milik yang dibina oleh pemaju perumahan (Nurbaity Aqmar
Mahamud, 2011). Justeru, hal ini menimbulkan persepsi kurang baik dalam kalangan penghuni
terhadap pemaju dalam aspek perkhidmatan yang diberikan. Tambahan pula, jika dilihat
daripada senario semasa perkara ini berlaku disebabkan oleh pertumbuhan pembangunan
yang pesat terhadap industri perumahan negara.Isu kecacatan perumahan dibawah projek
perumahan mampu milik semakin membimbangkan saban tahun. Menurut Mohd Yusof Abd
Rahman selaku Timbalan Presiden Gabungan Pengguna Malaysia (FOMCA) menyatakan pada
tahun 2014 statistik kecacatan perumahan semasa dalam tempoh liabiliti sebanyak 340 aduan
dan kejadian ini meningkat sebanyak 1,729 aduan pada tahun seterusnya. Tambah beliau,
FOMCA juga menerima aduan berkaitan ketidakpuasan hati penghuni terhadap pelbagai isu
perumahan pada tahun 2014 sebanyak 680 aduan dan meningkat sebanyak 2,034 aduan pada
tahun seterusnya (Hafiz Ithnin, 2016). Perkara ini menampakkan isu kecacatan perumahan di
bawah projek perumahan mampu milik sering terjadi dan semakin membimbangkan.
Seterusnya, Yang Berhormat Zuraida Kamaruddin selaku Menteri Perumahan dan Kerajaan
Tempatan menyatakan pihak beliau banyak menerima aduan daripada penghuni, berkenaan
421
dengan isu projek PPA1M yang mengalami masalah kebocoran, keretakan dan kualiti
perumahan yang tidak mengikut spesifikasi (Nik Hafizul Baharuddin, 2018). Malah, terdapat
juga aduan berkenaan dengan kualiti pemasangan pintu rumah yang tidak betul serta struktur
dinding rumah yang yang dibina kurang baik (Shafiq Azni, 2018). Disamping itu, Pihak Tribunal
Tuntutan Pembeli Perumahan menyatakan masalah paling tinggi selepas projek perumahan
siap dibina sepenuhnya akan terdapat masalah kebocoran, keretakan, pendawaian eletrik yang
tidak selamat dan simen yang pecah (Berita Harian, 2010).Masalah kualiti perumahan dalam
aspek fizikal sering kali dipersoalkan oleh penghuni perumahan. Menurut Mohamed Hussain
(2013), kualiti dalam aspek pembinaan fizikal perumahan merupakan permasalahan yang selalu
dialami oleh penghuni iaitu melibatkan mutu bahan binaan, bumbung, dinding, dan siling yang
kurang berkualiti. Malah, beliau juga menyatakan perumahan yang dibina tidak menepati
spesifikasi pembinaan, persekitaran perumahan yang kurang baik serta keperluan untuk Orang
Kelainan Upaya (OKU) diabaikan (Nurul Atiqah Mohd Sofberi, 2016). Menurut Nurizan Yahaya
dan Ahmad Hariza Hashim (2001), keluasan rumah seharusnya bersesuaian dengan bilangan
anggota keluarga untuk membekalkan ruang yang mencukupi kepada setiap ahli isi rumah. Di
samping itu, Husna dan Nurijan (1987) dalam kajiannya menyatakan bahawa sebanyak 41
peratus daripada responden tidak berpuas hati dengan ciri-ciri dalam unit kediaman dan 82
peratus perlukan bilik mandi yang berasingan daripada tandas (Mohammad Abdul Mohit,
Mansor Ibrahim, & Yong Razidah Rashid, 2010).
Selain itu, isu suhu yang tinggi dalam bangunan perumahan disebabkan oleh
sesetengah pihak yang mengabaikan kualiti pembinaan dari aspek fizikal dan persekitaran
rumah berdasarkan dengan kesesuaian iklim. Pembinaan perumahan yang dilakukan tanpa
mengambil kira isu pencahayaan dan pengudaraan dalaman rumah dengan ciri-ciri iklim
tempatan menyebabkan penghuni tidak selesa tinggal di dalam rumah. Menurut Haryati Shafii
(2012), keselesaan manusia dengan keadaan persekitaran mempengaruhi keadaan psikologi,
sosiologi dan fizikal seseorang. Lembaga Pembangunan Industri Pembinaan Malaysia (CIDB)
mengeluarkan kenyataan bahawa kualiti perumahan mampu milik di Malaysia masih tidak capai
piawaian dalam pembinaannya (Berita Harian, 2014).Seterusnya, isu berkenaan dengan
pengurusan kemudahan fasiliti yang disediakan kurang baik. Contohnya, masalah kerosakkan
lif sering kali berlaku, kebocoran dewan serbaguna setiap kali hujan dan masalah tempat letak
kereta yang tidak menepati kriteria (Amirul Aiman Anuar, 2017). Malahan, kemudahan lif yang
disediakan kerap kali tergendala penggunaannya serta keterukkan servis yang disediakan
untuk membaiki kerosakkan turut berlaku ke atas perumahan ini. Oleh itu, perkara ini
mengundang rasa tidak berpuas hati dalam kalangan penghuni terhadap kualiti perkhidmatan
yang disediakan. Selain itu, isu persekitaran kawasan perumahan juga turut menjadi
permasalahan yang perlu ditanggung oleh penghuni seperti isu pengurusan sampah,
pembentungan dan kebersihan. Menurut Amirul Aiman Anuar (2017), pengurusan pembuangan
sampah yang tidak sistematik menyebabkan berlakunya lambakan sisa buangan sampah
disekitar rumah penyimpanan sampah kerana pihak pengurusan menutup tempat tersebut,
seterusnya membawa kepada isu bau busuk yang tidak menyenangkan serta mengundang
kehadiran haiwan-haiwan liar sedangkan wang pengurusan penyelenggaraan untuk urusan
terbabit dibayar setiap bulan oleh penghuni perumahan. Kawasan perumahan dengan timbunan
sampah akan mencipta bau yang kurang menyenangkan, seterusnya mengakibatkan penghuni
perumahan mempersoalkan tahap kebersihan di kawasan persekitaran perumahan.
Selain itu, isu keselamatan persekitaran perumahan juga turut dipersoalkan oleh
penghuni. Contohnya, isu perumahan bergegar disebabkan oleh perumahan yang dihuni dekat
dengan kawasan pembinaan dan perkara ini mengancam keselamatan serta menganggu
ketenteraman penghuni. Akibat daripada pembinaan berdekatan dengan perumahan mereka
menyebabkan berlakunya keretakan pada dinding rumah, kebisingan akibat peletupan batu
422
sekitar tapak pembinaan dan menyebabkan penghuni merasa bimbang akan mendatangkan
kecederaan pada mereka dan ahli keluarga malah boleh mengamcam nyawa (Ainul Fatihah
Mansor, 2014). Kementerian Perumahan dan Kerajaan Tempatan (KPKT) meyatakan terdapat
empat kriteria berkaitan dengan piawaian konsep perumahan iaitu menjamin keselamatan
penghuni dan harta benda dalam rumah, menyediakan kemudahan fasiliti, kesihatan fizikal dan
mental serta kesihatan masyarakat (Mustaqim Yusof, 2012).
Daripada beberapa isu dan masalah yang dikemukakan, jelas menunjukkan bahawa
walaupun pelbagai aspek fizikal, persekitran dan fasiliti perumahan yang ditawarkan dan dapat
memenuhi kehendak permintaan dari segi kuantiti, pada hakikatnya perkara ini masih belum
mencapai kehendak dan tahap kepuasan yang diharapkan oleh penghuni akibat daripada
kurangnya penekanan terhadap elemen kualiti. Tanpa pertimbangan yang berat dalam ketiga-
tiga aspek diatas, akan menyukarkan pencapaian tahap kepuasan penghuni perumahan.
Perkara ini memberi kesan negatif dari sudut perasaan, tingkahlaku penghuni dan
ketidakpuasan kehidupan berkeluarga. Menurut Mohammad Abdul Mohit, Mansor Ibrahim, dan
Yong Razidah Rashid (2010) ketidakpuasan ke atas rumah yang diduduki memberi kesan
terhadap aspek psikologi sosial penghuni.
2.0 Metodologi
Pendekatan secara kuantitatif digunakan bagi mendapatkan data atau maklumat

daripada responden. Pendekatan kajian secara kuantitatif adalah berasaskan kepada maklumat
daripada kaji selidik ke atas responden mengenai tahap kepuasan penghuni dalam melihat
kualiti PPA1M Larai, Putrajaya. Menurut Abd Rahim Md Nor(2009), Kothari (2004) serta
Sekaran (2003) kaedah kuantitatif merupakan suatu pendekatan yang berorientasikan data
daripada persampelan populasi kajian yang dilakukan bertujuan menjimatkan masa dan kos.
Walau bagaimanapun, hasil yang diperolehi masih menggambarkan keadaan ciri-ciri populasi
sebenar kajian. Oleh itu, bagi tujuan analisis secara statistik, sifat data wajib bertaburan normal
melalui ujian satatistik seperti mana ujian yang biasa digunakan adalah Kolmogorov-Smirno (K-
S) dan Shapiro Wilks (SW).
Selain itu, kaedah kajian secara kuantitatif sangat mementingkan penggunaan angka
kerana ujian statistik dari segi falsafahnya adalah berdasarkan nombor yang memberikan
maksud tertentu (Kathy & Gareth, 2000). Kaedah ini kerap digunakan oleh golongan positivis
yang menekankan aspek kajian secara empirikal serta objektif. Maksud daripada nombor yang
terhasil daripada analisis pula perlu ditafsir dengan menggunakan hipotesis (andaian). Hasil
kajian menggunakan teknik kuantitatif ini mampu membuat generalisasi terhadap tahap
kepuasan penghuni PPA1M dalam melihat kualiti perumahan tersebut.
Di samping itu, bahagian ini juga membincangkan perkara berkenaan persampelan

bagi kaji selidik dan pengambilan responden dalam kalangan penghuni PPA1M Larai,
Putrajaya. Kesemua data kajian melibatkan data primer yang diperoleh daripada sumber kaji
selidik untuk mendapatkan hasil analisis kuantitatif berkaitan kajian.Menurut Mohd Majid
Konting (1990) kaedah kaji selidik mempunyai keupayaan dan kelebihan untuk mendapatkan
maklumat berhubung dengan fakta, kepercayaan, tanggapan, perasaan dan kehendak. Selain
itu, kaedah kaji selidik sosial juga digunakan untuk mengetahu situasi sedia ada, menilai
keperluan, menilai kejayaan dan kegagalan sesebuah projek atau program yang telah
dilaksanakan. Oleh itu, kajian ini melibatkan data primer pertama adalah diperoleh daripada kaji
selidik lapangan dengan menggunakan kerangka persampelan secara terkawal berdasarkan
populasi besar dan jumlah yang tidak sama atas satu-satu item bagi PPA1M Larai, Putrajaya.
Portal PPA1M Putrajaya (2016) menunjukkan jumlah unit PPA1M Larai, Putrajaya sebanyak
423
1,680 unit. Terdapat empat blok apartment untuk dihuni iaitu Blok 1 (Jenis A), Blok 2 (Jenis A1),
Blok 3 (Jenis B) dan Blok 4 (Jenis C) seperti dalam Jadual 3.1.
Jadual 3.1
Jumlah populasi mengikut blok rumah bagi unit PPA1M Larai, Putrajaya
Bil. Blok rumah Jumlah populasi
1. Blok 1 (Jenis A) 536
2. Blok 2 (Jenis A1) 748
3. Blok 3 (Jenis B) 380
4. Blok 4 (Jenis C) 16
Jumlah keseluruhan 1,680
Sumber: Portal PPA1M Putrajaya (2016)
Bagi memastikan kerangka persampelan tidak menjejaskan kualiti dalam jumlah

responden yang ramai, maka kajian menetapkan saiz sampel berdasarkan pandangan daripada
beberapa penulis terkenal seperti Krejcie dan Morgan (1970) serta Sekaran (2003). Mereka
mencadangkan saiz sampel seramai 313 orang sekiranya jumlah populasi dalam sesuatu
kawasan mencecah 1,700 orang dengan mengambil kira kecukupan responden bagi tujuan
analisis secara statistik inferensi. Walau bagaimanapun, pengambilan sampel seharusnya
bertaburan rawak dan data adalah berkeadaan normal. Berdasarkan peraturan-peraturan
tersebut, pengkaji menetapkan jumlah sampel asas yang menjadi sandaran pengiraan secara
terperinci mengikut blok rumah yang diambil bagi tujuan kajian ini adalah seramai 313 orang.
Abd Rahim Md Nor (2009), Kathy dan Gareth (2000), Mohd Majid Konting (1990), Ritchie dan
Lewis (2003) serta Sekaran (2003) berpandangan saiz sampel minimum sebanyak 30 dalam
keadaan tertentu boleh digunakan bagi memastikan kesesuaian data dan kualiti data.
Dalam kajian ini, pecahan saiz sampel dilakukan dengan menggunakan kaedah
peratusan (proportionate sampling) kerana kaedah ini merupakan teknik pengambilan sampel
yang memberikan peluang yang sama bagi setiap unsur populasi untuk dipilih dalam menjadi
anggota sampel. Dalam konteks kajian ini, pengambilan sampel secara peratusan merupakan
sebahagian daripada jenis sampel rawak berkemungkinan (probability). Pengiraan untuk
mendapatkan peratusan sampel menggunakan cara setiap jumlah populasi dibahagikan
dengan keseluruhan jumlah populasi dan didarabkan dengan 100 peratus. Manakala, pengiraan
untuk mendapatkan jumlah sampel menggunakan cara setiap peratusan sampel dibahagikan
dengan 100 peratus dan didarabkan dengan keseluruhan jumlah sampel seperti dalam Jadual
3.2.
Jadual 3.2
Jumlah sampel mengikut Blok rumah bagi unit PPA1M Larai, Putrajaya
Bil. Blok rumah Jumlah populasi Peratusan sampel Jumlah sampel

(%)
424
1. Blok 1 (Jenis A) 536 31.9 100
2. Blok 2 (Jenis A1) 748 44.5 139
3. Blok 3 (Jenis B) 380 22.6 71
4. Blok 4 (Jenis C) 16 1.0 3
Jumlah keseluruhan 1,680 100 313
N=313
Hasil daripada pengiraan saiz sampel secara peratusan mendapati terdapat blok rumah
yang melebihi 30 responden dan terdapat blok rumah yang kurang daripada 30 responden
seperti yang ditunjukkan dalam Jadual 3.2. Oleh itu, analisis taburan saiz sampel akan
dilakukan secara menyeluruh bagi PPA1M Larai. Seterusnya, dalam menentukan responden
kajian pula, teknik convenience sampling digunakan untuk kajian ini bersesuaian dengan tujuan
kajian yang bersifat umum tentang tahap kepuasan penghuni terhadap kualiti PPA1M Larai
yang diduduki tanpa mengira jenis pekerjaan dan keluasan persegi rumah. Walau
bagaimanapun, semua sampel tetap terdiri daripada penghuni PPA1M Larai bagi
menyenangkan proses kutipan data dan satu unit rumah mewakili satu orang responden kajian.
Menerusi kajian ini, kaji selidik melibatkan satu set borong soal selidik yang bertujuan
menguji tahap kepuasan penghuni PPA1M Larai terhadap kualiti rumah yang dihuni. Set borang
soal selidik ini mengandungi empat pecahan bahagian iaitu Bahagian A (Latar Belakang
Responden), Bahagian B (Tahap kepuasan penghuni terhadap kualiti ciri-ciri fizikal PPA1M
Larai), Bahagian C (Tahap kepuasan penghuni terhadap kualiti ciri-ciri persekitaran PPA1M
Larai) dan Bahagian D (Tahap kepuasan penghuni terhadap kualiti kemudahan fasiliti PPA1M
Larai).
Kajian ini menggunakan Skala Likert untuk menggambarkan kekuatan pengaruh antara
dua pemboleh ubah iaitu dari Skala 1 (paling rendah) sehingga Skala 5 (paling tinggi).
Penggunaan 5 ranting scale merupakan cadangan daripada Rensis Likert dan digunakan
secara meluas dalam pelbagai disiplin ilmu, walaupun diluar bidang psikologi (Allen & Seaman,
2007; Carifio & Rocco, 2007; Cresswell, 2014; Likert, 1932; van Alphen et al., 1994). Oleh itu,
penilaian yang digunakan dalam kajian ini untuk mengukur tahap kepuasan penghuni PPA1M
Larai terhadap kualiti rumah yang diduduki menggunakan skala likert iaitu sangat tidak berpuas
hati, tidak berpuas hati, tidak pasti, berpuas hati dan sangat berpuas hati. Namun, bentuk
soalan dalam Bahagian A tidak menggunakan penilaian melalui ranting scale kerana bahagian
ini adalah campuran bentuk interval (seperti umur) dengan norminal (seperti bangsa,
pendidikan, pekerjaan, jumlah isi rumah dan pendapatan).
Maklumat daripada kaji selidik dianalisis dengan menggunakan dua jenis analisis iaitu
analisis deskriptif dan analisis Kolerasi Pearson. Analisis deskriptif melibatkan Bahagian A iaitu
latar belakang responden untuk menjelaskan ciri-ciri reponden yang terlibat dalam kajian ini.
Tujuan analisis ini digunakan bagi mengenal pasti bentuk dan pola data populasi kajian yang
diperolehi daripada kaji selidik. Analisis di Bahagian A merupakan latar belakang responden
yang melibatkan item seperti jantina, umur, bangsa, bilangan ahli keluarga, jumlah pendapatan,
taraf pendidikan, dan jenis pekerjaan. Dalam kajian ini analisis deskriptif yang digunakan adalah
kekerapan, peratusan, sisihan piawai, purata, min dan mod.
425
Analisis Kolerasi Pearson digunakan dalam kajian ini bertujuan melihat arah hubungan
antara dua pemboleh ubah iaitu pemboleh ubah bebas dan pemboleh ubah bersandar.
Disamping, melihat kekuatan hubungan antara pemboleh ubah bebas dan pemboleh ubah
bersandar yang kedua-duanya bercirikan data numerik atau interval (Abd Rahim Md. Nor,
1999). Menurut Abd Rahim Md. Nor (2009), Labavitz (1967) serta Reips dan Funke (2008)
analisis tahap dalam kajian psikologi seperti kesedaran, kepuasan, tingkah laku, motivasi boleh
dilakukan dengan teknik analisis skor peratusan. Analisis berdasarkan skor peratusan ini
mempunyai kelebihan berbanding dengan lain-lain teknik kerana berdasarkan nilai yang
sebenar. Oleh itu, kajian ini berpendapat penggunaan ranting scale sebagai pilihan jawapan
responden dalam menentukan tahap kepuasan menggunakan analisis skor, min dan median
adalah sesuai.
Dalam hal ini, analisis Kolerasi Pearson diterjemahkan melalui pekali kolerasi
(Correlation Coefficient atau nilai r) iaitu penunjuk penting yang mengambarkan kekuatan
hubungan dan jenis hubungan antara pemboleh ubah. Nilai r yang menghampiri +1.0
menggambarkan hubungan positif yang semakin kuat antara kedua-dua pemboleh ubah kajian.
Peningkatan dalam satu pemboleh ubah boleh mempengaruhi peningkatan dalam pemboleh
ubah lain. Sekiranya nilai r ke arah -1.0 maka menunjukkan wujud hubungan negatif (songsang)
yang semakin kuat antara kedua-dua pemboleh ubah. Selain itu, pergerakan nilai ke arah 0
menunjukkan semakin lemah atau tiada hubungan antara pemboleh ubah. Menurut Abd Rahim
Md. Nor (2009) dan Mohd Majid Konting (1990) nilai r boleh menggambarkan kekuatan
hubungan antara pemboleh ubah. Sekiranya kajian perhubungan menunjukkan signifikan iaitu
nilai p pada aras 0.05 (p<0.05), maka hipotesis Null (H0) ditolak yang menunjukkan terdapat
hubungan dan menerima Hipotesis Alternatif (H1). Contohnya, hasil kajian menunjukkan aras
signifikan r=0.001 memerihalkan nilai p<0.05 iaitu pengkaji menolak H0 dan menerima H1.
4.0 Kesimpulan
Secara keseluruhannya, pembangunan projek PPA1M yang telah dilaksanakan oleh

pihak kerajaan dengan kerjasama Jabatan Perumahan Negara (JPN) dan unit PPAIM, JPM
bagi membolehkan penjawat awam terutamanya yang berpendapatan rendah dan sederhana
membeli rumah. Dalam erti kata lain, program pembangunan perumahan ini selaras dengan
matlamat penubuhannya sebagai satu skim rumah mampu milik untuk penjawat awam yang
menekankan kepada keselesaan dari aspek saiz, rekabentuk, kualiti, lokasi dan harga rumah ke
arah mencapai pembangunan yang seimbang dalam sektor perumahan negara.Di samping,
pembinaan PPA1M lebih dikhususkan di bandar-bandar utama dalam negara bertujuan
mengurangkan beban penjawat awam.
Secara umumnya, perumahan berperanan sebagai komponen guna tanah utama dalam
sesebuah bandar, malahan turut memainkan peranan sebagai sektor utama yang memacu
perkembangan industri harta tanah dan pertumbuhan ekonomi negara. Justeru, perumahan
yang dibina sehararusnya mematuhi piawaian yang ditetapkan agar hasil yang diperolehi
memuaskan. Penelitian status kualiti perumahan merupakan aspek yang sangat penting dalam
menjamin kepuasan penghuni rumah terbabit. Apabila dirumuskan mendapati bahawa
perumahan merangkumi pelbagai aktiviti yang melibatkan manusia dan alam sekitarnya.
Rumah tidak boleh dilihat sebagai tempat perlindungan sahaja tetapi fungsi dan
perancangannya memerlukan perincian yang teliti bagi menjamin kualitinya. Oleh itu, dapat
disimpulkan bahawa aspek fizikal, persekitaran dan fasiliti merupakan nadi utama yang dinilai
oleh penghuni terhadap kualiti perumahan yang dibeli. Justeru, aspek ini dijadikan pengukuran
ke atas kepuasan penghuni terhadap kualiti perumahan yang diduduki.
426
Rujukan
Abd Rahim Md. Nor. (1999). Kaedah menganalisis data berkomputer. Shah Alam: Fajar Bakti
Sdn.Bhd.
Abd Rahim Md. Nor. (2009). Statistical methods in research. Kuala Lumpur: Prentice Hall.
Ainul Fatihah Mansor. (2014, 16 Oktober). Flat kerap bergegar. Harian Metro.
https://www.hmetro.com.my/mutakhir/2014/10/2170/flat-kerap-bergegar
Allen, I.E. & Seaman, C.A. (2007). Likert Scales and data analyses. Quality progress, 40, 64-65.
Amirul Aiman Anuar. (2017, 23 November). Bagai melepas batuk ditangga. Utusan Online.
http://www.utusan.com.my/berita/wilayah/kl-putrajaya/bagai-melepas-batuk-di-tangga-
1.558682
Astro Awani. (2016, 25 Mac). Contohi Korea Selatan, Singapura dalam pembinaan rumah
mampu milik. http://www.astroawani.com/berita-bisnes/contohi-korea-selatan-singapura-
dalam-pembinaan-rumah-mampu-milik-bnm-99813
Azman Abdul Jamal. (2017, 28 Disember). QLASSIC menjamin kualiti hasil kerja. Berita Harian.
Bernama. (2014, 10 November). Kualiti rumah mampu milik masih tidak capai standard-CIDB.
Berita Harian. https://www.bharian.com.my/node/16796
Bernama. (2016, 24 Mac). Contohi Korea Selatan, Singapura dalam pembinaan rumah mampu
milik. http://bernama.com/bernama/v8/bm/ge/newsgeneral.php?id=1228539
Carifio, J. & Rocco, J.P. (2007). Ten common minusderstandings, misconceptions, persistent
myths and urban legends about Likert Scales and Likert Response formats and their
antidotes. Journal of social sciences, 3(3), 106-116.
Cresswell, J. W. (2014). Research Design: Qualitatuve, Quantitative, and Mixed Methods
Approaches. California: SAGE Publications.
Hafiz Ithnin. (2016, 20 Ogos). Gagal beri kualiti terbaik. Harian Metro.
https://www.google.com/amp/s/www.hmetro.com.my/node/160491/amp
Haryati Shafii. (2012). Keselesaan terma rumah kediaman dan pengaruhnya terhadap kualiti
hidup penduduk. Malaysian journal of society and space, 4, 28-43.
Kathy, P. & Gareth, R. (2000). Coastwatch UK: a public participation survey. Journal of Coastal
Conservation6, 61-66.
Kothari, C. R. (2004). Research Methodology: Methods and Technique. New Delhi: New Age
International Publishers.
Krejcie, R. V., & Morgan, D. W. (1970). Determining sample size for research activities.
Educational and Pychological Measurement, 30, 607-610.
Labavitz, S. (1967). Some observations on measurement and statistics. Social Forces, 46, 151-
160.
Likert, R. (1932). A technique for the Measurement of Attitudes. Archives of Psychology, 140, 1-
55.
Mohammad Abdul Mohit, Mansor Ibrahim & Yong Razidah Rashid. (2010). Assessment of
residential satisfaction in newly designed public low-cost housing in Kuala Lumpur,
Malaysia. Habitat International, 34, 18-27.
Mohd Majid Konting. (1990). Kaedah penyelidikan pendidikan. Ed. Ke-5. Kuala Lumpur: Dewan
Bahasa dan Pustaka.
Mstar. (2016, 24 Mac). Contohi Korea Selatan, Singapura dalam pembinaan rumah mampu
milik. http://www.mstar.com.my/berita/berita-semasa/2016/03/24/rumah-mampu-milik/
Mustaqim Yusof. (2012). Kepuasan penduduk program perumahan rakyat terhadap kualiti
perumahan. Kajian kes: Projek Perumahan Rakyat Sri Iskandar, Pasir Pelangi, Johor
Bharu dan Projek Perumahan Rakyat Desa Mutiara, Terbau, Johor Bahru. (Tesis Sarjana)
Universiti Teknologi Malaysia.
427
Nadia Hamid & Nora Mahpar. (2017, 21 Ogos). Kualiti projek kerajaan dinilai sistem QLASSIC.
Berita Harian. https://www.bharian.com.my/berita/nasional/2017/08/315370/kualiti-projek-
kerajaan-dinilai-sistem-qlassic-fadillah
Nik Hafizul Baharuddin. (2018, 29 Julai). Isu PPA1M Bukit Jalil ditangani segera. Utusan Online.
http://m.utusan.com.my/berita/nasional/isu-ppa1m-bukit-jalil-ditangani-segera-1.7187
Noraini Hamzah. (2014). Pembentukan kerangka kualiti pengurusan pembinaan projek
perumahan dalam mengurangkan kecacatan perumahan teres baru siap. (Tesis PhD
yang tidak diterbitkan) Universiti Malaya, Kuala Lumpur, Malaysia.
Nurbaity Aqmar Mahamud. (2011). Pengukuran prestasi pemaju perumahan berdasarkan
sistem star ranting. (Tesis Phd) Universiti Tun Hussein Onn Malaysia.
Nurizan Yahaya & Ahmad Hariza Hashim. (2001). Perumahan dan kediaman. Selangor:
Universiti Putra Malaysia.
Nurul Atiqah Mohd Sofberi. (2016). Kepuasan penghuni terhadap projek perumahan terengkalai
oleh kontraktor penyelamat. Kajian kes: Taman Perindustrian Hijau, Rawang. (Tesis Phd)
Universiti Tun Hussein Onn Malaysia.
Portal Rasmi Perumahan Penjawat Awam 1Malaysia Putrajaya. (2016). Kemajuan projek.
http://ppa1m.putrajaya.gov.my/kemajuan-projek/
Reips, U. D. & Funke, F. (2008). Interval-level measurement with visual analogue scales in
intenet-based research: VAS Generator. Behavior Research Methods,40(3), 699-704.
Ritchie, J. & Lewis, J. (2003). Qualitative research pratice: a guide for social science students
and researchers. Thousand Oaks. Sage Publications.
Sekaran, U. (2003). Research methods for business: a skill building approach. Ed. 4. New York:
John Wiley & Sons.
Shafiq Azni. (2018, 6 Mei). Adakah projek PPA1M kerajaan gagal?.Kaki Property.
https://www.kakiproperty.com/adakah-projek-ppa1m-kerajaan-gagal/
Tze San Ong. (2013). Factors Affecting the Price of Housing in Malaysia. Journal of Emerging
Issues in Economics, Finance and Banking, 1, 414-429.
Unit Perancang Ekonomi, Jabatan Perdana Menteri. (2011). Rancangan Malaysia kesepuluh
(2011-2015). Kuala Lumpur: Percetakan Nasional Berhad.
van Alphen, A., Halfens, R., Hasman, A. & Imbos, T. (1994). Likert or Rash? Nothing is more
applicable than good theory. Journal of Advanced Nursing, 20, 196-201.
Wan Rafyah Wan Muhd Zin. (2006). Pemilikan Rumah Kos Sederhana: Sejauhmana
Kemampuan Golongan Sasaran. Dalam, Norhaslina Hassan, Dinamika Masyarakat
Bandar di Malaysia kearah kualiti hidup mapan. Kuala Lumpur: Universiti Malaya.
Zainol Ariffin. (2011, 10 Februari). Penyediaan rumah yang mencukupi berkualiti dan mampu
dimiliki. Utusan Malaysia. http://www.utusan.com.my
-GP61-
Kajian Kesediaan Majlis Perbandaran Kangar Ke Arah Pelaksanaan
Bangunan Hijau di Perlis
Faizal Md Hanafiah1, Alyani Amanina Azros Abdul Aziz2, Mohamad Ghozali Hassan3,
Nor Azura A. Rahman4. Mohd Azril Ismail5..
1.2 4
Pusat Pengajian Kerajaan, Pusat Pengajian Antarabangsa.
Kolej Undang-Undang, Kerajaan dan Pengajian Antarabangsa. Universiti Utara Malaysia.
3, 5
Pusat Pengajian Pengurusan Teknologi dan Logistik.
Kolej Perniagaan, Universiti Utara Malaysia, 06010 UUM Sintok Kedah, Malaysia.
1 2 3
hfaizal@uum.edu.my , alyaniamanina92@gmail.com , ghozali@uum.edu.my ,
4 5
nrazura@uum.edu.my , azril@uum.edu.my .
428
Abstrak
Kajian ini dilakukan bertujuan untuk mengenalpasti tahap kesedaran, kesediaan serta
cabaran yang dihadapi oleh Majlis Perbandaran Kangar ke arah pelaksanaan Bangunan Hijau
di Perlis. Seramai 250 orang responden yang terdiri daripada 8 jabatan yang berbeza telah
dipilih untuk menjawab borang soal selidik dan soalan temu bual yang disediakan oleh pihak
pengkaji. Bangunan Hijau merupakan bangunan yang menekankan aspek kecekapan
penggunaan sumber tenaga, air dan bahan, seterusnya mengurangkan kesan negatif yang
berpunca daripada bangunan terhadap kesihatan manusia dan persekitaran (Siow Fui Woon,
2014). Dapatan kajian menunjukkan bahawa tahap kesediaan Majlis Perbandaran Kangar
terhadap pelaksanaan Bangunan Hijau masih berada pada tahap yang tidak memuaskan.
Pihak Berkuasa Tempatan memainkan peranan yang penting dalam memastikan pelaksanaan
Bangunan Hijau dijalankan di sesebuah tempat.
Kata Kunci: Kesediaan,Bangunan Hijau, Majlis Perbandaran Kangar
1.0 Pengenalan
Pencemaran alam sekitar merupakan isu penting yang wujud akibat kesan daripada
aktiviti-aktiviti manusia. Menurut Mohamad Suhaily & Mazdi Marzuki (2006), dalam tempoh
dua puluh tahun kebelakangan ini, isu-isu dan krisis alam sekitar hangat diperkatakan dan
sering dikaitkan dengan proses pembangunan ekonomi dan sektoral yang berlaku di
sesebuah negara atau wilayah.
Menurut Siti Rohani (2013), perubahan iklim, bencana alam dan pencemaran
merupakan satu fenomena alam semulajadi yang semakin nyata dan ketara, di samping
peningkatan keperluan manusia untuk menggunakan sumber alam semula jadi yang semakin
berkurangan dengan lebih bijak dan lestari telah mewujudkan cabaran dan persaingan dalam
pelbagai bidang seperti perniagaan, pembuatan dan pembinaan.
Pemanasan global merupakan isu utama yang hangat diperkatakan pada abad ke-21
ini. Permasalahan ini bukan hanya dari sudut saintifik, malah menjangkaui aspek ekonomi,
sosiologi, geopolitik dan gaya hidup manusia. Dunia yang semakin tercemar akibat aktiviti
manusia telah menyebabkan peningkatan gas rumah hijau secara mendadak, seperti gas
karbon dioksida di atmosfera (Mohd. Nazaruddin Yusoff, 2014).
Kementerian Tenaga, Teknologi Hijau dan Air Malaysia (KeTTHA) telah ditubuhkan
pada 9 April 2009 ekoran daripada rombakan Kabinet serta penstrukturan semula
kementerianyang dilakukan oleh Y.A.B Perdana Menteri Malaysia yang keenam iaitu Dato'
Sri Najib bin Tun Abdul Razak. Teknologi hijau merujuk kepada pembangunan dan aplikasi
produk, peralatan serta sistem untuk memelihara alam sekitar dan alam semulajadi dan
meminimumkan atau mengurangkan kesan negatif daripada aktivitimanusia.
Teknologi Hijau merujuk kepada pembangunan dan aplikasi produk, peralatan serta
sistem untuk memelihara alam sekitar dan alam semulajadi serta meminimumkankesan
negatif akibat aktiviti manusia. Teknologi Hijau merujuk kepada produk, peralatan, atau
sistem yang memenuhi kriteria-kriteria berikut. Antaranya adalah ia meminimumkan degrasi
429
kualiti persekitaran serta mempunyai pembebasan Gas Rumah Hijau (GHG) yang rendah
atau sifar, selamat untuk digunakan dan menyediakan persekitaran sihat dan lebih bain untuk
semua hidupan, menjimatkan tenaga dan sumber asli, serta menggalakkan sumber-sumber
yang boleh diperbaharui (Sumber: Portal Pusat Maklumat Rakyat).
Bangunan Hijau merupakan bangunan yang menekankan aspek kecekapan

penggunaan sumber tenaga, air dan bahan, seterusnya mengurangkan kesan negatif yang
berpunca daripada bangunan terhadap kesihatan manusia dan persekitaran (Siow Fui Woon,
2014). Secara umumnya, pembinaan bangunan hijau lebih mesra alam berbanding bangunan
konvensional. Misalnya, dari segi penggunaan bahan oleh bangunan hijau yang
menitikberatkan produk mesra alam.
Secara umumnya, bagi meningkatkan tahap kesedaran masyarakat dunia berkaitan

alam sekitar, khususnya rakyat Malaysia adalah sukar. Secara purata, hanya 3 daripada 10
orang rakyat Malaysia yang prihatin tentang isu-isu alam sekitar. Kejadian-kejadian bencana
alam yang besar dan meragut nyawa ribuan manusia seperti tsunami, gempa bumi dan banjir
adalah pengajaran yang terbaik untuk mendidik manusia supaya lebih bertanggungjawab
dalam memelihara alam sekitar. Mendidik bukan sahaja untuk memberikan mereka
kesedaran malah tentang memberi kesedaran kepada mereka tentang kepentingan menjaga
alam sekitar serta langkah berjaga-jaga untuk bertindak secara tepat dan betul sekiranya
berlaku sesuatu yang tidak diingini (Jabatan Penerangan, 2011).
2.0 Penyataan Masalah
Perubahan iklim merupakan salah satu isu yang hangat diperkatakan di dunia masa
kini. Secara umumnya, perubahan iklim telah menyebabkan berlakunya bencana alam,
seperti peningkatan tahap paras laut, banjir, tanah runtuh, hakisan pantai, kemarau,
kebakaran hutan, dan jerebu. Hal ini secara tidak langsung telah memberi kesan yang negatif
kepada manusia di samping menjejaskan ekonomi negara (Sumber: Kementerian Sumber
Asli dan Alam Sekitar).
Negeri Perlis tidak terkecuali daripada menghadapi masalah berkaitan perubahan iklim.
Cuaca panas yang melanda negeri Perlis telah memberi kesan kepada alam sekitar serta
masyarakat setempat. Keadaan ini dikaitkan dengan fenomena El Nino. Antara aspek yang
perlu ditekankan akibat suhu yang melampau adalah gelombang haba kerana keadaan
tersebut mampu menyumbang kepada masalah strok haba (Sumber: SinarOnline, Mac,
2016).
Menurut Mohamad Bokhari, Aida Nasirah Abdullah, Syed Najmuddin Syed Hassan,
Zanariah Jano, Rosli Saadan (2014), sehingga kini, Malaysia sudah berdepan dengan
pelbagai masalah yang melibatkan pencemaran alam sekitar yang semakin kritikal. Mereka
berpendapat bahawa masalah ini dapat dikurangkan melalui kesedaran, kefahaman serta
amalan terhadap penggunaan Teknologi Hijau.
430
Menurut Green Buiding Index Malaysia, masih tiada bangunan hijau di Perlis yang
didaftarkan di bawah Green Building Index Projects. Secara umumnya, statistik menunjukkan
bahawa jumlah bangunan hijau yang didaftarkan dan diiktiraf di Perlis kepada Green Building
Index adalah sifar. Oleh yang demikian, kajian dijalankan bagi mengenalpasti apakah punca
jumlah bangunan hijau yang didaftarkan dan diiktiraf di Perlis adalah sifar.
Walaupun saiz keluasan negeri Perlis kecil, namun negeri ini gagal mewujudkan
sebarang Bangunan Hijau. Pihak Berkuasa Tempatan dipilih agar kesedaran, pengetahuan
dan kefahaman berkaitan Bangunan Hijau dapat diterapkan dalam organisasi ini bagi
membantu mengurangkan masalah pencemaran yang berlaku di samping membantu
memelihara kesihatan masyarakat setempat.
3.0 Metodologi Kajian
Kajian ini dijalankan menggunakan kaedah kuantitatif dan kaedah kualitatif. Kaedah
kuantitatif dipilih oleh pihak pengkaji agar hipotesis yang dibina dapat diuji. Di samping itu,
kaedah penyelidikan kuantitatif dipilih kerana pengkaji menggunakan statistik korelasi bagi
mengukur hubungan di antara dua atau lebih pembolehubah. Menurut Chua Yan Piaw
(2014), variabel-variabel dalam suatu fenomena yang dikaji akan dioperasionalkan sebelum
diukur.
Populasi kajian ini secara keseluruhannya terdiri daripada warga Majlis Perbandaran
Kangar, Perlis. Di dalam Majlis Perbandaran Kangar, terdapat beberapa Jabatan yang
beroperasi iaitu Jabatan Khidmat Pengurusan, Jabatan Kejuruteraan, Jabatan Perancangan
dan Pembangunan, Jabatan Kesihatan Persekitaran dan Pelesenanan, Jabatan
Penguatkuasaan, Jabatan Perbendaharaan, Jabatan Penilaian dan Pengurusan Harta,
Jabatan Bangunan dan seterusnya adalah Jabatan Pembangunan Masyarakat. Menurut
Encik Yusri Abdul Rahman, salah seorang Pembantu Tadbir di Majlis Perbandaran Kangar,
berkata terdapat lebih kurang 250 orang pekerja di Majlis Perbandaran Kangar.
Jenis persampelan bertujuan dipilih di dalam kajian ini. Persampelan bertujuan merujuk
kepada prosedur persampelan di mana sekumpulan subjek yang mempunyai ciri-ciri tertentu
dipilih sebagai responden kajian. Menurut Krejcie dan Morgan (1970) dalam Chua Yan Piaw
(2014), jika jumlah populasi melibatkan 250 orang, maka sampel kajian yang terlibat adalah
seramai 152 orang. Oleh yang demikian, di dalam kajian ini, hanya beberapa jabatan di Majlis
Perbandaran Kangar sahaja yang akan dijadikan sampel kajian oleh pihak pengkaji.
Antaranya adalah pekerja di bawah Jabatan Kejuruteraan, Jabatan Perancangan dan

Pembangunan, Jabatan Kesihatan Persekitaran dan Pelesenan, Jabatan Penguatkuasaan,
Jabatan Perbendeharaan, Jabatan Penilaian dan Pengurusan Harta, Jabatan Bangunan dan
seterusnya adalah Jabatan Pembangunan Masyarakat. Oleh yang demikian, pekerja yang
431
berada di bawah jabatan yang terlibat sahaja akan dijadikan sebagai sample kajian oleh
pihak pengkaji.
Manakala, bagi kajian kualitatif, bilangan sampel yang digunakan biasanya kecil (Chua
Yan Piaw, 2014). Bagi kajian kualitatif di dalam kajian ini, kaedah temu bual semi-struktur
telah dipilih oleh pihak pengkaji. Pihak pengkaji hanya memilih tiga jabatan utama iaitu
Jabatan Kawalan dan Pembangunan, Jabatan Perancangan Pembangunan Bandar, dan
Jabatan Kejuruteraan. Ketiga-tiga jabatan ini dipilih berdasarkan aspek fungsi yang berkait
rapat dengan pelaksanaan bangunan di Perlis. Sesi temu bual semi-struktur hanya akan
dijalankan kepada seorang individu sahaja bagi setiap jabatan yang terlibat iaitu ketua unit
bagi jabatan masing-masing.
4.0 Penutup
Menurut Mohd. Nazaruddin dan Kamarudin Mohd Nor (2014), dianggarkan menjelang
tahun 2050, populasi manusia di dunia akan mencecah seramai 10 billion orang. Pertambahan
ini akan memberikan kesan kepada aktiviti ekonomi. Peluang-peluang pekerjaan perlu
diwujudkan terutamanya di bandar. Penghijrahan manusia dari luar bandar ke bandar berlaku
secara mendadak. Hal ini menyebabkan bandar-bandar utama dunia tidak dapat lagi
menampung populasi penduduk yang kian bertambah.
Pembukaan tanah dan bandar baru terpaksa diwujudkan. Kawasan luar bandar telah
diperbandarkan dan kesannya adalah pertumbuhan kepada kadar kepenggunaan manusia.
Maka, keperluan kepada sumber alam seperti air, udara, tanah, bahan api akan meningkat
berlipat kali ganda. Dunia semakin panas dan kesan rumah hijau akan meningkat.
Oleh yang demikian, adalah menjadi tanggunjawab setiap pihak dalam menangani
masalah pencemaran alam dengan lebih berkesan. Semuanya bermula dengan kesedaran
dalam diri masyarakat terhadap pemuliharaan alam sekitar. Mendidik rakyat Malaysia tentang
kepentingan alam sekitar dapat memberi kesedaran bahawa Teknologi Hijau dan amalannya
boleh menyelamatkan bumi.
Rujukan
Chua Yan Piaw. (2014). Kaedah Penyelidikan Edisi Ketiga. Selangor: McGraw-Hill Education
(Malaysia) Sdn. Bhd.
Green Building Index. Diakses pada 13 April, 2018, daripada http://new.greenbuildingindex
Mohamad Bokhari, Aida Nasirah Abdullah, Syed Najmuddin Syed Hassan, Zanariah Jano dan
Rosli Saadan. (2014). Hubungan antara kefahaman, kesedaran, dan amalan teknologi
hijau berdasarkan perpektif etnik di negeri Melaka: Kajian di Universiti Teknikal Malaysia
Melaka. Journal of Human Capital Development, 7(2), 34-35.
Mohd Nazaruddin Yusoff & Kamarudin Mohd Nor. (2014). Pemanasan Global dan
Pembangunan Lestari Alam Bina. Sintok, Kedah: Penerbit Universiti Utara Malaysia.
432
Mohamad Suhaily Yusri Che Ngah & Mazdi Marzuki (2006). Kajian Impak Pembangunan
Terhadap Alam Sekitar Di Lembah Bernam (Tanjong Malim).
Perit bahang El Nino dan bekalan air. (2016). Diakses pada 30 April, 2017, daripada
http://www.sinarharian.com.my/semasa/perit-bahang-el-nino-dan-bekalan-air-1.502838
Portal Rasmi Kementerian Sumber Asli dan Alam Sekitar (NRE). Diakses pada 7 September,
2018, daripada http://www.nre.gov.my/ms-my/Pages/default.aspx
Siow Fui Woon. (2014). Kajian Kepuasan Pengguna terhadap Ciri-ciri Bangunan Hijau yang
telah diberi Akreditasi. Malaysia: Universiti Tun Hussein Onn.
Siti Rohani Binti Johar (2013), Kesedaran Teknologi Hijau Dalam Kalangan Warga Universiti
Tun Hussein Onn Malaysia. Fakulti Pendidikan Teknikal dan Vokasional, Universiti Tun
Hussein Onn Malaysia.
Teknologi Hijau. Diakses pada 20 April, 2018, daripada http://pmr. penerangan.gov.my/index
.ph p/component/content/article/390-teknologi-hijau/4185-teknologi-hijau.html
KAJIAN-KAJIAN KES (CASE STUDIES)
-CS01-
Pembalakan Di Hutan Simpan Bukit Enggang, Sik, Kedah
Mohd Khairul Nizam Abd Latif

BahagianPerancangEkonomiNegeri,
PejabatSetiausaha Kerajaan Negeri Kedah
Abstrak
Kepelbagaian biologi atau Biodiversiti Malaysia adalah antara yang terkaya di dunia.
Hutan hujan tropika kita mempunyai pelbagai jenis tumbuh-tumbuhan dan haiwan termasuk
spesies ikonik seperti harimau, gajah, orang utan dan pokok-pokok bersaiz besar yang
menjulang lebih daripada 80 meter dari lantai hutan. Seiring maju ke hadapan untuk menjadi
negara maju yang berpendapatan tinggi, kita terus menghadapi cabaran termasuk ancaman
kepada biodiversiti. Dek pertumbuhan ekonomi yang begitu penting untuk kesejahteraan rakyat,
aktiviti pembangunan tanah memberi tekanan kepada flora dan fauna kita. Banyak haiwan liar
dan tumbuhan serta ekosistem sekeliling akan berisiko. Kerajaan Pusat, Negeri dan agensi
yang terbabit dalam hal biodiversiti telah dan terus bergiat dalam usaha mengurangkan impak
kepada alam sekeliling. Namun demikian, ketirisan dan kelemahan yang dihadapi oleh pihak
berwajib menyebabkan masih wujud kegiatan-kegiatan yang merosakkan keindahan bumi ini
antaranya ialah pembalakan haram. Kegiatan pembalakan haram adalah salah satu isu alam
sekitar yang mempengaruhi setiap aspek kehidupan manusia, alam semulajadi, biodiversiti,
ekologi, sosial dan ekonomi. Menurut sumber Kementerian Sumber Asli dan Alam Sekitar,
Negara kerugian kira-kira RM15.2 juta akibat daripada aktiviti pembalakan haram di
Semenanjung Malaysia dari tahun 2006 hingga 2016. Keadaan ini juga membawa kesan yang
buruk terhadap alam sekitar kerana ia mengakibatkan kerosakan terhadap ekologi alam serta
membawa kepada kehilangan atau kepupusan habitat haiwan. Kegiatan yang rakus ini berlaku
di mana-mana hutan di seluruh negera termasuklah di Hutan Simpan Bukit Enggang, Daerah
Sik, Kedah.Kajian dijalankan bagi mengenalpasti punca berlakunya aktiviti pembalakan haram
yang berlaku dan mencadangkan langkah-langkah mengatasi yang boleh dijadikan garis
433
panduan dalam menyediakan piawaian atau dasar-dasar bagi pelan pembangunan baharu di
masa hadapan.
Kata Kunci: Biodiversiti, Alam Sekitar, Pembalakan, Hutan Simpan Bukit Enggang
1. PENGENALAN
Hutan Hujan Tropika di Malaysia adalah merupakan salah satu ekosistem yang sangat
kompleks di dunia. Ianya juga satu warisan alam semulajadi ciptaan Allah Yang Maha Kaya
yang sangat unik dan telah wujud sejak lebih berjuta tahun. Hutan juga sering disebut dan
diumpamakan sebagai paru-paru kepada bumi. Tidak dapat disangkal melalui kajian saintifik
hutan mempunyai banyak kepentingannya antaranya menyerap pencemaran gas karbon
dioksida dan membekalkan oksigen kepada semua spesies hidupan melalui kitaran proses
tertentu seperti pernafasan dan fotosintesis.
Menurut sumber Jabatan Perhutanan Semananjung Malaysia, sehingga 2014, terdapat
seluas 18.27 juta hektar atau 55 peratus daripada bumi di Malaysia (termasuk Sabah dan
Sarawak) diliputi hutan hujan tropika yang kaya dengan 8,000 jenis flora dan lebih 400 spesis
fauna. Kawasan berhutan ini terdiri daripada 4.93 juta hektar kawasan Hutan Simpanan Kekal
(HSK), 0.78 juta hektar kawasan Taman Negara dan Rizab Hidupan Liar manakala baki 0.30
juta hektar adalah Tanah Kerajaan dan Tanah Berimilik.
Didalam kajian ini, topik yang akan dibincangkan ialah mengenai aktiviti pembalakan
hutan di Malaysia dan juga pembalakan secara haram yang akan ditekankan bagi melihat
impak yang menyeluruh terhadap manusia, biodiversiti, perubahan iklim, hidrologi dan tadahan
air.
Kemudian, kajiandiperincikandengan kes kajian dalam kertas kerja ini yang dibuat
berdasarkan aduan awam dari petikan cetakan akhbar Sinar Harian bertarikh 20 Mei 2018
bertajuk ―Kayu Balak Masih Di Bawa Keluar”. Kejadian berlaku di Hutan Simpan Bukit Enggang,
Daerah Sik, Kedah.
2. TOPIK PERBINCANGAN
2.1. Pembalakan dan hasil
Kegiatan pembalakan merupakan sumbangan terbesar hutan kepada penduduk di

Malaysia terutama sekali di kawasan luar bandar. Kegiatan ini telah dapat meningkatkan taraf
hidup penduduk luar bandar. Selain itu, ia juga telah berjaya memberi sumbangan kepada
ekonomi negara. Menurut sumber pendapatan hasil negara, aktiviti penuaian hutan atau
pembalakan menyumbang kepada hasil negeri dan negara. Pada tahun 2015 hasil hutan
menyumbang sebanyak 2.5% kepada ekonomi negara iaitu kira-kira RM20 bilion. Realitinya
pada masa ini kawasan hutan ini semakin mengecil dari setahun ke setahun dan semakin jauh
kerana desakan keperluan pembangunan bagi memenuhi keperluan masyarakat.
2.2. Pembalakan secara haram
Namun yang demikian, pembalakan secara haram semakin menjadi-jadi dek kerana
kepentingan oleh sestengah pihak yang tidak bertanggungjawab. Banyak kerugian dan impak
negatif kepada fizikal mukabumi, kemerosotan biodiversiti, perubahan iklim, sistem hidrologi
dan banyak lagi.
434
Pembalakan haram merujukkepada apa yang dalam perhutanan digelar pencuri balak. Ia
juga boleh merujuk kepada penuaian, pengangkutan, pembelian atau penjualan balak yang
menyalahi undang-undang. Prosedur penuaian itu sendiri mungkin haram, termasuk
menggunakan cara salah bagi memasuki hutan; pengeluaran tanpa kebenaran atau dari
kawasan dilindungi; penebangan spesies dilindungi; atau pengeluaran balak melampaui had
yang dipersetujui.
Malaysia pernah dituduh sebagai ‗laundering centre‘ bagi kayu balak haram yang diimport
daripada Negara jiran. Sehubungan dengan ini, Malaysia menghadapi cabaran untuk
membanteras aktiviti pembalakan haram di dalam negeri dan menangkis tohmahan yang
mengatakan Malaysia terlibat dengan masalah pembalakan haram di Indonesia. Ini penting bagi
memelihara kredibiliti Malaysia di pasaran antarabangsa.
2.3 Hutan Simpan Bukit Enggang
Hutan Simpan Bukit Enggang adalah sejenis Hutan Dipterokarpa Pamah dimana
mempunyai keluasan 6,693 hektar dan terletak di bahagian tengah Negeri Kedah. Ia telah
diwartakan sebagai hutan simpan pada 11 Mac 1933. Hutan Simpan Bukit Enggang ini
terbahagi kepada dua (2) kelas hutan iaitu terdapatnya Hutan Pengeluaran Kayu di bawah
Perolehan Berkekalan dan Hutan Tadahan Air di bawah Seksyen 10(1) Akta Perhutanan
Negara (Pindaan 1993). Hutan Tadahan Air yang telah dikenalpasti sebagai hutan tadahan air
adalah Kompartmen 1, 16, 17 dan 18. Manakala bagi Kompartmen 2, 3, 4, 5, 6, 7, 8, 9, 10,
11,12, 13, 14, 15 dan 19 adalah Hutan Pengeluaran Kayu dibawah Perolehan Berkekalan yang
diuruskan oleh Jabatan Perhutanan Negeri Kedah selari dengan keperluan di bawah Akta
Perhutanan Negara 1984 (Pindaan 1993).
Kawasan Hutan Simpan Bukit Enggang ini telah dikenalpasti sebagai kes kajian dalam
kertas kerja bagi isu pembalakan hutan bagi maksud pembangunan ladang hutan di
sebahagian Kompartmen 13, 14 dan 15 seperti yang ditanda di Rajah1.
Rajah 1: Pelan Kawasan kelulusan membalak bagi maksud pembangunan ladang hutan di
sebahagian kompartmen 13, 14 dan 15 Hutan Simpan Bukit Enggang, Sik, Kedah.
2.4. Kronologi Kelulusan Membalakbagi Maksud Pembangunan Ladang di Hutan Simpan

Bukit Enggang.
435
Kerajaan Negeri melalui Mesyuarat Jawatankuasa Tetap Hasil Bumi (JKTHB) yang
bersidang pada 8 Mei 2016 telah meluluskan kawasan membalak bagi maksud Pembangunan
Ladang Hutan di sebahagian Kompartmen 13, 14 dan 15 di Hutan Simpan Bukit Enggang
seluas ± 500 hektar kepada Perbadanan Menteri Besar Kedah (PMB Kedah). Lesen
berkuatkuasa pada 6 April sehingga 5 Oktober 2017 dan telah dilanjutkan mulai 6 Oktober 2017
sehingga 5 April 2018.
Secaraumumnya, pembangunandan pengurusan projek ini akan dilaksanakan dalam tiga
(3) peringkat iaitu pembalakan/permbersihan hutan & penyediaan untuk tanaman,
pembangunan ladang hutan dan pengusahasilan (penorehan getah dan pembalakan getah klon
pada pusingan akhir projek/pembalakan hutan alternative). Pelaksanaan adalah berdasarkan
Rancangan Mengusahasil Hutan (RMH) dan Rancangan Pengurusan Ladang Hutan (RPL).
Sehingga kini, seluas lebih kurang 300 hektar (60%) telahpundiusahasil.
Walaubagaimanapun, satuPerintahBerhenti Kerja Di Bawah Seksyen 34AA, Akta Kualiti
Alam Sekeliling 1974 (Pindaan 2012) telah dikeluarkan pada 5 Januari 2018 berhubung
perlaksanaan projek tanpa mendapat kelulusan Laporan Penilaian Kesan Alam Sekeliling (EIA)
daripadaJabatanAlamSekitar.
Pada 8 Januari 2018, satu semakan Pengarah Jabatan Perhutanan Negeri Kedah
(JPNK), Timbalan Pengarah (Operasi), Pegawai Hutan Daerah Kedah Tengah, Unit
Kejuruteraan Hutan serta kakitangan Pejabat Renjer Hutan Jeniang telah menjalankan lawatan
danpemantauankawasanaduan.
Pada 15 Januari 2018, satu pemeriksaan ke matau utama di sebahagian Kompartmen 14,
Hutan Simpan Bukit Enggang bagi membincangkan isu yang telah dibangkitkan pada keratan
akhbar The Star berkaitan ―No EIA, but logging went ahead‖ telah diadakan oleh Jabatan
Perhutanan Negeri Kedah bersama Jabatan Alam Sekitar (JAS) Negeri Kedah, Polis Di Raja
Malaysia (PDRM) dan Perbadanan Menteri Besar Kedah (PMBK).
Sehubungandenganitu, PMBK telah menyediakan Laporan EIA kepada JAS pada 8 April
2018. Satu mesyuarat bersama JAS telah diadakan pada 16 April 2018 dan bersetuju
longgokan kayu balak di matau sedia ada dibawa keluar untuk elakkan tebangan pokok,
pembukaan kawasan dan jalan baru dijalankan dalam kawasan berkenaan. JAS telah mengkaji
dan meluluskan Laporan EIA pada 22 April 2018.
SusulandaripadaPerintahBerhenti Kerja yang dikeluarkan oleh pihak JAS, JPNK telah
mengambil langkah-langkah mitigasi dengan mengarahkan pelesen untuk menjalankan kerja-
kerja pemulihan (remedy) kawasan bagi tujuan mengelak dan mengurangkan risiko bencana
alam sekitar sebab aktiviti pembangunan ladang hutan dihentikan separuh jalan dan terdedah
kepada risiko bencana. Selain itu, dikenalpasti terdapat lima (5) tandak air masyarakat yang
dibina tanpa kebenaran JPNK oleh penduduk setempat.
2.5. Perbincangan
Pada 20 November 2017, satu perbincangan dan lawatan tapak bersama Pengerusi
Jawatankuasa Penerangan, Pembangunan Luar Bandar, Pembasmian Kemiskinan merangkap
ADUN Belantik dan Jawatankuasa Kemajuan serta Keselamatan Kampung (JKKK) telah
diadakan di Kampung Paya Terendam. Dimaklumkan bahawa penduduk kampung telah
mendapat bekalan air yang bersih daripada Syarikat Air Darul Aman (SADA) tetapi masih lagi
ada baki penduduk yang masih menggunakan tandak air sebagai bekalan air bagi kegunaan
harian. Malah PMBK dengan kerjasama JPNK telah mengambil inisiatif menyediakan kolam
takungan air masyarakat yang baharu untuk kegunaan kira-kira 400 penduduk setempat.
Gambar tandak air yang tidak digunakan dalam kawasan aduan adalah seperti di Rajah 2.
Gambar diambil ketika musim hujan. Lazimnya air keruh pada musim hujan dan jernih pada hari
biasa.
436
Rajah 2 – Tandak air
Rajah 2: Tandak air yang tidakdigunakan
3. METODOLOGI KAJIAN
Dalamf alsafah penyelidikan, terdapat dua pendekatan yang telah diterimaiaitu

pendekatan secara kuantitatif ataupun pendekatan secara kualitatif. Kaedah penyelidikan
selalunya dijalankan bagi projek individu ataupun penyelidik samaada dengan menggunakan
pendekatankuantitatifataupunkualitatif (Neumann, 1994). Penyelidikanini dijalankanbagi
mengetahui lebihlanju ttentang sector perhutanan dan isu pembalakan yang berlaku. Data yang
diperolehi adalah melalui sumber seperti berikut:
i. Data Primer
InimelibatkantemuramahdenganpihakpegawaiJabatanPerhutananNegeri Kedah
secaralangsung yang
bertanggungjawabsepenuhnyadalampengurusandanpembangunanseluruhkawasanhuta
n di Negeri Kedah.
ii. Data Sekunder

Manakala data sekunderdalamkajianiniadalahhasilpembacaan yang
diperolehidaribukurujukanjabatan-jabatan, jurnal, dansuratkhabar.
4. KESIMPULAN
Bagikajianlapangan di HutanSimpan Bukit EnggangSik, tindakansegeraolehpihak JPNK

telahmengesyorkan agar membuatpemantauanberterusan di
laluanmasukutamakekawasanlesendenganmembinapagardanpenempatankakitanganbagitujuan
pemantauan. Keduanyaialahmelaksanakankerja-
kerjabagimengurangkanrisikohakisanmelaluitanamantutupbumi (rumputvertiver).
Namundemikian,
pelantindakanjangkapanjangperludirangkadenganlebihefektifsupayakejadianinitidakberulanglagi
di mana-mana kawasan hutan. Senaraicadangan yang bolehdilaksanakanolehpihakberwajib
seperti Good Forest Practices,penanamanpokokspesieshutan, KempenMenanam 26 Juta
Pokok, penanamansemulapokokbakau, projek CFS, SistemPengurusanMemilih (SMS),
danpembalakankurangimpak (RIL)
dapatmemberiimpakpositifdanmemuliharasistembiodiversitidan ekosistem alam sekeliling di
Malaysia. Denganitu,
kajianinidiharapkansedikitsebanyakmemberikanpanduankepadapihakberkuasa di
dalammenetapkanzonkawasanhutan yang bolehdantidakboleh di bangunkan. Maklumat
437
dankajiansedemikiandapatdijadikangarispanduan dalam menyediakan piawaian atau dasar-

dasar bagi pelan pembangunan baru di masa hadapan.
-CS02-
Lembaga BiasiswaNegeri Kedah
Muhammad Annas Baharudin

Pusat Pengajian Kerajaan, Universiti Utara Malaysia,
anneih312@gmail.com
Abstrak
Tujuan penulisan kajian kes ini adalah untuk mempelajari, menganalisis, merancang dan
membuat cadangan penambahbaikkan terhadap beberapa isu penting yang dihadapi oleh
LBNK terutamadalammengenalpastikaedah pengoperasian samaada beradas ebagai Badan
Berkanun Kerajaan Negeriataupun berubah menjadi Unit di bawah Bahagian Pengurusan
Sumber Manusia.Pengurusan LBNK pada ketika ini beroperasi sebagai satu unit di bawah
pentadbiran Bahagian Pengurusan Sumber Manusia (BPSM), Pejabat Setiausaha Kerajaan
Negeri Kedah dan diketuai oleh Setiausaha Bahagian Pengurusan Sumber Manusia merangkap
Setiausaha LBNK dan dibantu oleh Penolong Setiausaha Kerajaan (Pembangunan Sumber
Manusia) merangkap Penolong Setiausaha LBNK. Pengurusan dan tadbir urus LBNK telah
mendapat teguran daripada Y.Bhg Dato‘ Penasihat Undang-Undang Negeri Kedah disebabkan
pengurusan sedia ada tidak selari dengan peruntukan yang termaktub di dalam Enakmen yang
pada ketika ini berfungsi sebagai sebuahunit di bawah pentadbiran BPSM.Sehubungan itu,
selepasbeberapa perbincangan, lawatan penanda aras dan kertas ringkasan disediakan, ahli
Mesyuarat Induk Lembaga Biasiswa Negeri Kedah Bil 1/2017 telah bersidang pada 27
November 2017 dan memutuskan supaya LBNK distruktur semula daripada sebuah Badan
Berkanun Kerajaan Negeri kepada Unit Biasiswa dan Pinjaman, Bahagian Pengurusan Sumber
Manusia selaras dengan peruntukan Akta Prosedur Kewangan 1957 (Akta 61) di bawah
Seksyen 10.
Kata Kunci: Lembaga BiasiswaNegeri Kedah, LBNK, penstrukturan, pengoperasian
1. PENGENALAN
LBNK berfungsi sebagai salah sebuah organisasi yang menyalurkan dana pendidikan
melalui pemberian biasiswa kepada pelajar sekolah menengah di Negeri Kedah yang layak dan
menawarkan pinjaman pendidikan boleh ubah kepada anak-anak Negeri Kedah yang berjaya
melanjutkan pengajian ke peringkat Institusi Pengajian Tinggi Awam dan Swasta yang diiktiraf
dan berkelayakan.
Di samping itu, LBNK juga berfungsi untuk mengutip semula pinjaman pendidikan yang
dikenakan caj perkhidmatan sebanyak 2% atas baki pokok berkurang pada setiap bulan
sebagai salah satu daripada sumber pendapatan LBNK. Selain itu, terdapat juga waran
perjawatan daripada Jabatan Perkhidmatan Awam (JPA) bertaraf tetap dan berpencen yang
ditempatkan di LBNK berjumlah 12 orang. Untuk makluman, LBNK juga mempunyai pegawai
dan kakitangan lantikan Ahli Lembaga Pengarah Lembaga Biasiswa Negeri Kedah yang
berstatus tetap dan tidak berpencen serta kontrak berjumlah 11 orang. Selain itu terdapat
juga ”lacuna” di dalam Enakmen berkaitan kuasa melantik dan penamatan pegawai. Untuk
438
makluman, LBNK mempunyai pegawai yang dilantik di bawah kuasa Ahli Lembaga Pengarah
iaitu seramai 11 orang. Namun begitu, tiada proviso di dalam Enakmen berkaitan kuasa Ahli
Lembaga Pengarah untuk melantik dan menamatkan pegawai tersebut. Sehubungan dengan
itu, terdapat isu berkaitan ”validity” atau kesahan berkaitan pelantikan pegawai tersebut
disebabkan tiada punca kuasa untuk melantik dan menamatkan perkhidmatan pegawai
tersebut. Persetujuan untuk pelantikan pegawai hanya diputuskan di
dalamMesyuaratJawatankuasaInduk LBNK.
Batas perbelanjaan mengurus sedia ada bagi LBNK berjumlah RM 4,035,000.00 bagi
setahun. Isu yang timbul sekiranya LBNK menjadi sebuah badan berkanun yang beroperasi
sendiri adalah mengenai keupayaan LBNK untuk beroperasi sendiri tanpa menerima
peruntukan daripada kerajaan negeri. Berdasarkan kepada lawatan penanda aras ke agensi
lain, kebanyakan agensi tersebut masih menerima danaperuntukan daripada kerajaan
negeri pada setiap tahun kecuali Yayasan Selangor yang mampu menjana pendapatan sendiri
dan hanya menerima dana endowmen. Untuk makluman, sekiranya LBNK beroperasi sebagai
perbadanan, fungsi LBNK masih lagi dikekalkan iaitu sebagai pemberi pinjaman pendidikan
tinggi dan biasiswa kepada pelajar sekolah menengah. Maka peluang untuk LBNK menjana
pendapatan sendiri agak terhad melainkan sekiranya kerajaan negeri bersetuju untuk
menyumbang geran, dana atau memberikan sebarang aset kepada LBNK sebagai asas
untuk perniagaan. Walau bagaimanapun, tiada proviso di dalam Enakmen berkaitan kuasa
untuk LBNK bagi melaksanakan sebarang perniagaan.
2. ISU DAN ANALISA KAJIAN KES LBNK
Dalam aspek pengoperasian, kewangan dan pelaburan LBNK terdapat konflik yang tercetus
di mana LBNK sendiri tidak dapat mengenalpasti sama ada untuk beroperasi sebagai unit di
bawah Bahagian Pengurusan Sumber Manusia (kerajaan) atau beroperasi sebagai satu entiti
Badan Berkanun (Corporation). Sehingga hari ini LBNK masih beroperasi dengan mengguna
pakai kedua-dua kaedah atas pertimbangan yang mana memberikan kelebihan kepada LBNK
terhadapsatu-satuisuatausituasi.
Dengankekeliruansamaada harus beroperasi secara badan berkanun atas satu unit di bawah
kerajaan, LBNK akan mempunyai satu ruang kepincangan dalam hal guaman jika ada
peminjam yang ingin mencabar keputusan di mahkamah. Hal ini boleh menjadi kelebihan
kepada peminjam yang mana LBNK sendiri tidak kuat dari segi teknikal guaman berdasarkan
kekeliruan pengoperasian dan ini secara tidak langsung akan mengurangkan rasa ketakutan
kepada peminjam jikatidakmembayarbalikPinjamanPendidikan LBNK.
3. LANGKAH DAN CADANGAN PENYELESAIAN ISU LBNK
Langkah penyelesaian untuk isu LBNK kali ini akan fokus kepada isu yang pertama iaitu
dalam aspek pengoperasian, kewangan dan pelaburan LBNK terdapat konflik yang tercetus di
mana LBNK sendiri tidak dapat mengenalpasti sama ada untuk beroperasi sebagai unit di
bawah Bahagian Pengurusan Sumber Manusia (kerajaan) atau beroperasi sebagai satu entiti
Badan Berkanun (Corporation). Cadangan penstrukturan semula organisasi LBNK adalah
disebabkan terdapat beberapa isu yang timbul yang berkaitan dengan pengurusan pentadbiran
sedia ada. Sekiranya LBNK diputuskan untuk kekal sebagai sebuah Badan Berkanun Kerajaan
Negeri maka pengurusan LBNK memerlukan komitmen yang tinggi daripada Kerajaan
Negeri dari sudut peruntukandana kewangan dan juga bersetuju untuk menjadikan LBNK
sebagai ”one stop educational centre” di Negeri Kedah Darul Aman. Berikut merupakan
439
implikasi kewangan sekiranya LBNK dikekalkan sebagai Badan Berkanun Kerajaan Negeri
ataudistruktursemulasebagaiUnit di BPSM:
Jadual 1 ImplikasiKewangan LBNK SekiranyaDikekalkanSebagaiBadanBerkanunKerajaanNegeri

SKOP LBNK UNIT BIASISWA & PINJAMAN
Jumlah Dana RM 39 JUTA – RM 40 JUTA RM 5.4 JUTA
Peruntukan
Sumber  Caj perkhidmatan (RM 320,000)  Caj perkhidmatan (RM
Peruntukan  Prosespinjaman (RM 2,000.00) 320,000)
 Faedah dari simpanan (RM 200,000)  Proses pinjaman (RM
 Kutipanbalikpinjaman (RM 2,200,000) 2,000.00)
 Kerajaannegeri (RM 3,700,000)  Kutipan balik pinjaman
 LembagaZakat (RM 20,000,000) (RM 2,200,000)
 Yayasan Islam NegeriKedah (RM 5,000,000)  Kerajaan negeri (RM
 PerbadananMenteriBesarKedah& EXCO 2,828,000)
Pendidikan Negeri Kedah (RM 5,000,000)  Pulangan balik guaman
 Lain-lainbadankorporat (RM 1,000,000) (RM 50,000)
 Pulanganbalikguaman (RM 50,000)
Pengurusan Segala hasil akan dimasukkan ke akaun LBNK. Segala hasil akan dimasukkan
Hasil ke akaun Kerajaan Negeri.
Kaedah Mengekalkan Perbendaharaan Negeri Kedah
Kutipan Balik kemudahanbayaranbalikpinjamansediaadamelalui: perlu menyediakan kemudahan
Pinjaman  Kaunter Bank Islam dan BSN bayaran balik kepada pelajar.
 Internet Banking: CIMBclicks, JomPay,
BIMBebiz
 Kaunter UTC dan Wisma Darul Aman
Komponen Komponen tunai LBNK (pelaburan LBNK di Komponen tunai LBNK akan
Tunai simpanan tetap dan semasa) bernilai RM dipindahkan ke perbendaharaan
9,089,366 JUTA diuruskan oleh LBNK. bernilai RM 9,089,366 JUTA.
Pengurusan  Penambahan pegawai dan kakitangan kepada  Kerajaan Negeri perlu
Emolumen 35 orang disebabkan penambahan tugas dan membayar penambahan gaji
fungsi LBNK (Anggaran RM 1,142,000 JUTA) dan sumbangan bayaran
termasuk bayaran sumbangan berkanun berkanun (KWSP) kepada
(KWSP). 11 orang kakitangan LBNK
 Penawaran kepada kakitangan LBNK sedia yang ditawarkan
ada yang mempunyai waran perjawatan JPA sebagaikontrak di
seramai 10 orang yang melibatkanjumlah RM bawahPejabat SUK
706,176:kenaikantahunan RM 3,050). Kedah(Anggaran RM
480,000:kenaikantahunan
RM 1,350.00)
Bayaran  JabatanPendaftaran: RM 3,000 setahun  JabatanPendaftaran:Tiada
Kepada Agensi  JabatanAudit: RM 8,000 setahun  JabatanAudit:Tiada
Lain  Firma Guaman: RM 90,000 setahun  Firma
 RAMCI: RM 4,000 setahun Guaman:PenasihatUndang-
UndangNegeri
 RAMCI: RM 4,000 setahun
Perbelanjaan  Sewabangunan: RM 180,000 setahun  Sewabangunan:Tiada
Mengurus  Bayaranutiliti: RM 60,000 setahun  Bayaranutiliti:Tiada
Bekalan dan  Kenderaan: RM 250,000 (”one off”)  Kenderaan:Tiada
Perkhidmatan
Sehubungan itu, adalah disyorkan supaya Majlis Mesyuarat Kerajaan Negeri meluluskan
permohonan dan bersetuju supaya LBNK distrukturkan semula dan ditukar fungsi sebagai Unit
440
Biasiswa dan Pinjaman, Bahagian Pengurusan Sumber Manusia yang ditadbir urus selaras
dengan peruntukan Akta Prosedur Kewangan 1957 (Akta 61) di bawah Seksyen 10.
4. KESIMPULAN
Demi kelansungan kewujudan LBNK dan bagi mencapai efisyen dalam perkhidmatan
yang diberikan, LBNK perlu distrukturkan semula sebagai sebuah unit di bawah pentadbiran
Kerajaan Negeri Kedah Darul Aman. LBNK harus di buat penambahbaikkan dan pembetulan
dari segi penubuhan dan enekmen. Apabila asas penubuhan ini telah betul, pelbagai isu-isu
sampingan yang wujud sekarang ini dapat diselesaikan dengan mudah, secara tidak langsung
dapat membantu kerajaan negeri dalam penyaluran dana pendidikan negeri dan juga lain-lain
fungsi pendidikan secara efisyen serta meneruskan fungsi tajaan yang memberi impak yang
besar terhadap rakyatterutamarakyatnegeriKedahDarulAman.
RUJUKAN
AlamSiddiquee, N. (2006). Public management reform in Malaysia: Recent initiatives

and experiences. International Journal of Public Sector Management, 19(4), 339-
358.
Bertot, J. C., Jaeger, P. T., & Grimes, J. M. (2010). Using ICTs to create a culture of
transparency: E-government and social media as openness and anti-corruption
tools for societies. Government information quarterly, 27(3), 264-271.
Bryson, J. M. (2011). Strategic planning for public and nonprofit organizations: A guide
to strengthening and sustaining organizational achievement (Vol. 1). John Wiley &
Sons.
BukuBudjet 2017 Kerajaan Negeri Kedah Darul Aman.
EnakmenKumpulan Wang DermasiswaNegeriKedahDarulAmanTahun 1968
(En.6/1958).
Kraemer, K., & King, J. L. (2006). Information technology and administrative reform: will
e-government be different? International Journal of Electronic Government
Research (IJEGR), 2(1), 1-20.
LaporanTahunanBahagianPengurusanSumberManusia 2017.
-CS03-
Steering the Future Direction of Kulim Hi-Tech Park Local Authority & The Kedah
State Government Perspectives
Amal bt. Zubir

amal3373@yahoo.com
Abstract
441
The purpose of this paper is to analyse current situation of Kulim Hi-Tech Park Local
Authority (KHTP Local Authority) development in regard to expansion of its administrative
area,and to seek possible directions and justifications that the State Government may consider
in its decisionmaking process.The paper uses primary data and secondary data sources.
Primary data is based on series of interviewswith correspondents from relevant agencies. While
secondary data is from inspection on relevant documents and statistics from governments and
non-governments organizations, published reports and published information. In this writing,
based on analyses from multiple perspectives, the author finds justifications to support
alternative solutions forKHTP Local Authority‘s future direction. The supporting points
consequently provide concrete bases for the author to propose for the best solution to the
problem statement. The limitation of this writing is that extensive analyses on
macroeconomicperspectiveare not performed and only restricted to micro level just to give
sufficient ideas on the relevancy of KHTP Local Authority in the marketplace.
Key Words: Kulim Hi-Tech Park local authority, KHTP, micro perspective
1. INTRODUCTION
The Kulim district is identified as a potential economic‘s growth area in the northern region
of Peninsular Malaysia. In supporting the national government‘s policy, the Kedah State
Government has foreseen the importance to set up Kulim Hi-Tech Park Local Authority to
specialise its local government‘s roles and functions by performing local services dedicated to a
specialised park namely Kulim Hi-Tech Park (KHTP).
The growth of industrial development in KHTP drives a demand for further expansion of
area from 4,883.08 acres to 12,396.20 acres of land due to the fact that the existing phase is
getting densed, that it could not support for incoming development. The demand for KHTP
expansion should also impacts the KHTP Local Authority‘s administrative area. A conflict arises
as there is another local authority in Kulim district, namely Kulim Municipal Council. As there are
two (2) local councils governing local areas in one (1) district, any expansion in a particular local
administrative area will result to a shrink in another local council‘s area.
The issue of the local authority‘s area expansion is getting complex as it is intertwined with
the issue of future direction of KHTP Local Authority itself. Both issues remain unresolved for a
very long time without final decision by the Kedah State Government. In relation to sustain
KHTP as the National‘s interest and also for the State‘s interest, the Kedah State Government
should initially decides and sets direction for KHTP Local Authority.
3. ANALYSES AND DISCUSSIONS
3.1. Swot Analysis on KHTP Local Authority
3.1.1. Strength
i. Dedicated service delivery

ii. Strong leadership
iii. Financial stability
442
3.1.2. Weakness
i. Contract based employees

ii. The status of ―modified Local Authority‖
iii. Less supervision by the Ministry of Urban Wellbeing, Housing and Local Government
3.1.3. Opportunity
i. Funds injection from Ministry of Finance (MOF)

ii. Major potential for tax revenue from industrial sector
iii. Enjoying the KHTP‘s reputation spill-over
3.1.4. Threat
i. Uncertainty of future direction
3.2. Legal Perspective
3.2.1. Powers to commence operation as a local authority
The KHTP Local Authority is established under Section 11(4) and 11(5) of The Kedah
State Development Corporation Law 1956. The provision of Section 11(4) has outlined duties
and powers of the Corporation that subjects to any written laws, to act as local enforcer in a
particular area other than areas administered by local authorities.
3.2.2. Compliance to laws and legislations
In the Kedah State Government Gazette dated 19 January 2012, the Kedah State
Authority had approved Orders in regard to modification of the abovementioned Acts and
subsidiary legislations made under it. In short, the modifications were made to name the KHTP
Local Authority under the definition of local authorities in the respective Orders.
3.2.3. Future direction of KHTP Local Authority
Several options shall be considered by the State Government for the Council for instance;
i. KHTP Local Authority to become as a pure local authority or,

ii. To become a corporation with its own enactment or,
iii. To merge with Kulim Municipal Council, and creating a special Section to oversee and
manage KHTP issues.
3.3. Local Planning Perspective
3.3.1. Powers to commence operation as a local planning authority
In enforcing its functions as a local authority, the KHTP Local Authority refers to the Town
and Country Planning Act 1976 (Act 172). However, to validate the use of Act 172, modifications
are made in the (Modification of Use) (Town and Country Planning Act 1976) Order 2009, that
declares KHTP Local Authority as a local planning authority for Kulim Hi-Tech Park (KHTP). The
modification was made in Section 2 of the Order, to include KHTP Local Authority in the
definition of local planning authorities.
443
3.3.2. The area expansion: to what extend?
Any expansion in KHTP area will also affect the expansion of KHTP Local Authority‘s
administrative area. To meet the incoming demand, the KHTP has submitted a proposal on the
area expansion from 4,883.08 acres to 12,396.20 acres of land.However, to what extend that
the area expansion should be taking place? This issue should again, relate to the State‘s
decision on future direction of KHTP Local Authority.
3.3.3. Working behind the KHTP’s shadow: a leader or a feeder?
The KHTP Local Authority seems to work under the shadow of Kulim Technology Park
Corporation Sdn. Bhd. (KTPC) in completing the development request by the KTPC as the
Parks‘s developer. In this case, KTPC actually leads the development in KHTP, while KHTP
Local Authority merely feeds the KTPC‘s request in term of providing and applying for area
expansion in KHTP.
3.4. Maintaining the National’s And State’s Interest
As many initiatives and priorities being given to develop the KHTP as a high technology
industrial Park by National and StateGovernments, KHTP currently becomes the interest of both
governments that they can be proud of.
3.5. KHTP Local Authority’s Stand
From a series of interviews with correspondents among KHTP Local Authority‘s officers,
they are with a stand to remain on current status quo as a modified local authority in order for
the Council to enjoy MOF‘s grants, and they are persuing the application of area expansion to
the State level.
3.6. The State’s Development Plans
In the Term of Reference of Kedah Development Plan 2019-2035,is the emphasis on the
strength and potential of each district in Kedah State. As for Kulim district, the State will focus
on high technology industries competitive advantage. Most importantly, the State development
matters should be looked at from a wider perspective and a long run direction that aims to
benefit the people at large.
4. ALTERNATIVE SOLUTIONS AND JUSTIFICATIONS
4.1.1. Remains as status quo
For any area expansion being approved to the KHTP Local Authority, will result to an
alteration of size to existing administrative areas of Kulim Municipal Council.
4.1.2. Merger with Kulim Municipal Council, together with an establishment of a special
unit
Another option highlighted by the State Legal Advisor is the merger of both KHTP Local
Authority into the administrative structure of Kulim Municipal Council, together with an
establishment of a special unit to handle matters in relation to KHTP and industrial clients.
4.1.3. Becomes a district council
444
KHTP Local Authority is currently unable to fulfil a criterion on local population factor
although the rest of the criteria are fulfilled by the Council. Therefore, for now, this alternative
cannot be adopted.
4.1.4. Becomes a corporation
For now, the KHTP Local Authority does not fulfil the criteria as a District Council to hold a
pure local authority status. However, the Kedah State Government can decide on an option for
KHTP Local Authority to become a corporation under its own Enactment passed by the State
Authority. For a corporation to be established, the State Government shall make and endorse
an Enactment in regard to the corporation to carry out its power to administer its own local area
and also perform duties as a local authority. One of models of a corporation body is the
Perbadanan Putrajaya.
5. PROPOSED SOLUTION: MERGING OF KHTP LOCAL AUTHORITY WITH KULIM

MUNICIPAL COUNCIL,TOGETHER WITH AN ESTABLISHMENT OF A SPECIAL UNIT
From alternative solutions and analyses, this is to propose that the State Government
should decide on the merging of KHTP Local Authority within the Kulim Municipal Council, and
also establish a special unit to govern the KHTP area.The justifications are as follow;
i. The merger between both local authorities creates synergy when both Council have their
unique competitive advantages and strength
ii. Ensure a well balance development component in the district. As for planning permission
application, processes of approvals can be executed efficiently with the help of OSC
online system.
iii. The merger also offers a permanent and brighter career path for the KHTP Local
Authority‘s contractual employees because the Kulim Municipal Council has mentioned
its willingness to recruit these employees into the Municipal Council‘s organizational
structure.
6. RECOMMENDATIONS
In line with the area expansion issue, the most important point is that overall development
planning for the Kulim district has to be kept as a balance development planning, rather than
targeting on a particular area of development.
7. CONCLUSION
The State Government has to critically address and analyse this expansion issue from a
holistic point of view as to ensure a balance and sustainable development for the whole Kulim
district is achievable.
The importance of maintaining KHTP as the National‘s and the State‘s interest is
considered a huge agenda for both government, as it spurs the economic growth in Malaysia
generally, and in Kedah State particularly.
State development should be looked at from a wider perspective and a long run direction,
rather than a political-actors approach. In fact, the ultimate goal in developing a state or a
nation, is for the benefits and enjoyment of the people.
445
REFERENCES
Kulim Hi-Tech Industrial Park Local Authority, (2016), Background, Retrieved April 27, 2018 at
00.44AM from http://www.pbttphtk.gov.my/en/pbttphtk/profile/background
Kulim Technology Park Corporation Sdn. Bhd., (2018), Our Investors From All Over The World,
Retrieved April 27, 2018 at 00.14AM from https://www.khtp.com.my/directory.html
Malaysian Investment Development Authority (MIDA), (2018), Incentives for High Technology
Companies, Retrieved April 26, 2018 at 23.47PM from
http://www.mida.gov.my/home/incentives-in-manufacturing-sector/posts
-CS04-
Licensing Management Challenges: The Case of Migrants’ Application of Food
Establishment and Industrials/Trade Business
in AlorSetar City Council
JazilahJalaludin
Abstract
This study aims to examine the challenges in dealing with licensing issues involving the
business of food and business establishments / trade conducted by foreigners in the case of
AlorSetar City Council. The influx of foreigners who run non-licensed food stalls andrestaurants
business is increasing widespread. However, no appropriate action imposed towards them. The
study employed qualitative design with interview session with two license department officers
from AlorSetar City Council. The findings demonstrate that AlorSetar City Council facing with
difficulties to implement the laws towards illegal business conducted by foreigners as most of
them closed their premises during the raid and inspection. There are foreigners who do
business by selling food and other businesses such as grocery stores by hiring shop lots or land
from local people. They are also found to have rented shops and land for the purpose of being
used as a business site space such as a restaurant or business of goods from their home
country. Based on the existing provisions of the bylaw, there is no provision stating that
business by foreigner is not allowed. The use of the existing legislation of the bylaws has to be
reviewed from the aspect of licensing for the purpose of enforcement on unlicensed foreigners'
premises.
Key Words: Alor Setar City Council, Licensing, Food Premises, Legislation
1. INTRODUCTION
Local government plays critical roles in promoting well-being society by providing basic
public facilities. The basic services provided by the local governments is to issue licenses to
businesses in their area of administration. The requirement of this license is to uphold the
security and health of the local community as well as to generate income to the local
446
government. It is challenging for local governments to tackle the problem of misuse of business
premises particularly eateries in which the shop owner rent them out to foreigners. The current
scenario is that most premises checked by local governments had a valid business license and
no action could be taken against foreigners doing business at private premises. High price
offered by foreigners caused local people to rent out businesses including their registration
certificates and their premises to them. Licensee will receive more profits each month compared
than just a few if they run their business on their own. In line with the issue, the state
government is of the opinion that local governments should carry out joint responsibility with the
Immigration Department to take action by regulating business activities by foreigners to avoid
monopoly by them in business. Local governments in Kedah through the direction of the Local
Government Division dated 25 September 2014, with the existing policy, insisting that no
hawker license will be passed on to foreigners. (Kedah Local Government Department, 2014).
This is because the influx of foreigners in local governments‘ area throughout Kedah is definitely
a concern for the locals. In fact, the huge number of uncontrolled business without a license will
have a negative effect not only on sustainable economic development and social security but
also on national security. The huge amount of uncontrolled businesses has become concerns,
disputes and questions as why they are allowed to do business. This study will discuss
challenges facing by AlorSetar City Council in dealing with licensing of foreign premises and
control mechanism recommendation for local governments.
In the State of Kedah in particular, there are many foreigners who carry out business of
selling food and beverages in premises or on permanent sites. The premises or sites
mentioned, are intended to be a business site space such as restaurants and eateries. Based
on statistics from the Kedah Immigration Department, the number of illegal immigrants arrests
made in 2016 is 49,496 and in 2018 as of March is 16,214 with a total of 114,174 arrest. (Kedah
Immigration Department, 2018). The problem of increasing number of foreigners doing business
and conducting non-licensed restaurant and food business is increasingly widespread where
there is no enforcement action nor any legitimate legal action taken on these foreign
businessmen. Based on the Secretary General's Circular of the Ministry of Housing and Local
Government No. 3 Year 2008, it does not allow permits for small businesses (hawkers) who run
into small business activities such as farmer‘s market, night market or other small businesses.
(Circular of the Ministry of Housing and Local Government No. 3 Year, 2008). Other than that,
based on the circular, there is no legal clause in the Food or Industrial Establishment bylaws
that authorizes foreigners to have premises in the local government‘s area and to run business.
Yet the number of foreigners doing business has mushroomed in recent years. AlorSetar City
Council‘s Policy Maker Division which is the Legal Division, has presented paper by referring
and seeking views from Kedah Legal Advisory Office regarding the matter of licensing Food
Establishment to foreigners doing business in AlorSetar City Council‘s area. The paper has
been tabled in the Licensing Committee No. 7/2017 and as a result, the committee has rejected
this paper for approval. This is because it need to be discussed further with Kedah Local
Government Division for policy formulation purposes. Following the rejection of the paper, a
study was conducted to see its implications for AlorSetar City Council in the matter of licensing
447
of food establishments to foreigners in its area. Issues that arise are restaurants or business
premises / trade owned by foreigners continue to operate without licenses for years due to
licenses that cannot be given to foreigners or permanent residents. To what extent can this
issue be resolved, is still unclear as the provision under the Food Establishments Act (Kota
Setar Municipal Council) 1989, and AlorSetar City Council Business and Industrial Trade
Premises Act of 2010 state that business permits are granted to Malaysian citizens only.
3. METHODOLOGY
This study uses qualitative methods and primary data conducted through interviews with
two AlorSetar City Council‘s officers including Head of Licensing Division and Legal Officer to
give an opinion on the assessment and comparison of licensing and regulatory procedures
relating to issue of license to foreigners. Statistical data used has also been received from
Kedah Darul Aman Immigration Department, Alorsetar City Council‘s Enforcement Division and
licensing policy information from local governments of the states in Peninsular Malaysia via
electronic mail. In addition, secondary data is also collected through licensing files and online
data such as departmental websites and libraries through thesis, journal articles and
newspapers to obtain current issues.
4. ANALYSIS ON APPLICATION PROCESS OF FOOD ESTABLISHMENT AND

BUSSINESS/TRADE IN ALOR SETAR CITY COUNCIL
4.1. CASE STUDY 1
Sala Classic Tom Yam and Seafood Restaurant located at Lot 5468, Plot 5-6,
JalanAlorMengkudu 05400 AlorSetar is owned by local people who have permanent status and
have been operating for more than two years. Action notice and compound has been made by
the MBAS Enforcement Division but the owner still fails to apply for a license. In August 11,
2015, a license application from Sala Classic Tom Yam Restaurant license holder had been
received on behalf of EnFauzi bin Ramli, identity card number 681228-02-5471 and the
application of the license was approved on 5 September 2015. The license holder has 17
employees from Pattani, Thailand. The question here is that after compound and notice action
had been taken for several times in two years, obviously, the license holder still failed to submit
the application and continued to operate without a license. Is a non-citizen factor had caused a
problem to the license application?
4.2. CASE STUDY 2
Another case is about an Application for retail shop license by Navee Yusof bin Mohamad,
identity card number 781107-76-5017. He is a permanent resident and opens a mini market
(retail) shop located at KM 13, Jalan Datuk Kumbar, 06500 AlorSetar, Kedah. He is from
Pakistan. On March 5, 2017 a license application was made by the owner and it was rejected on
the grounds of non-Malaysian citizens.
448
5. EXISTING LAW USED FOR LICENSING OF FOOD AND BUSINESS/TRADE

ESTABLISHMENT IN ALOR SETAR CITY COUNCIL
i. Under Local Government Act of Food Establishment Licensing bylaws (Kota

SetarMunicipal Council) 1989, bylaw 2, interpreted 'Food Establishment' as ‗any place
where food was prepared, packaged, prepared for sale, manufactured, or displayed for
sale for human consumption.‘ Based on the interpretation, restaurants, coffee shop and
factories are included in food establishments. Since food shop, restaurant and factory
business activities are included in the interpretation of food establishments, therefore, they
are under the jurisdiction of AlorSetar City Council.
ii. The Food Establishment bylaws 3, has generally established that any premises within the
area under the administration of the City Council to be used as a food establishment must
have a license issued under these bylaws by the Council. This indicates that business
licenses issued by AlorSetar City Council are required for the establishment of food
business premises. Bylaws 3 (1), provides for the following: 'None of the places within the
Council area may be used as food establishment unless it has been licensed under these
bylaws by the Council for that purpose'.
iii. Bylaws 3 (2), provides that the Council may fix the rates for license fees issued under
these bylaws for a food establishment as specified in Schedule 1 of the bylaws. The
provisions of by-law 3 (2) are as follows; "The fees payable for a license under the bylaws
shall be as set out in Schedule 1. The Council may vary the rate of payment of this fee
from time to time but the change shall not exceed the rate set forth in the Schedule". "Item
8-9 Table 1 of bylaws, provides the license fee for food establishment as follows: meals -
not exceeding RM200.00 per year, food stalls within licensed premises - not more than
RM 50.00 per year".
iv. Bylaws 4 (1), Licensing of trade and industrial premises (AlorSetar City Council) 2010
provides that "an application for a license under bylaws 3 shall be made to the Council in
such form and manner as the Council may determine‖.
6. DISCUSSION AND IMPLICATION
There is no provisions of the Food and / or Business Establishments Act of Trades from
AlorSetar City Council prohibits foreigners from doing business. They can do business because
they do not have any restrictions or prohibitions on the law. Although bylaws does not allocate
any restrictions to issue food and business establishments / trades licenses to foreigners,
AlorSetar City Council does not grant licenses to foreigners based on the Secretary General's
Circular of the Ministry of Housing and Local Government No. 3 of 2008 and instructions from
the State Government regarding the implementation of Committee's decisions of Foreign
Worker Cabinet and Foreign Immigrants (JKKPA Illegal Immigrants), the 12th anniversary of
25th September 2014 (2) (2) (ii) that imposing legal action on employers issuing licenses to
foreigners including in cases related to Thai tom yam workers for chef's post.
The biggest challenge faced by Alorsetar City Council‘s enforcement agencies among
others is to enforce bylaws towards those who have violated the law. Political intervention is one
of the biggest challenges in the effort to enforce the law. Apart from that, the lack of cooperation
in term of enforcement between Local Authority and the Immigration Department had caused
foreigners to become bold to work in eateries. For example, there are cases where some local
people are protecting illegal immigrants when it is clear that it is an offense under section 56 (1)
449
(d) of the 1959/63 amendment to the 2002 amendments. However, those foreigners without
valid document often manage to be freed when it involves interference from politicians and
authorities had no choice but to agree on the intervention.
It is found that Thai business has become attractive to all residents of AlorSetar especially
food like tom yam cuisine. There are many Malay restaurateurs who employ foreign workers for
business purposes. In their restaurant, it is found that their cooking ingredients are imported
from neighboring countries and this indirectly attracts people to come to the restaurants. The
crisis and dilemma of the local community here is that many people choose to visit a shop or
restaurant operated by foreigners and not locals as their cooking is much better and open till
midnight. Even though most of the foreigners do not have a license and do not apply for a
license because they are not Malaysian.
This has become a problem to local stalls and restaurant operators and made complaints
as there are not many customers coming or eating at their stalls or restaurants. The impact of
this scenario to local community is that business environment is increasingly getting competitive
and increasingly threatened Malay economy. Inspection from AlorSetar City Council needs to be
done from time to time to ensure that local traders or restaurateurs do not lease their premises
to foreigners as it has become a major issue in AlorSetar and other local governments as well.
A good monitoring and inspection system from AlorSetar City Council, cooperation and
collaboration from traders in prioritizing local workforce is also important to ensure both local
and country's economy is not affected by the influx of foreigners and culture brought by them. If
a business license is to be granted to a foreigner, AlorSetar City Council needs to place more
stringent requirements so that the rights of local traders and business are not denied.
7. RECOMMENDATION
Kedah Legal Advisory Office is of the view that there is no restriction on the proposal to
allow food and business establishments / trade licenses issued to foreigners conducting food
business around AlorSetar City. However, Kedah Legal Advisory Office recommends that some
amendments to be made to bylaws or provisions for the purpose of nullifying existing provisions
and for more efficient implementation and in line with the policy recommendations being made
possible by AlorSetar City Council. The standardization by Local Government Division and the
State Government of Kedah should be made clear to facilitate all local governments to carry out
a uniform policy throughout the State of Kedah in cases where it is appropriate or not for certain
business premises to be licensed. If it is appropriate, the first thing to consider is to require
capital of a proper premises of a company to be licensed, to set the type of location for the
premises, to consider type of building and type of business activity allowed. Besides, it is also
important to consider terms of reference and approval of the application and to place deposit
money by type of sale. All these policies are introduced to control the entry of foreigners into the
agricultural and livestock sectors. In addition, foreign workers are also not allowed to work as
front liners in service sector. This step is to provide local people with opportunities to work in
fast food restaurants, convenience stores and hotels while maintaining the image of the country.
In addition, the government through the Ministry of Home Affairs stipulates that the approval of
foreign workers' recruitment is based on the number of employer / company requirements by
creating quota for each company requiring foreigners. The government also introduced
450
programs for illegal immigrants such as the 3 + 1 pardon program, rehiring for over-staying
foreigners who is having valid documents and having employers, e-cards for those without valid
travel documents and working illegally in Malaysia and provide them temporary work permit
card. Apart from that, improvements in term of operations have to be further strengthened
between AlorSetar City Council and Kedah State Immigration Department in the effort to combat
illegal immigrants. The implementation of the e-card program which expired at the end of June
2017, was the main strategy of the government in addressing the influx of illegal immigrants in
Kedah. Foreigners, who do not have valid travel documents, are no longer allowed to work
within the country for failing to comply with the designated deadline.
8. CONCLUSION
The problem of national dependence on foreign labours is very high today in the services,
construction, plantation, and manufacturing sectors. This bilateral symbiosis is very beneficial to
both sides. However, in terms of licensing, the government needs to take into consideration the
interests of local citizens so that business activities can be controlled by local people and
foreigners do not monopolize the business sector in our country. The standardization of
foreigners licensing issues for businesses under Food and Business / Trade Establishments Act
is very much expected to be implemented as soon as possible. Thus, all local governments in
the Kedah through Local Government Division have to take the approach to discuss this issue
clearly and thoroughly based on factors of economic development of local people and influx of
foreigners, especially in the area of administration of the local governments.
REFERENCES
Act 776. (2016) AktaKeselamatanNegara.Undang – Undang Malaysia.
By law of food establishment (MPKS) 1989.
By law of hawker licensing (MBAS) 2013.
By law licensing of commercial and industrial businesses. (MBAS)2013.
Che Hashim Hassan (2007) BuruhAsing Di Malaysia: Trend, Kaedah, Kesandan

Masalahdan Cara Mengatasinya.Jati Vol 1.
Foreign statistics data by sector 2017, Department of Statistics, Malaysia
Immigation Act 1959/63 (Act 155) Regulation and Orders and Passport Act 1968 Act.
IlbInternatinal Law Book Services
―ImplikasiBurukKebanjiranPendatangTanpaIzin‖ BH online., 24 Mei 2015
451
Intan Suria Hamzah et al. (2016) Implikasi Kemasukan Pekerja Asing:

SuatuTinjauanAwal.Jurnal Sains Insani.
―MenanganiIsuLambakanPekerjaAsing‖ BeritaHarian., 27 March 2016.
Mohd Na‘eim bin Ajis et al. (2014) The Dilemma of Managing Foreign workers in Malaysia:
Opportunies and Challenges: Global Journal of Human Social Science.
Mohd Ridzuan b. Abd Manaf. (PegawaiPelesenan MBAS) TemubualIsuPelesenan MBAS.

Kedah. Jan 2018.
-CS05-
Laporan Banjir di Kampung Alor Gunung, Alor Setar
Shahruzzaman Jibin
Abstrak
Banjir secara umumnya selalu menjadi permasalahan, terutama di Kawasan pedalaman.
selaras dengan perkembangan kehidupan masyarakat yang semakin maju dan moden, serta
memerlukan rasa aman terhadap bahaya banjir yang selalu mengancam pada musim hujan. Di
samping itu banjir dapat mengganggu aktiviti kehidupan masyarakat yang mengakibatkan
kerugian material dan bencana terhadap masyarakat yang berada di kawasan tersebut.
Bersamaan dengan timbulnya permasalahan banjir yang semakin kompleks, kemungkin
terjadinya perubahan adanya kejadian banjir. Kerosakan di pengairan sungai yang
mengakibatkan perubahan pun faktor aliran banjir sungai. Hakisan daripada pembalakan juga
menjadi punca secara umumnya yang menyebabkan berlaku banjir secara tiba-tiba atau
dikenali sebagai banjir kilat. Laporan ini adalah untuk mengetahui punca-punca banjir dan
penyelesaian masalah di salah sebuah kampung di daerah Kota Setar. Responden terdiri
daripada penduduk dari Kampung Alor Gunung sendiri, telah ditemuduga secara langsung
sebagai sampel untuk membuktikan dakwaan banjir telah berlaku. Pengumpulan data adalah
berasaskan penyelidikan tinjauan yang memanfaatkan kaedah laporan. Dapatan menunjukkan
ada pelbagai faktor yang telah menyebabkan banjir berlaku di Kampung Alor Gunung.Data-data
daripada agensi yang terlibat telah digunapakai untuk membuktikan bahawa terdapat faktor-
faktor lain yang menyebabkan banjir berlaku. Untuk menyelesaikan masalah banjir yang berlaku
ini, pelan jangka masa pendek dan panjang telah dicadangkan bagi menangani isu ini supaya
tidak berulang lagi.
Kata Kunci: Banjir, Air
452
1. PENGENALAN
Sebelum nama Jabatan Pengairan dan Saliran (JPS) dikenali sebagai Jabatan Parit dan
Tali Air (JPT). Sebelum JPT yang telah ditubuhkan pada tahun 1932, semua kerja yang
berkaitan dengan parit dan tali air menjadi tanggungjawab Jabatan Kerja Raya. Ekoran
kemerosotan industri timah dan getah pada lewat tahun dua puluhan dan keadaan beras yang
menjadi semakin runcing di negara ini, Pesuruhjaya Tinggi British pada waktu itu melantik
Jawatankuasa Penanaman Padi pada tahun 1930 untuk menentukan ―langkah terbaik yang
perlu diambil bagi menggalakkan penanaman padi di Tanah Melayu‖. Jawatankuasa ini telah
membuat kajian yang menyeluruh dan menerbitkan laporannya pada tahun 1931. Salah satu
saranan utamanya adalah ―sebuah Jabatan Parit dan Tali Air hendaklah ditubuhkan untuk
Negeri-Negeri Selat dan Negeri-Negeri Melayu Bersekutu dan penasihat di Negeri-Negeri
Melayu Tak Bersekutu, yang akan menyerapkan Cawangan Hidraulik Jabatan Kerja Raya,
Negeri-Negeri Melayu Bersekutu‖. Saranan ini telah diterima sebagai sebuah jabatan yang
berasingan pada 1 Januari 1932. Tiga fungsi utama JPT, iaitu pengairan, saliran pertanian dan
pemeliharaan sungai telah dilaksanakan selama empat dekad tanpa sebarang perubahan
sehinggalah pada tahun 1971 berikutan banjir yang banyak merosakkan harta benda di seluruh
negara pada bulan Disember 1971. Berikutan ini, pencegahan banjir dan hidrologi telah
disenaraikan sebagai fungsi tambahan Jabatan. Dengan demikian, sejak 1972, pencegahan
banjir menjadi salah satu tanggungjawab utama JPT dan dengan ini terbentuklah Bahagian
Hidrologi. Jabatan Pengairan Dan Saliran Negeri Kedah telah ditubuhkan pada tahun 1947
merangkumi Negeri Kedah Darul Aman dan Perlis, dikenali sebagai Bahagian Parit dan Tali Air
Kedah/Perlis dan beribu pejabat di Alor Setar.Pusat pentadbiran pada masa itu adalah di Balai
Seni Negeri sekarang yang diketuai oleh seorang Jurutera Negeri.
2. LATAR BELAKANG
Kampung Alor Gunung, Alor Setar ini adalah salah sebuah kampong yang terlibat
secara langsung dengan pembinaan Rancangan Tebatan Banjir (RTB) Sungai Kedah/Anak
Bukit. Pada penghujung tahun 2017, beberapa siri banjir telah berlaku di kampung ini yang
menyebabkan kerosakan kepada rumah penduduk sekitar. Dilaporkan oleh penduduk setempat
hampir 14 kali dalam tempoh beberapa bulan. Rata–rata penduduk yang ditemui menyatakan
punca kepada kejadian banjir tahun ini disebabkan projek RTB Sungai Kedah/Anak Bukit yang
belum siap sepenuhnya. Untuk itu, saya dibantu oleh Bahagian Hidrologi Jabatab Pengairan
Saliran Negeri Kedah telah menyiapkan satu pelaporan ringkas berkenaan kejadian banjir di
tempat ini bagi melihat punca sebenar kejadian banjir yang berulang ini.
3. OBJEKTIF
i. Laporan ini adalah untuk mengetahui punca-punca sebenar berlakunya banjir di Kampung
Alor Gunung, Alor Setar.
ii. Laporan ini ini juga akan memberi kaedah atau pelan yang boleh diatasi banjir yang berlaku
di Kampung Alor Gunung.
453
4. METODOLOGI LAPORAN
Laporan ini menggunakan data primer sebagai sumber utama laporan. Kaedah ini yang
digunakan dalam mendapatkan data ialah kaedah kaji selidik dengan sokongan kaedah
pemerhatian, pengambilan gambar dan temubual. Penduduk kampung telah memberi
kerjasama yang baik sepanjang temubual dibuat. Bagi mencapai objektif kajian iaitu
mengetahui punca-punca banjir yang berlaku di Kampung Alor Gunung, Alor Setar, beberapa
data telah dimasukkan ke dalam laporan ini seperti data kenaikan paras air sungai dan curahan
hujan. Data-data ini digunakan untuk meneliti punca sebenar terjadinya banjir di Kampung Alor
Gunung, Alor Setar.
5. PELAKSANAAN
i. Laporan ini dibuat dari bulan Februari – Mei 2018, sepanjang berada di Jabatan
Pengairan dan Saliran Negeri Kedah Ibu Pejabat (Bahagian Khidmat Pengurusan).
ii. Data-data yang diperolehi adalah pada penghujung Disember 2017 yang melibatkan
kawasan banjir di Kampung Alor Gunung, Alor Setar. Data-data laporan ini dibekalkan
oleh Bahagian hidrologi tetapi laporan tidak pernah dikeluarkan sebelum ini.
iii. Laporan yang dibuat ini sentiasa di pantau oleh Bahagian Hidrologi ini kerana setiap
ulasan yang diberikan adalah selari dengan pendapat yang dikemukan perlulah mendapat
kata akhir daripada Bahagian Hidrologi.
6. IMPLIKASI KEWANGAN
i. Laporan yang dibuat tidak memerlukan kos yang tinggi kerana kawasan yang terlibat
adalah berdekatan dengan di dalam daerah yang sama dengan Ibu Pejabat Jabatan
Pengairan Dan Saliran Negeri Kedah.
ii. Disamping itu, data-data telah disediakan dengan bantuan Bahagian Hidrologi dengan
alat kelengkapan yang canggih bagi memudahkan laporan dibuat dengan terperinci.
Bantuan dari agensi kerajaan lain seperti MADA yang membekalkan data juga dapat
mejimatkan dan melengkapkan lagi kos laporan ini.
7. HASIL LAPORAN
i. Secara keseluruhannya, laporan ini dapat membantu Jabatan Pengairan Dan Saliran
meyemak dan megetahui punca-punca sebenar kejadian banjir yang berlaku di Kampung
Alor Gunung.
ii. Pelan dan tindakan telah disyorkan sendiri sama ada melalui kaedah yang diberikan oleh
kontraktor binaan dan daripada Jabatan Pengairan dan Saliran sendiri.
RUJUKAN
454
Jabatan Pengairan Dan Saliran Malaysia (2018, Februari 25). Capaian Daripada
https://www.water.gov.my/
Jabatan Pengairan Dan Saliran Negeri Kedah (2018, Mac 19). Capaian Daripada
https://didkedah.gov.my/
Jabatan Pengairan Dan Saliran Negeri P.Pinang (2018, Mac 19). Capaian Daripada
http://jps.penang.gov.my/index.php/en/
Bahagian Sumber Air & Hidrogi JPS Malaysia (2018, April 15).Capaian Daripada
http://h2o.water.gov.my/v2/index.cfm?linkKu=fail/terbitph.cfm&menu=4&bahasa=0
Lembaga Kemajuan Pertanian Muda (MADA) (2018, April 20).Capaian Daripada

http://www.mada.gov.my/
-CS06-
Government Delivery System: It is matter to the person with disabilities?
Adlina Nasmi Sha’ari1 and Nur Syakiran Akmal Ismail2

1 School of Government, Univeristi Utara Malaysia
2 School of Government, Univeristi Utara Malaysia, nsai@uum.edu.my
Abstract
Effective delivery is the best of the public sector function that makes this level of
government closest to the people. Public services need to be delivered with integrity, centred
around citizens, and responsive to their needs, particularly the needs of the most vulnerable
(Ringold et al, 2013). Malaysian Government's aim to accelerate the Government‘s efforts to
become more efficient and facilitative in both business and public related services (Public
Service Delivery, 2018). Hence, this paper evaluates the effectiveness and efficiency of service
delivery to the person with disabilities (PWDs) by the National Registration Department (NRD)
as a public sector. According to the World Health Organisation (WHO) 2017, person with
disabilities are among the most marginalised groups in the world. Disability is now understood to
be a human rights issue. NRD‘s services are important in giving positive public perception to the
overall government structure. In developing countries, improving the quality of government
delivery system is quite challenging, but effective delivery systems are crucial in achieving the
people's satisfaction level. The case study was to use in assessingthe service delivery to the
PWDs. The finding shows that the service delivery was influenced by the SOP in the task.
Hence, the finding shows that there is still a room for NRD to improve their delivery system to
PWDs because of the lack of inter-organisational service delivery between NRD and Social
Welfare Department (SWD) has slow down the efficiency of service delivery to this marginal
group.
Keywords:Public Service Delivery, Person with Disabilities, Inter-organisational, Efficiency
455
1. INTRODUCTION
Public service is a key task for Government. Public service has always responded to calls
for enhancing its efficiency and effectiveness in meeting the citizens' demands. Public services
need to be delivered with integrity, centered around citizens, and responsive to their needs,
particularly the needs of the most vulnerable (Ringold et al, 2013). Hence, Malaysian
Government aims to accelerate the Government‘s efforts to become more efficient and became
as facilitator in both business and public-related services (Public Service Delivery, 2018). Public
service delivery is servicing all public needs, including the need and right of persons with
disabilities (PWDs).
According to the World Health Organization (WHO) 2017, person with disabilities are
among the most marginalized groups in the world. Disability is now understood to be a human
rights issue. People are disabled by society, not just by their bodies. These barriers can be
overcome, if governments, nongovernmental organizations, professionals and people with
disabilities and their families work together (10 facts of disabilities, 2017). As of 2012, there are
about 445, 006 persons with disabilities in Malaysia who voluntary registered with Social
Welfare Department (SWD) (Unicef, 2018). Providing effective public services to the PWDs is
always the challenge ahead of the Malaysian Government to ensure the rights of PWDs are
protected. Malaysia National Registration Department (NRD) under the purview of the Ministry
of Home Affairs (MOHA), is committed to a national approach to support people with disability to
maximize their potential and participate as equal citizens in Malaysian society. The NRD
provides an exemption of fees for PWDs who apply for replacement of Mykad and exemption of
fee for birth late registration (Facilities and privileges of PWDs in Malaysia, n.d). However, to
receive those privileges provided by NRD, PWDs need to follow rules and regulations stated in
the standard operating procedures (SOP) to entitle them to receive the fee exemptions. This
SOP builds a problem for this group. Hence, this article discusses the issues of public service
delivery to the person with disabilities (PWDs) at the National Registration Department (NRD).
2. PUBLIC SERVICE DELIVERY
Public service delivery is the mechanism through which public services are delivered to
the public by local, municipal, or federal governments. According to Obaidullad (2001), it is the
efficiency and effectiveness of the administrative organ of the government in the delivery of
services that makes a significant difference between good and bad government. Thus, it is so
important ensuring effective service delivery in the will boost up the good governance. People
care about public services and depend on them being delivered well. Public services provide the
most common interface between people and the state, and their functioning shapes people‘s
sense of trust in and expectations of government.
At a national level, public services underpin human welfare and economic growth.
Promoting greater transparency and enabling ordinary citizens to assess the quality, adequacy
and effectiveness of basic services, to voice their needs and preferences and to become
involved in innovation offers an opportunity to enable better use of public funds, and improve
service delivery (Ringold et al, 2013). However,the claim that perceived organizational red tape
hampers public services has become a central theme in public administration research
456
(Christian et al, 2018). Too many procedures contribute to the lack of delivery service to the
public. This is supported by Bozeman 1993 with his argument that one familiar definition of red
tape is ―rules, regulations and procedures that entail a compliance burden but do not achieve
the functional objectives of the organization‖. Kaufmann & Feeney, 2013 also argue that most
studies of red tape have focused on its measurement or its impacts. Thus, we know that
perceptions of red tape are affected by both the burden of the rule or procedure and the
outcome, and Brewer et all 2012 argue that increased levels of external control are associated
with higher levels of perceived red tape.
Win Oosterom(2007) mentioned that customer focus is often challenged by public sector
cultures, hierarchical organisational structures and differing agency priorities. He also suggested
to overcome these challenges mean aligning agency priorities to customer requirements to
deliver a customer-centric strategy. He argued that citizens today are more aware of their rights,
have better access to information on public services and consequently have higher expectations
of service levels. Because they have become accustomed to capable private sector
organisations providing high levels of customisation and other benefits, they are not prepared to
accept that public sector organisations are incapable of improving their own service delivery.
They also expect a positive customer experience and better returns on the taxes they pay.
Further, a number of countries have empowered citizens with ‗Right to Information‘ legislation
leading to heightened awareness about customer rights and, consequently, customer service.
The concept of good governance must be implemented in public service delivery to ensure all
entities in the Government act efficiently in public interest all times. Effective governance can
improve management, leading to more effective implementation of the chosen interventions,
better service delivery, and, ultimately, better outcomes (Good governance in public sector,
2013).
Public service delivery needs to ensure the time taken to deliver a service should be the
shortest possible to the public, the manner in services should be seen as a customer-centric,
there should be an intelligent mechanism in meeting the challenges in service delivery and the
delivery mechanism should be cost effective and values is drives by public outcomes.
Furthermore, the service delivery should be integrated and no wrong door policy to the public,
multiple choice for service delivery is provided so publics can have channels of choice and
ensure the delivery of service is on par with what public used to receiving from the private sector
(Win Oosterom, 2007).
3. THE CASE STUDY - NRD SERVICE DELIVERY TO THE PWDs
The United Nations Convention on the Rights of Persons with Disabilitiesin Article 1
defines ‗disability‘ as persons with disabilities includethosewhohavelongterm physical, mental,
intellectual or sensory impairments,which in interaction with various barriers may hinder their full
and effective participation in society on an equal basis with others.Malaysia on the other hand,
although adopting the definition, omitted the phrase ‗on an equal basis with others‘. This is
evident in section 2 of Persons with Disabilities Act 2008 which provides that
personswithdisabilities include those who have longterm physical, mental, intellectual or sensory
impairments,which in interaction with various barriers may hinder their full and effective
participation in society. Section 39 of thePersons with Disabilities Act 2008mentions further that
457
a person withsevere disabilities is a person suffering from one or more disabilities who is
dependent on others for basic daily living activities. In addition, Ministry of Women, Family and
Community Development has stipulated specific categories of disabilities which includes seven
categories which are hearing; vision, speech, physical, learning difficulties, mental and various
or multiple disabilities.
The NRD is committed to a national approach to support people with disability to
maximize their potential and participate as equal citizens in Malaysian society. The PWDs
receive free services for the departmenthas provided fee exemptions for them. The service
provides with fee exemption are replacing Mykad, issuing of birth and death certificate. They
just need to show their OKU Card produce by the Department of Social Welfare Malaysia
(SWD) to facilitate them deal with the services concerned. Registration for PWDs in Malaysia is
on a voluntary basis. To apply for the card, one need to submit the application form together
with the birth certificate or Mykad or Mykid. Regulation 13 of the National Registration
Regulations 1990 (Amendment 2007) states that a person who has lost his/her identity card
shall immediately apply for a replacement. As said before, charges for replacement of losing
Mykad is exempted for the OKU Card holder. But if the person doesn‘t present the card at the
counter, some amount will be charged to them and the exception of fines under of the National
Registration Regulation 1990 (Amendment 2001) if Mykad lost, is not applicable.
However, PWDs with physical abilities still able to receive those privileges with the
consideration of the staff because it is easier to identify instead non-physical abilities. But what
about the PWDs with non-physical disabilities? Those with non-physical abilities need to present
a clarification document from SWD to ensure all exemptions receive.This category of PWDs
needs to submit another application of replacement of OKU card and provide confirmation letter
of disabilities from the SWD. The redundant procedure of PWDs clarification and excessive
identification card needed for PWDs (Mykad and PWDs Card) proved that the department is
implying red tape approach in their service delivery procedure. There is lack of speed in
providing services to PWDs because NRD need the official document produce by SWD to
confirm the disabilities. NRD also act non-responsive to the PWDs‘ need and wrong-door-policy
where the application from PWDs for fee exemption will be rejected without PWDs card. This
shows that the good governance elements are not being practices in NRD‘s public service
delivery, but red tape to the PWDs. As Bennett and Johnson (1979) argued, red tape usually
implies excessive or meaningless paperwork and Hall (1968) mentioned that a high degree of
formalization and constraint, unnecessary rules, procedures and regulations; inefficiency;
unjustifiable delays; and as a result, from all this, frustration and vexation.
4. FINDING AND RECOMMENDATION
From the aforementioned issue, we could see that non-good governance and red tape are
being practicing in NRD‘s service delivery towardPWDs. A redundant process and procedure in
NRDisneeded to identify PWDs who are registered with SWD before they are entitled with the
fee exemptions provided. SWD is the department responsible in registering PWDs and
producing PWDs card as a proof of PWDs (Registration of Persons with Disabilities, 2018) while
NRD is the department responsible in registering and producing Mykad as proof of national
identification (National Registration Department, 2018). NRD need to evaluate its policy and
458
procedure and changes to enhance its public delivery service to PWDs. According to the
Bulmer‘s engineering model of research (1990), there are five (5) steps in changing policy. The
model is a linear one. A problem exists; information or understanding is lacking either to
generate a solution to the problem or to select among alternative solutions; research provides
the missing knowledge; and a solution is reached. Typically, a single study will be involved. This
with its data, analysis and conclusions will affect the choices decision makers face (Bulmer,
1990:125). NRD should implement a policy and exercise procedures that can meet the needs of
PWDs. Overcoming this challenge means aligning NRD priorities to PWDs requirements to
deliver a customer-centric manner to ensure it public service delivery run itself effectively and
efficiently. According to Win Oosterom, (2007), there are five (5) keys approach in delivering
service to the public – understand the customer-centricity; pull down the walls by connected
government; build capacity of institution; realise benefits by deliver the promise and
continuously improve thru innovation.
Around the world, attention to the issue of disability is gaining increasing prominence
(Daniel Mont, 2016). Why should PWDs in Malaysia burden with many cards to carry with while
a single Mykad can record their details beside being a proof of citizenship? Karim (2003) argue
that the MyKad introduced in 2002 is already known locally and abroad as a major innovation in
Malaysia‘s public service delivery system. The single smart card with a variety of information in
a micro-chip embedded in it serves as a key to managing access to a number of services
offered by public as well as private agencies. Since the card contains all relevant information,
currently it is used simultaneously as a driving license, as a passport document for fast entry
and exit in immigration points (as cited in NooreAlam Siddique, 2008). The additional details of
disabilities in Mykad will give major impact to the PWDs and their families in daily activities
because it can be a vehicle of convenience in all aspects of PWDs‘ life.
But how to make it happen if these two government agencies still work in silos?A wall
between NRD and SWD need to be pull down by using the inter-organizational approach so the
procedure of Mykad replacement will be much easier for the PWDs. Integrated and coordinated
government is of fundamental importance since it holds the key to unlocking effectiveness and
efficiency in service delivery. It has the potential to remove unnecessary duplication and
improve the use of scarce resource, it also contributes to better communications in highly-
complex organisations (Geraldine Fraser-Moleketi, Minister of Public Service and
Administration, 2018). As Colebatch and Larmour point out, the world can‘t be divided into
market, bureaucratic and community organizations, because there are likely to be elements of
all these in any organisation. It will not be the same in all organisations and an organisation in
the 1990s may operate quite differently from the way that organisation worked in 1950s. The
task is to identify the nature of the mix, not to place the organisation into one box or another
(Colebatch and Larmour, 1993:80). So too in inter-organizational approach, our task is not to
put the organisations into boxes but adopting an integrated approach for information and
processflow at the back end and front end to help enhance the effectiveness and efficiency of
service delivery. This approach may adopt from the model of delivery mix by Wayne Parsons,
1995:
459
Model 1
market
mix
bureaucracy community
Figure 1: The Delivery Mix model

Refering to Model 1, according to Wayne Parsons (1995), in public policy, our task is not
to put policies into boxes but to analyze and map the mix elements that make up particular
policy fields. If we envisage delivery systems as a function, we might represent them in the
context of a triangular relationships which changes over time and space.
Model 2
market
ICT
mix
bureaucrac community
y
ICT ICT
Figure 2: Suggested Delivery Mix model

However, this paper suggests that collaboration is supported by information and
communication technology (ICT) as in Model 2. This is where ICT can play the role of an
enabler, by ‗allowing things to happen‘, facilitating connected agencies through improved data
sharing and collaboration in service delivery withinter-organizational approach. A major element
of governmental drives to improve the quality, efficiency and effectiveness of public services is
the use of ICT in service provision. Since the establishment of the Multimedia Super Corridor
(MSC) in 1996 the public service in Malaysia has seen sustained attempts made towards
enhancing performance and service delivery using IT and multimedia as enabler
(NooreAlamSiddiquee, 2008). The data verification of disabilities by SWD can be embedded in
460
the Mykad microchip. Therefore, their details can be easily read thru the system with Mykad
reader and be recognized as PWDs without submitting any physical letter or card from SWD.
This integration improves front-line services and bring more beneficial to them because they can
enjoy all the privileges provided by the Governmentwith just a single Mykad as Mykad is an
official document for Malaysians and be used in both public and private agencies.
So, the proposed solution for the above issue is to have an inter-organizational approach
between NRD and SWD. Both agencies need to break down intra-agency silos and
reengineering their policy and SOP that in line with the overall objective of improving public
service delivery that can provide best service to all citizens especially to the PWDs. The design
of the integration front-line service delivery system addresses the question of ―how‖ the service
concept is delivered to target customers (Tax and Stuart, 1997). A large number of issues need
to be considered to design a service delivery system. Heskett (1987) suggests that design
choices revolve around the role of people, technology, facilities, equipment, layout, service
processes, and procedures. Similarly, Ramaswamy (1996) suggests that service system design
decisions concern the service facilities where the service is provided and the processes through
which the service is delivered. Since a service system is characterized by the relationships
occurring between people, service processes, and physical elements, these dimensions must
be considered jointly to effectively plan and conceive the service delivery system (Tax and
Stuart, 1997). Roth and Menor (2003) offer a compelling account of design choices for the
service delivery system. They argue that design decisions include aspects of structure,
infrastructure, and integration. With the elimination of intra-agency silos, the PWDs are no more
require to present OKU card when they want to apply for fee exemptions of Mykad replacement.
The key measure of public service delivery and performance is quickly and easily public
can access a service and the quality of that service once received. This inter-organizational
approach provides a major opportunity to deliver faster, more readily accessible services and
secure internal data sharing to simplify with the public service. Cooperation between and
traverse agencies need to be widespread (OECD, 2008). Integrated service delivery providesa
broader spectrum of public service. In a nutshell, inter-organizational approach about
government restructuring. It also calls for the implementation of a common vision, supportedby
integrated objectives, outcomes, information and process flows. Technology plays a key role in
this integration. However, while the integration of technology is challenging, it is often easier
than the integration of hearts and minds as Win Oosterom (2007) believed that a successful
inter-organizational approach should be found by having visible leadership at a strategic level,
common goals for a connected agency, focus on the front end of public service delivery,
breaking down intra-agency silos and enabling regulatory and legal framework.
5. PROPOSAL OF NEW PHYSICAL MYKAD FEATURE
With the inter-organizational approach and disabilities details be embedded in the Mykad
microchip, this paperwould like to suggest the new physical feature of Mykad by adding a logo
for the recognition of PWDs. Its means that the PWDs only need to carry Mykad with such logo
that can be recognized by other agencies in public and private sector. The approximate size for
the logo to be placed is 10mm x 5mm equivalent to the size of the existing "Touch n Go" logo.
461
This is because the size is considered appropriate and fit to be placed next to the 80K chip logo
on the right side. Thelogo proposes:
Figure 3: OKU logo

Coat of wheelchairs in the logo is synonymous with disabled people in Malaysia. The
symbol is also more easily be recognized by all communities as this symbol is created
specifically for the disabled. The letter O carries the meaning of ―orang‖. Letter K means
―kurang‖. The letter U refers to ―upaya‖.
Figure 4: Mykad Prototype with OKU Logo

The Mykad prototype with OKU logo next to the existing ‗Touch n Go‖ logo. Easily be
recognized by all government agencies and private sector. Enabling PWDs‘ recognition and
entitle them to receive all amenities provided by both sectors.
6. CONCLUSION
According to Wim Oosterom, (2007) the public sector does not choose its customers, the
fact that it is required to service all of them including the PWDs. Their diverse requirements are
another factor driving the need for new service delivery strategy. The public sector must always
find ways of improving the efficiency and effectiveness of its service delivery. This means by
improving quality of service (accessibility for all and satisfactory customer experiences and
outcomes). NRD must improve its service delivery with an aim to become PWDs-centric
agency. Agency priorities need to be aligned to public requirements and understand that the
citizen is king in the public sector including PWDs.I hope this paper has highlighted the scope of
the challenge, and the issues that need to be considered, as well as the range of approaches
available in order to successfully deliver on the public promise especially to the PWDs.
462
The wellness of PWDs in Malaysia are mostly depend on the current policy made by the
Government. It is one common challenge faced for by the Government on how to service its
public better including to the persons with disabled. While the public sector does not choose its
customers, the fact that it is required to service them and their diverse requirements is another
factor driving the need for new service delivery models. To deliver on the customer promise,
public sector organisations must build ‗connected government‘, seamlessly aligning multiple
government departments with customer journey needs (Wim Oosterom, 2007). This is
prompting the Government through NRD and SWD to integrate and collaborate a
comprehensive policy aimed at a better quality of life for people with disabilities because the
disabled persons also have the right to receive the best public service delivery as other ordinary
people.
REFERENCES
Bozeman, B. (2013, April 2). A Theory Of Government "Red Tape". Retrieved May 26, 2018,
from http://www.jstor.org/stable/1181785. Journal of Public Administration Research and
Theory: J-PART, Vol. 3, No. 3 (Jul.,1993), pp. 273-303Published by: Oxford
Bozeman, B. (1993). A theory of government ―red tape.‖ Journal of Public Administration
Research and Theory, 3(3), 273–304.
Christian, J. and Mads, J. (2018, February). Perceived Organizational Red Tape and
Organizational Performance in Public Services. Retrieved May 31, 2018, from
file:///C:/Users/Adlina Nasmi/Downloads_et_al-2018-Public_Administration_Review.pdf
F. Ponsignon, P.A. Smart, R.S. Maull, (2011) "Service delivery system design: characteristics
and contingencies", International Journal of Operations & Production Management, Vol.
31 Issue: 3, pp.324-349, https://doi.org/10.1108/01443571111111946
Facilities and privileges of PWDs in Malaysia (n.d). Retrieved 31 May 2018 from
http://www.jkm.gov.my/jkm/uploads/files/JPOKU/Kemudahan%20dan%20Keistimewaan%
20OKU%20di%20Malaysia.pdf
Geraldine Fraser-Moleketi (as cited in Win Oosterom 2007). The Road Ahead For Public
Service Delivery, Retrieved 22 May 2018,
https://www.pwc.com/gx/en/psrc/pdf/the_road_ahead_for_public_service_delivery.pdf
Good governance in public sector (2013). Retrieved May 31, 2018, from
http://www.ifac.org/system/files/publications/files/Good-Governance-in-the-Public-
Sector.pdf
Integrated Public Service Delivery for Social Protection. (n.d.). Retrieved May 26, 2018, from
https://www.giz.de/expertise/downloads/giz2017-en-integrated-public-service-delivery-
study.pdf
Kaufmann, W., & Feeney, M. K. (2012). Objective Formalization, Perceived Formalization and
Perceived Red Tape. Public Management Review, 14, 8, 1195–1214
Lathrop, Daniel and Laurel Ruma, 2010, Open Government, Collaboration, Transparency and
Participation in Practice, O‟Reilly Media https://github.com/oreillymedia/open_government
463
Mohamad Saiful Hasan (2015). Ensuring Effective Public Service Delivery in the Field
Administration of Bangladesh to Boast up Good Governance: The Perspective of Deputy
Commissioner Office.http://dx.doi.org/10.5539/ijbm.v10n4p92
National Registration Department (2018). APPLICATION For Replacement Of Lost Identity Card
(MyKad/MyTentera Or MyPR/MyKAS). Retrieved May 31, 2018, from
http://www.jpn.gov.my/en/kp/permohonan-gantian-hilang-kad-pengenalan-mykad-atau-
mypr/
Noore Alam Siddiquee, (2008) "Service delivery innovations and governance: the Malaysian
experience", Transforming Government: People, Process and Policy, Vol. 2 Issue: 3, pp.194-
213, https://doi.org/10.1108/17506160810902194
Open Government Partnership. Public Service Delivery, 22 May 2018,
www.opengovpartnership.org/theme/public-service-delivery.
Organisation for economic cooperation and development. (n.d.). Retrieved May 26, 2018, from
www.planejamento.gov.br/secretarias/upload/...public.../OECD_Public_Ireland.pdf
Public Service Delivery (n.d). Retrieved 31 May 2018 from
http://etp.pemandu.gov.my/Public_Service_Delivery-@-
Public_Service_Delivery_(PSD).aspx
Registration of Person With Disabilities (n.d). Retrieved 31 May 2018 from
http://www.jkm.gov.my/
Svend Otto Remoe. (2008). Innovation Governance: Getting the Most out of Innovation
Systems. Retrieved May 26, 2018, from
www.raco.cat/index.php/Paradigmes/article/download/226041/307614
United Nation. (n.d.). Convention on the Rights of Persons with Disabilities and Optional
Protocol. Retrieved May 26, 2018, from
www.un.org/disabilities/documents/convention/convoptprot-e.pdf
Wim Oosterom (2007). The Road Ahead For Public Service Delivery, Retrieved 22 May 2018,
https://www.pwc.com/gx/en/psrc/pdf/the_road_ahead_for_public_service_delivery.pdf
Wayne Parsons (1995). An Introduction to the Theory and Practice of Policy Analysis.
10 facts on disability, (2017). Retrieved 31 May 2018 from
http://www.who.int/features/factfiles/disability/en/
-CS07-
Case Study on Training and Development Management
of Kedah State Development Corporation (PKNK)
Puteri Yulianty Binti Samsudin1

1 Universiti Utara Malaysia, UUM Sintok, Kedah.
Email: puteri@pknk.gov.my
Abstract
Training is one of the organization‘s initiative to encourage its employees to learn and
increase knowledge. It is also a process of educating new employees on the basic skills they
464
need in carrying out their duties. The training focuses on the acquisition of knowledge for a short
period of time. Effectiveness in training and development will have a positive impact on the
organization in the long run. In this context, the study focused on the effectiveness of training
and development programs in the Kedah State Development Corporation (PKNK), one of the
state statutory bodies in Kedah. This study is based on my experience of conducting internship
training at PKNK and the data collection for this study is using two different methods. The
information and data training and development is collected by interview session with The
Manager of Human Resource Department. The second method for this study is by distributing
the questionnaire to 20 respondents which is the employees of PKNK. This questionnaire is
analyzed using SPSS software version 22 to get the descriptive data. The mean, mode and
percentage of perception is analyzed in this study. From the analysis, there are two perceptions
of employees have been analyzed. Firstly is the employees‘ perception on training and
development in PKNK. Secondly is perceptions employees on management of training and
development in PKNK. Then, the solutions and strategies taken by the top management and
also HR department on training and career development of the PKNK‘s employees also have
been explained. The strategies taken in line with the goal of PKNK‘s Transformation Plan, which
will be implemented in 2019. The theory of Herzberg Two factor of motivation and Hygiene
factor are also related to the development of employees' career that can be followed by PKNK
to make sure the training and development in PKNK become priorities and main activities in
improving the human capital management. The effectiveness of the training and development
can increase the quality and productivity of the employees‘ knowledge, attitude and ability to
achieve PKNK goals.
Key Words: Training, Development Management, Kedah State Development Corporation,

Case Study.
1. INTRODUCTION
Nowadays, training is the most important factor in the organizations because training
increases the efficiency and the effectiveness of both employees and the organization. The
employee performance depends on various factors and the most important factor of employee
performance is training. Training is important to enhance the capabilities of employees. Training
and development are one of the most important activities in any company or organization that
aims for progressing. In public sectors, the training and development of the employees also
become one of the important elements in improving the performance and productivity of the
organization. This includes decision making, thinking creatively and managing people.
According to Chruden and Shermun, (1976), training is defined as a process of assisting
employees to acquire or develop knowledge, skills, techniques and attitudes and experiences
which enable them to make the most effective contributions to their combined efforts, to meet
organizational objectives. Development means the efforts taken by the organization in the long
run to widen knowledge, skills and abilities of employees, especially for employees who have
long been in the organization. The major difference between training and development,
therefore, is that while training focuses often on the current employee needs or competency
465
gaps, development concerns itself with preparing people for future assignments and
responsibilities.
A survey of literature shows that training and development are variously defined in a
narrow as well as in a broad sense. For example Jackson and Schuler, (2000) refers to training
as the act of improving competencies needed today or in the future while development refers to
improving competencies over the long term. Mathews, et al. (2004) argues that training is
concerned with providing an individual with the opportunity to learn what he needs in order to do
their job more effectively. Also management training is considered to be a process of enhancing
an employee‘s capacity to handle greater responsibilities successfully, (Singh & Vinnicombe,
2003).
Kedah State Development Corporation (PKNK) is one of the state statutory bodies of
Kedah, which also takes a serious look at the development of human resources among the
employees. However, the level of effectiveness and outcome of the training program has been
taken as a routine where no specific objectives are observed, nor does it add to the knowledge,
skills, techniques and changes in the attitudes of employees in implementing current
employment. Assessment of work quality and employee productivity cannot be evaluated and
determined by the effectiveness of the training programmed that have been done. Therefore, for
the last 5 years, the training and development programmed implemented or organized in PKNK
seems do not give maximum impact to the employees and also management. There are few
major factors that prevent and limit the effectiveness of training and development programs
implemented in PKNK. Basically, the recommended training program PKNK employees is only
to days. This number is to fulfill the requirement as stipulated in the circular. However, there is
no proper plan for each employee to follow the training that is in line with the task. Besides, the
obvious lack of clear policy on the selection of staff training and the social factors of individual
employees also among the causes resulted in a lack of effective training practices in PKNK.
Due to the problem in the implementation of training and development in PKNK, issues
and the strategies that have been planned and implement to upgrade the knowledge
management in PKNK will be discussed in this paper.
3. OBJECTIVE OF THE STUDY
The main objectives of this study are:
i) To identify the factors that limiting the effectiveness of training and development
programmed in PKNK.
ii) To identify employees‘ perceptions on the training and development implemented
in PKNK.
4. BACKGROUND STUDY OF KEDAH STATE DEVELOPMENT CORPORATION (PKNK)
This study will examine the development of a training and development of the
employees in an organization's statutory body, namely Kedah State Development Corporation.
Kedah State Development Corporation (PKNK). At this time, the operation based PKNK letter of
466
approval by the Ministry of Finance with a total of 194 posts and filling up to now are as many as
160 positions.
5. CONCEPT OF TRAINING AND DEVELOPMENT IN PKNK
Based on Service Circular Number 6 Year 2005 has outlined the Public Sector Human
Resources Training Policy. In support of these policies, training plans that incorporate more
systematic and comprehensive training structures and programs have been designed as
guidelines to ensure that civil service personnel are equipped with competency-based and
continuous learning exercises. In order to realize the goals set by the PKNK management, the
Training Unit of the Administrative and Human Resources Division is responsible for planning
and conducting training / training programs for PKNK members who are well-organized,
visionary and comprehensive. The main focus of this unit is based on the following values:
i. The ability of the workforce to be enhanced

ii. The combination between management and new and experienced staff has the
experience
iii. Recognized as the sole agency that is the backbone of the State Government in
generating development.
6. PROBLEM AND ISSUES
Training is a program designed to improve performance at individual, group, and

organizational levels. At PKNK, in an effort to develop human capital, there are also constraints
and problems faced by the management, especially the PKNK HR Department. According to the
data prepared by the HR Department from 2013 until 2017, the major problems and issues
faced by the management are as follows:
6.1. No Clear Guidelines in Training Management and Human Resource Development
At PKNK, Training Unit has been set up in PKNK and is responsible for planning and
conducting training for all staff. However, based on the information from the Training Unit, there
is no clear guideline as a reference by the Training Unit for the management and development
at PKNK. This problem becomes a major issue in training management. When there is no
guideline in training programs, the selection of courses or training programmed done by the HR
Department always not suitable with job scope and the selection of employees attending the
courses also not relevant to their current job specification. The training management also done
less training on the skill which is very important in improving the quality and productivity of the
employees. Furthermore, the reduction of training budget by the management starting from
2015 also one of the effect derived from the issues of training guideline When the top
management decides that the training and development is not very important in the improving
the human capital development, the budget has been reduced. One of the reasons is that the
HR Department never done a detailed analysis and assessment report on performance of
467
training and development in PKNK to the top management. In reality, this report is critical to
convince senior team that training is one of the main activities in career development.
6.2. Working Culture
As a closed organization, most of PKNK employees are from the generation of 'baby
boomers' who will retire soon. The old working culture has been well-aligned with the staff and
the changes are quite difficult to make. The distinction of a relatively short distance to the staff
group also results in the difference in attitudes and acceptance of new knowledge and
knowledge for career development through different training methods. However, this group of
workers is less interested in change and comfortable with the current work. Hence, the content
of the training modules still cannot be fully implemented in the daily work.
6.3. Staff Attitude
Based on interviews with the Manager of Human Resource and course attendance data
for 2013 to 2017, the percentage of staff who have fulfilled the compulsory course of 7 days a
year is between 93% and 96%. This means that only 6% to 7% of all PKNK staff are not eligible.
Based on observations, it is found that the staff cannot meet those conditions for a variety of
reasons. Thus, the effectiveness of career development and training is influenced by the attitude
of some staff. The improvement in staff performance can be seen through improvements in
work quality and work productivity, especially the attitude change after attending the organized
training.
7. FINDINGS: ANALYSIS USING SPSS
This chapter describes the results obtained from the survey data. The results are derived
from the 19 questionnaires that were returned out of 20 questionnaires that were distributed to
staff at the PKNK. Each section in the questionnaire will be described and analyzed the results
obtained by using the Statistical Package for the Social Sciences (SPSS) version 22. PKNK
employee perception towards career development will use the data the mean, mode and
percentage of perception. The analyzed of employees‘ perception is divided into two subtopic
which is the employees‘ perception of training and development in PKNK and have five
elements that have been analyzed. The elements are the satisfaction of knowledge, skill,
attitude, productivity and quality of works. Another perception that has been analyzed is on
employees‘ perception of the management of the training and development programmed. From
this perception, the elements that have been analysis are element from Selection Of Courses,
element of Training Related To Job Scope, Application of Courses and perception employees‘
of Training Improvement in PKNK. From the analysis, the results are as Table 1.
Table 1 Frequency and Percent for Elements of Perception

No. Elements of Perception Frequency Percent Likert Scale
(%)
1. Knowledge 11 57.9 Satisfied
2. Skill 13 68.4 Satisfied
468
3. Attitude 11 57.9 Satisfied
4. Quality 9 47.4 Satisfied
5 Productivity 10 36.8 Satisfied
6. Selection of Courses 7 36.8 Somewhat

Satisfied
7. Application of Courses 9 47.4 Somewhat

Satisfied
8. Training Improvement 9 47.4 Satisfied
9. Job Scope 7 36.8 Somewhat

Satisfied
From the result of five elements on employees‘ perception of training and development
in PKNK, all the elements have the same result. The employees ‗satisfied‘ that they have
improved their knowledge, skill, attitude, productivity and quality of works after attending the
training program implemented by PKNK. On the perceptions employees‘ on management of the
training and development programmed, only one element gets the ‗satisfied‘ result while the 3
elements which is a selection of courses, application of courses and training related to job
scope get the result of ‗somewhat satisfied‘. From the result, it shows that the management on
training and development need to be improved by the HR Department especially in preparing
the guideline for the training and development courses.
8. ALTERNATIVES AND STRATEGIES
Through the PKNK Transformation Plan (PTP) Program which was initiated by Kedah
State Development Corporation management to employees in November 2017, the
management took a serious look at the implementation of the PTP program which is expected
to be implemented in January 2019. Among the strategies implemented are selection on training
program, restructuring, multitasking, program of Training Of Trainee (TOT) and lastly reward
and motivation for career development. This is in line with Hygiene-Motivator theory founded
by Frederick Herzberg, stating that workers will have more job satisfaction if the organization
cares about it their career development and provide workers with the opportunity to advance
and build in the organization. Therefore, the reward and motivation for the PKNK employees
that have been taken such as Excellent Service Award. Through this award, other employees
also took the initiative to improve themselves and eager to implement responsibilities assigned.
In addition to outstanding employee recognition awards, PKNK has also provide bonus
to employees and the approval of the bonus is based on certain criteria such as good
performance and financial performance of the PKNK and discipline of employees. In addition to
the strategies mentioned above, the organization has also taken action to investigate and
ensure the employee is eligible to receive the promotion. This is depends on the vacancies.
Another rewards and motivations to the employees is given the opportunity to travel abroad.
The tour will be given by PKNK to all staff every three years. In 2017, PKNK has sponsored
employee with a visit to Thailand, India and Turkey.
469
Since 2010, when the financial performance of the PKNK began strong, PKNK has
provided financial resources to eligible employees for finance their education. Employees who
continue their studies to university as a part time will be given sponsorship fees. This is because
the PKNK is providing support to employees who wish to be advance in their careers. This
sponsorship support of the workers and give a boost to the workers to work harder in jobs after
graduation. It also aims to helping employees to develop their career to a higher level.
9. RECOMMENDATION AND CONCLUSION
In conclusion, the development of training management for staff is improving in line with MOF's
goals and objectives in human capital development. However, improvements in terms of policy
and training program guidelines in PKNK need to be established in line with the speed of
change and market dynamics. This organization need to inspect their existing culture and spend
considerable time to assess their current practice of training and development processes,
procedures and practices.
REFERENCES
Vinesh, (2014) Role of Training & Development in an Organizational Development. ISSN 2277-
3177 Volume 4, Number 2 pp. 213-220 © Research India Publications.
Pallavi P. Kulkarni, (2013).A Literature Review on Training & Development and Quality of Work
Life.
Norhafizah Abd Rani, Wan Idros Wan Sulaiman & Maizatul Haizan Mahbob, (2016). Pengaruh
Budaya Organisasi Terhadap Latihan Dan Pembangunan Dalam Kalangan Kakitangan
Kumpulan Sokongan Di UPM.
-CS08-
Opportunities and Promotions of Engineering Scheme at The Kedah State
Development Corporation (PKNK)
Rosafizawati Suib
Universiti Utara Malaysia, UUM Sintok, Kedah.
Email: ros@pknk.gov.my
Abstract
This study was proposed to reviewed the opportunities of engineering scheme employees for
promotion, identify the problem of promotion of engineering scheme employees and to provide
suggestions to the issue of promotion of engineering scheme employees. Engineering is a
popular and fast growing professional field between other sectors of the country. The most
important job demand is this profession because the scope of engineering is vast and have
certain specializations such as civil engineering, electrical, electronics and systems, chemicals,
processes, natural resources, mechanical, materials, computers, airlines, manufacturing,
470
telecommunications and agriculture. This study is based on my experience of conducting

internship training at the Kedah State Development Corporation (PKNK) and using two methods
of data collection. It is by making interviews with the Human Resources Management Division
Manager and using a questionnaire which is distributed to 17 respondents. The results of the
count are derived from the 15 questionnaires that were returned out of 17 questionnaires. This
questionnaire using Likert scale and analyzed using SPSS software version 22 in the way of
frequency descriptive model. The mean, mode and percentage of perception are analyzed in
this study. Results of this analysis indicate that the 4 elements which led to the limited
opportunity and career development of a skilled engineering scheme such as limited JPA
warrant approval, limited position, PKNK financial resources and PKNK transformation plan
(PTP). Analytical questionnaire states that respondents agree (53.3 per cent - 8 respondents) at
a high level that engineering schemes are limited to promoted and career development at
PKNK. So for the solution in this study, the action such as SOP replacement plan, personnel
restructuring, new business field, strengthening financial resources and motivation using
Maslow Theory to make sure the employees retained at PKNK and eager to carry out the given
work.
Key Words:Opportunity, Promotion, Engineering, Retaining.
1. INTRODUCTION
Career development is defined by Greenhouse as a continuous process involving

individual movements through several levels of life and each level has its own issues, themes,
and tasks. (Norhani, et al., 2009). Youn (1988) argues that academic career success depends
on the achievement of promotion opportunities. This promotion structure differs in most colleges
and universities in America. It is parallel to Amey (1993) who argues that promotion is a form of
recognition and the backbone of the traditional academic rewards system.
Engineering is a popular and fast growing professional field between other sectors of the
country. The most important job demand is this profession because the scope of engineering is
vast. Scope of works for an engineering employees is to plan, manage, design, and supervise
the construction and maintenance of various public services and skilled problem solving such as
knowledge about construction work. These include Civil Engineers, Civil Engineers, Building
Civil Engineers, Civil Engineers and Roads, Public Civil Engineers, Civil Engineers, Bridge
Builders, Public Irrigation Engineers, Hydraulic Civil Engineers, Sewage Public Engineers.
Principal Statistics of Engineering Services, 1971 - 2012, Malaysia shows that the number of
jobs in 1971 was at 1222 people increasing to 34,920 persons in 2012 and the total employment
was RM 1,340,304,000 per year. It shows that career in engineering very popular and high
demand.
In the public sector such as the Public Works Department (JKR), the Ministry of Works of
Malaysia and other government departments, engineers can promote to the highest-grade level
in promotion of the Public Sector. In the private sector, they can be the Head of Division, the
471
Consultant and open the Engineering Consulting firms. While civil engineers working in the
semi-government sector such as the Kedah State Development Corporation (PKNK) can also
increase their career opportunities to a higher level as in other government departments.
However, increment and opportunity are very limited and will take a long time to reach a level of
rank. This is because corporations are one of the government's statutory bodies whose services
are closed and limited position. This study is based on my experience of conducting internship
training at the Kedah State Development Corporation and based on my experience in
engineering. This report will examine opportunities and promotion for engineering scheme
employees at the Kedah State Development Corporation (PKNK). The objectives of the study
are to reviewed the opportunities of engineering scheme employees at PKNK for promotion,
identify the problem of promotion of engineering scheme employees at PKNK and provide
suggestions to address the issue of promotion of engineering scheme employees at PKNK.
2. BACKGROUND STUDY: Kedah State Development Corporation
Kedah State Development Corporation (PKNK) is a statutory body established on 25

August 1965 under the Kedah State Government Enactment No. 5/1965 as an agency
entrusted in safeguarding the interest of Bumiputera under the supervision of the Ministry of
Finance Malaysia (MOF). PKNK is a statuary body that runs its own business and does not
depend on the allocation of the Kedah state government. As a leader in economic development
for the State of Kedah Darul Aman, PKNK has played an important role in plantation, property,
industrial, investment, tourism and entrepreneurial development as well as engaging in
corporate social responsibility activities. At present, the PKNK operations are based on the
Letter of Approval for Personnel No. B55 Year 2017 dated 20 November 2017 by Jabatan
Perkhidmatan Awam (JPA) and the total number of posts is 160 posts. Currently PKNK has 25
engineering employees who work at PKNK. All these employees are placed in the Technical
Development Division.
During the internship at PKNK, I was conducted a study on the problems of civil servants
in engineering scheme at PKNK and need to be examined is the opportunity and the promotion
of engineering employees PKNK. The problems is promotion of employees especially
engineering scheme at PKNK takes a long time, the engineering opportunity to hold a limited
post between engineering scheme and the highest position such as grade J52 at PKNK is
limited to one person.
4. JPA WARRANT AND POLICY EMPLOYMENT AT PKNK
The last time study about PKNK organization structure was made for the PKNK on May
30, 1997. Following the study, the number of Warrants No. 4, 1998 was approved by the JPA
through the approval of the Statutory Bodies of the No. 4 of 1998 dated 6 August 1998. The
approved posts in warrants is a total of 193 positions. The restructuring of the posts in PKNK
was approved on 29/01/2015. Applications in 2014 involve 24 promoted positions and 13 new
472
posts from various scopes of service proposed for additions. This is because since the last 15
years PKNK has only have an approval for 161 posts. The restructuring of this office will provide
a total of 193 posts and excludes the Kulim Hi-Tech Park Local Authority. PKNK is still
implementing the employment according to the policy set by the government. Positions taken
are reviewed according to procedures and recommended by the government. However,
application for any positions can be made directly to the PKNK without the application from SPA
portal or the Kedah government. In the event of staff recruitment, vacancy advertisement will be
made through PKNK website or advertisement of Utusan Malaysia newspaper.
5. ANALYSIS OF OPPORTUNITY AND PROMOTION UNDER ENGINEERING SCHEME
Management and administration of all PKNK employees are managed by the

Administration and Human Resource Management Division. The process of recruitment of
engineers at PKNK is similar to the recruitment of engineers in government departments. The
only difference is the application for PKNK posts directly to the PKNK without the application of
the state government such as the SPA portal. The placement of engineers at PKNK is at the
Technical Development Division, Industrial Division and Property Management Division and
Maintenance Unit at the Technical Development Division. The engineer's career development in
PKNK is only within the PKNK projects and small involvement in the management of a
subsidiary. Engineers are also given the opportunity to gain knowledge through engineering
courses but are very limited because engineering courses require a very expensive fee. To
ensure that the engineering employees are retaining at PKNK and are eager to carry out their
duties despite long waiting for promotion, PKNK also gives the engineers the right to take
courses and training appropriate to the post.
6. SCOPE OF RESEARCH
This study was also carried out by the method of interviews with Managers of Human
Resources and analyzed using Likert scale questionnaires and the data is calculate for the
frequencies and descriptive statistics using Statistical Package for the Social Sciences (SPSS)
version 22. This data is showing about the perception of employee‘s opportunities in
engineering scheme at PKNK.
7. FINDINGS: ANALYSIS USING INTERVIEW METHOD
There are some problem and issues happened to the engineering scheme had a limited
post in PKNK such as limited JPA warrant approval, limited position, PKNK financial resources
and PKNK Transformation Plan (PTP).
The reconstruction of the posts at PKNK in total for 2015 did not significantly change the
engineering's position. Applications are also made with little to engineering positions and more
to positions in N-grade administration and management. Application for the reorganization of
office for 2014 applies for an engineering schemes only approved for 27 position out of 28
473
position. It can be seen here the present position and the approvals given are very limited and
indicate the competition in the promotion of an engineer. Warrants approved by JPA indicate
that engineering scheme at PKNK will be in one-grade positions over long periods of time. The
main source of engineering scheme at PKNK is slowly gaining promotions is the approval of
limited JPA warrants and requires strong justification for future additions. Apart from that, PKNK
is only requesting a small increase in posts for this scheme.
Since approved posts are limited, promotion is also limited and officials will hold such
posts very long time. For example, J41 grade engineers have the opportunity to be promoted to
the next grade within 9 to 10 years. This opportunity occurs when J48 grade promoted to grade
J52. Increase to Grade J52 usually occurs when Grade J52 employees are pensionable even
though the employees are complied with the promotion requirement.
The promotion, hired new posts and staff recruitment will involve additional cost of salary
management to PKNK. Every year, PKNK needs an expenditure of RM12, 703,600.00 for
employment, emoluments and allowances for 160 employees. This is a very high spending and
shows that PKNK's income should exceed RM1 million every month. The PKNK's financial
condition must be strong every year to ensure that employees' salaries are paid. PKNK needs
to consistently increase annual revenue sources to apply for the addition of new positions.
Limited financial resources and inconsistent income led the PKNK to apply for a few positions to
restructure the post of JPA in 2014.
PKNK has received instructions from the Ministry of Finance of Malaysia on 14 June
2017 to implement a transformation plan whereby the Malaysian Remuneration Scheme (SSM)
has been converted to the status of the Statutory Bodies Separated Remuneration and Release
(BBDSB). Through this transformation plan, PKNK has already begun to implement some
actions on the ministry's direction. However, this effect is very hard and PKNK needs to have a
strategy plan to strengthen the organization and continue to develop. Therefore, recruitment of
temporary workers during the transformation period has been halted until the PKNK
consolidation review is completed in 2019.
8. FINDINGS: ANALYSIS USING SPSS
The results of the count in this chapter are derived from the 15 respondents out of 17
questionnaires were distributed to engineering scheme staff at PKNK. Each section in the
questionnaire will be described and analyzed the results by using the Statistical Package for the
Social Sciences (SPSS) version 22. The data will be analyzed by using frequency descriptive
model. In this section will discuss the employee‘s perception on the issues of opportunity and
promotion at PKNK where the elements are reviewed. Levels under review is very disagreeable
(1%- 19%), disagreeable (20%- 30%), quite agreeable (40%- 59%), agreeable (60%- 79%) and
very agreeable (80%- 100%). The 5 element is understanding the terms of promotion, the
importance of organizational financial sources, competition between officers, limited post at
PKNK (Closed Service) and eligibility for promotion.
474
Analysis show that only 6.7% respond they are don‘t understand the terms of promotion.
Meanwhile 93.3 % balance show that the employee understands and knows about the terms of
promotion in the PKNK for the position being taken care. Analysis showed that 33.3% disagreed
that PKNK's financial resources were important items to be seen before promotion. While
balance from that 66.7% in categories agree with this statement.
The result from 15 respondents showed that 20% in categories disagreed that
competition was a limited promotion at PKNK and balance is 80 % were agreed that promotion
was limited due to competition officers. PKNK is a statutory body with close servicing. This is
because employees will not be transferred to any external departments such as officers in JKR,
Ministry or state government officers. A total of 6.7% disagree with this perception and balance
is agree categories that PKNK is a statutory body that implements a close service.
An analysis was also made to see respondents with self-sufficiency to be promoted

within the working period to date. 13.3% less agree with their eligibility to be promoted
meanwhile 86.7% where in categories agree that they are eligible to be promoted during work at
PKNK.
Next, the study will discuss the employee‘s perception on the career opportunity and
provided by PKNK where there are 5 elements are reviewed such as post restructuring,
placement to subsidiary, engineering training provided, part time studies and annual salary
increment, allowance and bonuses.
The analysis takes into account the methods employed by the PKNK in implementing
the restructuring of workers within the PKNK for the development of employee. Overall
respondent is agreed that this method is useable to apply at PKNK. The mean is 4.33 and the
mode is 5 where the respondents strongly agree with this method of assisting the career
development of engineering scheme employees.
Since PKNK is a statutory body that implements closed services and no employee is
transferred to the external department, it has once been implemented the method of placement
of employees within the professional group to be sent to a subsidiary to gain experience. Mean
is 3.53 and mode is 4 where respondents agree with placement to a subsidiary as career
development and one of the chances of promotion.
PKNK also gives workers permission to undergo external training in engineering.

However, the cost of training outside is very expensive and sometimes the exercise is not
approved. As many as 46.7 % agree with the training, 33.3 % agree and the remaining 20 %
strongly agree that engineering training is the career development of engineering scheme
officers and future promotion opportunities.
PKNK also provides the opportunity for all employees to pursue their studies. The fee
contribution is also given to eligible employees. This is one of the career development
opportunities and is very helpful if employees take this opportunity. Mean is 4.2 and mode is 4
where most respondents agree with this analysis which is that pursuing studies was a career
development opportunity and should be captured by all employees.
475
In addition to the opportunities mentioned above, PKNK has also provided other
opportunities such as allowances, bonuses every year, annual salary increases and other
contributions. Due to the limited chances of promotion, this opportunity is also sometimes
helpful to encourage and retain the commitment of employees to carry out their duties. There
are 13.3 % disagree with this analysis and the balance is 86.7 % in categories agree with this
opportunity every year, promotion is not a problem for PKNK employees.
The opportunity provided was a great deal to help employees stay in PKNK even though
promotion problems for engineering schemes were very limited. Analytical questionnaire states
that respondents agree (53.3 %) at a high level that engineering schemes are limited to
promoted and career development at PKNK.
9. ALTERNATIVES AND CONSTRAINT
Based on the finding, there are several alternatives that have been proposed to the
respondents to identify suitable alternatives for this study. This strategy was made as a
suggestion to ensure the engineering scheme at PKNK was given a great opportunity for
promotion like any other scheme or engineering scheme in the state and federal government
departments. The alternatives suggestion to solve this issues is provide the SOP replacement
plan, personnel restructuring, involved in new business field and strengthening financial
resources.
To overcome this problem, PKNK should provide a standard operating procedures for
complete replacement plans in accordance with the requirements of the office. This is because
the employee's replacement plan is incomplete and burden to the replacement staff. A
replacement plan for engineering schemes should also be made to ensure that the job scope
left is not delayed.
The reorganization of the post and the increase in the workforce will provide much
opportunities for promotion, especially the engineering schemes. PKNK is bound by JPA's
approval for warrant approval. Therefore, the best suggestion is always to apply for a post-
employment to the JPA every 5 years and there must be a rising employee. This will help
engineer scheme employees be given the opportunity.
PKNK needs to establish a service or business that provides a permanent profit and
needs to prepare a project strategic plan that will provide income to the PKNK continuously.
High income enables additional workers to be created and many development projects that can
be managed by engineering scheme workers at PKNK. PKNK needs to create a new business
that is more efficient.
However, the constraints on these alternatives are time, financial resources and the
parties involved. PKNK is still in phase for PKNK Transformation Plan study and it will take up to
July 2019 to examine the overall PKNK's ability to transform. This study takes a comprehensive
time and advice to make a changes.
476
PKNK needs to have strong income in the event of an increase in posts or an

opportunity to increase the engineering scheme. This is because engineering schemes offer a
high pay rate compared to other schemes. Engineering schemes are one of the most
professional areas of risk in other jobs. Alternative proposals can be implemented and require
multiple parties to implement. Application for restructuring of office requires confirmation of
Supreme Committee Meeting of Human Resource Development. Additionally, PKNK Board of
Directors (BOD) and the EXCO Committee.
10. PROPOSED SOLUTION
In coordination with the Ministry of Finance (MOF) to enable PKNK to be incorporated

and implemented by the BBDSD system, PKNK should review all the scope of the strategic plan
for the operation of PKNK, legal, financial and human resources owned by PKNK. Although this
change is very big and drastic but it has helped PKNK development the plans. When the
transformation is implemented, the engineering scheme posts have been widely open where,
opportunities of engineering scheme officials are eligible to hold other and higher positions.
Motivation is a process that takes into account in strength, individual direction and
diligence in an effort towards achieving goals. Hence, the motivational theory that may be linked
to the proposed problem solving is using Maslow theory where various levels of need have been
given to all working members although it is difficult to obtain promotion opportunities. Maslow
theory emphasizes the need for personal development and in PKNK, workers are given the
opportunity to further their studies and to be sponsored by PKNK. Even after the transformation
plan is implemented all the levels of needs to look at Maslow's Theory into account in terms of
physiology, safety, social, self-esteem and self-development. These all make the employees
more corporate and in line with today's technological advances.
11. CONCLUSION
Engineering schemes are one of the professional fields that provide expertise in career
development in Malaysia. This is because development in the country will involve engineers to
develop projects. PKNK's responsibilities are limited to the state of Kedah and do not practice
the transfer of officers to external departments. That is why career development in PKNK is very
limited in engineering. This study has shown that promotion and career opportunities at PKNK
are limited. PKNK has also begun implementing the PKNK Transformation Plan for which the
remuneration system has been fully released and will take the approach to not provide pension
provision. The preparation for this challenge is crucial and strengthens the administrative lines
of PKNK that will drive the PKNK excellence. But this transformation is a good opportunity for all
employees and PKNK always takes the staff's welfare to ensure that the staff are loyal and
remain in the PKNK.
477
REFERENCES
Amey, B. M. J. (1993). Institutional market places and faculty attrition: The realities for
professors at one Research University. The NEA Higher Education Journal, 2(1): 23–35.
Norhani Bakri, Yoong, S. K.,&Hanipah Hussin. (2009). Hubungan antara peranan Individu dan
organisasi dengan amalan pembangunan kerjaya. Journal of Human Capital
Development.
Youn, T. I. K. (1988). Studies of academic markets and careers: An historical review. In
Academic labor markets and careers, ed. D. W. Breneman, 8–27. Philadelphia, United
States: The Falmer Press.
-CS09-
Jawatankuasa Kemajuan dan Keselamatan Kampung (JKKK) Penentu Kemajuan
atau Kemunduran Sesebuah Kampung di Negeri Kedah
Ahmad Fayadh Abdul Manap

Seksyen Pembangunan Luar Bandar, Pejabat Setiausaha Kerajaan Negeri Kedah, Kedah.
Emel: fayadh@kedah.gov.my
Abstrak
Jawatankuasa Kemajuan dan Keselamatan Kampung (JKKK) merupakan sebuah
organisasi sosial yang telah ditubuhkan oleh kerajaan sebagai agen pentadbiran dan
pembangunan masyarakat khususnya di luar bandar. Kajian ini dijalankan untuk menilai
peranan JKKK terhadap kemajuan atau kemunduran di kampungnya selaras dengan peranan
JKKK sendiri sebagai agen penggerak utama dalam organisasi JKKK. Selain itu juga, kajian ini
menilai dari segi keberkesanan program-program pembangunan yang dikendalikan oleh JKKK
kepada penduduk kampung dalam usaha meningkatkan taraf hidup masyarakatnya. Oleh
sebab itu, keberkesanan kepimpinan JKKK memainkan peranan penting dalam pembangunan
sosio-ekonomi masyarakat setempat. Hasil kajian menunjukkan JKKK yang berjaya memainkan
peranannya akan menjadikan kampung mereka maju samada dalam bidang fizikal mahupun
bidang bukan fizikal. JKKK di tiga buah kampung yang dikaji telah memainkan peranan yang
berkesan dalam menerajui organisasi masing-masing ke arah pembangunan sosio-ekonomi
penduduk setempat. Bagi memperkukuhkan lagi fungsi dan peranan JKKK dan kepimpinannya
pada masa hadapan, disarankan agar pemimpin yang sedia ada tidak memegang jawatan
terlalu lama dan sanggup melepaskannya kepada kepimpinan baharu yang memiliki taraf
pendidikan yang lebih tinggi. Golongan belia dan wanita juga perlu diberi peluang yang
saksama dalam menerajui kepimpinan di peringkat komuniti bagi membiasakan mereka dengan
keadaan dunia semasa.
Kata Kunci: Jawatankuasa Kemajuan dan Keselamatan Kampung, Kemajuan, Kemunduran,

Kampung.
478
1. PENGENALAN
Jawatankuasa Kemajuan dan Keselamatan Kampung (JKKK) merupakan organisasi di

peringkat kampung yang berfungsi untuk mentadbir dan menguruskan hal-hal berkaitan
kebajikan penduduk serta pembangunan di sesebuah kampung. JKKK diketuai oleh seorang
Pengerusi, dibant u oleh seorang Setiausaha dan 13 orang ahli jawatankuasa. Anggota JKKK
adalah individu yang dilantik untuk berkhidmat secara sukarela sebagai pemudahcara dan
penghubung antara Kerajaan dengan masyarakat.
Tujuan asal penubuhan JKKK di Malaysia adalah untuk memastikan kemajuan dan
keselamatan penduduk di kawasan luar bandar khususnya tidak ketinggalan berbanding
masyarakat bandar. Setelah lebih 50 tahun institusi JKKK wujud di Malaysia, JKKK dikatakan
telah berperanan menyumbang kepada kemajuan sesebuah kampung. Kajian ini akan meneliti
sejauh manakah fungsi JKKK menjadi pemangkin kemajuan sesebuah kampung atau
sebaliknya. Kajian ini akan meneliti aspek kepentingan JKKK dalam melaksanakan tugas
sebagai wakil pihak kerajaan di peringkat komuniti dan penggerak aktiviti yang menjurus
kepada kemajuan fizikal dan bukan fizikal di sesebuah kampung.
2. LATAR BELAKANG
Selaras dengan era globalisasi dan pemodenan, kerajaan Malaysia telah melaksanakan
banyak usaha untuk membangunkan masyarakat luar bandar supaya ia dapat membolehkan
komuniti ini berjaya meningkatkan kualiti hidup mereka setanding dengan masyarakat bandar.
Usaha ini dipacukan oleh penggerak masyarakat itu sendiri iaitu JKKK yang dilantik dan
diberikan elaun serta diberikan tanggungjawab memastikan apa sahaja maklumat dasar dan
perancangan kerajaan dapat disalurkan kepada masyarakat. Begitu juga sebaliknya di mana
idea dan kehendak masyarakat akan diangkat kepada pengetahuan kerajaan melalui JKKK.
3. KEPENTINGAN JKKK
3.1. Pengaruh Politik dalam Pemilihan JKKK
Senario yang berlaku kini, walaupun garispanduan yang lengkap mengenai tatacara
lantikan telah ditetapkan oleh Kementerian Kemajuan Luar Bandar dan Wilayah (KKLW) namun
ianya agak sukar untuk dilaksanakan sepenuhnya kerana proses lantikan Pengerusi dan
Setiausaha JKKK adalah melalui cadangan daripada Ketua Bahagian UMNO. Di Kedah, pada
kebiasaannya ketua UMNO cawangan kampung akan dilantik menjadi Pengerusi jkkk dan
setiausaha UMNO cawangan dilantik menjadi setiausaha JKKK. Ini kerana ia dianggap sebagai
salah satu cara untuk memberi pengiktirafan di atas jasa dan penat lelah penggerak UMNO di
peringkat komuniti dan dengan terlantiknya mereka dalam JKKK, mereka akan menerima elaun
bulanan.
3.2.JKKK sebagai Agen Penghubung antara Masyarakat dan Kerajaan
Fungsi JKKK sebagai agen perhubungan antara kerajaan dan masyarakat dapat dilihat
jelas melalui peranan mereka sebagai penyampai agenda kemajuan dan halatuju pentadbiran
Negara. Kepentingan fungsi JKKK diiktiraf oleh agensi-agensi kerajaan. Terdapat agensi yang
479
meletakkan syarat sokongan JKKK sebagai prasyarat untuk memohon bantuan atau
mendapatkan perkhidmatan daripada mereka. Ini kerana JKKK lebih mengetahui sesiapa yang
menetap di kawasan mereka dan latar belakang seseorang individu tersebut. Begitu juga dalam
merencanakan kemajuan, kerajaan akan mengambilkira pandangan masyarakat setempat dan
input ini diperolehi daripada JKKK.
3.3. Tiada Golongan Belia Menerajui Organisasi JKKK
Dari segi umur, kebanyakan Pengerusi dan Setiausaha JKKK di Kedah adalah dari
kalangan warga emas kerana penyandang jawatan tersebut dipilih oleh Ketua Bahagian UMNO
dari kalangan mereka yang telah lama menabur bakti dan bekerja keras untuk parti berkenaan.
Apabila dilantik menjadi Pengerusi atau Setiausaha JKKK, ia dianggap sebagai satu
pengiktirafan buat mereka atas kerja kuat dan sokongan padu yang diberikan selama ini. Oleh
yang demikian, agak mustahil bagi sesebuah kampung untuk diterajui oleh kepimpinan muda
kerana pada mereka amalan lantikan mengikut senioriti adalah lebih wajar.
4. TEORI
Dalam melengkapkan kajian ini, didapati ada berbagai-bagai teori boleh dikaitkan
dengan peranan dan fungsi JKKK itu sendiri. Antaranya ialah, teori kepimpinan transformasi,
teori peranan kepimpinan belia, teori kepimpinan transformasi wanita, dan teori kronisme.
4.1. Kepimpinan Transformasi
Kepimpinan transformasi secara dasarnya adalah berkaitan perubahan cara kerja

organisasi dengan melibatkan proses interaksi dua hala iaitu pemimpin dan pengikut. Ting
(2009) menyatakan kepimpinan transformasi adalah mengenai perubahan atau mengubah
organisasi dengan melibatkan pemimpin dan subordinat. Dalam menentukan halatuju sebenar
sesebuah kampung, peranan pengerusi JKKK sebagai agen perubahan amat penting untuk
memiliki semangat untuk mentransformasikan diri dan seluruh masyarakat yang dipimpinnya ke
arah yang lebih baik. Dan ini menjadi titik tolak kepada kemajuan sesebuah kampung atau
sebaliknya.
4.2. Peranan Kepimpinan Belia
Kepimpinan belia membolehkan belia menjalankan hak mereka sebagai anak muda
yang menyumbang sepenuhnya dan terlibat dalam kehidupan demokratik (Checkoway, 2011).
Ia memberi peluang kepada mereka untuk mengambil bahagian dalam proses membuat
keputusan, mewujudkan dan memperbaiki sistem dan komuniti yang mampan, serta
menganjurkan dan menggubal perubahan sosial dan politik yang positif (Checkoway, 2011;
Evans and Knight Abowitz, 2015; Govan et al., 2015 ; Hastings et al., 2011; Kress, 2006; Libby
et al., 2006). Dalam pengurusan JKKK, kita dapat lihat di mana golongan belia kurang berminat
untuk menyertai organisasi JKKK ini mungkin kerana penglibatan mereka tidak ditekankan.
Malah mereka juga mungkin tidak berminat kerana rata-ratanya kepimpinan JKKK terlalu
mengikut cara orang politik bekerja sehinggakan golongan belia merasakan sesuatu keputusan
yang rasional sukar untuk dicapai dalam menjalankan sesuatu aktiviti atau program.
480
4.3. Teori Kepimpinan Transformasi Wanita
Pendekatan teori kepimpinan transformasional wanita yang diperkenalkan Violet Eudine

Barriteau (2003) adalah merupakan perspektif baharu yang tercetus daripada teori kepimpinan
transformasional yang dipelopori James McGregor Burns sejak tahun 1970an. Bagi Wazir
(1981), perkembangan kepimpinan wanita Melayu di Semenanjung Malaysia didorong oleh
faktor struktural, dan faktor pemasyarakatan dan pendidikan. Dalam konteks JKKK, kira-kira 0.2
peratus sahaja daripada Pengerusi JKKK di Kedah adalah dari kalangan wanita manakala
selebihnya dipelopori oleh kaum lelaki. Dari segi kebolehan mengelola dan memimpin, tidak
dinafikan wanita juga setanding dengan kaum lelaki. Ini menunjukkan kepercayaan terhadap
tahap kebolehan tanggungjawab yang boleh ditanggung oleh kaum wanita dalam menerajui
pentadbiran kampung masih lagi berada di tahap yang rendah.
5. ANALISIS
Lebih daripada separuh JKKK yang masih menganggap lantikan mereka sebagai
Pengerusi dan Setiausaha JKKK ini adalah sebagai balasan atas jasa dan keterlibatan mereka
dalam politik semata-mata. Jumlah mereka yang ramai iaitu, 1900 orang Pengerusi, 1900 orang
Setiausaha dan 24,700 orang ahli jawatankuasa JKKK di seluruh negeri Kedah, ia sama sekali
tidak dapat membantu pihak kerajaan menguruskan masyarakat kampung dengan berkesan.
Sepatutnya dengan jumlah yang begitu besar, dengan peruntukan kewangan yang juga besar,
pihak kerajaan sepatutnya dapat melicinkan tugas di peringkat bawahan, namun apa yang
berlaku adalah sebaliknya. Melalui penganalisaan, saya berpendapat masalah ini berpunca
daripada 4 permasalah berikut:
5.1. Pentadbiran Berasaskan Politik Keterlaluan
Politik keterlaluan telah membawa suasana yang tidak harmoni di mana nilai kasih
sayang dan sifat tolong menolong tidak lagi menjadi agenda utama JKKK. Ketidakprihatinan
JKKK terhadap golongan bukan penyokong UMNO menyebabkan masyarakat semakin muak
dan tidak lagi menganggap institusi JKKK ini sebagai sebuah institusi yang masih lagi relevan
dalam memastikan kemajuan sesebuah kampung. Mana tidaknya, kemajuan yang dipacu oleh
JKKK ini hanya tertumpu kepada golongan kroni mereka sahaja.
5.2. JKKK Gagal Menghubungkan antara Kerajaan dan Masyarakat
Melalui pemerhatian saya yang bertugas sebagai pamantau di peringkat negeri, peranan
JKKK dalam menjadi jambatan penghubung antara kerajaan dan masyarakat di sesetengah
kampung tidak berlaku dengan efisyen. Ini berkait dengan pelbagai punca antaranya faktor
JKKK yang tidak bermastautin di dalam kampung itu, JKKK yang uzur dan sakit serta tidak
berupaya lagi untuk mentadbir dan faktor politik yang keterlaluan. Begitu juga dalam hal
kebajikan penduduk kampung. Dengan adanya perhubungan yang baik dengan agensi
kerajaan, segala masalah yang ditimbulkan oleh penduduk kampung dapat ditangani dengan
berkesan. Sebagai contoh sekiranya ada penduduk yang fakir dan miskin, mereka boleh segera
menyampaikan maklumat kepada agensi kerajaan berkaitan seperti Jabatan Kebajikan
481
Masyarakat, Lembaga Zakat Negeri Kedah dan pejabat daerah. Dengan adanya maklumat itu,
agensi berkenaan juga mudah untuk menjalankan tugas dan bantuan dapat disalurkan segera.
Sekiranya JKKK memainkan peranan yang berkesan, mana mungkin tersebar dan tertularnya
kisah orang-orang miskin dalam media sosial yang sering kita lihat singgah di paparan telefon
bimbit kita. Namun apa yang berlaku kini adalah sebaliknya. JKKK tidak tahu langsung
mengenai kesusahan penduduk di kampung mereka.
5.3. Golongan Belia Tidak Dilibatkan Secara Proaktif Dalam JKKK
Jika dilihat dalam struktur JKKK di Kedah, golongan belia kurang diwakili dalam struktur
pentadbiran JKKK. Ini kerana lantikan JKKK lebih bersifat pengiktirafan kepada mereka yang
telah banyak berjasa dalam parti UMNO, mereka yang membantu meraih kedudukan ahli-ahli
politik dan mereka yang bergiat aktif dalam cawangan UMNO di peringkat kampung. Oleh
kerana faktor inilah belia tidak terpilih untuk menerajui pimpinan JKKK kerana mana mungkin
dengan umur yang muda membolehkan mereka diiktiraf sebagai orang yang telah banyak
berjasa kepada kelestarian parti UMNO. Oleh kerana faktor itu, belia berasa dipinggirkan dan
akhirnya mereka berasa tidak lagi berminat untuk menyertai JKKK di kampung mereka. Ia
ditambah pula dengan sikap Pengerusi JKKK yang rata-ratanya bersifat tegas dan merasa diri
mereka berkuasa menentukan apa sahaja halatuju pentadbiran JKKK yang mereka terajui
tanpa mengambilkira pandangan dan kehendak golongan belia ini.
Sudah tentu perkara ini menjadi lebih parah apabila golongan belia berasa kecil hati dan
bertekad untuk tidak lagi mahu melibatkan diri dan menceburi bidang kepimpinan di kampung
mereka. Cuba kita bayangkan apakah yang akan terjadi sekiranya golongan yang sedang
mentadbir sekarang sudah tiada lagi nanti. Sudah tentu ia menjadi krisis kepimpinan yang amat
membimbangkan.
5.4. Golongan Wanita Tidak Diberi Peluang Menerajui JKKK
Perjuangan wanita untuk membela nasib kaum sejenis dan memainkan peranan mereka
dalam pembangunan kampung dan komuniti masing-masing menampakkan kesan yang nyata,
meskipun masih belum begitu cemerlang memandangkan halangan-halangan yang menjadi
cabaran untuk wanita terus maju. Tidak harus wanita diletakkan sebagai golongan lemah
kerana mereka juga berkemampuan dan berkredibiliti.
Menurut laporan umum, bagi kampung yang Pengerusi JKKKnya di kalangan wanita,
kampung berkenaan biasanya menyerlah dalam segala hal termasuklah berkaitan kebersihan,
kebajikan, pentadbiran, dan memenangi pertandingan-pertandingan yang disertai oleh
kampung mereka. Ini kerana ramai yang semakin mempercayai wanita juga mempunyai
ketokohan dalam bidang kepimpinan dan mereka mampu menjadikan organisasi yang diterajui
menjadi cemerlang dan setanding dengan organisasi yang diterajui oleh kaum lelaki. Namun
bilangan mereka yang diberi kepercayaan untuk memimpin sesebuah kampung masih lagi
berada di tahap yang amat rendah.
6.CADANGAN
482
Secara keseluruhannya, didapati bahawa JKKK adalah sebuah organisasi yang dapat
menjalankan peranan dan tanggungjawabnya sebagai institusi yang paling hampir dengan
masyarakat. Kesedaran yang tinggi JKKK menunjukkan bahawa mereka tahu akan
tanggungjawab yang dipikul. Namun demikian, tahap kemahiran dan kebolehan mereka
sebahagian besarnya pada tahap sederhana. Dan ini menyebabkan gaya kepimpinan mereka
juga tidak menyerlah. Oleh yang demikian, kaedah pemilihan JKKK harus diperketatkan dan
garispanduan sedia ada mengenai umur, dan kelayakan akademik dan pengalaman harus
diperkasakan. Lantikan atas dasar membalas jasa bagi mereka yang bergiat aktif dalam politik
tidak harus lagi dibenarkan untuk berlaku bagi menjaga kualiti pemimpin peringkat komuniti di
Negara kita.
Pengaruh politik yang keterlaluan harus dielakkan sekiranya kelestarian JKKK mahu
diteruskan untuk masa akan datang. Ini kerana masyarakat kini adalah masyarakat yang
berintelektual dan berfikiran matang. Adalah tidak wajar pemimpin dilantik dari kalangan mereka
yang tidak matang untuk mentadbir penduduk yang berfikiran matang.
Selain itu, golongan belia juga harus diberikan peluang untuk menerajui kepimpinan
dalam JKKK bagi memberikan nafas baru dan menjadikan JKKK lebih relevan untuk masa akan
datang. Melalui ini juga, penyertaan golongan muda lain dapat dipertingkatkan kerana wakil
yang ada dalam JKKK bertindak sebagai pembimbing rakan sebaya untuk menjadikan mereka
lebih cakna mengenai halatuju kepimpinan dan kemajuan di kampung masing-masing.
Golongan wanita juga harus diberikan peluang yang lebih banyak untuk menjadi
Pengerusi JKKK kerana sifat mereka yang prihatin dan melindung orang di bawah jagaan
mereka dilihat sebagai salah satu faktor kejayaan bagi kampung-kampung yang diterajui oleh
wanita. Ini kerana rata-rata kampung yang dipengerusikan oleh wanita terbukti mampu untuk
ditransformasikan daripada kampung yang biasa-biasa kepada kampung yang berpotensi tinggi
dalam pelbagai bidang.
7. KESIMPULAN
Bagi memastikan kelestarian JKKK kini, JKKK perlu bangkit dan sedar akan peranan
dan tanggungjawab yang harus mereka pikul agar jawatan yang diamanahkan itu kelak tidak
akan disoal di akhirat nanti. Dengan ura-ura keputusan yang bakal dibuat oleh kerajaan baru
kini yang bercadang untuk membubarkan JKKK dilihat sebagai indikator bahawa peranan JKKK
tidak lagi dianggap relevan dalam pentadbiran kini. JKKK juga didapati tidak banyak membantu
kerajaan dalam mengurustadbirkan penduduk kampung ke arah mencapai kemajuan. Dengan
peruntukan perbelanjaan yang besar yang dibuat oleh kerajaan sebelum ini untuk membayar
elaun JKKK, kerajaan baru kini melihat ianya sebagai liabiliti dan langkah rasionalisasi
perbelanjaan harus dibuat.
Peranan JKKK yang sepatutnya memacu pembangunan penduduk kampung didapati

telah terpesong sehinggakan kampung yang diterajui mereka ketinggalan daripada arus
pembangunan. Kebajikan penduduk yang sepatutnya menjadi tanggungjawab mereka tidak lagi
483
diambil peduli kerana apa yang mereka mahukan hanyalah kedudukan dan kuasa semata-
mata.
Namun perkara ini masih ada jalan untuk diperbaiki. Jika dibandingkan dengan negara
luar, institusi kepimpinan komuniti sebenarnya sangat membantu usaha pihak kerajaan dalam
menguruskan masyarakat dan merencanakan agenda pembangunan dan seterusnya mencapai
kemajuan. Cuma dalam JKKK, pemimpin itu sendiri yang harus berubah demi destini anak buah
dan dan masa depan kampung mereka. Mekanisme dan tatacara pengurusan telah lengkap
tetapi ianya perlulah selari dengan individu yang menerajuinya. Apa gunanya kita mempunyai
kenderaan yang canggih jika kita menyuruh orang yang tiada lesen untuk memandunya. Sudah
tentu orang itu tidak dapat memandunya dengan baik dan selamat. Begitu juga dalam JKKK,
jika orang yang dilantik itu benar-benar layak dan berwibawa, mempunyai sikap mahu
membantu dan sentiasa proaktif dan peka dengan segala perubahan ke arah kebaikan, sudah
tentu semua kampung di negara kita akan maju dan setanding dengan kejiranan di bandar.
-CS10-
Impak Peranan Dan Fungsi Jawatankuasa Kemajuan Dan Keselamatan Kampung
(JKKK) Terhadap Keputusan PRU14 Di Daerah Yan
Hafiz Hasri Bin Khaludin 1

1 Pejabat Daerah dan Tanah Yan, Kedah.
Emel: hafiz_hasri@gsgsg.uum.edu.my
Abstrak
Peranan dan fungsi JKKK adalah menjadi sebahagian daripada faktor yang menentukan
kejayaan atau kegagalan umno pada piliharaya umum sebelum ini. bagaimanapun setelah
melebihi separuh dekad pemerintahan di malaysia, didapati peranan dan fungsi JKKK tersebut
telah diabaikan sehingga membawa kepada kekalahan umno di daerah yan. daerah yan yang
majoritinya adalah terdiri daripada masyarakat melayu dan beragama islam harus
mempertimbangkan berkenaan idea penyatuan. cadangan saya adalah sesuatu perlu dilakukan
oleh perkasa, umno bersama dengan pas demi survival perjuangan bangsa melayu dan agama
islam. hanya penyatuan bangsa melayu dan agama islam yang akan memastikan kejayaan
matlamat tersebut yang boleh membawa kepada kebangkitan semula umno pada masa
hadapan.
Kata Kunci: Peranan dan Fungsi, Jawatankuasa Kemajuan Dan Keselamatan Kampung,
PRU14, Daerah Yan.
1. PENGENALAN
Kerajaan telah lama mengiktiraf bahawa penglibatan organisasi JKKK. Mereka adalah
sangat diperlukan untuk sama-sama membantu menjayakan hasrat membangunkan negara
secara bersama. Penglibatan aktif penduduk karnpung adalah untuk mengintegrasikan mereka
484
supaya selari dengan arus pembangunan negara agar tidak tertinggal di belakang. Dalam
konteks pembangunan luar bandar di Malaysia ini, penubuhan Jawatankuasa Kemajuan dan
Keselamatan Kampung (JKKK) dilihat sebagai satu tindakan dasar untuk mengajak penglibatan
penduduk kampung di dalam proses pembangunan. Setelah sekian lama kewujudan JKKK,
dapatlah disimpulkan bahawa peranan dan fungsi mereka ini pernah membantu kemenangan
UMNO dalam Pilihanraya Umum yang terdahulu namun pada PRU14 yang lalu, UMNO telah
tewas mengejut. Terdapat banyak faktor-faktor yang dikatakan menjadi punca kepada
kekalahan di dalam PRU14 yang lalu, namun kajian ini akan memberi fokus dan melihat kepada
skop yang lebih kecil iaitu peranan dan fungsi JKKK di daerah Yan yang memberi impak
kepada keputusan Pilihanraya Umum ke 14 baru-baru ini yang melibatkan kawasan daerah Yan
sahaja.
Rancangan Malaya Kedua (1961-1965), detik bermulanya penubuhan JKKK pada
peringkat kedua pembangunan luar bandar dilancarkan dengan menumpukan kepada
pembangunan manusia iaitu penghuni serta keluarga mereka di luar bandar. Peringkat pertama
pembangunan luar bandar telah dilancarkan terdahulu pada tahun 1959 dengan lebih
menumpukan kepada pembangunan infrastruktur negara. Pada ketika itu, penglibatan
penduduk kampung bagaimanapun kurang dititikberatkan kerana ianya lebih mementingkan
kepada penglibatan serta usaha di pihak kerajaan pemerintah untuk mengadakan kemudahan-
kemudahan asas terlebih dahulu. Pada permulaannya, jawatankuasa ini dikenali sebagai
Jawatankuasa Kemajuan Kampung atau ringkasnya JKK. Bagaimanapun, pada tahun 1975,
namanya ditukar menjadi Jawatankuasa Kemajuan dan Keselamatan Kampung atau JKKK
sebagai tambahan tugas dan juga penambahbaikan untuk menjaga keselamatan dan
keamanan kampung dari ancaman anasir jahat.
Situasi PRU14 yang berlaku di negeri Kedah, tidak jauh bezanya di peringkat
persekutuan kerana pada PRU14, Pakatan Harapan yang diketuai bekas Menteri Besar, Dato‘
Seri Mukhriz Tun Dr. Mahathir telah menguasai 18 daripada 36 kerusi Dewan Undangan Negeri
(DUN) ini. Barisan Nasional (BN) pula hanya memenangi tiga kerusi manakala PAS
memperoleh 15 kerusi.
Jadual 1 Bilangan Pengerusi dan Setiausaha JKKK Daerah Yan
MUKIM PENGERUSI SETIAUSAHA

SALA BESAR 31 31
SUNGAI DAUN 23 23
YAN 29 29
DULANG 8 8
SINGKIR 4 4
JUMLAH 95 95
Pentadbiran daerah Yan adalah terdiri daripada pentadbiran yang meliputi lima mukim
iaitu Sala Besar, Sungai Daun, Yan, Dulang dan Singkir serta mencakupi kawasan Parlimen
Jerai, DUN Sungai Limau, DUN Guar Chempedak dan sebahagian DUN Gurun mengikut
485
persempadanan kawasan SPR. Kawasan ini adalah kawasan yang dihuni dan dijaga oleh 95
organisasi JKKK yang masing-masing mempunyai 95 pengerusi JKKK serta 95 setiausaha
JKKK masing-masing (rujuk Jadual 1).
Jadual 2 Keputusan PRU14 Berbanding PRU13 di Daerah Yan
KAWASAN PARLIMEN JERAI DUN SUNGAI DUN GUAR DUN GURUN

PARTI LIMAU CHEMPEDAK
2013 2018 2013 2018 2013 2018 2013 2018
BN 32,429 21,773 10,520 7,075 10,158 6,518 11,411 6,525

(1,196) (2,298) (259) (1,296)
PAS 31,233 22,312 13,294 13,048 7,860 6,259 (-) 5,257

(539) (2,774) (5,973)
PKR (-) 21,651 (-) 4,493 (-) 5,686 10,115 10,732

(4,207)
BEBAS (-) (-) 184 (-) (-) (-) (-) 167
Penilaian terhadap keputusan PRU14 yang lalu berbanding PRU13 menunjukkan

berlaku perubahan yang ketara terhadap tren undian rakyat di daerah Yan. Merujuk kepada
Jadual 2 dapatlah disimpulkan bahawa bagi Parlimen Jerai yang dimenangi oleh BN pada 2013
telah bertukar tangan kepada parti PAS. Bilangan majoriti berkurangan hampir 50% daripada
1,196 undi kepada 539 undi kerana pertandingan 2 penjuru pada 2013 telah menjadi semakin
sengit pada 2018 dengan persaingan 3 penjuru. Seterusnya kita lihat kepada DUN Sungai
Limau yang sememangnya sudah lama menjadi kubu kuat parti PAS. Secara jelas dapat dilihat
di DUN Sungai Limau ini, Parti PAS sememangnya dominan serta terus mencengkam kukuh
dengan peningkatan jumlah majoriti daripada 2,774 undi kepada 5,973 undi yang juga
menyaksikan persaingan dua penjuru pada 2013 berubah kepada persaingan 3 penjuru pada
2018. BN masih kekal menang seperti PRU13 di DUN Guar Chempedak tetapi harus diingat
majoriti undi menurun mendadak dari 2,298 undi kepada 259 undi yang menyaksikan
penurunan jumlah majoriti sebanyak 90 peratus dan perlu diberi perhatian serius jika mahu
mengulangi saat kemenangan tersebut pada pilihanraya akan datang. Seterusnya kita ke DUN
Gurun yang pada 2013 dimenangi oleh BN dengan majoriti sebanyak 1,296 undi dengan 11,411
undian keseluruhan tetapi hanya mampu memperoleh 6,525 undian sahaja pada 2018. PH
yang mengemukakan calon berpengalaman bagi kerusi ini berjaya merampas kerusi DUN
Gurun ini dengan calon melayu biarpun ramai pengundi adalah bukan melayu. Majoriti yang
dicapai juga amat tinggi berbanding pada 2013 iaitu sebanyak 4,207 majoriti jumlah undian
walaupun ada cubaan untuk memecah undi dengan kemasukan calon bebas yang bebangsa
india.
2. ANALISIS KEPUTUSAN PRU14 DI DAERAH YAN
486
Sebagai analisa terhadap keputusan PRU 14 yang lalu, saya ingin mengaitkan
keputusan tersebut dengan peranan dan fungsi JKKK di daerah Yan. Berikut adalah enam
faktor yang saya kemukakan sebagai punca yang menyumbang kepada kegagalan fungsi dan
peranan JKKK yang membawa kepada kekalahan PRU14 di daerah Yan.
2.1. Kronisme
Secara teori, pemimpin melaksanakan pelbagai fungsi kepimpinan yang membawa

kepada kecemerlangan, keberkesanan dan kecekapan organisasi. Demokrasi didefinisikan
sebagai kerajaan oleh rakyat di mana kuasa tertinggi terletak pada rakyat dan dilaksanakan
secara langsung oleh mereka atau oleh agen pilihan mereka di bawah sistem pemilihan bebas.
Dalam frasa Abraham Lincoln, demokrasi adalah kerajaan "rakyat, rakyat, dan rakyat".
Sepanjang berugas di daerah Yan ini, saya ingin merumuskan bahawa secara keseluruhannya,
program-program dan projek-projek pembangunan yang dicadangkan oleh pihak JKKK di
daerah Yan ini bersifat selektif kepada golongan yang menyokong dan mendokong parti yang
sama sahaja. Ia seolah-olah hadiah kepada penyokong yang memberi kuasa untuk
memerintah.
2.2. Sikap Tidak Mengambil Tahu Kemahuan dan Keperluan Rakyat
Bagi mencapai hak ke atas dasar demokrasi, pihak yang memerintah harus memberi
peluang kepada ahli-ahli komuniti yang menonjolkan perhatian dan kebimbangan terhadap isu-
isu umum untuk pembangunan yang lebih adil dan saksama. Ia secara tidak langsung akan
menutup ruang kepada penyalahgunaan kuasa. Teori ini menerangkan tentang keperluan pihak
yang memimpin untuk memastikan kelancaran proses penggunaan kuasa di dalam sistem
pemerintahan agar tidak disalahgunakan. Apabila segala projek dan program yang diadakan
oleh kerajaan dan organisasi JKKK sendiri tidak mengambil pandangan rakyat mengenai
keperluan dan kemahuan mereka, maka seringkali projek dan program yang diadakan akan
disalah erti dan dikaitkan dengan salah guna kuasa.
2.3. Tadbir Urus Yang Lemah
Tadbir urus bermaksud tindakan yang dilaksanakan oleh golongan yang mempunyai
kuasa daripada pelbagai peringkat pengurusan untuk mencapai kecemerlangan, kecekapan,
persamaan, penglibatan yang menyeluruh, ketelusan dan akauntibiliti dalam pengurusan
pentadbiran. Organisasi JKKK amat perlu mengamalkan konsep tadbir urus yang baik ini bagi
memastikan kecekapan dan kejayaan dalam setiap objektif program mahupun projek yang
dilaksanakan untuk rakyat. Walaubagaimanapun, tadbir urus JKKK yang lemah menyebabkan
ramai JKKK yang tidak dapat menjalankan tugas yang diamanahkan dengan baik contohnya
seperti jarang mengadakan mesyuarat untuk menilai prestasi JKKK selain tidak menyimpan
rekod, profil dan dokumen penting berkenaan kampung.
2.4. Kelayakan Akademik dan Tahap Pemikiran yang Rendah
Dalam hal ini, saya berpendapat kerajaan perlu memperkemaskan isu kelayakan
akademik pengerusi dan setiausaha serta ahli jawatankuasa organisasi JKKK bagi memastikan
matlamat kewujudan JKKK itu diadakan dapat dicapai. Pihak JKKK sepatutnya membantu
kerajaan dalam melaksana program pembangunan dan juga menjelaskan polisi dan dasar
kerajaan kepada rakyat. Justeru JKKK dengan kelauakan akademik yang lebih tinggi contohnya
menaikkan taraf minimum kepada diploma sekurang-kurangnya boleh memberi impak yang
lebih baik kepada keberkesanan organisasi JKKK.
487
2.5. Sifat Kepimpinan dan Gaya Komunikasi yang lemah
Greean dalam Dunnette (1976) pula mengatakan gaya kepimpinan ialah kuasa yang
dapat mempengaruhi pekerja sama ada dari segi komunikasi dua hala yang baik dan mampu
memberi arahan yang jelas manakala Zaleznik (1977) melihat gaya kepimpinan sebagai proses
mempengaruhi pekerja agar bekerja dalam pasukan dan bertindak menjadi penghubung antara
pekerja dengan pihak atasan organisasi. Pemerhatian saya mendapati secara realiti JKKK lebih
bersifat menutup kelemahan mereka itu daripada berusaha untuk memperbaikinya. Sesetengah
hal yang dirasakan tidak penting mungkin hanya didiamkan tanpa dimaklumkan kepada pucuk
pimpinan. Hal ini menyebabkan sebahagian daripada ahli mereka sendiri tidak berpuashati
kerana ia menggambarkan seolah-olah suara mereka tidak diendahkan oleh pucuk pimpinan
mereka. Ahli-ahli yang kecewa berkemungkinan akan lompat parti. Lebih menyedihkan isu
lompat parti ini berlaku tanpa pengetahuan JKKK kerana mereka yang melompat masih tidak
mengesahkan yang mereka telah keluar parti dan masih bersama dengan UMNO tanpa
disedari. JKKK gagal melaporkan kepada UMNO bahagian atau cawangan menyebabkan ianya
tidak dapat ditangani dengan betul.
2.6. Kegagalan Hubungan JKKK, Rakyat dan Pejabat Daerah dan Tanah Yan
Tosun memberi definisi penglibatan komuniti sebagai satu bentuk tindakan sukarela
yang melaluinya individu mengambil peluang dan memikul tanggungjawab kemasyarakatan.
Penglibatan komuniti adalah satu proses di mana masyarakat bekerjasama dengan penggerak
pembangunan dan melibatkan diri dalam usaha pembangunan yang akhirnya akan memberi
kesan terhadap keadaan dan taraf hidup mereka sendiri. Penglibatan komuniti memastikan
bahawa keperluan dan aspirasi komuniti tersebut tidak diabaikan dan hasilnya ialah ahli
komuniti itu akan mendapat didikan dan seterusnya diperkasakan (Tosun, 2000). Sekiranya
hubungan itu berlaku dengan baik maka JKKK sebagai penghubung antara rakyat dan jabatan
kerajaan akan dapat memberi gambaran yang baik dan dapat menyelesaikan pelbagai maslah
rakyat. Namun, kegagalan fungsi dan peranan JKKK menjadi punca rakyat tidak berpuas hati.
3. CADANGAN
UMNO seharusnya bangun daripada kekalahan PRU14 ini demi meneruskan dan
menggalas semangat perjuangan melayu biarpun dikatakan tidak lagi relevan pada masa kini.
Kali ini mereka harus bangun dengan lebih kuat kerana belum pernah mereka tewas dengan
begitu hebat seumpama yang berlaku pada PRU14 ini. Jika UMNO tidak mahu terus terkubur,
maka UMNO perlu diperkuatkan semula. Saya berpandangan bahawa pemimpin-pemimpin
yang menjadi liabiliti hendaklah disingkir dan digantikan dengan muka-muka baru yang lebih
segar. Buangkan amalan dan sifat-sifat keji yang dibenci oleh pengundi. Persidangan Agung
UMNO janganlah dijadikan medan pertandingan lawak jenaka untuk mendapat tepukan
gemuruh. Itu tempat berbincang dengan serius dengan hujah-hujah bernas mengenai
kedudukan dan masa depan UMNO dan negara. Seharusnya UMNO mula mempertaruhkan
calon-calon yang muda dan berwibawa seperti YB Khairy Jamaludin. Kalau dulu UMNO
dibayangi pemimpin-pemimpin separuh abad yang sekian lama berkecimpung dalam era
pemerintahan mereka terdahulu, maka perkara itu harus diubah supaya pengundi-pengundi
baru lebih tertarik dengan UMNO. Mereka seharusnya diberi peluang untuk membuktikan
kewibawaan mereka. Kesetiaan mereka harus dibayar dengan kepercayaan parti bagi
meneruskan kesinambungan semangat perjuangan melayu.
488
Dalam usaha memperkukuhkan golongan muda, pelbagai penambahbaikan yang perlu

dilaksanakan peringkat akar umbi melalui Pemuda Umno. Pemuda perlu sentiasa bergerak aktif
di pelbagai peringkat terutamanya akar umbi dan usaha tersebut perlu diteruskan dengan
mempelbagaikan aktiviti Pemuda UMNO yang realistik sekaligus meyakinkan mereka bahawa
BN menjanjikan sebuah masa depan yang gemilang dan terbaik untuk mereka. Golongan muda
hari ini tidak akan menyokong kepimpinan parti UMNO secara membuta tuli. Penglibatan
mahasiswa dan anak muda dalam kepimpinan parti perlu diperbanyakkan lagi supaya parti
disinari wajah-wajah baharu dari golongan muda, sekaligus mampu menarik sokongan anak
muda kepada UMNO. Budaya utamakan golongan yang lebih senior dalam setiap gerakan atau
pasukan di dalam UMNO harus diubah kerana ianya tidak lagi relevan pada zaman ini. Hanya
calon terbaik yang layak tanpa mengira senior atau junior sahaja layak dipertimbangkan.
Kelayakan diutamakan bukan lagi faktor lama atau baru yang menjadi amalan UMNO sekian
lama. Perkara ini banyak membunuh semangat juang pemuda mahupun puteri UMNO. Selain
itu, kepimpinan kerajaan perlu berfikir panjang sekiranya ingin melaksanakan sesuatu tindakan
yang tidak popular di mata rakyat kerana ia boleh membawa kepada isu yang lebih panas dan
seterusnya merugikan UMNO sendiri.Isu semasa boleh memberikan kesan kurang baik kepada
negara, namun UMNO harus segera menyelesaikannya lebih awal setiap kali apabila
dibangkitkan sebelum ia menjadi lebih parah dan susah untuk ditangani lagi.Seharusnya UMNO
perlu kembali kepada falsafah dan asas perjuangannya yang asal sekali gus memperbaiki
segala kelemahan dan keburukan lantaran kelekaan dan kelalaian mereka sendiri. UMNO perlu
bangkit daripada kekalahan ini dengan jiwa yang lebih besar, jati diri yang lebih kental dan
semangat juang yang lebih tinggi demi menjamin hak dan suara rakyat benar-benar dipelihara
dan dimartabatkan kembali.
UMNO masih mempunyai 54 kerusi dan didokong lebih 3.5 juta rakyat dalam PRU-14.
PH menguasai 73 kerusi tetapi bukan semuanya Islam dan 41 kerusi adalah mewakili Islam dan
Melayu. Ini bermakna perjuangan UMNO selaku parti utama yang mewakili umat Islam dan
Melayu masih penting dan relevan. Bersama komponen lain di dalam Barisan Nasional (BN),
mereka masih mempunyai 78 kerusi parlimen. Sudah tentu peranan BN dan UMNO amat
penting untuk memastikan suara rakyat majoriti melayu terus dibawa sekurang-kurangnya
sebagai anggota pembangkang yang efektif, dihormati dan menjadi pengimbang dalam
memastikan negara terus dipacu dengan gemilang. Harus diingatkan, sekiranya UMNO dapat
dipulihkan sekalipun, selagi orang Melayu berpecah-belah maka politik orang Melayu akan
terus lemah. Maka saya berpendapat bahawa UMNO, Pas dan Perkasa perlu mencari jalan
untuk bersatu atau berkerjasama. Jika dimbas kembali sejarah penubuhan perkasa,
kebanyakan ahli Perkasa adalah bekas atau masih menjadi ahli UMNO. Saya dapati mereka itu
berjiwa Melayu tetapi kecewa dengan UMNO. Demi kelangsungan dan survival melayu, saya
rasa mereka patut kembali kepada UMNO. Mereka tidak perlu untuk menubuhkan parti baru. Ia
hanya akan lebih mengeliru dan memecah-belahkan bangsa Melayu itu sendiri. Saya
merasakan ada kewajaran tentang perlunya kerjasama antara UMNO dan Pas demi menjaga
kepentingan orang Melayu dan kedudukan agama Islam.
Akhir sekali, peranan dan fungsi JKKK perlu diperkasakan dengan lebih baik. Bermula
dengan syarat kelayakan yang perlu ditingkatkan supaya hanya orang yang benar layak dapat
dipilih dan menjadikan pembayaran elaun yang diberikan berbaloi atas kerja dan khidmat yang
dilakukan. Jika tidak ia sememangnya menjadi sia-sia dan hanya merugikan duit kerajaan.
Sememangnya diakui, organisasi JKKK ini mempunyai peranan dan fungsi yang hebat
sekiranya dipraktikkan dengan baik oleh organisasi tersebut. Oleh kerana JKKK merupakan
489
organisasi yang paling hampir dengan masyarakat, maka ia merupakan organisasi yang amat
penting bagi memacu serta memastikan kemajuan negara. Kemajuan sesebuah kampung
adalah menjadi asas yang membawa kepada kemajuan daerah, negeri dan seterusnya negara.
Bagi menjamin kesinambungan ini berlaku, maka satu organisasi JKKK yang cekap dan
sistematik perlu diwujudkan.
4. KESIMPULAN
Peranan dan fungsi JKKK adalah menjadi sebahagian daripada faktor yang menentukan
kejayaan atau kegagalan UMNO pada Piliharaya Umum sebelum ini. Bagaimanapun setelah
melebihi separuh dekad pemerintahan di Malaysia, didapati peranan dan fungsi JKKK tersebut
telah diabaikan sehingga membawa kepada kekalahan UMNO di daerah Yan. Daerah Yan yang
majoritinya adalah terdiri daripada masyarakat Melayu dan beragama Islam harus
mempertimbangkan berkenaan idea penyatuan. Cadangan saya adalah sesuatu perlu
dilakukan oleh Perkasa, UMNO bersama dengan PAS demi survival perjuangan bangsa Melayu
dan agama Islam. Hanya penyatuan bangsa Melayu dan agama Islam yang akan memastikan
kejayaan matlamat tersebut yang boleh membawa kepada kebangkitan semula UMNO pada
masa hadapan.
-CS11-
Integrity Enhancement: A Case Study in The Immigration Department of Kedah
Zuhair Jamaludin1 and Badariah Haji Din2

1 UUM COLGIS, Universiti Utara Malaysia, UUM Sintok, Kedah.
Emel: zuhair1976@gmail.com
2 UUM COLGIS, Universiti Utara Malaysia, UUM Sintok, Kedah.
Emel: badariahdin@uum.edu.my
Abstract
Absenteeism, abusing of power, corruption, and consumption of illegal substances are
the common integrity issues in the Malaysian Immigration Department which subsequently,
among other things, contributing to the increase in the Corruption Perception Index. This study
aims to investigate the root cause of integrity issues, to describe current actions undertook by
government to mitigate the impacts, and to propose possible solutions in curbing the problems.
Primary (interview) and secondary (government‘s reports and newspapers) data were collected.
Firstly, this study found that there are many root causes for these integrity issues such as low
level of maturity, lack of experience, family matters (eg: divorce issues), health issues, attitude
problem as well as consuming drug and illegal substances. Secondly, two approaches have
been taken by the government through existing plans and internal prevention programs. Lastly,
this study suggests a few recommendations to curb the problems, includes strengthening
Islamic values, decisive punishmentand setting up taskforce to trace any attempt of committing
corruption.
490
Key Words: Integrity, Corruption, Immigration Department.
1. INTRODUCTION
Malaysia aims to become a developed nation by 2020. The transformation towards a

developed nation is not solely based on economic and technological advancement. The
advancement should cover on the social, cultural, intellectual and spiritual aspects. In order to
achieve these objectives, the enhancing of ethics and integrity is a must to ensure that they
become part of the society‘s culture (National Integrity Malaysia, 2007). Unfortunately, similar to
other developing countries, Malaysia also faced various issues mainly related to integrity
problems involving public servants, especially its enforcement agencies including police,
Customs as well as immigration officers in Malaysia. This problem has been highlighted by the
local media every day. Below, are the examples of the news showing the severity of the
problem:
“Immigration Officers Made RM18 Million in 2 Years by Smuggling Foreigners into

Malaysia”(Balakrishnan, 2016) - Utusan Malaysia, October 2016.
―Two Immigration officers detained by the Malaysian Anti-Corruption Commission (MACC) in

connection with the alleged corruption practices involving more than RM27.9 million
”(Randhawa, 2017) - Star Online, May 2017.
According to the Corruption Perception Index (CPI) 2017, Malaysia fell to number 62 out
of 180 countries in the Transparency International (TI) index compared to its 55th ranking in
2016 which is country's worst score since the last five years and lowest ranking since the index
was introduced in 1995.
Transparency International Malaysia President Datuk Akhbar Satar said some of the
reasons that contributed to the lower score last year were the issues surrounding 1Malaysia
Development Bhd and SRC International Sdn Bhd, the Felda Global Ventures Holdings Bhd
scandal and the conviction of opposition parliamentarian Rafizi Ramli for whistle-blowing.
Based on survey conducted regarding this issue, major concerns surrounding corruption
in Malaysia were impunity where thefts of public funds are unpunished, unresolved high-profile
cases, absence of political financing law, injustice for whistle-blowers and corporate liability
provisions in the anti-graft laws. As a chain effect of Low CPI score, it will negatively represent a
country's reputation for economic viability, especially for foreign investors.
491
Given the aforementioned problems related to integrity, one should understand what it
really means. Integrity carries more than one could possibly fathomed. According to Kolthoff,
Cox III and Johnson (2009, p.198), ―integrity is a quality or characteristic of individual or
organizational behaviour that denotes the quality of acting in accordance with the moral values,
standards, and rules accepted by the organization‘s members and society‖. Hence, integrity
violations can be defined as violations of these moral values and norms such as corruption,
nepotism, fraud and misconducts.
In a simple definition quotes by a famous television host, Oprah Winfre, ―Real integrity is
doing the right thing, knowing that nobody's going to know whether you did it or not‖.
Interestingly, in Islamic civilization, this concept which is known as ―ihsan‖ has been discussed
thoroughly by Muslim scholars. It can be defined as doing something good as if someone is
seeing us, even if s/he does not see us. In that case, one will always be doing good in his/her
work or daily activities.
To improve organizational integrity, public and private organizations have to design

policies to reduce the extent of unethical behaviour in the organization. In this paper, the
concept of integrity is focused on the public administration, one of the crucial issues that has
become the centre of discussion among the developing countries. Lack of integrity in public
administration is associated with governance failures, corruption, and poor internal control and
financial management (Aziz, 2015). Particularly, if higher level government officials are involved
in any misconducts it can drain huge amounts of resources from a country (Kolisnichenko,
2006).
In order to tackle these problems, Malaysian government has put a lot of efforts in term
of budgets and programs to ensure public servants and money being managed properly and
with integrity. For instance, according to Rosli, (2015) to enhance integrity in government
administration management, the Integrity Management Committee in all ministries, departments
and agencies of the Federal Government and the State Governments was being setting up to
strengthening integrity values. Also, National Integrity Program has been introduced in 2008 to
establish a fully moral and ethical society whose citizens are strong in religious and spiritual
values and imbued with the highest ethical standards.
There are four major integrity issues occurred in the Immigration Department, namely,
absenteeism, abusing of power, corruption, and consumption of illegal substances. Firstly, for
absenteeism case, the government servants shall not be absent for more than 3 days without
any valid reasons. Failure to obey the rule stated, they will be subjected to disciplinary actions
or a worst-case scenario of being dismissal.
Secondly, abusing of power is the act of using one‘s position in abusive ways such as
taking advantage of someone, gaining access to information that should not be revealed to
public or just manipulating someone with the ability of punishing them if they do not comply.
Thirdly, involvement in corruption due to personal interest. The tendency of involving in
corruption is higher for those who work at the country‘s border compared to other immigration
officers. For example, receiving bribe to stay or bring in worker into Malaysia illegally.
492
Lastly, consumption in illegal substances because it is easily found and sold everywhere
especially for those who located near to country‘s border and those who are facing high
pressure and get stress in their jobs.
2. LITERATURE REVIEWS
There are several studies that focused their discussions on integrity in public
administration. For example, Abdullah et al. (2010) examined the level of awareness,
knowledge and understanding of integrity values among civil servants in the State Government
agencies in Pulau Pinang, Malaysia. Purposive sampling technique was used to select
respondents. This paper employed a quantitative approach and descriptive and inference
analysis were conducted. Findings showed that some civil servants were unclear of the
meaning of integrity in public sector, specifically whom with shorter length of services. In
addition, length of service was found to be negatively related to the perception on the
knowledge of integrity, corruption and quality of service delivery.
Siddiquee (2006) studied the recent changes in public management in Malaysia in

relation to new public management. The author also assessed their impacts on administrative
performance and service delivery from 1981 until the present date of study. This paper used
secondary data which combine the descriptive and analytical methods. The finding of the paper
showed that although reforms are being implemented in the right time, their impacts are not
encouraging. Despite reforms and a few improvements made in service provisions, the public
bureaucracy in Malaysia are continuously suffering from various problems namely, inefficiency,
corruption and other problems. The paper also demonstrated the gap existed between rhetoric
and reality of public management reforms in Malaysia.
In other study, Siddiquee (2010) examined the effectiveness of government‘s measures

under the rule of Badawi‘s administration to fight corruption. However, the governmental
attempts and strategies appeared to have met with little success, as evidenced by the current
data that suggests entrenched corruption in the society. Evidence showed that despite
governmental campaigns and initiatives, corruption has remained acute, widespread and, in
fact, worsened in recent years. This paper also presented a critical overview of the anti-
corruption strategies implemented in Malaysia and explored the problems and limitations of the
current approach to fight corruption and managing integrity in the society.
Previous studies revealed numerous problems associated with Malaysia‘s public

administration although various measures have been taken by the government to reduce the
ongoing problems. Recently, Rosli et al. (2015) aimed to assess the integrity systems of
Malaysian Public Sector by collecting questionnaire data from 104 public officials from Federal
Ministry in Malaysia. Respondents‘ perceptions on twelve elements of integrity on practices in
the department or agency were collected using Likert scale. Finding of this study revealed that
the mean score of each integrity items were above the mid-point. It showed that Malaysian
Public Sector is serious in implementing the integrity concept in their daily management. Thus,
493
this finding provides further understanding for the Malaysian Public Sector to improve and
enhance their integrity system.
3. RESEARCH OBJECTIVES
The main objective of the study is to investigate the root cause of integrity issues.
Secondly is to describe current actions undertook by government as preventive measures to
mitigate the impacts. Lastly is to propose new possible solutions in curbing the problems.
There two (2) methods that are used to collect data; Primary and secondary. Primary
data were collected through interview with various related parties to gather statistical data on
immigration officers who have involved in disciplinary actions e.g. dismissal, demotion and
imprisonment due to his or her wrong doings. First, three Head of Units were interviewed,
namely Head of Permit and Visa Unit, Head of Foreign Workers Unit, Head of Integrity Unit in
Immigration Department. Second, the head of immigration department branches (eg: Kulim,
Bukit Kayu Hitam, Langkawi) were also talked to. Both sources are important in this study
because the former has wide range of knowledge in policy formation, while the latter has huge
experience in handling the integrity cases. Since the informants are among the main players of
this study, thus a purposive sampling method was used for data collection.
Meanwhile secondary data were sourced based on government‘s reports and

newspapers. In particular, government report sourced from the Human Resource Unit,
Immigration Department of Kedah. The report is shown in Table 1.
5. FINDINGS
5.1. Factors Contribute to Integrity Issues
Overall, there are four main issues regarding integrity cases that had occurred in the
Kedah Immigration Department since 2011 to 2018 (Table 1). They are absenteeism, corruption
(SPRM), abusing of power, drugs and related issues (consumption of illegal substances). The
details of disciplinary cases are depicted in Table 1.
Table 1 Disciplinary Cases in 2011 – 2018
No. Cases 2011 2012 2013 2014 2015 2016 2017 2018 Total
494
1 Absenteeism 1 7 1 2 3 1 3 3 21
2 Abuse of power - - 1 1 3 2 2 2 11
3 Drugs - 1 - 1 1 1 3 2 8
4 Corruption 1 - - 1 1 - - - 3
Total 2 8 2 5 8 4 8 7 43
Source: Human Resource Unit, Immigration Department of Kedah (2018).
Immigration officers consist of three (3) categories of service, namely Pengurusan dan
Profesional (P&P - grade 41 and above), KumpulanSokongan II (grade 19 – 40), Kumpulan
Sokongan I (grade 19 and below). Table 1 combines the results from all categories. In general,
absenteeism scored the highest number related to disciplinary issues among the immigration
staff in Kedah. In particular, the case of absenteeism is most frequently done by the Kumpulan
Sokongan I (15 out of 21 cases – 71%). The main reason for this irresponsible behaviour is that
some of them were employed at the very young age, between 18 – 25 years old, thus having
low level of maturity. Another reason is that the minimum requirement for this group to be
employed is only Sijil Pelajaran Malaysia (SPM), hence, they had lack of experience and
motivational factor to work efficiently.
Meanwhile, for the Kumpulan Sokongan II, this group is older (26 – 60 years old),
matured and having more experience than the first group. However, some of them are not
exceptional from all kinds of integrity issues. The reasons for being absence from work is due to
family matters (eg: divorce issues), health issues, attitude problem as well as consuming drug
and illegal substances.
The second highest (25%) disciplinary case is abuse of power. There are a few factors
contributing to this problem such as personal interests (salary insufficiency, greedy and/or
dream of luxury lifestyle), peers influence (eg: one will be boycotted if they do not accept the
bribes), ignorance of current procedures as well as rules and regulations.
The third case is drug and related activities contributing to nineteen percent (19%).
Related activities include consumption in illegal substances. They involved in such activities
because these substances are easily found and sold everywhere especially for those who are
working near to the country‘s border. Those who are facing high pressure and stress in their
jobs tend to consume these substances.
Last, the result also shows that corruption is found to be the lowest integrity cases in
Kedah due to the difficulty to prove that they have committed such activities. Corruption also as
a result of personal interest. The tendency of involving in corruption is high for those who work
at the country‘s border including smuggling activities, human trafficking, and firearm as well as
firecrackers.
495
It is also found that the Kumpulan Sokongan I involved in integrity problems more than
double compared to the KumpulanSokongan II. Fortunately, P&P group had not been caught in
disciplinary cases in Kedah. During this eight years, the number of staff involved in immoral
activities is found to be small (on average 5 cases a year). However, there were many cases
occurred but due to some reason the issues were dropped because of insufficient of evident,
unreported cases, as well as inefficient of previous management. For comparison purposes, the
integrity cases in Kedah from 2016 to 2017 is relatively lower compared to other state where
some state like Johor, KLIA, WP Putrajaya had marked 40 cases a year on average. Overall,
based on the data sourced from Immigration Head Quarter, Putrajaya, about 293 immigration
staff in Malaysia were fired due to integrity matters since 2015 until 2018. It means that Kedah‘s
immigration only marked about nine percent (9%) out of the total 293 cases nations wide.
5.2. Current Actions or Solutions Undertook by Government as Preventive Measures to

Mitigate the Impacts
5.2.1. Government’s actions
The government constantly strives to enhance the effectiveness and strengthen the
integrity of its public administration. An efficient and effective public administration of high
integrity reduces opportunities for corruption. Among the numerous steps that have been
undertaken such as Improving Public Service Delivery System e.g. One Stop Centre, providing
customer-oriented services, improving the system and work processes and procedures,
introduction of client‘s charter, upgrading the use of ICT by providing online service to avoid
face to face interaction, promoting integrity in immigration and Customs transactions and
adopting no wrong door policy.
Secondly, Integrity Enhancement Program has been introducing to further promote

integrity among government servant. This program consists of Special Cabinet Committee on
the Integrity of Government Management, Adoption of Code of Conduct and Ethics for
government servants, the judges, member of the Parliament, Signing of a Letter of Undertaking
and also declaration of asset by public servants.
5.3. Internal Approach by Kedah Department of Immigration
There are five (5) approaches implemented by Kedah Department of Immigration. They
are given as follows:
Head of Department as a role model (lead by example): This is important enough for the
heads of departments and directors to monitor, because leakages and weaknesses like this
need to be rectified. Adding that integrity was key to any operation and as it played a huge role
in determining the level of integrity in their departments. Therefore, leadership by example is
very important, Akhbar Satar Transparency International Malaysia President (Murthy, 2018).
496
Job rotation: As precautionary measures against corruption, staff rotation has been
implemented every 3 years depending on its performance. Immigration officer who experience
more than one job rotation throughout his tenure in certain unit will become more competent
and knowledgeable as well as not easy to influenced by unscrupulous individual who try to take
advantage on him due to unclear proses.
Training: Currently training is run regularly to help our staff by inculcating integrity principle into
their day to day basis. The choice of course is designed to suite the need at all level in
immigration department. For instant, high level management needs skill to foster, influence and
sustain a culture of ethics and compliance. Meanwhile, support staff needs to attend any course
related to integrity so that they can clearly understand ethic as well as unethical things which
always regarded as core element in our organization.
Disciplinary action: Any action done by immigration will be based on the standard of
procedures (SOP). Anything that go against code of conduct will be subjected to disciplinary
action.
Minimal risk placement: Human Resource Unit is responsible in organizing future plan
immigration Kedah mainly when it‘s come to the placement of staff as well as suitable candidate
for certain position to maintain subject matter expert in immigration. Therefore, the immigration
staff which seen as potentially commit of corruption will be sending at low risk unit to minimize
face to face interaction with customer.
6. RECOMMENDATION OF POSSIBLE SOLUTIONS IN CURBING THE PROBLEMS
Strengthening Islamic values: It is recommended that the Islamic values e.g. concept ihsan
must be embedded at every individual so as to practice and promote integrity. What is the
meaning of ihsan in Islamic point of view? It is a matter of taking one's inner faith (iman) and
showing it in both deed and action, a sense of social responsibility borne from religious
convictions.How to nurture this concept? The leader has to play major roles to keep on
reminding the concept of ihsan to all his or her staff. Any staff whose really understand and
practice ihsan will surely avoid any kind of misconduct as well as negative elements in his life.
Benchmarking – developed country: It also encourages that Immigration‘s HR division at

headquarters is to benchmark with developed country on the recipe of successfulness in
handling any issue related with integrity and how to maintain it.
497
Decisive punishment: In order to expel element related to lack of integrity among immigration‘s
staff, it would be appropriate to start with the heavy punishment of problematic related persons
in Immigration Kedah first. Previous management seem to be less efficient to bring up the
disciplinary case into solution as it takes longer time than what it‘s supposed to be.
Setting up taskforce to trace any attempt of committing corruption: In police agency, this
taskforce is always regarded as a source of intelligence to smell any temptation of misconducts
by internal staff. Therefore, it is suggested that similar kinds of team to be established in so as
to liquidate of the deep-rooted evil in immigration Department.
7. CONCLUSION
Kedah‘s Immigration Department has identified four main factors of violation in integrity values
such as absenteeism, abusing of power, corruption, and consumption of illegal substances. The
Malaysian government has come out with various measures to curb the problems, but they were
ineffective to eliminate the problems. However, changing in leadership and job rotation had
some positive impacts in reducing the problems. Given the solutions proposed by this paper, the
integrity issues might be tackled efficiently for the Immigration Department in future.
REFERENCES
Abd Aziz, M. A., Ab Rahman, H., Alam, M. M., & Said, J. (2015). Enhancement of the
Accountability of Public Sectors through Integrity System, Internal Control System and
Leadership Practices: A Review Study. Procedia Economics and Finance 28,163 – 169.
Abdullah, I. H. T., Salleh, A., Ismail, R., & Ngah, N. E. (2010, December). Knowledge and
perception of integrity among penang civil servants. In Science and Social Research
(CSSR), 2010 International Conference on (pp. 234-239). IEEE.
Balakrishnan, N. (2016). Immigration Officers Made RM18 Million in 2 Years By Smuggling
Foreigners Into Malaysia. Utusan Malaysia. Retrieved May 1, 2018.
http://says.com/my/news/immigration-officers-arrested-for-making-rm18-million-by-
letting-in-foreigners-illegally
Kolisnichenko, N. (2006). Corruption in Developing Countries: Some Insights Drawn from the
Ukrainian Experience. In Ethics, Integrity, and Accountability in the Public Sector: RE-
BUILDING TRUST IN GOVERNMENT Through Implementation of the United Nations
Convention against Corruption (p.22-32).
Kolthoff, E., Cox III, R. W., & Johnson, T. (2009). Measuring integrity: a Dutch-American
comparative project. In Ethics and integrity in public administration: concepts and cases
(p.197-211). Armonk, New York, London, England.
498
National Integrity Malaysia. (2007). The National Integrity Plan of Malaysia. Retrieved May 23,
2018. http://slideplayer.com/slide/3053617/
Randhawa, S. S. (2017). MACC detains two more contractors in Immigration case. The Star.
Retrieved May 1, 2018.
https://www.thestar.com.my/news/nation/2017/05/10/macc-detains-two-more-
contractors-in-immigration-case/
Rosli, M. H., Abd Aziz, M. A., Mohd, F., & Said, J. (2015). Integrity Systems in Malaysian Public
Sector: An Empirical Finding. Procedia Economics and Finance, 28, 260-265.
Siddiquee, N. A. (2010). Combating corruption and managing integrity in Malaysia: A critical
overview of recent strategies and initiatives. Public Organization Review, 10(2), 153-171.
Siddiquee, N. A. (2006). Public management reform in Malaysia: Recent initiatives and
experiences. International Journal of Public Sector Management, 19(4), 339-358.
Zainul, E. (2018). Malaysia going through an integrity crisis, says Transparency International.
Retrieved May 1, 2018. http://www.theedgemarkets.com/article/malaysia-going-through-
integrity-crisis-says-transparency-international
Interview with the Head of Integrity Unit in the Immigration Department.
Interview with the Head of Human Resource Unit in the Immigration Department.
-CS12-
Work Stress and The Tendency for Early Retirement Amongst The Royal
Malaysia
Police Officers in Kangar District Police Headquarters
1 2
Azral Hairil Ezmil Saidin and Badariah Haji Din
1 School of Government, UUM COLGIS, Universiti Utara Malaysia, UUM Sintok, Kedah.
Email:azralxxx@yahoo.com.my
2 School of Government, UUM COLGIS, Universiti Utara Malaysia, UUM Sintok, Kedah.
Email:badariahdin@uum.edu.my
Abstract
Living in an era of rapid technological development has been very challenging. In this
fast pace of the world, the two essential things in a person‘s life is money and happiness. High
cost of living aside from the increase of the needs in life is putting a lot of pressure to both men
and women. Nevertheless, while the people are talking about the economic challenges as well
as the struggles to find a job, there‘s an issue of requests for early retirement than the allocated
timing. Findings from the statistic obtained from the Management Department of IPD Kangar
shows a drastic increase on the number of officers who choose early retirement or options. This
study aims to see the factors that cause the police officers in IPD Kangar to have the tendency
to choose option retirement rather than mandatory retirement, to describe current actions
undertook by government, and to propose possible solutions in curbing the problem. Primary
(interview) and secondary (government‘s reports and newspapers) data were collected. Firstly,
this study found that there are many causes for work stress and the tendency for early
retirement issues such as high burden of work load, age factor, health issues and family matters
as the. Secondly, two approaches have been taken by the government through existing plans
499
and internal innovative programs. Lastly, this study suggests a few recommendations to curb
the problems, eg: revision on the work structure of RMP, revision on the relevant retirement
age, leadership and integrity course for the senior officers and the supervisors.
Key Words:Work Stress, Early Retirement, Royal Malaysia Police.
1. INTRODUCTION
Royal Malaysia Police (RMP) is the primary law enforcement organization in Malaysia.
RMP has reached the age of 211 years old on 25th March 2018 and is currently under the
jurisdiction of the Ministry of Home Affairs. RMP plays a significant role in the formation of a
peaceful and prosperous country. This is supported by the firmness and efficiency in the
implementation of the law. Despite the difficulties to face the challenges in the globalization era,
RMP stands still in ensuring the sovereignty of the law as well as the welfare of the society.
Every personnel in RMP, whether higher or even lower ranking officers need to obey their duties
according to the law as stated in Section 3(3) Police Act 1967. The roles of every RMP member
under Section 3(3) Police Act 1967 are to preserve the law, maintain and secure the national
security, identify and prevent crimes, capture and prosecute criminals and collect intelligence for
security purpose (Police Act 1967). Vision and directions set by the leaders are very clear. First
is modernisation and enhancement of the organization which emphasises on the structures,
procedures and working system; equipment acquisition with the use of computers; information
technology and updated management methods. Secondly is the improvement on the team
image which emphasises on delivering professional, effective, efficient and friendly services.
Thirdly is to improve the quality of the services based on committed, ethical and well trained
human resources. This focuses on few things like basic training scheme, development and
extension, attractive service scheme and maintaining the human resources with calibre and
highly qualified (www.rmp.gov.my).
Challenges faced by RMP changes by time. The challenges faced are not just physically
or mentally, but they also exist in a new form which is cyber threat. RMP needs to be wiser in
handling criminal threat that is getting more sophisticated. In countering criminal threat, the
police often need to deal with other challenges like society‘s negative perception which has
been instilled by certain party who wants to fulfil their personal agenda. At this moment, RMP
emphasises on the professionalism issue and next to improve the quality of their services that is
oriented for the society, mainly to fix the negative perception apart from maintaining their main
roles to ensure the people‘s safety and security (Tun Hisan & Khoo, 2011). Living in an era of
rapid technological development has been very challenging. In this fast pace of the world, the
two essential things in a person‘s life is money and happiness. High cost of living aside from the
increase of the needs in life is putting a lot of pressure to both men and women. When
mentioning about living cost, the first thing in the people‘s mind would be occupation and the
source of income. Everyone knows that in this period of time, finding a job is not easy. All we
500
hear are termination of employees and the reduction of job positions whether in private or
government sector.
In fact, the statement from the president of the Congress of Union of the Public Services
(CUEPECS) around the year 2018 mentioned that the government servants who chooses to
retire early are increasing between 30,000 until 35,000 people which is a big number and is
almost equal to the total of the government servant who chooses to work until their mandatory
retirement age. This situation is a bit awkward because if the factor of current issue is taken into
consideration, this group should prone to selecting the mandatory retirement due to its longer
service period, fixed and annually increased income aside from the retirement bonuses. In the
current situation which requires a stable source of income, these government servants are
willing to option otherwise. It needs to be looked into in order to understand the root of the
problem and finding the pushing factor that cause them to make a decision that contradicts from
the norms of the current life necessities.
There are four major issues occurred in the IPD Kangar, namely, increased burden of
duty, Age factor, health problem, and family institution‘s perspective. All officers and even the
lower rank members in RMP are not excused from the increased burden of duty that is currently
happening. In this matter, and in this organisation, especially lower ranks officers are not
excused from being involved in crime prevention operations conducted by RMP include public
holidays. Moreover, all the responsibilities need to be performed regardless of time because
according to Section 19, Police Act 1967.
Age factor plays a vital role in prolong of an officer‘s task. Entering the 50s of age,
almost every single men or women are tending to think about the family and religious. This
category of person usually have limited focus and ability to implement the job that been given
especially the rugged and rough task.
From a family institution‘s perspective, it has also become one of the issues related to
the stress given by the work. Looking at this view, a police officer is seen to feel the pressure in
needing to balance their responsibilities towards their work and family. Bit by bit, this situation is
affecting police officer who felt the inability to take full responsibility as a father or a mother. This
is due to the perspective of adding values to their social life and the responsibility they have
towards their family will boost up their motivation instead of adding stress. The last factor why
the police officers choose to retire earlier is because of health problem and unable to carry the
work burden. Same as the age factor, the focus to the job are slightly decrease because of the
limited strength and unable to get fit.
2. LITERATURE REVIEWS
There are several researchers conducted about the stress faced by government servant.
For example, Ummi Kalsom (2014) conducted a research on the level of stress faced by the
government servant among the teachers in Sekolah Menengah Daerah Hulu Terengganu,
Terengganu Darul Iman. The quantitative techniques used by distributing questionnaire to the
501
teachers in Sekolah Menengah Daerah Hulu Terengganu. In this research, five independent
variables have been chosen. There were time management, work stress, challenges in career
advancement, motivation and discipline and authority in profession. The result of the research
shows that the factor of work stress has a positive connection with mental pressure and
emotions of the teacher. In addition, the affect of the work pressure on the intention of the
teachers to resign shows the factors of time management in teacher‘s task, self-time
management and stress related to work which shows the positive link with the intention for
teachers to resign.
Irwan (2012) research is about the relation between work stress and work performance
among personnel in Traffic Department, Royal Malaysian Police in Iskandar Malaysia, Johor.
The author focuses on the officers from traffic department to relate between the work stress and
the work performance based on the increase of the rate of traffic rules violation and other work
stress. His research shows that there is a connection between these two elements and assisted
by other factors as a triggering factor while other factors like demography and age are also the
factors that contribute to the increase in stress among traffic officers in Iskandar Malaysia that
result in the drop of their work performance.
Herbert W. Heinrich (1920) stated that there are three factors leading to mistakes in
organization which are overload work (environment factor, internal factor, and personal factor),
unsuitable reaction (behaviour, attitude, ergonomic, environment) and unsuitable activity
(misunderstanding, misconception). The spirit of theory of the work stress above, raised that the
balance between work and health can leave effects on the workers. The employee‘s attitude in
managing the work accordingly can increase the ability to handle roles uncertainty, roles conflict
and roles pressure that can lead to the increase of their health.
According to Karasek (1979), he stated that the biggest risk of exposing to the
employee‘s physiology and psychology are the work demand in fulfilling roles and decision-
making process while working and Edward (1998) said that the lack of work demand and
sources can contribute to the two elements of stress from the aspect of physiology (for example
high blood pressure, increase in cholesterol and reduce of immunity) and psychology (for
example, sleep depression, anxiety, panic attack).
3. RESEARCH OBJECTIVES
The main objective of the study is to observe the factors between work stress and the
effects to the officers on duty in IPD Kangar until causing the tendency for them to retire early or
taking options. Secondly is to describe current actions that undertaken by government as
preventive measures to mitigate the impacts. Lastly is to propose new possible solutions in
curbing the problems.
502
This study employed a survey technique where a set of questionnaire has been
developed to examine the reason why the police officers at IPD Kangar have tendency to
choose option retirement rather than mandatory retirement. There two (2) methods that are
used to collect data; Primary and secondary. Primary data were collected through interview with
selected 62 police officers which are those who choose to retire early or options rather than
mandatory retirement by distributing questionnaire form and 3 of them was selected for the
purpose of the research case study. Officer in Charge of Management Department and
Management Officer also involved and were interviewed during the data collection process.
Meanwhile secondary data were sourced based on government‘s reports and newspapers. In
particular, government early retirement statistic sourced from the Management Department of
KangarDistrict Police Headquarters. The statistic is shown in Table 1.
5. RESEARCH FINDINGS
62 respondents involved to identify the factors they choose or prone to choose early retirement.
The outcome of the interviews has highlighted four factors raised by the respondents. The main
factors that triggered the stress feeling and posed them the idea to retire earlier than the
allocated times are the work burden, family, health issue and age.
Factor with the highest percentage is the high workload burden. 61.29 per cent
respondents stated that this factor as the main reason why they choose to retire early. One of
the issues raised to support this fact is the increasing pile of work.
24 per cent which mean 24 officers out of 62 respondents stated that age factor as the
main reason why they have chosen to retire early. In RMP‘s organization, no task can be taken
easily. Every officer in any contingent is involved in crime prevention operation. With the tight
schedule and uncertain and the factor of increase in age, even most of the officer have reached
the golden age, thus other problem might appear. The stress increases when every task needs
to be completed without any excuses.
Problems that often occur and strongly relates to the golden age will surely be health
issue. As many as 22.58 per cent which is 14 respondents stated the factor of health is the main
reason for the early retirement. And it gets more exciting when this factor is said to be strongly
related to the factor of workload burden and is not suitable for those in their 50s. These issues
are believed not only caused by unhealthy eating habits, but also the lack of rest or sleep and
uncertain meal time.
Finally, the factor chosen by the respondents with 4.84 per cent which is 3 out of 62
respondents is the family factor. In this challenging environment to face the high living cost,
many of husbands and wives need to work and mostly choose a different field of work and
location just to get the income to support their family and their parents. Because of the long
period of being far from their family, feelings arise that they have not perform their
responsibilities to their family thus decided to retire early to repay the debts to their children
apart from not having enough time to learn their religious knowledge.
503
Table 1 Early Retirement Cases in 2014 – 2018

No. Causes 2014 2015 2016 2017 2018 Total
1 Work 4 5 6 7 8 30
Overload
2 Age 1 3 5 5 1 15
3 Family - 1 - 1 1 3
4 Health 2 2 3 2 5 14
Total 7 11 14 15 15 62
Source: Management Department, IPD Kangar (2018).
The result in Table 1 shows that the main factors that triggered the stress feeling and
posed them the idea to retire earlier than the allocated times are the work burden, family, health
issue and age.
5.1. Current Actions or Solutions Undertook by Government
Related to the work stress faced by the lower ranks officer, few initiatives have been
taken by the federal government and the higher management. One of them is the expansion of
Integrity and Standard Compliance Department (JIPS) to a full department with the small
division of Religion and Counselling Department (BAKA) in it which is meant to not only observe
the officers discipline, but to assist in arranging programs to reduce the stress level of the
officers that seem to be having problem or facing high pressure. Some of the programs
conducted are religious programs and family related. Courses to strengthen their character and
self-value, integrity, stress management, household management etc. are organized to reduce
the amount of stress for all the police officer in all level.
The concern of the higher management of RMP can be seen with the flexibility given
during transfer application. Before this, uniformed officers are seen as not being able to serve
their state of birth even though it is nearby to their partner‘s job location. The flexibility is clearly
seen where more officers can transfer to an area nearby their partner‘s job area and even
transfer back to their hometown especially those reaching their retirement date.
Other welfare is more on the after-retirement benefits like courses on how to face the
retirement for the officers to know what they can work on after the retirement inclusive the
available government‘s assistance that can be applied. This help is not only within RMP but
practiced by other government agencies. Other than that, the facilities in term of health and
504
medical assistance are also provided by the government where all the retired personnel can
gain benefit when getting treatment in any government hospital.
6. RECOMMENDATION OF POSSIBLE SOLUTIONS IN CURBING THE PROBLEMS
Revision on the structure of the establishment in RMP :One of it is to review the suitable
retirement age for all uniformed government officer (police) which needs to be in line with the
period for a certain position, the retirement benefits, revising posts structure in RMP to get the
best flow and suitable according to their strengths and the age of the officer, revising the
working hour and the nature of the task to fit the capability of the officer as well as leadership
and integrity courses for the lower ranks officer and to be smart in managing any situation
despite in a tense situation and to understand the stress level of the lower level officers.
Revision on the relevant retirement age : On the 1st May 2017, the CUEPECS has advised
that the retirement age to be extended to 62 years old. However, there are few implications if it
is implemented. The extension of the retirement age will only degrade the work performance
and increase pressure among the workers. The quality of human life tends to decline over age,
Yenny and Elly Herwana (2006). These worries appear when looking at the rate of death of the
officers during their service period whether during on duty, tiredness or health problems.
Furthermore, it will avoid the slowdown of the process for workforce replacement and even
avoid from reduce the opportunities for the lower ranks officers to be promoted.
A review on the work structure of RMP : It is very important to get the best and suitable flow
according to the officer‘s strength and their age. A smart move to make is maybe absorbing
those approaching their golden age to be a teaching staff to the new officers and no longer as
executors. It will be a huge loss if these officers are deployed to be executors to the extent of
their retirement age or early retirement age. When there is early retirement during the execution
time, it is a loss because they are not able to share their experience with the younger officers
entirely due to the lack of quality time with their subordinates. In a nutshell, early retirement for
this well-experienced group is a huge loss in terms of their knowledge and experience.
The review on the working hour : It must to suit the existing manpower. As mentioned earlier,
the definition of old and young does not exist in RMP. Everyone is considered fit for the entire
task regardless the time. Therefore, the scheduling system needs to be revised so the task
assignments will be according to their age, ability and expertise of every officer. For example,
an older officer can be assigned during the time where crime rate is less as well as not assigned
during night time apart from being assisted by a younger officer. In addition, the period of this
505
rotation system needs to be reviewed. Some assignment needs the officer in charge to guard
until 12 hours, sometimes even up to 24 hours and 48 hours.
Leadership and integrity course for the senior officers and the supervisors : The last
suggestion is to organize a seminar or leadership and integrity course for the senior officers and
the supervisors to develop smart leadership skills in handling the lower level officers and being
able to control the situation even in a tense situation. The seminar or the course is important to
build empathy amongst the higher management, so they can understand the officers under their
supervision and being able to assist them in absorbing the stress and not the opposite way. It is
undeniable that in any agency there will exist some strict and firm with their subordinates.
Strictness is a must in a leader, but it needs to be used wisely and sometimes a leader needs to
be smart and tolerance in certain tense situation to defuse the situation and not to worsen it.
Motivational inspiration is also very important skills that every leader should have.
7. CONCLUSION
The reality is, as a country is growing, the crime rates will increase as well in the country.
National crime index statistics are projected to increase in tandem with population and
economic growth (Sidhu, 2006).In facing the crime rates and challenges in implementing the
crime prevention responsibilities, the government and the leaders of RMP specifically not only
need to think about how to prevent this issue, but they have to consider the implementation and
reviewing it including the executors of the jobs. The government should look into the RMP
structure to improve and improve the quality of RMP presentations.
The factors such as burden of duties, health, age and family are contributing to work
pressure for police officers at IPD Kangar. The burden of duties shows the highest percentage
of why they chose to retire early while all the mentioned factors were intertwined and
contributed to work pressure. Based on the research of ―time and motion study‖, Frank Gilbert
and Lilian Gilbert summarized that the physical factors at the work place can lead to stress thus
causing fatigue to the employees. The policeman‘s physical plays an important role in
determining their capability to pursue their duty and influences their decision for early retirement
the moment they felt that their energy, age and their ability are no longer fit to the daily tasks
which causes work stress environment.
The issue of higher level officer‘s attitude is also mentioned as the work stress exists not
just because of the increase of tasks, but also due to the environment which sometimes
comprises the team member itself. The higher management needs to approach and understand
the hearts of their officers so they would not missed out anything crucial that can disrupts the
officers‘ emotions and performance. The higher management must be wise in handling the
stress that arises amongst the team member so it would not spread and creates pressure
towards the task that is being conducted.
Empathy and wisdom of a leader are required during crucial times to overcome any
problems. According to Hugo Munsterberg, the use of psychological in management skill is very
506
important as it emphasize the concept of scientific management and human‘s behaviour for the
good sake to the manager and the employee in order to reach the target. This theory is then
strengthen by Elton Mayo through his research, Hawthorne Research that sees the real work
performance is influenced by the individual‘s behaviour in a team rather than other factors.
Leadership can either be seen as science or art, which is a way of influencing or inspiring
someone or some group to work hard heading to the goals (Husin, 2007).
According to progress and the modernisation of the country, leadership pattern in every
managerial aspect needs to be parallel with the organisation‘s environment. The recent
challenges require changes and transformation along with the development of the world.
Leadership transformation basically is more to the change of ways of working and involves the
two way interaction process which are leaders and followers. Ting (2009) stated that leadership
transformation is about changes or changing the organisation by involving leaders and
subordinate. Burns (1978) is one of the founders to the theory of leadership has defined this
theory as a process whereby a leader and the follower build each other to develop moral and
motivation to a higher level.
To get the best result, all necessities for the implementation need to be the best and
ready from all angle. In a uniformed organization, not only energy is required, but also fitness
and expertise. Therefore, experiences from a more experienced people are needed to guide the
younger officer. It would be huge losses if their expertise is not fully adapted due to the lack of
time to share and the early retirement than the expected date. The government and RMP needs
to consider and review all these factors for these ―sulking‖ groups regarding the factors causing
them to retire early. Finally, to revive the spirit and achieving RMP‘s vision which is ―foremost in
maintaining a safe, secure and prosperous Malaysia‖ (www.rmp.gov.my), all the suggestions
given need to be reviewed to get more positive outcomes in heading to competitiveness.
REFERENCES
Adlan_A. (2000), Tekanan Kerja Di Kalangan Pegawai Penyiasat Dan Penolong Pegawai
Penyiasat Yang Berumahtangga Di Jabatan Narkotik Dan Cawangan Trafik, Kontinjen
Polis Kuala Lumpur. UTM.
Ahmad Nordin, I. (1989), Hubungan Di Antara Tekanan, Beban Kerja Dan Prestasi Pegawai
penyiasat Polis DiRaja Malaysia. Universiti Kebangsaan Malaysia.
Ainsworth, P.B. & Pease, K. (1987), Stress and the Police Officer. In Police Work. Leicester,
UK: The British Psychological Society, pp. 143–162.
Burns, J. M. (1978), Leadership. Harper & Row, New York.
Edwards J. R. (1998), Cybernetic theory of stress, coping, and well-being: Review and
extension to work and family. In: Cooper CL (ed) Theories of Organizational Stress, pp.
122-52. Oxford University Press, NY.
Herbert W. H. (1920), Industrial Accident Prevention.
507
Irwan Hardy, B. (2012), Hubungan Tekanan Kerja Dengan Prestasi Kerja Di Kalangan Personel
Cawangan Trafik, Polis Diraja Malaysia (PDRM) Di Iskandar Malaysia, Johor.
Jaafar, M. (2010), Kelakuan Organisasi 7th ed., Petaling Jaya : Leeds Publications (M) Sdn.
Bhd.
Jaffe, D., Scott, C. (1994), Rekindling Commitment: How To Revitalize Yourself, Your Work,
And Your Organization. San Francisco: Jossey-Bass.
Karasek R. A. (1979), Job Demands, Job Decision Latitude And Mental Strain: Implications For
Job Redesign. Administrative Science Quarterly 24(2), 285-308.
Marhaini, AG., Husna, N., Azharudin, M., Nur, H., Amin, HM. (2016), Gaya Kepimpinan
Transformasional Terhadap Keberkesanan Organisasi Di Bahagian Pentadbiran Kolej
Universiti Islam Antarabangsa Selangor. Proceeding of the 2nd International Conference
on Economics & Banking 2016 (2nd ICEB), hlm. 978-967.
Nor Liyana, M. B. & mansor, A. T. (2010), Tekanan Kerja Motivasi Dan Kepuasan Kerja Tentera
Laut Armada Tentera Laut DiRaja Malaysia. Jurnal kemanusiaan, 15.
Sainayune;, S. Bin. (2007), Sejarah Ringkas Polis. In P. M. D. R. bt M. Yusof, ed. Polis Wanita :
Sejarah Bergambar 1955 – 2007. Petaling Jaya : Kelana Publication Sdn Bhd, p. 6.
Sidhu, A.S (2005). The Rise of Crime in Malaysia: An Academic and Statistical Analysis.
Journal of the Kuala Lumpur Royal Malaysia Police College, No.4:1-28.
Tun Hisan Tun Hamzah & Khoo Kheng-Hor. (2011), Beyond Policing The Strategic Shift, 1st
ed., Kuala Lumpur : MPH Group Publishing Sdn. Bhd.
Ting, K. (2009), Kepimpinan Transformasi : Iventori Amalan Kepimpinan Pengetua Sekolah

Menengah Kebangsaan Daerah Sibu, Sarawak (Master Thesis), Universiti Teknologi
Malasysia.
Ummi Kalsom, Z. (2014), Faktor-Faktor Yang Mempengaruhi Tekanan Kerja Dalam Kalangan
Guru Sekolah Menengah Daerah Hulu Terengganu, Terengganu Darul Iman.
Undang-undang, L. P. (2013), AKTA POLIS 1967 (AKTA 344), Petaling Jaya : International
Law Book Services (ILBS).
Yenny, Elly, H. (2006), Prevalensi Penyakit Kronis Dan Kualitas Hidup Pada Lanjut Usia Di
Jakarta Selatan, Universa Medicina, Oktober-Desember 2006, Vol.25 No.4.
-CS14-
THE PROTOCOL AND EVENT MANAGEMENT DEPARTMENT
MohdNasrun B Md Suid
College Of Law, Government & International Studies
mohd.nasrun@yahoo.com
508
Abstract
The Protocol and Event Management Department of the Kedah State Secretary Office is
one of the contributor available in the government state component to play an important role of
implementing the state transformation agenda based on macro and sectoral policies in line with
the vision and mission of the state and country, coordinating state government decision making
and federal basis based on state and federal policies to ensure the implementation of decisions
can go smoothly and perfectly, coordinate the relationship of the stakeholders and internal
customers in ensuring that the government can deliver the best service for the people's
prosperity. This study insist to observed and highlight the nature of event management and the
practices of protocol in Kedah State Government by reviewing the stages of event management,
components of events management, challenges in event management, recommendations to
tackle those challenges and also to show the relationship of protocol and etiquette in conducting
an event. Act as main organizer for Kedah‘ formal ceremony and event, this department tends
to meet their own target and goals, not only for their department but also each event targets.
They go through all the event stages of pre event, at event and post event accordingly to their
plan. All components being supervised well eventhough there is few circumstances to be
overcome. This department takes a serious attention on the practices of protocol and etiquette
in event management especially during the royal state ceremony, formal state ceremony and
formal events. As such, practices of protocol conducted in every event helps the event
management team to launching a high prestige and memorable event to all the audiences. As
sum, protocol and event management is relating to each other that drive toward an event
successfulness. The most important thing to be remembered in handling or conducting event
and ceremony is the memorable moment created for the audiences to keep all the way of their
life.
1.0 INTRODUCTION
The Kedah State Secretary Office is a government administrative center of the state. It is
the driving force behind the socio-economic development policies outlined by the State
Government of Kedah. There are 12 divisions in Kedah State Secretariat Office Y.A.B Chief
Minister Office, Management Services Department, Economic Planning Department, Human
Resources Department, Local Government Department, Housing Department, Information
Technology and Communications Department, Internal Audit Unit, State Sports Council,
Corporate Communications Department, The Department of Integrity and State Governance
(JITU) and The Protocol and Event Management Department. Each of the departments has its
own roles and functions towards the state management level. All the departments are
interrelated to each other‘s eventhough they are in the different fields because their combination
and correlation will helps and support the state development well.
The Protocol and Event Management Department of Kedah State Secretariat Office act
as the main organizer of any formal ceremony and the state event supervisors by providing
guidelines and assistance in managing the functions. At the state level event and function, this
department and its committee will become the backbone that plays more important roles and
have bigger responsibilities especially in the functions that involved formalities and protocols.
Every event or function organized has its own agenda and goals to be achieve and maximizing
the benefits of an event for the organization‘s image and status.
There are 4 main principles hold by The Protocol and Event Management Department
which are commitment, speed, consistency and efficiency. The objective of the department are
to plan, coordinates and provide competent services in matters related to the state
509
government‘s official functions as well as domestic and foreign visitors. Besides, they is also to
ensure the matters that relating to protocols and ceremonies that involve KDYMM Tuanku
Sultan Kedah and the Chief Minister of Kedah always follow the rules. Last but not least is to
provide effective and efficient services related to the management of the functions and the
protocol.
Event and protocol are interrelated and comes in a package for any functions. Each
event will follow different protocol which usually set according to the precedence. Every event
will also have its own challenges to be face and sometimes there are similar challenges and
problems happen to a different event or functions. Thus, The Protocol and Event Management
Department has to take alternative actions and find solutions of the repeated problems found.
Many events conducting by state government facing an internal problem within the stages of
before event, at event and after the event being launch. There should be a proper guideline on
event planning and managing including the practices of protocol according to the state structure
by take into consideration the order of precedence, the culture and the state nature and
practices.
This paper is based on the ground experience of internship and it is found that there is
available area and aspect can be improved in ensuring that event and function conducted by
The Protocol and Event Management Department is successful and reach its goal. Thus, this
study will provide some information, opinions and recommendations on few areas to be
improved. This study will tend to list down the event planning stages and necessary actions to
be done at each stage, to list down the event components of product (tools), people, price,
place and promotion, to identify the challenges of organizing an event and to provide
recommendations toward successful event launching.
2.0 DISCUSSION
2.1 Event Management
Event management is the application of project management to the creation and

development of large-scale events such as festivals, conferences, ceremonies, weddings,
formal parties, concerts, or conventions. It involves studying the brand, identifying its target
audience, devising the event concept, and coordinating the technical aspects before actually
launching the event.
2.2 Protocol
Protocol is the rules to set daily routine to be carried out in order appropriately in the
society. Depending on the seriousness of the event or engagement in question, protocol
assists the officer to rehearse or practice different greetings or role-play potentially tough
scenarios. Protocol is considered something new to our society. However, Mokhtar and
Ahmad Fawzi (2003) said, it has been practiced for long since the olden time; it was at time
appeared as the norm and practices in the royalty.
2.3 Order of Precedence
Order of precedence is a sequential hierarchy of nominal importance of persons.

Most often it is used in the context of people by many organizations and governments, for
very formal and state occasions, especially where diplomats are present. It can also be used
in the context of decorations, medals and awards. Order of Precedence is based on the
510
sequence of seniority for officers in the government and non-governmental organization. As

a government officer, the status is marked by the type of positions, the grade of the
positions, the salary scheme and the title awarded, as for the public is depended on the title
that awarded to them.
2.4 Stages of an event management
Event management is divided into three main stages which is pre event, at event and
post event activities.Pre event stage is the starting point of the event where primary items
and idea being gather and discuss. The idea of organizing an event basically originated from
the organizations nature of work and the culture practices. Every event organized will come
with its own focus and goals.
Second stage is during the event launching or at event stage. They include opening
and closing speeches, musical fanfares, playing of national anthems, presentation of awards
and flowers, visits from dignitaries, flag rising, and special displays. Nevertheless adding a
little ceremony to the event programmed, which often costs very little, should be considered
for smaller events. A failure to include ceremonial activities is an opportunity lost for the
organization hosting the event. Some points to consider in adding ceremony to the event
programmed are to make contingency plans for dignitaries that fail to show or arrive late,
capturing and positioning the crowd to witness the ceremony as they tend not to be effective
if the people are dispersed too widely, always remember that ceremonies that are not well
organized may backfire badly include the rehearsals and consider carefully the best time for
ceremonies in the event programmed and try to avoid dignitaries arriving at bad times or
when there a few to witness i.e. crowd at its smallest.
The final and last stage is post event stage which involves the process of post-
mortem. Post-mortem is the examination of something after it happened to find out why it
succeeded or failed. A post-mortem is usually performed at the end of an event, and lessons
learned can be applied for further events. Any event, success or failure, will lead to lessons
learned in some way, although the second may be especially prolific in this regard.
There are few steps involve in conducting a good post-mortem sessions. First, start
the meeting by summarizing the event goal and initial objectives, then, present the project
outcomes, generate discussion on lessons learned, generate lessons learned and solutions
and lastly thanks everybody for their commitment in the post-mortem.
All the stages mention above were experienced by the team in The Protocol and
Event Management Department through the state event such as Kedah State Independence
Day Program which originated from a combination of social event, corporate event and
ceremony. This event is considered as the state yearly event because it is held every year in
August.
2.5 Protocol and Event Management
Protocol practice involved in all function at all level, it is indeed a challenge to the
person who need to organized functions in appropriate manner. Hence, they are advised to
follow the rules and orders set by the Federal, states as well as any organization.
Protocol is being practiced in most of the function for most of the party even though the
importance of it seemingly less noticed. In an event, protocol is not just about the order of
precedence that need to be follow but also other etiquette which consider as a part of
protocol. This is including the arrangement etiquette, the invitation etiquette, the controlling
guest lists and numbers and also the food and beverage management etiquette especially
511
for the VIPs. Good protocol and etiquette practices during any event and ceremony will bring
the event to the higher prestige and stand at its own level. The protocol practice should be
done by someone who is knowledgeable and expert in handling all the doubts in
protocol practice. Protocol and event management is always relating to each other and
specify the event successfulness.
2.6 Issues and challenges
Throughout my personal participation in the event engagement, some challenges

and issues were observed. There is an area to be improved in having a better event
management strategy. Following are the main issues arise to The Protocol and Event
Management Department being highlighted which are workforce problem, guests
management issues, infrastructure and facilities, failure to keep a track of changes to the
scope of the event and simple mistakes such as not following standard etc.
Workforce main problem are two that is scarcity of workforce and unskilled
workforce. In The Protocol and Event Management Department, there are 15 staffs
including officer, officer assistant, administrative assistants, operation assistants and drivers.
For the state level event being organized by this department, it is seem to be a scarce in
workforce to complete the task of planning the event and launching it well and successful.
Inadequate skills or knowledge of the staffs are also one of the problems the department is
facing. In handling any events that involve the protocol management, staffs need to have
some skills and knowledge especially involving the State Order of Precedence. As I
observed, there are only several employees that have the skill to manage the order. This
lack of expertise probably can affect the productivity of the Protocol and Event Management
Department. Not only that, it will also affecting the successfulness of the event.
Guest management faces two main problems of guest‘s attendance and guest‘s
dress code. The problem arises when the invited person did not response to their
attendance. This will create problem in arranging the seat. To avoid any disturbance during
the event, staffs of the department need to contact every guest asking whether they will
attend the ceremony or event. This will consume some time and workforce. Sometime
another unexpected incident takes place regarding guest‘s management due to difference in
response and action. Guests who do not following the dress code of the ceremony is also
one of the problem that Protocol and Event Management Department facing recently
especially for Royal Ceremony. Any ceremony that held in palace usually applied strict dress
code etiquette. This is because it is the rules of the palace for each guest to dress according
to the dress code.
Proper preparation of facilities at the event venue is very important in order to
ensure that the event can run smoothly as pre-planned. The Protocol and Event
Management Department always facing big challenges in this area because it involves
many aspects including seating, food and refreshment, a reception area for dignitaries and
other important personnel, information stands manned by event personnel, good standard of
toilets, wash rooms and baby change areas for public, good standard change facilities,
facilities for people with a disability, giveaways and lucky door prizes, special services for
competitors such as masseurs or lockers, directions to venue on web site, assistance with
parking, good public announcement system and end of the event function
As with most real-life scenarios, most events will have changes in plans and scope
before the big day. Failure to keep a track of the smallest change can mean an out of control
budget, or an impossible timeline.
This is a far more common event management mistake than most event planners
imagine. Lack of an agreed upon plan increases the risk that tasks related to the event will
512
fall through the cracks, that the event will have last minute issues, fall short on budget and
ultimately miss a major objective.
2.7 Recommendations of event management
2.7.1 Workforce
Organizing an event basically requires huge number of workforce which involve

in every stage of event management process. Thus, the department needs to find
alternatives to build a bigger community or team if they are organizing such a bigger
event. Some alternatives can be implement are as follow:
o collaboration with other department within the organization or collaboration with other
agencies or NGOs depends on the event nature.
o hire a contract staff using Contract for Service basis.
o If there is a bigger budget available, the department may also appoint an event
management team to manage the event especially for the big event which is beyond
the department capability.
o providing a training to the staffs on event management so that they have a
knowledge on handling situation or unexpected event.
o people want to be recognized and appreciated. The Protocol and Event Management
Department should think about providing those kind of reward to the staff other than
overtime payment.
2.7.2 Guests Management
To be safe, The Protocol and Event Management Department need to have an

early backup plan and ready to coop with the unexpected event. For the guest‘s
attendance, it is better to have a backup strategy if the attendance list changes or etc.
For the dress code, it is possible to inform it earlier to the guests by mention it in the
invitation card and also to remind them through phone call during the follow up session.
2.8 Preparing a Blue Print for the Yearly State Event
It is necessary to have a proper plan in conducting an event. The department can

take initiatives to prepare a blueprint for the state yearly event so that early preparation can
be make. Example of the event that can be consider as yearly event is the Sultans Birthday,
Independence Day and any other event that is suitable. It also can be in Event Calendar
type to be share by other related agencies and people whose indirectly involve in the event.
Even though it is subject to changes but at least the organizer has a platform of planning in
term of budget and workforce allocation.
2.9 Building Good Relationship with Other Related Agencies
Event is a big thing to conduct. Thus, it is important for the department to have a
good relationship and communications with other agencies especially those who can
513
support in the event organizing such as Public Works Department (JKR), Department of
Information and other state agencies.
3.0 CONCLUSIONS
The Protocol and Event Management Department playing an important roles to the
Kedah State by organizing such Royal Ceremony inside and outside the palace which involve
Sultan and also other state or political event which involve Prime Minister, Deputy of Prime
Minister and Chief Minister of Kedah. These departments act as one stop center of other state
agencies in assisting and providing an advice and guideline in managing an event and
ceremony. Protocol of the event being emphasized to all the state agencies and standardized
because it is an important element in ensuring the smoothness of the event. Protocol provide an
etiquette of doing things in all related area and it is good to be applied. Protocol helps an event
organized to stand at its own prestige upon it successfulness.
-CS15-
Problems And Issues In Landscape Construction Industries: Study On
Construction Waste In Senitaman Bumi Indah Sdn. Bhd’s (SBISB)
LandscapeProjects
Mohd Faizal b. Abu Bakar

College Of Law, Government & International Studies
yorke81@gmail.com
Abstract
Construction industries is considered as one of the main sources of environmental

issues in the world. It has massive direct and indirect effects on the environment. The
environmental effects of the physical construction process can be created to various
environmental impacts. The aim of this study is to understand the implication of environmental
issues in construction and provides a guideline for the construction organizations to practice.
The objective of the study is to investigate the contributing factors to the environmental issues in
construction, their types and implication towards the environment. Secondly is to review and
analyses cases studies in SBISB‘s projects which deal with the environmental issues and lastly
to draw and suggest a possible solution to be adopted within the construction organization to
deal with the implication of environmental issues. Throughout the construction activities, a lot of
waste been created from it site works. The majority of their waste are disposed to landfill and
this generate more effects to the environmental as the disposal area will become bigger and
bigger. There are a large number of constructions and demolition wastes were producing every
year. This can contribute to the serious environmental impact if not carefully wisely manage by
the site management team. It is recommended to enhance the knowledge and awareness of
construction participants with regard to environmental impacts of construction and enact strict
laws to attempt curbing down the adverse impacts of construction such as enforcing institutions
to conduct environmental impact assessment (EIA) in the early stage of the projects. The results
514
of this study can help decision makers to identify major construction impacts on environment
and make environmentally friendly construction plans in the early stages of construction.
1. INTRODUCTION
The construction industry is facing a significant pressure which can only be deal through
the sound environmental management system and good environment practice in construction.
The implication of the environmental issues in construction is becoming very critical and needed
the construction industry practitioners to understand their implication, contribution factors and
need a proper guideline for construction industry players to practice. Although there are
increasing legislation and environmental procedure with the sustainable development agenda to
comply with but still the level of their effectiveness as complying by the construction industry
practitioners is still can be questioned. Do they aware about it, clearly understand it or comply it
to help to minimize the implication towards the environment by their construction activities?
The aim of this study is to understand the implication of environmental issues in
construction and provides a guideline for the construction organizations to practice. There are
three main objectives of this study. Firstly, to identify the contributing factors to the
environmental issues in construction, their types and implication towards the environment.
Secondly, to review and analyses cases studies which deal with the environmental issues and
the last one is to draw and suggest a possible solution to be adopted within the construction
organization to deal with the implication of environmental issues.
2. CONSTRUCTION INDUSTRY AND ENVIRONMENTAL
Environment includes water, air and land and the interrelationships which exist among
and between water, air and land and human beings and other living creatures such as plants,
animals and microorganisms (Kalavathy, 2004). The natural environment consists of four
interlinking systems namely, the atmosphere, the hydrosphere, the lithosphere and the
biosphere. These four systems are in constant change and such changes are affected by
human activities and vice versa (Kumarasamy et al., 2004). Any change in any component of
the environment may cause discomfort and affect their normal life. The unfavourable change or
degeneration in the environment is known as ‗Environmental Pollution‘. Environmental
ecosystem can be affected by many ways. These factors may be from other living organism
(biotic factors) or non-living factors (abiotic factors), such as soil, water, sound, air, light, climate
and others. However, this study will be only focusing on the non-living factors that caused by
numerous construction activities which have affect the environmental ecosystem.
Construction industries are often criticized for their negative effect that they create to
their surrounding environment. The environmental effects of the physical construction process
can be created to various environmental impacts. The possibly can cause damage to the natural
landscape which affecting the local inhabitants, flora and fauna, pollution and as well as comfort
disturbances. Besides that, construction activities, also create waste from its site works. The
majority of their waste are disposed to landfill and this generate more effects to the
environmental as the disposal area will become bigger and bigger.
The nature of all construction works is always come with some effects to its surrounding
environments. The construction industry is said to be a major source of pollution, with
responsible for around 4% of particulate emissions, more water pollution incidents than any
other industry, and thousands of noise complaints every year (Sustainable Build, 2008). Some
of these effects are irreversible and therefore they should be planned and conducted carefully to
515
really minimize the environmental effect and the serious negative environmental implication can
be avoided. CIRIA, 2002 has categorized the environmental issues in 7 categories. There are
pollutions of ground, water, noise and vibration, air (dust, dirt, emission, odors and pollutants),
plants and wildlife, and archaeology and historic features.
3. CONSTRUCTION WASTE
Waste is defined as a ‗things that are not wanted‘ (Oxford Advanced Learner). CIRIA,
2002 has defined waste as ‗any substance or object which the holder discards, intends to
discard, or is required to discard‘. There are three definitions types of construction waste
according to (Coventry & Woolveridge, 2002) which are inactive waste, active wastes and
special wastes.
There are a large number of constructions and demolition wastes were producing every
year. This can contribute to the serious environmental impact if not carefully wisely manage by
the site management team. Examples of these are noise, dust and other related pollution during
wastes is being transported to a waste landfill site. In addition, they will also create traffic
emission during the transportation process to disposal. Coventry & Woolveridge, (2002) had
revealed the main problems in poor site waste management that can lead to the environmental
impact in construction.
The contributions factors that can lead to the environmental issues which related to
construction and demolition wastes are the amount of material that are wasted. If there are no
proper waste management on site take place, the amount of materials that are waste on site will
get increase and his will lead to more impact to the environment rather than small size of
material that are wasted. Other than that, poorly handled and stored of wastes also can
contribute toward the issues. The bad technique of handled and stored the waste in their proper
way they should be will easily cause the impact on the environment. The amount of reclaimable
waste also can be a reason for the bad image of the construction site. If they are more amount
of waste that is unable to reclaim or reuse for other construction purpose, this will increase the
amount of construction material that are going to be waste. Waste disposal should not be simply
looked as they are not important because the method of waste disposal such as burning or
letting them to discharge through water channel or other method that being used should
consider the effect to the environment.
3.1 CASE STUDIES: Construction Waste In SBISB’s Landscape Projects
In this study, I will look upon a major issue that cause the environmental issues in two
numbers of projects which been handle and constructed by Senitaman Bumi Indah Sdn. Bhd
(SBISB) which will be used to support the study. The case studies were selected base on their
approach in dealing with the potential environmental implication that brings out by the
construction waste. The two projects that have been chosen were the Landscape Upgrading
Works at Al-Bukhary International University in Alor Setar, Kedah and the other one is the
Landscape Construction Works for Campus 1 and Campus 2 Bbraun Medical Industries
Sdn.Bhd. in Pulau Penang. These case studies will be used to draw up upon the conclusion on
how the construction waste give impact toward the environmental implications in construction.
In general, a worksite will always be staffed with the appropriate level of manpower, be it
laborers, mechanics, or operators and there is always a superintendent or foreman on hand. A
well-organized site will then yield higher productivity, hence, achieving higher performance.
516
Information about each site was received through the report submitted by company to the client
and observations been made while touring the physical sites.
A. Albukhary International University (AiU)
Albukhary International University (AiU) is designed and constructed on 45 acres (18

hectares) site, AiU has a dedicated and iconic campus located near the city of Alor Setar,
the capital of the State of Kedah in the north of Malaysia. It is one of the University in Alor
Setar that been built by Yayasan Al-Bukhary. The AiU building were built in 2005 not only
has a beautiful architecture façade but also an attractive scenery landscape that resembles
the Middle East country.
SBISB were appointed by AiU for the upgrading landscape works. While the
landscape construction work has just begun, the company need to do the site clearance
work as per indicate in the contract. During that time, the site was still full of construction
debris such as building materials, building remnants and construction waste that need to be
cleared first.
All those remedies gave an impact toward the landscape development that will be
undertaken by the company if it is not cleared first. This poor site waste management that
can lead to the environmental impact in construction. The effect of this idle remnants will
lead to breeding of disease-bearing insects. In addition, it also will produce water puddles
and causes pollution. The main contractor for the building construction needs to have a
proper technique of handled and stored the waste in a proper way.
There are still a lot of the materials or residues that are still can be used and some of
it are no longer needed. As long as the construction work were still in progress or it is fully
completed, every building material used should be kept properly and the rest of the unused
material cannot be left either during working progress or after completion. All of the waste
must always be disposed of at the dumping site at all times during the project. Besides
polluting the environment, it also poses a hazard to the workers in the area and can even
affect nearby residents.
After the SBISB was appointed as a sub-contractor for the landscape upgrading
works, almost 90% of AiU's building works have been completed by main contractor. In
order to carry out the infrastructure work provided to SBISB, all of the building materials
either that were still in use or no longer required should be stored or packed by the main
contractor. Construction materials or construction waste should not be left at the project site
provided to SBISB as it negatively affects the quality of SBISB's work, it also disrupts the
time frame for SBISB project completion.
B. B.Braun Medical Industries Sdn. Bhd. (BMISB)
Located in Bayan Lepas, Pulau Pinang. Being more than 40 years established in
Penang, BMISB is one of the leading suppliers and manufacturers of healthcare sector.
BMISB supplies the global healthcare market with products for anaesthesia, intensive
medicine, cardiology, extra corporeal blood treatment and surgery, as well as services for
hospitals, general practitioners and the homecare sector.
In October 2017, SBISB was appointed as a Landscape Contractor to build a work,
leisure and well-being landscape garden and park in BMISB, Pulau Pinang. The origin
517
condition of the construction site was an open green space which does not have any
landscape elements and was only filled with grass.
As of today, the progress of the site is almost 90%. In the early stage for this project, the
SBISB needs to remove the entire existing grass and remove the original soil layer to begin
the new landscape design work. The pre-construction work involves earthworks, wiring,
piping and drainage systems. During this pre-construction works, almost 10,000 cubic
metres of non-hazardous waste materials and 7,000 cubic metres of inert material from the
demolition of the existing surface, former roads and car parks which had to be removed
before construction work could begin. There is also an existing construction waste such as
existing electrical cables, drainage and piping need to carry out from the site.
Common materials found in this project were timber frameworks, plastic bags and
papers (packaging waste), wasted soil, and unused pipes and cables. It was observed that
such materials were kept in order and tidy, but no proper storage location was provided.
Regarding timber formwork, alterations were made so that they redesigned for another use.
Although materials were placed close to the building without blocking the road, the situation
appeared to be messy, especially on rainy days. However, 5-10% extra materials were
always ordered and stored on site to keep up with the progress of the project. Considering
the total quantity of timber involved, only 30% was reused. The remaining timber materials
were exported to other sites for continued usage. Human error, redesigning of work and
unavoidable damages was regarded as the most prominent causes of this waste.
4. ENVIRONMENTAL IMPACT
It is very well recognized that both of the construction sites are not environmentally
friendly. A part from consuming large amount of natural resources, it has been criticized to
generate high level of solid waste. Construction waste are in the forms of building debris, rubble,
earth, concrete, steel, timber, and mixed site clearance materials, arising from the construction
activities including land excavation or formation, civil and building construction, demolition
activities, roadwork and building renovation (Shen et al. 2004). The environmental impact cause
by the construction materials may give substantial influence. If there is no development in
reducing these environmental impacts and if the same old trends are continued more and more
environmental impacts may occur in the nearby feature such as pollution, diseases, landslide
and etc.
Every construction project result in the emission of carbon dioxide, methane, and other
waste products that pollute the air and believed to contribute to global climate change. The most
harmful aspect of construction in terms of contributing to climate change is the operation of
heavy machinery in mining projects that extract raw materials from the earth for use in
construction projects.
Aside from contributing to climate change on a global scale, construction projects can
have a significant impact on local environments and nature. The construction process itself
causes different environmental impacts (Kilbert, 2005, Gangolells Et Al., 2011, Abdul-
Rahman Et Al., 2016). Bulk materials, water and electricity among other resources of various
types and origins are consumed on construction sites during the different production activities
and by the temporary facilities. These activities generate solid waste and particle emissions
causing a concern with soil contamination, air and water pollution and soil erosion
(Gangolells Et Al., 2014). Noise emission is also an important issue, as the construction site
518
activities temporarily increase noise pollution, and are often set in the urban environment
(Ballesteros Et Al., 2010)
Serious actions need to be taken by designers, engineers and contractor as well to

overcome these issues. As we can see from the both projects, waste management was only
practiced to a certain extent. The awareness and implementation of waste minimization was of
concern in only certain areas. Financial motivation can highly influence the behaviour of those
involved in the construction industry, regardless of cost saving or financial incentives.
Awareness should be raised in a more practical way or woven into a few crucial parameters so
that the minimization of waste can be implemented in the early stages of construction
The two projects been handled by SBISB have shown a few holistic approaches in
dealing with the situation whereby the decision is needed to deal with the environmental impact
brought by the construction activities. The decision however must be aligned with the
sustainable development agenda and in conjunction with all the regulations made of related
regulator bodies.The approach that might have useful to adopt in references with these cases
studies is in managing waste. The proper waste management is just not benefiting the
construction practitioners to the cost that might save but it also can improve the environmental
impact in many ways.
5.0 CONCLUSION
Construction activities have brought many negative implications towards the

environment. Despite of trying to cater with the increasing development in the construction
project, it is vital important to minimized the impact for future generation benefit. It is appropriate
with the aim of this study which is trying to understand the implication of the environmental
issues in construction and to provide the guidelines for the construction organization to practice.
The main environmental issues discussed in this study is about the waste that resulted
from the construction activities on site. The major problem that has been created is to the
increasing landfill capacity to cope with an increasing waste by the construction activities. The
proper site waste management which has tried to manage the construction waste on site has
managed to slightly reduce the environmental pollution that the disposal of site waste may
cause.
The contributions factors to the environmental issues in construction have been
concluded in this study are such as, firstly, lack of awareness and effectiveness level of
implementing the Environmental Management System and the sustainable development
agenda among the construction industries. Second, improper site management towards the
environmental sensitivity during the construction activities on site also contribute to these
factors. Third, the construction practitioners also trying to maximize their profit and reduce time
to complete the given project. Forth, limited of knowledge among the workers on how
construction practice can affect the environment and the last factor is about the poor public
relationship with the site neighbourhood.
All the five factors have much contribute to the environmental issues in construction on
the management point of view whereas this can be minimized by cope with more serious and
effective environmental management system in the whole life cycle of the project which involved
all level staff in the organization. The proper site management is crucial in helping to reduce the
potential environmental pollution on the site. The site waste management can help to reduce the
519
related environmental pollution that might derive from the transportation of waste to be disposed
as well as reducing the problem of scarcity of the landfill area.
Finally, to conclude everything toward this study, we need to draw and suggest a
possible solution to be adopted within the construction organization to deal with the implication
of environmental issues. The solution that have been concluded for the better effectiveness in
achieving a better environmentalperformance in the future, all construction professional
regardless of their position have to play their role and can‘t be left solely to the site management
team. The proper planning from the design and tendering stage have to consider on how the
environmental issues will be tackle and not only manage the working papers on the EMS
procedure or EIA but the important thing is the result.
REFERENCES
COVENTRY, S., & WOOLVERIDGE, C. (2002). Environmental Good Practice on Site.

London: CIRIA.
GRIFFITH, A., & WATSON, P. (2004). Construction Management Principle and
Practice. New York: Palgrave Macmillan.
STUBBS, A. (1998). Environmental Law for the Construction Industry. London: Thomas
Telford.
SUSTAINABLE BUILD, (2008). Pollution from Construction [online]. Eco-Friendly
Building Tips & Advice. Available at <URL:
http://www.sustainablebuild.co.uk/PollutionFromConstruction. html> [Accessed 03 April
2018].
ERAN FEITELSON. (2012). What is water? A normative perspective. Department of
Geography, The Hebrew University of Jerusalem, Mount Scopus, Jerusalem 91905,
Israel
KALAVATHY. (2004). Definition of environment. Retrieved from
http://shodhganga.inflibnet.ac.in/bitstream/10603/5081/8/08_chapter%201.pdf.
[Accessed 03 April 2018].
K. KLINKA. (June 2008), Ecosystem (Site) Classification: Principles, Concepts,
Rationale, System, and Its Development; Applications In Forest Resources
Management. UBC Forest Sciences Department, Vancouver, BC
-CS16-
POOR GOVERNANCE OF KSDC’S SUBSIDIARIES: THE NEED FOR
RESTRUCTURING
Muhammad Zuhairi Bin Muhamad Nor

KolejUndang-undang, Kerajaan dan PengajianAntarabangsa
zuhairi7070@gmail.com
Abstract
Poor governance of a company or organization always being the reason when a

company involve with customer dissatisfaction. The weakness of the members in organizational
structure of the company in implementing their activities may be the reason why people is
520
complaining. This paper aiming to provide more insight that determines the management‘s issue
in one of the Kedah State Development Corporation (KSDC)‘s subsidiaries.Firstly, this paper will
briefly describe on KSDC's background and its subsidiary, STDC. Secondly, this paper will
explain the problems that arise to the KSDC regarding poor governance and management‘s
issue of STDC. Thirdly, the author makes an analysis of the company's financial performance as
well as external and internal factors affecting the company and the fourth end, the proposals
that KSDC can take to address the problems that arise at the level of its subsidiaries.
Keywords: Poor governance, organizational structure, customer dissatisfaction
1. INTRODUCTION
As a part of my internship, I chose to study one of the management problems faced by

KSDC which involve with the governance of it‘ s subsidiary. KSDC in general, is a statutory
body entity established on 25 August 1965 under the Kedah State Government Enactment No.
5/1965 as an agency entrusted to protect the interests of Bumiputra supervised by the Ministry
of Finance of Malaysia. KSDC was set up to drive the socio-economic development and
development of urban and rural areas in Kedah.
In February 1968, KSDC managed to own its own office building located at Jalan Tunku
Ibrahim, AlorSetar and named UKIR Building. The word 'UKIR' which means
'UntukKemajuanIktisad Rakyat' is now an inspiration to KSDC to expand its corporate
dimensions. KSDC currently operates with 162 employees in 13 divisions according to their
respective duties and roles.
As a government-linked company (Government Link Company, GLC) for Kedah state,

KSDC has ventured into various sectors which give revenue to it. The plantation sector is the
most important sector that contributes to the main income of KSDC. In addition, KSDC is also
involved directly and indirectly in the property development, industrial parks, tourism and
entrepreneurship sector in Kedah. KSDC has also expanded its corporate dimensions through
the investment sector through wholly-owned subsidiaries, subsidiaries, associates and
investment companies in which companies are able to generate income in a highly competitive
economic situation.
Seri Temin Development Corporation (M) S/B (STDC) is a wholly-owned subsidiary of

KSDC and was established on March 15, 1979. STDC has been in operation for 38 years and
has many experiences in the field of construction contractors and property developments.
STDC also has a G7 license (Class A Bumiputra Contractor) - Building Construction, Civil
Engineering, Mechanical & Electrical Construction. Since the inception of the STDC, it has been
successful in developing a house shop project and other construction projects. In 2003 to 2010,
STDC successfully completed 58 projects.
521
2.PROBLEM STATEMENT & OBJECTIVE OF STUDY
In this regard, as a case study, I chose the problem of poor governance in the KSDC‘s
100% owned subsidiary in managing and implementing a commercial housing project which
eventually failed to complete the project within a timeframe. The failure has resulted in customer
dissatisfaction which is the house buyer. Various complaints were reported to the company itself
until the same complaint was submitted to KSDC as well as the state government. This first
failure had trigger for a heavier issue involving the management of STDC.
The problem arises when it comes to KSDC where the development land granted to the
STDC is not developed and implemented properly. In this case study, the author will emphasize
on the problems raised by KSDC's subsidiary, which is STDC that has been granted the right of
development of 200 acres of land owned by KSDC in district of PokokSena, Kedah for mixed
development purposes which will involve the construction of various types of houses, as well as
other infrastructure needs. The whole development was planned to be implemented through
several phases of development, namely Phase 1, Phase 2, Phase 3, Phase 4 and Phase 5.
STDC also initially held a ground-breaking ceremony executed by the Kedah Chief Minister at
that time as a sign of the launch of the project. It also shows high government support for the
provision of affordable housing to the people of Kedah.
In terms of sales for Phase 1 zone 1, STDC management was not faced with the
problem of selling home-built units at that time where the project had been 95% sold during
construction. After 2 years of construction, problems arise when there is a issue when there is
late handing over of vacant possession of the 128 house units to the house‘ buyer. This failure
has prompted the rage of the buyers who finally massively complained and demanded the
company's response. Various feedback and excuses have been given to buyers by STDC and
have finally submitted their concerns to KSDC as the holding company of STDC and landlords
and also to the state government to claim interfere with both parties for a concrete solution. The
KSDC has heard the complaints and complaints from these buyers and has finally sent their
representative to go down and try to settle the issue.
Some literature, when business problems arise, signs often exist in the design or
component of the organizational structure. In some cases, these signs can be an early indicator
of important issues to be addressed. The following signs are an indication of the company's
weaknesses in management:
1) Weak productivity
Low productivity is the key metric for almost every business. Low productivity levels can
point to problems within the organizational structure. Through inadequate resource allocation,
poor vertical communications and constraints of workers' co-workers, employees may not have
the appropriate environment to complete their work tasks efficiently.
2) Uneven workload
Poor organizational structure can lead to unequal distribution of work between

departments or divisions. When some areas of the company are routinely constrained and
522
working overtime to meet the workload requirements, while other fields are struggling to find
sufficient work to ensure that every employee is busy, the organizational structure has not been
optimized for business needs.
3) Communication Line Not clear
Employees routinely skip the standard chain of command in the company can be a sign
of a weak organizational design. Employees with complaints or suggestions will usually provide
feedback to their managers or sometimes to their manager's boss. In an optimum business,
employees should feel their voices heard through standard management routes. In
organizations with weak structures, workers may find it necessary to go directly to the head of
department, vice president or president to express concern or suggestion.
4) Less team spiritual
Poor organizational structure is little to nurture teamwork concepts. The department may
not be willing or unable to cooperate with each other, and employees in the department may not
feel intimacy. Workers can focus on their own duties and not provide assistance to others
unless directed by the supervisor.
5) Slow decision making
Slow decisions can prevent sales and innovation opportunities. If the organizational
structure is not optimized to direct the decision-making authority to the appropriate person or
must go through several management layers before the decision is made, the organizational
structure may need to be changed. More leaner decision-making or departments may be
needed to foster innovative spirit in the company.
6) Less innovation
Companies with a poor organizational structure are often slow to innovate. The pipeline
for new ideas may not exist, and even if it does, poor communication may mean that the idea
never reaches the right source for development and implementation. As a result, employees
who come up with new ideas can save it to themselves or bring them to a new employer.
In order to ensure an accurate study approach, the objectives of the study are set out below:
a) This study is to identify the causes for the company's management weakness
experienced by STDC companies which led to the delay of this Phase 1 zone 1‘s project
b) The study will also suggest options that KSDC may take in controlling it‘s subsidiaries
company
3. ANALYSIS
523
The main revenue of STDC is from Bandar Sejahtera housing project in PokokSena
besides several other construction projects. Based on financial information, STDC revenue has
started to decline as housing construction projects have been completed in 2013. This can be
seen from 2014 STDC has no income and does not have any employment contract. STDC
losses have increased since 2013 due to the large fixed cost of management and write-offs and
no new projects were obtained.
For further study, the author chose to apply the SWOT Analysis Technique in order tostudy the
strengths, weaknesses, opportunities and threats to the company.
1) STDC‘s strength
a. Long time in the construction and property industry
b. Having a CIDB G7 License (Class A Bumiputra Contractor)
c. Experience developing large-scale projects
d. Still have good cash flow
2) STDC‘s weakness
a. Poor management of Human Resources
b. Not having a new project since 2013
c. Rely on commissions
d. Contained by debt
e. Company has Negative Net Tangible Assets (NTAs)
f. Housing developer's license has been blacklisted by KPKT - PES Sena Bandar
Sejahtera Project
g. There is no investment return from STDC as well as lack of monitoring from
KSDC
h. Sometimes has to apply for borrowing funds from KSDC to bear the operating
costs of the company
3) STDC‘s Opportunity
a. Opportunity to manage KSDC projects & government projects
b. Opportunity to develop KSDC‘s land
4) STDC‘s treat
a. The profit of new project revenue is used for debt repayment
b. Lack of financial sources
c. Lack of Skills
d. Competition with other
4. RECOMMENDATIONS
In the KSDC point of view, one of the immediate actions needs to be taken by the
company and the management of KSDC is to look at the needs of STDC‘s restructuring. It is
seen need to be implemented for the purpose of setting the direction and goals of the company.
Based on the current situation of its operation and financial status, the company's management
handed over to KSDC as itsholding company to determine the company's new direction.
For the purpose of restructuring the company, among the suggestions that can be
considered are as follows:
524
1) Based on current financial records and company operations, one of the possible
proposals is to close the company's operations and to discharge and redress the
workforce. This approach can be considered as a difficult option to take. Sensitive
issues such as retrenchment, voluntary retrenchment (VSS), reduction of employee
wages always be complicated but must be decided.
2) Provide transfer of STDC workforce to another subsidiary

For now, STDC staff only carry out outstanding debt collection activities to STDC.
There is no activity that generates new income to the company. To address human
resources matters, among the options that KSDC can implement in the effort to
restructure the company is to resettle staff to companies conducting similar business
operations with STDC namely Kynetics Land S/B (KLSB) where KLSB is also a
wholly-owned subsidiary of PKNK. The transfer of this workforce is seen as the best
alternative and suitable to be implemented. This means that the restructuring at
KLSB will indirectly be carried out with the entry of staff from STDC.
3) Establish an exco committee at the company level
To control the activities of a subsidiary, KSDC can create a special committee to

evaluate any proposals that will be implemented at a company level later. The Committee will
act to provide initial assessment and recommendations before it is presented at the Company‘s
Board. It is more likely as controlling tools on a subsidiary where this committee will be staffed
by PKNK staff themselves.
5.CONCLUSIONS
To determine organizational activity to be more organized as planned, it requires a

system of oversight, coordination and regulation of the activities of a company or organization.
Thus, in an organization, the rules, policies, procedures and systems of relations must be
clearly explained to the staff. Determination of whether the organization is effective, efficient or
not, depends on how far the above characteristics are practiced. The need of company
restructuring is likely necessity when the above characteristics is not fulfilled.
To improve a company‘s performance by successfully solving problems that is causing
dissatisfaction for internal or external and to ensure that problem solvers do not jump to
solutions before they have analyzed the cause of the problems.
REFERENCES
Nedal M.Elsaid, Ahmed E. Okasha& Abdalla A. Abdelghaly (2013). Defining and Solving the
Organizational Structure Problems to Improve the Performance of Ministry of State for
525
Environmental Affairs- Egypt. International Journal of Scientific and Research

Publications
Peter Keen ,Sajda Qureshi(2006). Organizational Transformation Through Business Model: A
Framework for Business Model Design. 39th Hawaii International Conference on
System Sciences – 2006
Ioana Julieta Josan (2013).Human Capital and Organizational Effectiveness, Change and
Leadership, 17 2013,p39-45
Shashank Shah and Ajith Sankar R.N.(2013).Human resource management in the changing
business environment of the Indian construction industry: a case study. Vol. 3 NO. 6
2013, pp. 1-21, Q Emerald Group Publishing Limited, ISSN 2045-0621jEmerrald
Emerging Markets Case Studies
STDC Annual Report (2011-2016)
-CS17-
PERUBAHAN PENGURUSAN KE ARAH PENINGKATAN PRESTASI INSPIN
Norhasma Fazliana Binti Othman

Universiti Utara Malaysia, Kedah
hasma@inspin.gov.my
Abstrak
Perubahan pengurusan merupakan satu siri proses yang digunakan untuk memastikan
bahawa perubahan yang signifikan dapat dilakukan secara terkawal dan sistematik, untuk
mengatasi rintangan terhadap perubahan dalam rangka meningkatkan penglibatan dan
pencapaian matlamat organisasi untuk melakukan trnsformasi yang berkesan. Kajian kes ini
menggambarkan perubahan pengurusan yang berjaya dalam organsasi di Institut Pengurusan
Dan Integriti Negeri Kedah (INSPIN), mengutarakan pengalaman seperti faktor-faktor
perubahan, perubahan yang telah dilakukan dan faedah daripada perubahan yang telah dibuat
antara tahun 2015 hingga tahun 2017. Data untuk kajian kes ini diperolehi daripada wawancara
pengurus besar, pegawai dan kakitangan lain di INSPIN dan juga rujukan daripada dokumen-
dokumen rasmi di INSPIN. Tujuan kajian kes adalah untuk perkongsian pengalaman perubahan
pengurusan yang dilaksanakan oleh INSPIN untuk menjalankan operasinya dengan lebih
cekap. INSPIN mula menghadapi masalah kemerosotan operasinya sejak tahun 2013.
Kemerosotan ini berterusan sehingga pada tahun 2015 apabila INSPIN mula melaksanakan
pengurusan perubahan di bawah pimpinan pengurus besar yang baru dilantik pada masa kajian
ini dilaksanakan. Oleh kerana INSPIN adalah satu organisasi yang berjaya dalam pengurusan
perubahan yang telah dilaksanakan, kajian ini diharap dapat membantu pengkaji lain dalam
penyelidikan yang berkaitan. Dalam era dimana perubahan organisasi sering diuruskan dengan
lemah dan sangat jarang dilihat untuk meningkatkan tadbir urus yang cemerlang, kisah
kejayaan INSPIN diharap memberi wawasan yang berharga untuk organisasi lain dalam
melaksanakan pengurusan perubahan.
1.0 PENGENALAN
Organsisasi untuk terus kekal dalam persekitaran perniagaan yang kompetetif haruslah
sentiasa membuat perubahan terhadap proses perniagaannya, disesuaikan dengan keadaan
526
persekitaran. Pendekatan kebanyakkan organisasi untuk perubahan terletak pada spektrum

antara yang dirancang dan perubahan yang muncul (Burnes, 2000). Punca kuasa kepada
perubahan yang dirancang adalah merujuk kepada model perubahan tiga tahap Lewin (1958),
(pembasmian sekarang, mengubah masa kini dan menyegarkan semula yang baru), yang
melibatkan perancangan terdahulu dan perancangan dari atas ke bawah mendapati
kesesuainya dalam persekitaran dinamik yang dikaji (Dawson, 2003). Pengurusan perubahan
yang berlaku di INSPIN adalah digerakkan oleh Pengurus Besar INSPIN. Beliau memainkan
peranan aktif dalam peruabahan yang berlaku dipersekitaran kerja INSPIN dari segi
pengurusan dan persekitaran. Beliau memegang jawatan pengurus besar sejak tahun 2015
sehingga kajian ini dibuat. Pengurus Besar INSPIN adalah dilantik dikalangan Pegawai Tadbir
Negeri Kedah yang mana lantikan ini adalah secara pinjaman kepada INSPIN. Kakitangan
INSPIN yang lain adalah lantikan daripada pengurusan INSPIN melalui kelulusan Ahli Lembaga
Pengarah. Peraturan yang digunapakai di INSPIN adalah berdasarkan Pekeliling Kerajaan,
Akta-Akta yang berkaitan dan melalui keputusan yang diputuskan semasa mesyurat ahli
lembaga pengarah yang diadakan empat kali setahun. Pengurus Besar INSPIN telah
merancang pengurusan perubahan yang harus dilaksanakan oleh INSPIN bagi membolehkan
INSPIN terus beroperasi dan kekal relevan untuk berfungsi sebagai institut latihan milik
Kerajaan Negeri Kedah Darul Aman yang terunggul.
2.0 PENYATAAN MASALAH
Setiap organisasi memerlukan perubahan untuk meningkatkan keberkesanan dan terus

kekal bersaing dalam cabaran arus globalisasi (Barsade&Gibson 2007). Perubahan ini berlaku
kesan daripada perkembangan pesat teknologi dan sosio ekonomi dalam beberapa dekad
terakhir ini, termasuklah perkembangan teknologi maklumat, trend ke arah ekonomi berasaskan
perkhidmatan dan masyarakat yang berpengetahuan. Sehubungan itu, konflik organisasi dan
isu-isu yang timbul memerlukan penyelesaian apabila organisasi berkehendak kepada
perubahan. Antaranya ialah isu strategi kepada perubahan yang handak dicapai, kekangan-
kekangan yang perlu dihadapi, gelagat kepimpinan organisasi, perubahan dalam pengurusan
dan struktur organisasi, perancangan melaksanakan perubahan dan matlamat yang hendak
dicapai (Burnes 2004). INSPIN perlu melakukan perubahan bagi memastikan objektif
penubuhannya mencapai matlamat yang telah ditetapkan. Sejak penubuhannya pada tahun
1999 operasi INSPIN dibantu oleh bantuan kerajaan berbentuk geran bernilai 0.5 juta setahun.
Walau bagaimanapun bantuan berbentuk geran ini akan dikurangkan dan ditamatkan apabila
INSPIN berjaya untuk menjalankan operasinya sendiri dan memperoleh keuntungan hasil
daripada aktiviti yang dilaksanakan. Namun pada tahun 2013, INSPIN mula mengalami
kerugian dan ini menyebabkan pengurusan INSPIN tidak dapat menjana pendapatan dalam
bentuk keuntungan. Penurunan penjanaan keuntungan ini semakin berkurang saban tahun
sehingga tahun 2015. Oleh itu, INSPIN perlu melakukan perubahan untuk memastikan
keberkesanan dan kecekapan INSPIN dapat ditingkatkan bagi mencapai hasil yang optimum.
Merujuk Buku Mengurus Perubahan Dalam Organisasi karya Ab. Aziz Yusof, terdapat empat
desakan utama kepada perubahan dalam organisasi yang saling mempengaruhi, saling
bergantung dan saling memberi kesan kepada matlamat organisasi yang perlu diberi
pertimbangan. Keempat-empat desakan itu ialah sumber tenaga kerja, struktur, teknologi dan
persekitaran.
3.0 OBJEKTIF KAJIAN
 Mengenalpasti faktor-faktor yang mendorong kepada perubahan pengurusan di INSPIN
527
 Mengenalpasti perubahan yang telah dilaksanakan untuk meningkatkan prestasi INSPIN

 Mengenalpasti faedah yang diperolehi daripada peruubahan yang dilakukan
4.0 LATARBELAKANG INSPIN
Institut Pengurusan Dan Integriti Negeri Kedah Sdn Bhd (INSPIN) atau sebelum ini
dikenali dengan nama Instiut Pengurusan Kedah (KIM) telah ditubuhkan pada 29 ogos 1999.
INSPIN merupakan sebuah syarikat milik penuh Kerajaan Negeri Kedah Darul Aman di bawah
Perbadanan Setiausaha Kerajaan Negeri Kedah Darul Aman (SSI). Kewujudannya adalah
susulan daripada keputusan Majlis Mesyuarat Kerajaan Negeri pada 19 Julai 1999 yang telah
melahirkan hasrat Kerajaan Negeri untuk menubuh dan mengendalikan sebuah institut latihan
milik kerajaan bertujuan pembangunan latihan anggota pentadbiran awam negeri dan rakyat
Negeri Kedah secara lebih terancang, berwawasan dan menyeluruh. Aktiviti utama INSPIN
adalah sebagai pusat pembelajaran dan latihan bagi kakitangan kerajaan dan bukan kerajaan.
Operasi pengurusan dan perkhidmatan di INSPIN lebih bersifat perniagaan dengan mengambil
kira faktor untung dan rugi dalam perniagaan. Semua peserta yang ingin mengikuti kursus di
INSPIN dikenakan yuran kursus dengan mengambil kira kadar pulangan untuk pembiayaan kos
pengurusan sesuatu latihan dan juga peratus keuntungan yang akan diperolehi. Falsafah
INSPIN adalah untuk menjadi sebuah institusi latihan yang hebat dan berintegriti seiring dengan
matlamat dan hasrat kerajaan untuk meningkatkan modal insan bagi mencapai status Negara
Maju menjelang tahun 2020. INSPIN menganjurkan pelbagai bentuk kursus iaitu kursus wajib
perkhidmatan, kursus terbuka, kursus khusus, kursus kerjasama dengan Agensi/ Jabatan,
program profesioanal dan program ijazah lanjutan.
5.0 KAJIAN KES DI INSPIN
Buku Mengurus Perubahan Dalam Organisasi karya Ab. Aziz Yusof membincangkan
empat desakan utama kepada perubahan dalam organisasi yang saling mempengaruhi, saling
bergantung dan saling memberi kesan kepada matlamat organisasi yang perlu diberi
pertimbangan. Keempat-empat desakan itu ialah sumber tenaga kerja, sturktur, teknologi dan
persekitaran. Kajian ini meliputi aktiviti utama INSPIN dan aspek kewangan dengan memberi
perhatian terhadap prestasi kewangan, pengurusan aktiviti, inovasi dan tadbir urus korporat.
Bagi prestasi kewangan, analisis trend telah dilakukan secara perbandingan terhadap Penyata
Kewangan beraudit bagi tahun 2011 sehingga 2013. Manakala bagi pengurusan aktiviti dan
tadbir urus korporat pula, kajian dijalankan dengan menyemak dokumen, fail serta rekod yang
berkaitan bagi tahun 2011 hingga 2013. Disamping itu, temu bual diadakan dengan pegawai
INSPIN bagi mendapatkan penjelasan lanjut megenai perkara berbangkit. Perubahan faktor
persekitaran INSPIN sedikit sebanyak mendesak INSPIN untuk berubah bagi memenuhi
kehendak pelanggan, mengikut arus perniagaan semasa dan yang penting adalah untuk
memastikan bahawa objektif kewujudan INSPIN masih lagi relevan dan diperlukan oleh
pelanggan dan kerajaan negeri. Seandainya INSPIN memilih untuk mengabaikan keperluan
untuk perubahan ini, maka lama kelamaan INSPIN akan tersingkir daripada arus perdana.
Keadaan akan menjadi lebih teruk lagi sekiranya INSPIN tidak lagi diperlukan oleh kerajaan
negeri. Maka, INSPIN juga harus membuat perubahan untuk memastikannya kekal relevan
dalam memenuhi kehendak pelanggan. Namun, untuk membuat perubahan, pengurusan
INSPIN perlu bijak dalam mengenalpasti keperluan perubahan dan merancang perubahan
tersebut.
528
6.0 FAKTOR-FAKTOR PERUBAHAN
Bahagian ini akan merungkaikan dapatan kajian hasil daripada temu bual yang telah
dijalankan. Soalan yang dikemukakan adalah seperti: Apakah faktor-faktor yang menyebabkan
perubahan harus dilakukan di INSPIN? Persoalan ini telah dirungkaikan melalui temu bual yang
telah dijalankan dengan pegawai dan kakitangan terpilih dan juga melalui pemerhatian yang
dibuat berdasarkan persekitaran INSPIN.
Berdasarkan maklum balas yang telah diberikan oleh responden-responden yang telah
ditemu bual, majoriti memberikan pendapat yang berlainan iaitu mereka berpendapat bahawa
terdapat beberapa faktor perubahan harus dilakukan iaitu antaranya adalah faktor kewangan,
persekitaran dan teknologi.
6.1 Faktor Kewangan
Menurut sumber daripada Laporan Kewangan INSPIN yang dilaporkan dalam

Mesyuarat Ahli Lembaga Pengarah bermula tahun 2011 hingga 2013, INSPIN
mencatatkan keuntungan selama 2 tahun berturut-turut bagi tahun 2011 dan 2012
sebelum mencatatkan kerugian pada tahun 2013. Keuntungan yang diperoleh pada
tahun 2011 dan 2012 masing-masing berjumlah RM 0.66 juta dan RM 0.13 juta. Pada
tahun 2013, INSPIN telah mengalami kerugian berjumlah RM 1.31 juta. Penurunan
keuntungan dalam tahun 2012 adalah disebabkan oleh peningkatan dalam jumlah
perbelanjaan sejumlah RM 0.91 juta walaupun terdapat kenaikan dalam jumlah
pendapatan sejumlah RM 0.38 juta berbanding tahun 2011. Dalam tahun 2013 jumlah
perbelanjaan terus meningkat sejumlah RM 0.36 juta berbanding tahun 2012 dan
pendapatan pula telah merosot sejumlah RM 1.09 juta dan menyebabkan INSPIN
mengalami kerugian berjumlah RM 1.31 juta. Pendapatan utama INSPIN sepanjang
tahun 2011 hingga 2013 adalah terdiri daripada hasil pengendalian kursus, seminar dan
latihan yang disediakan kepada kakitangan kerajaan dan bukan kerajaan. Selain
daripada kursus, seminar dan latihan, INSPIN juga menyediakan perkhidmatan sewaan
prasarana. Selain menjana pendapatan daripada operasi utamanya, INSPIN juga
memperoleh lain-lain pendapatan daripada geran kerajaan negeri, faedah atas
pelaburan, diskaun diterima dan faedah diterima. Geran kerajaan yang diterima dalam
tahun 2011 hingga 2013 masing-masing berjumlah RM 0.7 juta, RM 0.5 juta dan RM 0.3
juta. Analisis kajian mendapati pendapatan yang diterima bagi tempoh tersebut tidak
mampu untuk menampung keseluruhan perbelanjaan INSPIN sekiranya kerajaan negeri
tidak memberi bantuan kewangan kepada INSPIN.
6.2 Faktor Persaingan – Pengurusan Program Latihan
Aktiviti utama INSPIN adalah melaksanakan pelbagai latihan kepada kakitangan

kerajaan dan bukan kerajaan. INSPIN perlu meningkatkan usaha dalam melaksanakan
aktiviti latihan bagi memastikan syarikat berdaya saing sebagai sebuah institusi latihan
yang hebat selain daripada menambah baik prestasi kewangan. Antara kelemahan
yang dikenalpasti adalah didapati bilangan kursus jabatan yang dijalankan oleh INSPIN
berkurangan disebabkan oleh bilangan peserta yang tidak mencukupi untuk diadakan
kursus yang dirancang. Selain itu mulai tahun 2013, Bahagian Sumber Manusia
Pejabat Setiausaha Kerajaan Negeri tidak lagi mengamalkan dasar pencalonan 20
orang peserta bagi setiap kursus yang dianjurkan oleh INSPIN. Perkara ini telah
menjejaskan pendapatan INSPIN kerana sebahagian besar kursus yang dianjurkan
oleh INSPIN mensasarkan penyertaan daripada Jabatan dan Agensi Kerajaan Negeri
dan Persekutuan.
529
6.3 Faktor Budaya dan Teknologi – Pengurusan Pembangunan Kakitangan dan

Pembentukan Budaya Organisasi
Dalam mengurus pembangunan kakitangan, bukan hanya melibatkan pekerja

di peringkat bawahan sahaja, malahan pembangunan kakitangan juga melibatkan
pekerja di peringkat pertengahan dan profesional. Kaedah untuk mengurus kakitangan
adalah berbeza bagi setiap peringkat pekerja dan mestilah mengikut kesesuaian atau
jenis kerja yang dilaksanakan. Pengurusan pembangunan kakitangan juga perlu
menitikberatkan pemindahan latihan, dimana pemindahan latihan merujuk kepada
tahap pengetahuan, kemahiran, kemampuan atau ciri lain yang dipelajari dalam
latihan dapat diterapkan dalam kerja. Pemilihan kaedah latihan yang baru menjelma
setiap tahun. Meskipun sesetengahnya telah terasa kukuh dalam teori pembelajaran
atau model pembaharuan kelakuan (contohnya pemodelan kelakuan), yang lainnya
lebih dihasilkan dari pembangunan teknologi daripada teori (contohnya pita video,
permainan perniagaan berasaskan komputer). Kakitangan perlu dilengkapkan dengan
ilmu-ilmu dan teknologi pembelajaran terkini supaya boleh menghasilkan idea-idea
yang boleh meningkatkan prestasi latihan di INSPIN.
6.4 Faktor Persekitaran – Kemudahan Prasarana
Selain daripada penganjuran latihan, aktiviti lain yang dijalankan INSPIN

adalah sewaan dewan, bilik kuliah dan makmal komputer. INSPIN telah
menyediakan kemudahan sewaan bagi dewan, bilik kuliah dan makmal komputer
untuk kegunaan pelbagai pihak. Walaubagaimanapun pihak INSPIN perlu
menggiatkan promosi mengenai kemudahan yang ditawarkan seperti di atas.
Mengikut maklum balas INSPIN, dasar penjimatan yang dilaksanakan oleh Jabatan
Negeri di mana kursus dijalankan secara in-house telah menyebabkan dewan
INSPIN kurang mendapat sambutan. Selain itu, INSPIN tidak mempunyai
peruntukan kewangan untuk menaik taraf Bilik Kuliah dan Dewan Sultanah Bahiyah.
7.0 PERUBAHAN YANG TELAH DILAKSANAKAN
Daripada temu bual bersama Pengurus Besar INSPIN, Tuan Syed Shaharuddin bin
Syed Abdullah, antara perubahan yang telah dilaksanakan bermula tahun 2015 sehingga tahun
2017 adalah seperti berikut:-
7.1 Keterbukaan Pengkhususan Sektor Dalam Penganjuran Kursus
Sejak penubuhan INSPIN pada yahun 1999, program latihan akan dirancang
dan dilaksanakan oleh Bahagian Latihan INSPIN. Bahagian latihan terdiri daripada
Pengurus Latihan, Penolong Pengurus Latihan dan Setiausaha Kerja Latihan. Sejak
tahun 2012, pengurusan INSPIN telah menetapkan skop kerja penolong pengurus
latihan yang mana setiap pegawai diletakkan di bawah empat sektor khas iaitu
Sektor Profesional Dan Ijazah Lanjutan, Sektor Integriti Dan Kerajaan Tempatan,
Sektor Transformasi dan Pengurusan Kewangan dan Sektor Kemahiran dan ICT.
Dengan kewujudan sektor-sektor ini, pegawai latihan dapat menganjurkan latihan
yang lebih terfokus kepada sektor masing-masing. Walau bagaimanapun
kewujudan sector-sektor ini menyebabkan pegawai terhad untuk melaksanakan
530
kursus dibawah sektornya sahaja sedangkan masih ada ruang dan peluang untuk
melaksanakan pelbagai kursus tanpa perlu mengikut sektor tertentu. Sejak tahun
2015, perubahan yang dibuat adalah tiada lagi pengkhususan bagi penolong
pengurus latihan untuk melaksanakan program latihan yang mana boleh dikatakan
setiap pegawai boleh melaksanakan semua jenis kursus yang mendapat tempat di
pasaran dan memenuhi kehendak pelanggan.
7.2 Mewujudkan Key Performance Indicator (KPI)
Key Performance Indicator adalah sangat penting bagi menetapkan hala

tuju INSPIN. Sebelum ini tiada KPI diwujudkan kepada setiap pegawai. Penilaian
kepada aktiviti yang telah dilaksanakan adalah berdasarkan key performance
indicator. Apabila KPI telah dibangunkan di awal tahun pada setiap tahun,
pengurusan INSPIN akan lebih cekap kerana bertindak berdasarkan KPI yang
telah ditetapkan. Sejak tahun 2015, setiap pegawai mempunyai KPI berbentuk
perolehan pendapatan yang akan diperolehi melalui penganjuran kursus yang
dilaksanakan.
7.3 Mewujudkan Insentif Kepada Kakitangan
Insentif merupakan satu dorongan motivasi kepada pekerja untuk bekerja

dengan bersemangat dan lebih baik. Sebelum ini tiada sebarang insentif diberikan
kepada pegawai atau kakitangan yang menunjukkan prestasi cemerlang. Setelah
membuat perubahan dengan pemberian insentif kepada pegawai dan kakitangan,
sikap bersaing secara sihat diwujudkan. Insentif diberikan dalam bentuk wang tunai
setiap bulan kepada pegawai dan kakitangan yang cemerlang pada setiap kali
Mesyuarat Pengurusan INSPIN yang dilaksanakan pada setiap bulan.
7.4 Sumber Kewangan Yang Lebih Cekap
Sumber kewangan INSPIN dijana melalui penganjuran latihan dan sewaan

prasarana INSPIN. Walau bagaimanapun pendapat yang diperolehi tidak dapat
menampung kos operasi INSPIN yang semakin meningkat. Antara sumber baru
yang diterokai oleh INSPIN adalah penyewaan Billboard, sewaan asrama INSPIN
secara pajakan tahunan kepada Institut Quran Darul Aman, mengadakan Buffet
Ramadhan di perkarangan kompleks INSPIN dan penyewaan padang bola INSPIN
kepada orang awam.
7.5 Tambahan Skop Kerja Kakitangan
Kakitangan sokongan yang terdiri daripada setiausaha kerja latihan tidak

menjalankan kursus secara sendiri. Walau bagaimanapun sejak tahun 2016,
setiausaha kerja latihan diarahkan untuk menjalankan kursus secara serius yang
mana perolehan kursus tidak mencecah RM10,000.00 untuk setiap kursus yang
dilaksanakan. Dengan ini pegawai boleh menumpukan perhatian kepada program-
program berimpak tinggi dan mengadakan pemasaran kepada agensi yang
berpotensi.
7.6 Menaiktaraf Infrastuktur Dan Kualiti Perkhidmatan
531
Kompleks INSPIN yang merupakan kuarters lama kerajaan, agak usang

untuk dijadikan pusat latihan. Bangunan yang digunakan mengalami banyak
kerosakkan seperti kebocoran, haiwan perosak dan cat luntur. Untuk mengatasi
masalah ini, pihak pengurusan INSPIN telah membuat permohnan khas daripada
pihak Bahagian Pembangunan Ekonomi Negeri Kedah (BPEN) bagi membaik pulih
prasarana INSPIN. Hasil daripada kelulusan pihak kerajaan, bagunan INSPIN
dinaiktaraf dan lanskap diperindah bagi tujuan keselesaan pelanggan INSPIN.
Antara kemudahan yang dinaiktaraf adalah surau, tempat letak kereta, bilik rehat
penceramah, tandas dan bilik kuliah yang digunakan bagi tujuan latihan.
7.7 Menjalinkan Kerjasama Rakan Strategik
INSPIN telah mengadakan beberapa jalinan kerjasama strategik bersama

beberapa agensi untuk memastikan perkongsian kepakaran dapat dilaksanakan
secara lebih fokus. Antara kerjasama yang dijalankan bersama Universiti Sains
Malaysia, Universiti Utara Malaysia, Universiti Teknologi MARA, Politeknik Tuanku
Syed Sirajuddin dan rakan strategik di luar Negara seperti Asian Institute of
Management (AIM) dan National Graduate Institute for Policies Study (GRIPS) di
Tokyo, Jepun.
7.8 Penetapan Sasaran Program
Program INSPIN dahulunya banyak tertumpu kepada sektor kerajaan

terutamanya Kerajaan Negeri Kedah. Walau bagaimanapun operasi INSPIN kini
tidak hanya bergantung kepada sektor kerajaan tetapi melibatkan sektor swasta dan
organisasi bukan kerajaan (NGO). Untuk menarik penglibatan sektor swasta untuk
menggunakan khidmat INSPIN, INSPIN telah memperolehi sijil daripada
Pembangunan Sumber Manusia Berhad (HRDF) bagi menjalankan program pada
sektor swasta.
8.0 PENCAPAIAN PENGURUSAN PERUBAHAN
Bagi memastikan objektif penubuhan INSPIN mendapat value for money, beberapa
aspek pengurusan syarikat perlu diperkemaskan dengan memberi pertimbangan kepada
perubahan berikut:
8.1 Peningkatan Pendapatan Kewangan
Pendapatan kewangan INSPIN pada tahun 2017 ialah RM 4,604,338.90.

Pecahan punca pendapatan adalah seperti berikut:
Kursus/ Seminar RM 2,954,873.93

Sewaan Prasarana dan lain-lain kemudahan RM 1,149,464.97
Geran Kerajaan RM 500,000.00
Berbanding tempoh yang sama pada tahun 2016, secara keseluruhannya

terdapat peningkatan sebanyak 14% iaitu jumlah pendapatan keseluruhan
532
sebanyak RM 3,953,219.00 dan agihan pendapatan pada tahun 2016 adalah

seperti berikut:
Kursus/ Seminar RM 2,513,757.00

Sewaan Prasarana dan lain-lain kemudahan RM 939,435.51
Geran Kerajaan RM 500,000.00
8.2 Menaiktaraf Jenama INSPIN dan Pemasaran Strategik
INSPIN perlu menggiatkan usaha promosi latihan dan sewaan prasarana

yang tidak terhad peda sektor awam sahaja agar kemudahan INSPIN digunakan
secara optimum. Selain itu, INSPIN perlu mengambil inisiatif untuk menaik taraf
kemudahan sedia ada agar dapat menarik lebih ramai peserta berkursus di INSPIN.
Bagi memasarkan produk-produk, INSPIN telah melaksanakan pemasaran
menggunakan laman web dan media sosial seperti facebook, instagram dan
youtube. Dengan pelaksanaan promosi melalui media sosial ini, jenama INSPIN
dapat dicapai oleh semua golongan tanpa sebarang sekatan. Maklumat yang
diperolehi melalui medium ini sentiasa dikemaskini bagi tujuan kemudahan
pelanggan untuk mendapatkan maklumat terkini. Pemasaran strategik yang
dilaksanakan melaui media sosial memberikan outcome yang menguntungkan
kerana tidak perlu mengeluarkan modal yang banyak untuk tujuan mempromosi
INSPIN. Pembentukan komitmen untuk menghasilkan produk berkualiti dan
memuaskan hati pelanggan. Pada tahun 2018, INSPIN telah mula menyusun
langkah yang baik apabila pihak kerajaan negeri telah memberi peluang kepada
INSPIN untuk terlibat dalam Program Ekspo Muafakat Kedah yang berlangsung
pada 28 Februari 2018 sehingga 3 Mac 2018. Melalui penglibatan ini, nama INSPIN
semakin dikenali apabila telah mendapat pengiktirafan sebagai juara bagi kluster
terbaik sepanjang ekspo berlangsung. INSPIN juga telah dilantik sebagai sekretariat
bagi urusan Pertabalan KDYMM Tuanku Sultan Kedah, dengan perlantikan INSPIN
sebagai sekretariat, ini membuktikan bahawa kerajaan negeri yakin dengan
kebolehan INSPIN untuk terus beroperasi dan mempelbagaikan sumber pendapatan
melalui pelbagai cabang perniagaan.
8.3 Inovasi
Meneruskan usaha mempelbagaikan kursus-kursus yang lebih menarik yang

ditawarkan dan menguruskan kemudahan dengan lebih teratur bagi memastikan
penggunaanya adalah optimum dan dapat memberi pulangan kepada syarikat.
Antara inovasi yang telah dilaksanakan adalah sewaan mini billboard, sewaan giant
billboard, menyediakan Buffet Ramadhan, menembusi pasaran antarabangsa dan
menyediakan program berbentuk pensijilan.
8.4 Peningkatan Perolehan Dan Pengurangan Perbelanjaan
Pengurangan perbelanjaan operasi dan peningkatan jualan. Ini membuktikan

INSPIN memperoleh keuntungan berbanding pada tahun sebelum ini yang mana
mencatat perolehan yang paling tinggi dalam tiga tahun terakhir. Organisasi diwakili
oleh pemimpin muda dalam perniagaan. Ini memberi peluang kepada generasi muda
untuk mengurus syarikat dan lebih bemotivasi untuk bekerja. Operasi INSPIN
mendapat sokongan daripada exco kerajaan negeri yang mana pada mensyuarat
exco pada tahun 2015 telah bersetuju memutuskan bahawa semua agensi kerajaan
533
yang memerlukan latihan kakitangan haruslah bekerjasama dengan INSPIN untuk

melaksanakan latihan. Hasil daripada perubahan ini juga meningkatkan hasil jualan
perkhidmatan INSPIN dan ini sakaligus meningkatkan perolehan INSPIN.
8.5 Motivasi pekerja
Meningkatkan tahap motivasi pekerja merupakan salah satu daripada

kepentingan perubahan dalam pengurusan. Pekerja akan menjadi fokus apabila
matlamat pencapaian syarikat berpadanan dengan matlamat pencapaian diri. Bagi
tujuan ini, komunikasi yang efisien antara majikan dan pekerja adalah sangat
penting. Pekerja dibekalkan dengan garis panduan dan semua maklumat tentang
pekerjaan yang dijalankannya. Pekerja juga akan memahami dengan baik semua
rutin dan proses-proses kerja supaya pekerja lebih jelas bagaimana usaha dan
ketekunan mereka mempengaruhi pencapaian matlamat.
9.0 PENUTUP
Dalam melaksanakan perubahan, pemimpin perlu memastikan organisasi akan berjaya

meningkatkan produktiviti berasaskan sumber yang dilaburkan sama ada dalam bentuk usaha,
masa atau kewangan. Kecekapan akan membolehkan organisasi menjimatkan kos,
menyelesaikan konflik yang berlaku, mengurangkan ketegangan, kekecewaan dan
ketidakpuasan dalam kalangan subordinat. Oleh itu organisasi perlu bagi memastikan
terdapatnya nilai tambah ke atas produk akhir setiap perubahan yang dilakukan. Maka dapatlah
difahamkan kecekapan berkait rapat dengan pengoperasian sistem yang tepat dalam usaha
untuk mencapai hasil atau matlamat yang telah ditetapkan. Memandangkan perubahan adalah
satu-satunya konsep yang berkekalan dalam dunia perniagaan hari ini, pembelajaran tentang
pengurusan perubahan organisasi harus menjadi proses yang berterusan dan berorentasikan
amalan (Burnes, 2011).
Rujukan:
Ayu Diana Awang (2016). Pengurusan Perubahan Dalam Organisasi.

Alan Deutschman (2007). Change Or Die.
Burnes, B. (22004) Managing Change (4th edn). Prentice Hall: Pearson
Education.
Burnes, B., & Jackson, P. (2001). Success and Failure in Organizatioanal
Change: An Exploration of the role of values. Journal of Change
Management, 11(2), 133-162.
Dawsan, P. (2003). Organozational Change: A processual approach. London:
Routledge.
Denzin, N.K., & Lincoln, Y.S. (2011). Introduction: Disciplining the practice of
qualitative research. In N.K. Denzine & Y.S. Lincoln (Eds), The SAGE
handbook of qualitative research (4th ed.,pp1-6). Thousand Oaks, CA:
Sage Publications.
Fylan, F. (2005). Semi-structured interviewing. In j. Miles & P. Gilbert (Eds)
INSPIN Annual Report. (2012-2017)
Noor Armah Addy (2013). Leading Change in Management: A Case Study of
534
Jaguar/Halewood, International Journal of ICT and Management, vol 1

issues 1.
Nazlee Siddiqui (2016) Managing Change For Better : New Zealand Dairy
Products Bangladesh Ltd.
O‘Neill, J.(1994). Tooled-up for management: Lessons from the main stream.
International Journal of Educational Management, 8(2),23-26.
Schermerhorn, J.R.(2010). Management. New York, NY : John Wiley& Sons.
R. Bhatt (2017). Managing Change at Muhibbah Engineering (M) Bhd.
-CS18-
Teguran Audit Oleh Jabatan Audit Negara
Mohd Fauzul Fitri Abdul Rahman

Mohd Fitri Abdul Rahman
Abstrak
Perkara 106 Perlembagaan Persekutuan dan Akta Audit 1957 menghendaki Ketua Audit
Negara mengaudit PenyataKewangan Kerajaan Negeri, PengurusanKewangan dan
AktivitiJabatan/Agensi Negeri. Seksyen 5(1)(d) Akta Audit 1957 sertaPerintah Audit (Akaun
Syarikat) 2013 pulamemberi kuasakepadaKetua Audit Negara untukmengaudit sesebuah
syarikat yang didaftarkan di bawahAkta Syarikat 1965 yang menerima geran/pinjaman/jaminan
daripada Kerajaan Persekutuan atau Kerajaan Negeri dan sesebuahsyarikat di mana
lebihdaripada 50% modal saham berbayar dipegang oleh Kerajaan Persekutuan, Kerajaan
Negeri atau Agensi Kerajaan Persekutuan/Negeri. Manakala perkara 107, Perlembagaan
Persekutuan menghendakiKetua Audit Negara mengemukakan laporan hasil pengauditan
kepada Seri Paduka Baginda Yang di-PertuanAgong dan KebawahDuli Yang MahaMulia Sultan
Kedah. Seri Paduka Baginda Yang di-Pertuan Agongakan menitahkan Laporan Ketua Audit
Negara untuk dibentangkan di Parlimen manakala Kebawah Duli Yang Maha Mulia Sultan
Kedah menitahkanuntuk membentangkan Laporan Ketua Audit Negara di Dewan Undangan
Negeri Kedah.
Tujuan penulisan Laporan Praktikal ini adalah untuk mempelajari, menganalisis,
merancang dan membua tcadangan penambahbaikkan terhadap beberapa isup enting yang
dihadapi oleh Pejabat Setiausaha Kerajaan terutama dalam menangani kaedah perolehan yang
benar-benar terurus dan professional dengan mengikut pekeliling yang telah ditetapkan oleh
pihak berwajib. Sehubungan ini dinyatakan beberapa faktor yang menyebabkan ketidakpatuhan
proses perolehan dan langkahmengatasidalamerti kata sebenarbagimencapai status
cemerlangdalamperkhidmatanawam.
Kata Kunci: Teguran audit oleh Jabatan Audit Negara, faktor penyebab dan langkahmengatasi
535
1.0 PENGENALAN
Laporan praktikal/internship ini disediakan berpandukan laporan audit negara siri 1

tahun 2016 Pejabat Setiausaha Kerajaan Negeri Kedah Darul Aman berkaitan:
1. Menyediakan peralatan dan persiapan tempat di masjid zahir sempena majlis khatam al-
quran peringkat negeri kedah tahun 2015 sebanyak RM 62,139.00 bertarikh 11 Julai
2015.
2. Menyediakan Live Circuit TV sempena Majlis Berbuka Puasa YAB Menteri Besar
bersama rakyat di Masjid Al-Bukhary ebanyak RM 62,599.00 bertarikh 11 Julai 2015.
Setelah proses audit dijalankan, terdapat beberapa perkara telah diberi teguran
berpandukan prosidur perolehan yang sepatutnya digunapakai di dalam perkhidmatanawam.
Untukmakluman juga, proses perolehan pada kedua-dua acara teersebut adalah melalui
rundingan terus. Oleh yang demikian, ia haruslah mengikut tatacara yang digariskan
menggunakan pekeliling yang dikeluarkan oleh Kementerian Kewangan Malaysia melalui
Pekeliling 7.13 iaitu Garis Panduan Permohonan Perolehan Secara Rundingan Terus.
2.0 ISU DAN ANALISA KAJIAN KES
Isu yang sebenarnya berlaku adalah pada ketika mesyurat penyelarasan lawatan YAB
Perdana Menteri ke Kedah, pihak Pejabat Menteri Besar telah bersetuju untuk menggunakan
dana darinya. Namunsetelah majlis berlangsung segala keputusan telahberubah menyebabkan
perkara tersebut iaitu dari segi perolehan telah tergantung dan menyebabkan pihak pembekal
merasasangsi dan tertipu. Atas sebab tersebut, Timbalan Setiauasaha Kerajaan (Pengurusan)
telah mengarahkan pegawai yang ditugaskaniaitu Penolong Setiausaha Kerajaan (pentadbiran
am dan keselamatan) memulakan proses perolehan tersebut bermula bulan November 2015.
Segala pembayaran akhirnya dapat dimuktamadkan dan dibayar sekitar pertengahan bulan
Disember 2015.
Apa yang ditemui oleh pihak audit disini adalah kelambatan bayaran kepada pembekal
sedangkan pihak jabatan audit tidak pun mengetahui perkara sebenar yang berlaku secarad
alamannya. Selainitu, terdapatelemen lain yang menyebabkan kelewatan proses perolehan
berlaku iaitu setelah pihak Pejabat Menteri Besar melengahkan pembayaran, pegawai yang
ditugaskanmelakukan proses perolehaniaitu SetiausahaBahagianKhidmat Pengurusan telah
diarahkanbertukarjabatandalam proses pertukaran biasa. Hal ini menyebabkan tindakan
tersebut tergantung dan penggantibeliautidakmengambiltindakan yang sepatutnya. Atas rasa
tanggungjawab oleh pihakatasanmakatindakansusulantelah pun diambil dengan melakukan
tatacara yang sebenarnya. Namun begitutidak dapatlaridarisegikelewatan pembayaran. Pada
ketika inipihak atasanhanya mementingkan satu tujuan iaitu menjaga kebajikan
pihakpembekaldenganmembuat bayaran yang sepatutnya tanpa memikirkan kesan
dikemudianhari. Segala arahan daripihak atasan yang berlaku ketika proses perolehan pada
536
ketika itu adalah hanya melalui lisan sahaja. Hal ini juga telah menyebabkan berlaku masalah
dan keraguanketika proses auditandijalankan.
3.0 LANGKAH DAN CADANGAN PENYELESAIAN ISU LBNK
Bagimengatasimasalahtersebutberlaku dan berulang, terdapat pelbagai bentuktindakan

boleh di ambildalamjangka masa pendek dan panjang. Antara langkah yang dicadangkan bagi
mengatasi masalahtersebutadalah:
1. Pihakkerajaan negeri perlumengeluarkanpekelilingkhaskepadasetiappenjawatawam

negeri Kedah agar mematuhikesemuaprosidurkewangan yang ditetapkan.
Jikaberlakuketidakpatuhanmakatindakandisiplinbolehdikenakankeataspegawai yang
terlibat. Tindakandisiplintersebut juga haruslahbersifatpugnitif dan
tiadaelemenkemaafandiberikan agar
iadiambilsebagaitauladankepadasetiappenjawatawam.
2. Latihankhusus dan
komprensifharuslahdiberikankepadasetiappenjawatawamterutamakepadamereka yang
seringterlibatdalamperolehanawam. Latihanini juga
dicadangkandiberikansecaraberkalakepadaseluruh staff yang
terdiridaripadaperingkatatasanataubawahan.
3. Mewujudkan badan khas yang memantau dan menjagakebajikanpegawaikerajaan yang

teraniayaakibatdaripada proses perolehan yang dijalankan. Badan
iniharuslahmenimbangdarisetiapaspekakanketidakpatuhan yang
berlakusamadarelevenianyaterjadiatauadaelemenlain. Hal
iniakanmenyebabkanperkataan ‗kambinghitam‘ tidakterjadisecaratidaklangsung juga
akanmeningkatkantahap professional penjawatawamitusendiri.
4. Mewujudkansuatuprosidursetiaparahan yang
diberikanharuslahmelaluibertulisataudiminitkan oleh pihakatasankepadabawahan.
Inidapatmengelakkandaripadaarahansecaralisan yang pada
akhirnyaakanmenyebakanpegawai yang berikantugasmenjalan proses
perolehanawammenghadapimasalah di kemudianhari.
4.0 KESIMPULAN
Dalam menghadapicabarankini, penjawatawamseringdinilai oleh masyarakat sebagai

satuentiti yang perluberintegritidalammelaksanakantugas dan tanggungjawab. Namun
disebalikusahauntukmenjadi yang terbaik dalamaspek penjawat awam menjadi
jambatanantarakerajaandan masyarakat, seringkaliterbelenggu dengan kekhilafan samada
terjadiakibatkecuaiansendiriatau pun melibatkanelemenlain. Oleh yang demikian, adalah
menjadi tanggungjawabpihakkerajaandalammenggariskantatacara yang sebenarnya
dalamkonteks melindungikepentingankerajaan dan dalam pada masa yang sama menjaga
kebajikan keseluruhan penjawatawam. Setiaptindakandaripadapihakatasan juga haruslah
537
melihatdalamsetiapaspeksebelumkeputusandicapaiterutamanyaseperti yang diterangkan dalam

kajiankes praktikalini. Biarlahsegalausaha yang dilakukan dengan mengambil
semangatperibahasa ‗buatbaikberpada-pada, buatjahatjangansekali‘ dan pada masa yang
samaperludielakkan ‗kera di hutandisusukan, anakdirumahmatikelaparan‘.
-CS19-
Peralihan Kuasa dan Perubahan Struktur Pentadbiran
Pejabat Menteri Besar Kedah Darul Aman
Ridzuan bin Mohd Rashid

Pejabat Menteri Besar
Kedah Darul Aman
Abstrak
Konsep peralihan kuasa merupakan satu konsep yang signifikan dalam sesebuah
negara yang mengamalkan sistem demokrasi. Lazimnya, peralihan kuasa akan berlaku
berdasarkan keputusan rasmi pilihan raya yang telah dijalankan. Pilihan Raya Umum ke 14
(PRU 14) yang telah berlalu merupakan pilihan raya yang paling sengit dan bersejarah di
negara ini yang menyaksikan ‗tsunami politik‘ dan suara rakyat yang inginkan perubahan dasar
pentadbiran di peringkat negeri dan persekutuan. Di negara ini telah mengamalkan
pemerintahan bercorak demokrasi sejak kemerdekaan hingga ke hari ini. Konsep demokrasi
yang diamalkan di Malaysia adalah sama seperti diamalkan oleh negara lain iaitu pemerintahan
yang menggunakan ‗suara rakyat‘ dalam menentukan pemimpin negara atau satu
pemerintahan. Di negeri Kedah khususnya, sekali lagi telah menyaksikan peralihan kuasa dan
perubahan pentadbiran kerajaan. Pakatan Harapan telah mendapat majoriti mudah untuk
membentuk kerajaan sekaligus diberi mandat untuk menerajui pentadbiran kerajaan negeri. Di
dalam struktur pentadbiran Pejabat Menteri Besar Kedah juga telah mengalami peralihan kuasa
serta perubahan struktur organisasi dari segi pengisian perjawatan di kalangan lantikan dari
politik. Selain itu, jawatan Menteri Besar juga menyaksikan dengan pengisian dan pelantikkan
dari individu yang pernah menjawat jawatan yang sama namun mewakili dari parti yang
berbeza. Peralihan kuasa di peringkat negeri telah berjalan dengan lancar, aman dan harmoni
tanpa provokasi dari mana-mana pihak. Hal ini juga sebenarnya menunjukkan atau dilihat
sebagai petunjuk penting dalam memastikan amalan politik matang di negara ini.
Katakunci : Peralihan kuasa, Pilihan Raya Umum ke 14, tsunami politik, demokrasi, struktur
pentadbiran
1.0 PENGENALAN
Laporan ini mengandungi kupasan dan perbincangan mengenai topik utama iaitu proses
peralihan kuasa dan perubahan struktur pentadbiran di Pejabat Menteri Besar Kedah. Menurut
Undang-Undang Tubuh Negeri Kedah, Fasal 35(2) memperihalkan bidang kuasa Sultan dalam
memperkenankan pelantikan seorang Menteri Besar. Individu yang dilantik memegang jawatan
Menteri Besar berperanan sebagai ketua pegawai-pegawai pemerintah (Eksekutif) di negeri ini.
Individu yang dilantik sebagai menteri besar silih berganti, namun bidang tugas bukanlah
perkara yang boleh ditukar-tukar.
538
Di peringkat kerajaan kedua atau lebih dikenali sebagai second level of government,
Menteri Besar memainkan peranan sebagai ketua kerajaan. Kemenangan Pakatan Harapan
(PH) dalam Pilihanraya Umum ke-14 (PRU 14) pada 9 Mei 2018, melayakkan parti ini
menubuhkan kerajaan di negeri ini. Pakatan Harapan telah mencalonkan Ahli Parlimen Jerlun
yang juga Ahli Dewan Undangan Negeri (ADUN) Jitra, Dato‘ Seri Mukhriz Bin Tun Mahathir
sebagai Menteri Besar Kedah. Selepas mendapat perkenan daripada Ke Bawah Duli Yang
Maha Mulia Sultan Kedah, pada tanggal 11 Mei 2018 beliau mengangkat sumpah sebagai
Menteri Besar Kedah yang ke-13. Jika di peringkat kerajaan persekutuan, Yang Amat
Berhormat Tun Dr. Mahathir B. Mohamad telah mencipta sejarah negara apabila dilantik semula
sebagai Perdana Menteri Malaysia ke 7, di negeri Kedah pula anak beliau iaitu Yang Amat
Berhormat Dato‘ Seri Mukhriz Bin Tun Mahathir telah melakar sejarah tersendiri apabila beliau
telah dilantik sebagai Menteri Besar sebanyak dua kali. Kali pertama ialah pada tahun 2013
sebagai Menteri Besar ke-11 di atas kemenangan Barisan Nasional pada PRU 13.
2.0 TOPIK PERBINCANGAN
2.1 Sejarah Peralihan Kuasa di Zaman Kesultanan Melayu
Peralihan kuasa bukanlah lagi sesuatu yang baru bagi negeri Kedah. Pada akhir abad
ke-19, sewaktu masih berada di bawah naungan Kerajaan Siam lagi, Kedah sudah pun
memperkenalkan dan memperkembangkan sistem pentadbiran yang tersendiri lagi moden.
Bermula dengan pemerintahan Almarhum Sultan Ahmad Tajuddin Mukarram Shah (1853-
1879), Kedah memasuki era pembangunan dan pemodenan.
Keadaan ini berterusan sehinggalah berlakunya peralihan kuasa naungan terhadap
Kedah daripada Siam kepada British pada 15 Julai 1909. Almarhum Sultan Abdul Hamid Halim
Shah (1882-1943) di awal pemerintahannya telah mengadakan lawatan ke beberapa buah
negeri seperti Thailand, India, Burma dan Eropah bertujuan untuk meluaskan lagi pengalaman
dan pengetahuan baginda dalam membangunkan negeri. Menurut ahli sejarahwan Dato Prof.
Khoo Kay Kim pernah menegaskan bahawa "Kedah dapat mengembangkan sistem politik yang
lebih tersusun daripada negeri-negeri Melayu Barat (Perak, Selangor dan Negeri Sembilan)
sebelum campur tangan Inggeris kerana Kedah sudahpun mempunyai pegawai-pegawai
berpengalaman dan dapat memainkan peranan yang berkesan dalam sistem pentadbiran.
Kerana itu juga Kedah tidak perlu bergantung kepada begitu ramai Pegawai Inggeris
sebagaimana Perak dan Selangor".
2.2 Konsep Peralihan Kuasa
Konsep peralihan kuasa merupakan satu konsep yang signifikan dalam sebuah negara
yang mengamalkan sistem demokrasi. Lazimnya, peralihan kuasa akan berlaku berdasarkan
keputusan pilihan raya yang telah dijalankan. Demi memberi ruang kepada proses pilihan
raya, kerajaan yang memerintah akan membubarkan parlimen di peringkat persekutuan dan
dewan undangan negeri di peringkat kerajaan negeri. Konsep peralihan kuasa akan berlaku
sekiranya rakyat memberi mandat kepada parti yang berlainan daripada sebelumnya sehingga
berjaya menubuhkan kerajaan. Hal ini juga sebenarnya dilihat sebagai indikator penting dalam
memastikan amalan demokrasi dan politik matang di Malaysia.
2.3 Senario Politik Semasa dan Peralihan Kuasa di Kedah
Seterusnya, laporan ini juga akan membincangkan peralihan kuasa yang berlaku di
negeri Kedah Darul Aman. Sebuah negeri yang terletak di utara semenanjung Malaysia yang
539
mempunyai populasi hampir dua juta penduduk. Sebenarnya, konsep ini bukanlah suatu
perkara yang janggal kepada rakyat Kedah.
Umum sudah masak dengan isu peralihan kuasa di Kedah yang berlaku antara
penghujung Januari hingga Februari 2016 yang mana Dato‘ Seri Ahmad Bashah bin Md
Hanipah telah mengambil alih kuasa pentadbiran daripada Dato‘ Seri Mukhriz Tun
Mahathir.Ramai masih menganggap kemenangan BN pada 2013 turut didorong populariti Tun
Dr Mahathir Mohamad dan pengumuman Dato‘ Seri Mukhriz Mahathir, sebagai calon Menteri
Besar Kedah.
Peralihan kuasa di negeri ini sudah pun berlaku beberapa kali sejak Pilihan Raya Umum
ke-12 (PRU-12) pada tahun 2008. Kekalahan Barisan Nasional (BN) kepada Parti Islam Se-
Malaysia (PAS) telah menyaksikan rakyat Kedah buat pertama kalinya memberi mandate
kepasa Pas untuk membentuk kerajaan yang dipimpin oleh Tan Sri Dato' Seri Azizan
Razak.Setelah sepenggal memegang tampok kerajaan, rakyat Kedah sekali lagi berani
mengubah kerajaan semasa PRU-13. Kali ini mandat diberi kepada BN yang dipimpin oleh
Dato' Seri Mukhriz bin Tun Mahathir pada tahun 2013. Namun begitu, susulan daripada krisis
politik Kedah dan pemecatan beliau, peralihan kuasa berlaku hanya melibatkan jawatan Menteri
Besar pada tahun 2016. Oleh itu Dato' Seri Diraja Ahmad Bashah bin Md Hanipah telah dilantik
secara sebulat suara sebagai pucuk pimpinan negeri yang baru dan memulakan tugas sebagai
Menteri Besar ke 12 pada 7 Februari 2016.
2.4 Sistem Demokrasi di Malaysia
Dalam bahagian laporan ini akan menjelaskan dengan secara umum dengan sistem
pemerintahan di Malaysia. Penulis akan akan mendefinisikan maksud demokrasi. Iaitu
perkataan yang berasal daripada Yunani yang dikenali sebagai Demos yang bermaksud
―Rakyat‖ dan Cratos/Cratien bermaksud ―Memerintah‖ atau ―Kuasa‖ yang bermaksud
―Diperintah oleh Rakyat‖. Menurut teori Karl Marx, komunisme merupakan peringkat terakhir
pembangunan sosial dalam negara yang mengamalkan demokrasi secara langsung, dan tiada
kerajaan yang bebas daripada kehendak rakyat. Di negara ini telah mengamalkan
pemerintahan bercorak demokrasi sejak kemerdekaan hingga ke hari ini. Konsep demokrasi
yang diamalkan di Malaysia adalah sama seperti diamalkan oleh negara lain iaitu pemerintahan
yang menggunakan ‗suara rakyat‘ dalam menentukan pemimpin negara atau satu
pemerintahan. Menerusi sistem demokrasi yang diamalkan, Pilihan Raya Umum akan
dijalankan setiap 5 tahun sekali berpandukan Akta Suruhanjaya Pilihanraya. Pemerintahan
Malaysia mengamalkan pemerintahan demokrasi berparlimen dengan raja berpelembagaan
seperti dinyatakan dalam perkara 44 Perlembagaan Persekutuan. Dalam sistem ini, kuasa
perundangan Persekutuan terletak kepada Parlimen yang mengandungi Yang Di-Pertuan
Agong dan dua majlis yang dinamakan Dewan Negara dan Dewan Rakyat.Parlimen
mempunyai kedudukan tertinggi dan merupakan badan yang mewakili rakyat untuk membuat
undang-undang dan dasar-dasar. Dalam demokrasi berparlimen, rakyat mempunyai kuasa
memilih pemimpin dan kerajaan. Wakil yang dipilih oleh rakyat sama ada bagi kawasan
Parlimen atau Dewan Undangan Negeri akan bertanggungjawab serta bertindak untuk
memperjuangkan kepentingan rakyat yang diwakilinya. Amalan memilih pemimpin dan kerajaan
dalam demokrasi berparlimen ini dibuat melalui pilihanraya. Pilihanraya merupakan salah satu
saluran penglibatan warganegara dalam membuat keputusan politik. Melalui pilihanraya, rakyat
diberi hak bagi memberi mandat kepada sesuatu seperti parti untuk membentuk kerajaan.
Kuasa rakyatlah yang akan menentukan parti yang akan memerintah negara serta membentuk
540
corak pembangunan dan masa depan rakyat. Dalam penulisan laporan ini juga akan
menunjukkan analisa keputusan PRU 14 yang lalu.
Menurut saintis politik dari Amerika, Larry Diamond, demokrasi terdiri daripada empat
elemen utama iaitu:
1. Satu sistem politik untuk memilih dan menggantikan kerajaan melalui pilihan raya bebas
and adil.
2. Penyertaan aktif orang ramai, sebagai warganegara, di politik dan kehidupan sivik.
3. Perlindungan hak asasi manusia semua rakyat.
4. Satu kaedah undang-undang yang mana undang-undang dan prosedur digunakan sama
rata terhadap semua rakyat.
2.5 Kesan Pilihan Raya Umum ke 14
Keputusan PRU-14 baru-baru ini menyaksikan kemenangan kepada Pakatan Harapan.

Pilihan raya yang paling bersejarah dalam sistem politik negara dimana Barisan Nasional (BN)
gagal membentuk kerajaan setelah mentadbir Malaysia lebih daripada 60 tahun. Faktor utama
ialah 'tsunami rakyat' yang inginkan perubahan daripada cengkaman kerajaan terdahulu. BN
bukan sahaja gagal mempertahankan Kedah malah turut kalah di peringkat persekutuan. BN
Kedah yang dibawah pimpinan Dato Seri Diraja Ahmad Bashah Md Hanipah, gagal
mempertahankan majoriti kerusi DUN malahan gagal mempertahankan kawasan yang
ditandingi iaitu DUN Suka Menanti. Malah BN hanya memenangi 3 kerusi Dun daripada
keseluruhan 36 kerusi. Jelas PRU 14 menyaksikan penolakan rakyat Malaysia terhadap
pentadbiran Barisan Nasional. Oleh itu, sekali lagi menyaksikan peralihan kuasa yang berlaku
di negeri Kedah Darul Aman.
Di negeri Kedah khususnya, sekali lagi telah menyaksikan peralihan kuasa dan
perubahan pentadbiran kerajaan. Pakatan Harapan telah mendapat majoriti mudah dengan 18
kerusi DUN untuk membentuk kerajaan sekaligus diberi mandat untuk menerajui pentadbiran
kerajaan negeri. Di dalam struktur pentadbiran Pejabat Menteri Besar Kedah juga telah
mengalami peralihan kuasa serta perubahan struktur organisasi dari segi pengisian perjawatan
di kalangan lantikan dari politik. Jawatan tertinggi kerajaan negeri pastinya akan mengalami
perubahan kesan daripada peralihan kuasa melalui sistem Pilihan Raya. Selain itu, jawatan
Menteri Besar juga telah menyaksikan dengan pengisian dan pelantikkan dari individu yang
pernah menjawat jawatan yang sama namun mewakili dari parti yang berbeza.
2.5.1 Statistik Keseluruhan Bagi Parlimen PRU14
541
2.5.2 Analisa Keputusan PRU – 14 Bagi DUN Kedah Darul Aman
2.6 Peralihan Kuasa Struktur Pentadbiran Pejabat Menteri Besar Kedah
Laporan ini disediakan dengan menerangkan secara terperinci perubahan struktur

pentadbiran tertinggi dan pegawai peringkat atasan di Pejabat Menteri Besar Kedah. Dalam
penulisan laporan ini juga akan di sertakan dengan Visi, Misi, Objektif serta Piagam Pelanggan
Pejabat Menteri Besar Kedah yang menjadi asas dan tunjang dalam pentadbiran organisasi.
Setiap dasar mestilah mempunyai pelaksananya. Pelaksana yang baik akan memastikan
kejayaan sebuah dasar. Oleh itu, dalam bahagian ini penulis mengfokuskan kepada struktur
pentadbiran di Pejabat Menteri Besar Kedah bersama klasifikasi fungsi tugas ketua jabatan.
Pejabat Menteri Besar Kedah terbahagi kepada Bahagian Pentadbiran dan Bahagian Politik.
Dalam memahami konsep pentadbiran awam, pihak yang dilantik melalui lantikan
pentadbiran adalah penjawat awam atau lebih dikenali sebagai civil servant melalui lantikan di
bawah Suruhanjaya Perkhidmatan Awam Negeri Kedah. Manakala, pegawai dari lantikan politik
dilantik secara di bawah Bahagian Sumber Manusia dan sebahagian dilantik di bawah Syarikat
Berkaitan Kerajaan (GLC). Pejabat Menteri Besar Kedah terletak dibawah unit pentabiran
Pejabat Setiausaha Kerajaan Negeri Kedah Darul Aman (SUK). Pegawai dan kakitangan yang
menerima lantikan daripada kerajaan negeri tidak akan terjejas jika berlaku peralihan kuasa
542
kerajaan. Berbeza dengan lantikan pentadbiran, ada pegawai yang berkhidmat di Pejabat
Menteri Besar yang dilantik melalui lantikan politik. Jika berlaku peralihan kuasa para pegawai
ini akan merasakan kesannya dengan pengguguran kerja. Antara jawatan yang terlibat ialah
seperti Setiausaha Politik, Setiausaha Akhbar, dan beberapa orang Pegawai Khas. Selain itu,
semasa peralihan kuasa berlaku jawatan Ketua Pegawai Eksekutif Perbadanan Menteri Besar
(PMBKed) juga telah meyaksikan perubahan penyandang jawatan
2.6.1 Visi, Misi, Objektif, Piagam Pelanggan
i. Visi
Bersama menggembeling usaha untuk menjadikan Negeri Kedah sebagai sebuah

negeri yang aman, serta mengamalkan budaya muafakat dalam semua bidang.
ii. Misi
Mengamalkan pengurusan yang cekap , cepat dan penuh beramanah serta mesra
rakyat.
iii. Objektif
Menjadi pendokong utama kepada setiap iltizam YAB. Menteri Besar demi
meningkatkan syiarislam, memajukan negeri dan mempertahankan kedaulatan sultan.
iv. Piagam pelanggan
1. Melayani setiap pelanggan yang hadir dengan mesra

2. Memproses atau menjawab semua surat-surat rasmi atau sokongan dengan
seberapa segera.
3. Menjawab dan melayani setiap panggilan telefon yang diterima dengan segera.
4. Berkhidmat kepada semua lapisan masyarakat dengan cekap tanpa mengira bangsa
dan agama.
2.7 Kesan Peralihan Kuasa dan Hala Tuju Semasa
Menerusi penulisan laporan ini, penulis akan menyatakan beberapa perubahan yang
berlaku di peringkat dasar kerajaan negeri, pentadbiran Pejabat Menteri Besar serta hala tuju
semasa pentadbiran. Setiap ahli politik yang memegang tampok pentadbiran kerajaan akan
datang dengan ideologi yang berbeza. Ideologi inilah yang akan menentukan hala tuju
pentadbiran yang dipimpin. Apa yang dirasakan penting, pastilah itu yang menjadi
keutamaannya. Peralihan kuasa yang berlaku di Kedah jelas menunjukkan perihal ini.
Berdasarkan hasil pemerhatian, penulis melihat ada satu paten atau acuan yang menarik dalam
pentadbiran di negeri Kedah. Setelah beberapa kali peralihan kuasa berlaku, namun misi utama
untuk memajukan negeri serta mensejahterakan rakyat tetap menjadi keutamaan. Dalam
bahagian ini akan memperkatakan tentang slogan dan moto yang digunakan semasa berlaku
peralihan kuasa dalam pentadbiran kerajaan negeri.
2.7.1 Urustadbir yang Baik
543
Tadbir urus negara yang baik amat penting kerana mengukuhkan

kebolehpercayaan rakyat kepada kerajaan . Peranan ini dipikul oleh penjawat awam
yang memegang prinsip telus, berakuantibiliti dan amanah untuk menjadikan sistem
pentadbiran negara yang mantap. Prinsip tadbir urus yang baik bermakna setiap
penjawat awam melaksanakan tanggungjawab melaksanakan tugas yang berfokus
kepada pelanggan (rakyat). Mereka seharusnya memastikan tuntutan pelanggan
dipenuhi secara cekap dan berkesan dengan meneroka dan menjangka pelbagai
kemungkinan pilihan yang diperlukan pelanggan. Menurut Wohlmuth (1997), good
governance was reflected as the existence of a multiparty democracy, rule of law and
free press that kept political leaders accountable in view of the fusion of the role of
politics and administration”. Penjawat awam perlu mematuhi segala peraturan dan
undang-undang dan piawaian yang diguna pakai dalam perkhidmatan. Adalah menjadi
kewajipan penjawat awam memberikan penjelasan terhadap apa-apa isu yang
menggugat kestabilan negara. Menurut World Bank (1992), “ governance is the manner
in which power is exercised in the management of a country‟s economic and social
resources for development” . Prinsip tadbir urus yang baik ialah sistem penyampaian
perkhidmatan yang efektif dan efisyen. Seseorang penjawat awam perlu memastikan
organisasinya mempunyai sistem yang dinamik seperti yang diharapkan oleh pihak-
pihak yang berkepntingan (stakeholders). Di samping pelanggan mendapat
perkhidmatan ‖ value for money‖ dan pengurangan terhadap pembaziran masa, dana
dan sumber negara.
2.8 Analisis Kritikal
Dalam penulisan laporan ini, akan menggunakan kaedah Analisa SWOT ( SWOT
Analysis ) iaitu Kekuatan ( Strength ), Kekurangan ( Weakness ), Peluang ( Opportunity ) dan
Ancaman ( Threat ) bagi mengenal pasti keadaan dalaman dan luaran organisasi. Dalam
memastikan kelestarian kecekapan pentadbiran, segala kekurangan akan dapat diatasi dengan
menggunakan peluang yang ada menerusi kaedah analisis yang dilakukan.
3.0 PENUTUP
Berdasarkan pemerhatian, dapatlah dirumuskan bahawa konsep peralihan kuasa

berpotensi berlaku dalam sebuah negara yang mengamalkan sistem demokrasi. Di bahagian
ini, penulis akan merumuskan keseluruhan hasil laporan yang disediakan. Dapatlah dikatakan
bahawa sistem demokrasi adalah sistem yang mengangkat suara dan kuasa di tangan rakyat
dalam menentukan hala tuju sesebuah negara dan menentukan kuasa pemerintah melalui
suara majoriti dalam pilihan raya. Kebebasan bersuara dan memilih pemimpin telah dizahirkan
dalam Pilihan Raya Umum ke 14 yang menyaksikan ‗tsunami rakyat‘ yang mana telah
mengubah dan berlaku peralihan kuasa di peringkat kerajaan pusat, dimana Barisan Nasional
telah memegang tampuk pemerintahan lebih setengah abad. Pemimpin melalui parti yang
dipilih perlulah lebih peka, mendengar suara rakyat, menunaikan tanggungjawab dengan
berdedikasi dan amanah agar dapat memenuhi aspirasi rakyat. Apa yang dapat disimpulkan
ialah proses peralihan kuasa merupakan perkara lazim dalam sesebuah negara yang
berdemokrasi seperti di Malaysia dan amat penting dalam menuju ke arah politik yang lebih
matang.
-CS20-
Pejabat Setiausaha Kerajaan Negeri Kedah:
544
Langkah-langkah Penglestarian Tenaga Elektrik
Mohd Tarmizi bin Saad

Pejabat Setiausaha Kerajaan Negeri
Kedah Darul Aman
Abstrak
Konsep kelestarian tenaga merupakan salah satu tajuk atau yang hangat diperdebatkan
oleh semua pihak pada masa kini. Justeru kertas kerja ini diwujudkan bertujuan
membincangkan langkah – langkah yang boleh digunapakai oleh pihak pengurusan sesebuah
bangunan pentadbiran milik kerajaan negeri khasnya dalam memastikan tahap penggunaan
tenaga elektrik dapat dijimatkan serta mengelak pembaziran dengan menggunakan salah satu
ciri atau kriteria yang terdapat dalam sesebuah bangunan hijau “Green Building” sebagai
panduan. Secara umumnya bangunan bercirikan bangunan hijau “Green Building” mempunyai
enam (6) kriteria utama iaitu tahap kecekapan penggunaan tenaga, kualiti persekitaran
dalaman, perancangan tapak dan pengurusan berterusan, penggunaan bahan dan sumber,
kecekapan penggunaan air dan inovasi. Keberkesanan untuk menjayakan langkah penjimatan
tenaga elektrik seiring dengan konsep bangunan hijau “Green Building” amatlah berhubung
rapat dengan tahap kesedaran penghuni di sesebuah bangunan walaubagaimanapun semakan
dan cadangan penambahbaikan terhadap sistem mekanikal dan elektrikal sedia ada turut perlu
dilakukan bagi membolehkan konsep penglestarian guna tenaga elektrik dapat diterapkan di
bangunan-bangunan kompleks pentadbiran kerajaan negeri di Malaysia.
Katakunci : Kelestarian Tenaga, , bangunan pentadbiran kerajaan negeri, bangunan hijau,

penjimatan tenaga.
1.0 PENDAHULUAN
Kertas kerja ini disediakan bertujuan untuk membincangkan berkenaan kaedah serta
langkah – langkah penjimatan kos pengoperasian sesebuah bangunan pentadbiran kerajaan
yang kini kerap kali diperdebatkan memandangkan keadaan ekonomi Malaysia yang dilihat
berada pada tahap yang kurang memuaskan. Pejabat Setiausaha kerajaan Negeri kedah turut
menerima kesan dengan keadaan ekonomi pada masa kini sehingga mendorong Setiausaha
Kerajaan Negeri Kedah mengeluarkan arahan melalui Mesyuarat Jawatankuasa Pengurusan
Kewangan dan Akaun supaya seksyen pengurusan aset dan fasiliti mencari kaedah – kaedah
serta langkah yang bersesuaian bagi memastikan penjimatan terhadap kos operasi bangunan
dapat direalisasikan. Justeru, sebagai sebuah seksyen yang telah diberi tanggungjawab untuk
memastikan Pejabat Setiausaha Kerajaan Negeri Kedah dapat menjalankan langkah – langkah
penjimatan, seksyen ini telah merangka beberapa langkah serta kaedah yang boleh digunakan
dengan menjadikan salah satu ciri atau kriteria yang terdapat dalam sesebuah bangunan hijau
“Green Building” sebagai panduan.
2.0 PERBINCANGAN
Isu penstrukturan semula tarif elektrik setiap tahun memberi kesan terhadap peningkatan kos
operasi bangunan-bangunan di kompleks pentadbiran kerajaan negeri di Malaysia. Berkuat
kuasa 1 Januari 2014, kadar purata tarif elektrik di Semenanjung telah dinaikkan sebanyak 4.99
sen/kWj atau peningkatan sebanyak 14.89 peratus daripada kadar purata semasa 33.54
sen/kWj kepada 38.53sen/kWj (Utusan Malaysia, 2013). Justeru, bagi meminimakan kesan
545
kenaikan secara berterusan ekoran daripada kesan kenaikan kadar kenaikan tarif elektrik setiap
tahun, perlaksanaan langkah penjimatan tenaga elektrik merupakan mekanisma yang boleh
diambil oleh kebanyakan bangunan kompleks pentadbiran kerajaan negeri di Malaysia
bertujuan untuk mengekang kesan kenaikkan dan seterusnya memberi kesan yang minima
terhadap kesan kenaikan tarif elektrik.
Langkah penjimatan tenaga elektrik merupakan suatu usaha ke arah mewujudkan
bangunan bercirikan bangunan hijau di kompleks pentadbiran kerajaan negeri di Malaysia. Bagi
merialisasikan hasrat ini, satu garis panduan yang khusus diperlukan bagi memastikan langkah
-langkah yang bakal diambil terbukti berkesan dan mampu memberi kesan penjimatan yang
optimum tanpa menjejaskan operasi dan urusan rasmi pengguna bangunan di kompleks
pentadbiran kerajaan negeri di Malaysia.
Walaubagaimanapun, kebanyakkan bangunan pentadbiran kerajaan negeri di Malaysia
pada masa kini dibina tanpa mengambilkira elemen bercirikan kecekapan penggunaan tenaga
elektrik, justeru itu suatu semakan dan cadangan penambahbaikan terhadap sistem mekanikal
dan elektrikal sedia ada perlu dilakukan bagi membolehkan konsep penglestarian guna tenaga
elektrik dapat diterapkan di bangunan-bangunan kompleks pentadbiran kerajaan negeri di
Malaysia.
2.1 BANGUNAN HIJAU
Bangunan yang dikategorikan sebagai bangunan hijau adalah berfokuskan kepada

matlamat untuk meningkatkan kadar kecekapan tenaga elektrik, air dan bahan di sesebuah
bangunan dengan mengurangkan kesan terhadap kesihatan dan persekitaran. Proses
perlaksanaan
untuk mewujudkan bangunan hijau bergantung kepada kitar hidup bangunan ―building
lifecycle”dengan melibatkan proses penentuan kedudukan tapak, rekabentuk,
pembinaan,perlaksanaan projek, pemeliharaan dan aktiviti perlupusan (Ahmad, 2010). Secara
umumnyaperlaksanaan kitar hidup sesebuah bangunan akan di bahagikan kepada tiga fasa
meliputi fasatempoh pembangunan, fasa tempoh operasi dan fasa tempoh pelupusan (Suhaida,
2011).. Justeru itu, bagi melayakkan sesebuah bangunan boleh dikategorikan sebagai
bangunan hijau ―Green Building” enam (6) kriteria utama yang ditetapkan seperti jadual berikut
haruslah dipatuhi :
Bil KrIteria Penerangan

Mengurangkan kadar permintaan tenaga,
1 Kecekapan Tenaga meminimakan kesan haba matahari terhadap
―Energy Efficiency” (EE) bangunan, sumber pencahayaan berasaskan cahaya
semulajadi, mengenalpasti tenaga diperbaharui dan
proses penyelenggaraan yang sempurna
2 Kualiti Persekitaran Dalaman Mensasarkan kualiti pengudaraan dalaman, akustik,
Indoor “Environment Quality dan keselesaan. Melibatkan bahan, kadar penapisan
“(EQ) udara, kawalan suhu dalam bangunan, pergerakan
dan kelembapan.
3 Melestarikan Perancangan Tapak Pemilihan lokasi tapak yang mengambilkira akses
546
Dan Pengurusan kepada pengangkutan awam, kemudahan awam,

“Sustainable Site Planning & kawasan lapang dan lanskap. Melibatkan
management” (SM) pengurusan projek yang berkesan, pengurusan air
hujan dan mengurangkan kesan ketegangan kepada
pembangunan sedia ada.
4 Bahan Dan Sumber Menggunakan bahan yang mesra alam dan boleh
Material & Resources (MR) dikitar semula, Pengurusan sisa binaan, mengumpul
dan mengguna kembali papan acuan dan sisa
binaan.
5 Kecekapan Air Menuai air hujan, kitar semula air dan pemasangan
―Water Efficiency” (WE) peralatan jimat air.
6 Inovasi Rekabentuk inovatif dan inisiatif untuk mencapai GBI
―Innovation” (IN)
Kriteria bangunan hijau (Suhaida, 2011)
2.2 KECEKAPAN TENAGA ELEKTRIK
Kecekapan tenaga adalah proses mengurangkan kadar kegunaan tenaga sedia ada
kepadakadar kegunaan tenaga yang lebih rendah dengan mengamalkan pengurusan tenaga
secara berkesan. Terdapat tujuh langkah yang boleh dilaksanakan untuk membudayakan
amalan kecekapan tenaga (Hamimah et.al, 2012) senarai langkah adalah seperti berikut:
i. Menambahbaik keberkesanan tenaga dengan mengurangkan kadar kegunaan tenaga

sedia ada.
ii. Memupuk komunikasi secara berkesan berkaitan pengurusan tenaga.
iii. Membangunkan dan penyelenggaran berkesan, laporan, strategi pengurusan tenaga.
iv. Memberikan kesedaran dan minat terhadap pengurusan tenaga secara cekap.
v. Mencari sumber tenaga diperbaharui dan mampu memberi nilai pulangan yang baik.
vi. Membangunkan minat dan dedikasi terhadap program pengurusan tenaga.
vii. Mengurangkan kesan impak terhadap pembekal tenaga.
2.3 LANGKAH - LANGKAH PENJIMATAN TENAGA ELEKTRIK
Tenaga elektrik yang dibekalkan ke bangunan merupakan utiliti penting kepada

penggunabangunan. Oleh yang demikian langkah penjimatan elektrik yang bakal di laksanakan
di bangunan baru mahupun sedia ada perlulah mengambilkira kesan terhadap keselesaan
penggunabangunan dan kesan terhadap alam sekitar. Secara umumnya kadar peratusan
permintaan elektrik di kebanyakan bangunan di Malaysia mendapati sistem hawa dingin
menunjukkan permintaan tertinggi dengan menyumbang sebanyak 58 peratus diikuti sistem
pencahayaan 20 peratus, peralatan dan kelengkapan pejabat 19 peratus dan lain-lain 3
peratus. Bagi mengawal kesan kenaikan tersebut beberapa mekanisma telah dilaksanakan
547
misalnya satu garis panduan kepada MS 1525:2007 Code Of Practice On Renewable Energy
For Non-Residential Buildings (First Revision) telah diperkenalkan pada tahun 2007 bagi
meminimakan kesan peningkatan kadar permintaan tenaga elektrik dari tahun ke tahun.
Peratusan kegunaan elektrik

Berdasarkan kepada rajah peratus kegunaan elektrik diatas, langkah utama untuk
mengekang kadar penggunaan tenaga elektrik adalah semakan terhadap sistem penghawa
dingin. Tindakan paling berkesan adalah dengan membuat penetapan suhu di ruang pejabat
melebihi 23°C dimana dengan membuat perubahan nilai suhu kepada suhu 23°C kadar
permintaan tenaga elektrik untuk sistem hawa dingin berpusat dapat dikurangkan dimana pada
suhu melebihi 23°C sistem pemampat hawa dingin beroperasi berada dalam keadaan normal
dan menyebabkan pengurangan permintaan tenaga elektrik dari semasa ke semasa.
Langkah kedua paling berkesan adalah berkaitan amalan cekap tenaga ke atas sistem
pencahayaan lampu antara langkah-langkah yang berkesan seperti menggunakan
pencahayaan semulajadi dengan meminimakan jumlah pencahayaan lampu, tidak menyalakan
lampu hiasan di luar waktu keperluan, lampu di dalam tandas dimatikan selepas menggunakan
tandas dan lampu-lampu kawasan di pasang ―timer‖ dan masa nyalaan di optimumkan bagi
menyumbang kepada keberkesanan penjimatan elektrik.
Langkah ketiga paling berkesan adalah dengan membuat pembayaran bil kepada pihak
Tenaga Nasional Berhad melalui kaedah pembayaran bil secara pukal. Pembayaran bil secara
pukal dapat menggelakkan daripada dikenakan caj denda lewat bayar oleh pihak Tenaga
Nasional Berhad. Pembayaran bil secara pukal juga dapat menggelakkan daripada dikenakan
caj tambahan denda kelewatan menjelaskan bil elektrik bagi bangunan kerajaan di Malaysia.
Langkah keempat adalah langkah yang tidak ekonomik untuk dilaksanakan bagi
menyumbang ke arah penjimatan elektrik yang berkesan. Langkah-langkah yang terlibat adalah
seperti menukar peralatan sedia ada kepada peralatan bercirikan cekap tenaga, tindakan
menukar peralatan kepada bercirikan cekap tenaga akan menyumbang kepada pembaziran
dimana sejumlah peruntukan kewangan diperlukan bagi membiayai kos untuk membuat
penggantian peralatan sedia ada kepada peralatan cekap tenaga. Keberkesanan langkah ini
lebih sesuai dilakukan ke atas cadangan pembelian peralatan bagi pembinaan bangunan baru
bangunan.
3.0 PENUTUP
548
Secara kesimpulannya, keberkesanan langkah – langkah penjimatan ini adalah

bergantung kepada dua faktor iaitu faktor pengguna bangunan dan juga peranan kontraktor
penyelenggaraan sistem mekanikal dan elektrikal. Tahap kesedaran pengguna bangunan
haruslah berada pada tahap yang tinggi bagi memastikan langkah – langkah penjimatan tenaga
elektrik ini dapat direalisasikan dan diteruskan ke masa hadapan. Selain itu, peranan kontraktor
penyelenggaraan sistem mekanikal dan elektrikal untuk memastikan keseluruhan sistem
beroperasi dalam keadaan cekap tenaga dengan mematuhi semua jadual servis dan lain-lain
tindakan turut boleh menyumbang ke arah keberkesanan langkah penjimatan elektrik di
bangunan pentadbiran kerajaan negeri di Malaysia.
Secara keseluruhannya, walaupun langkah penjimatan elektrik tanpa kos memberi
kesan gangguan yang minima kepada pengguna bangunan namun ianya tetap boleh memberi
impak yang berkesan kepada pihak pengurusan sesebuah bangunan kerajaan dimana melalui
perlaksanaan langkah penjimatan ini, sedikit sebanyak kos operasi dapat dikurangkan dan
dapat disalurkan kepada perkara yang lebih diperlukan.
RUJUKAN
Ar. Aniza and Yasmin Mohd. Architectural Features. Incorporation Of Innovation Passive
Architecctural Features In Office Building Design Towards Achieving Operational Cost
Saving-The Move To Enhance Sustainable Development. 1-11
Amirul Imran M. Ali and Nadzirah Zainordin. Energy Efficiency. Users Perception Towards
Green Building Practise At Pusat Tenaga Malaysia (Geo Building).2013.81
Department Of Standard Malaysia. Code Of Practice On Energy Efficiency And Use Of

Renewable Energy For Non-Residential Building (First Revision) MS 1525:2007. 2007
Haminah Adnan, Ahmad Faiz Abdul Rashid and Azizan Supardi. Air Conditional System.
Energy Management Practice: Office Building In Malaysia. 2012. 8(7): 3792-3801.
Hamzah Abdul Rahman, Chen Wang and Mei Ye Kho. Energy Efficiency. Potentials For
Sustainable Improvement In Building Energy Efficiency: Case Studies In Tropical Zone.
2011(6):325-339
Ar. Dr Tan. GBI Malaysia. The Development Of GBI Malaysia (GBI). 2009(1):1-8
Kamyar, K. and Majid, A. Quality Of Life. Worth Of Sick Building Syndrome And Enhance The
Quality Of Life In Green Building. 2013(7):183-185
M.M.S Dezfouli, S. Moghimi, F. Azizipour, S. Mat and K. Sopian. HVAC System. Feasibility Of
Saving Energy By Using VSD In HVAC System, A Case Study Of Large Scale Hospital
In Malaysia. 2014(10):15-25
Roslan Amirudin. Kemudahan Dan Peralatan Asas Bangunan Dewan Bahasa Dan Pustaka.
1992
S. N. Kamaruzzaman and Azlan Shah Ali. Electricity Performance. Energy Performance Of

Electrical Support Facilities: The Case Of Adaptive Re-Used Historical Building In
Malaysia, 2009. 4(12): 752-757
549
S.Sadr., Ksopian, and Sohif. Energy. Energy Consumption And Energy Saving In Malaysia
Office Building. 2009:152
Tuan Pah Rokiah Syed Hussain, Hamidi Ismail and Mat Khalid Md Noh. Dasar Kecekapan
Tenaga. Kesedaran Mengenai Penjimatan Tenaga Elektrik Dan Kelestraian Alam
Sekitar.2013(2):977-990
Zam Bin Nasir, Maznah Binti Tugiman and Nawawi Bin Mohd. Jan. Penyaman Udara. Dewan
Bahasa Dan Pustaka. 2009
Zuhairuse Md Darus, Nor Atikah Hashim and Elias Salleh. Green Building Assessment.
Development Of Rating System For Sustainable Building In Malaysia. 2009(5):260-272
Utusan Malaysia 15 Disember 2013 ‗Tarif Elektrik Naik : Perlu Cari Alternatif Elak Pengguna
Terbebai.
Hamzah Abdul Rahman, Chen Wang and Mei Ye Kho. Energy Efficiency. Potentials For
Sustainable Improvement In Building Energy Efficiency: Case Studies In Tropical Zone.
2011(6):325-339
Ar. Dr Tan. GBI Malaysia. The Development Of GBI Malaysia (GBI). 2009(1):1-8
Utusan Malaysia 15 Disember 2013 ‗Tarif Elektrik Naik : Perlu Cari Alternatif Elak Pengguna
Terbeban.
-CS21-
Innovation in Governance for Suitable Development: Struggles Over Malay
Reservation Lands in District of Kota Setar, Kedah
Ommulkhair binti Ahmad

Kedah Darul Aman
ABSTRACT
Malay Reservation Land is land which was reserved only for the alienation to the
Malays only. It can only be transacted between the Malays. Transaction here includes
sales and purchase of the land, transfer of title, mortgage and lease. There are various
sections in Malay Reservation Enactment for Malay Reservation Land which has been
enacted by the British. This land is restricted from sale, lease, transfer of title and
mortgage to the non-Malays. However, the decreases of Malay Reservation Land area is
still happen until now. This is because there are several factors that contributed to the
decreases of the land area. This study was conducted to identify issues and challenges
involving Malay Reservation Land and also the factor that lead to the decreasing the
area as well as how to maintain the area of Malay Reservation Land. The data collected
for this study was obtained from a Land Office of Kota Setar and several government
agencies and the methods used to analyze the information by using descriptive analysis.
Through a preliminary study conducted, the authors found that there were several
factors that caused the decreasing in the area of Malay Reservation Land, which land is
550
taken for the development and by the state authorities to build for public interest without
replacing the land. In addition, there are also several land owners who sell or lease their
land to non-Malays. Therefore, this study also discussed the steps that should be taken
by the authorities to maintain the area of Malay Reservation Land especially in the
affected areas.
Keywords: Malay Reservation Land, Enactment, Kedah
1.0 INTRODUCTION
The perceptions that Malay Reservation Lands are low in value and low prospect
always lead to the undeveloped land. Generally, Malay Reservation Land always has
pressured by poverty and uneconomic. Due to this situation, the Malays sold or leased
their lands to Non-Malays. Historically, on the Conference of the Residents of the four
Federated Malay States held in 1908, the issue on the sale of Malay land was
addressed for the first time. The British representatives were alerted to the drastic
increase of land sales initiated by Malay land owners to foreign immigrants. It was
anticipated that such acts would inevitably affect the political power of the Malays.
Kedah Malay Reservation Land was aimed at protecting and preserving the right
to land ownership of the Malays in Kedah State. Like other Malay Reservation State
Enactments, the declaration and reservation was not confined to the Malay reservation
land but also included several other types of land which could only be owned or dealt
over by Malays, such as the Malays holdings, Sultanate land, Malacca customary land,
Malay agricultural settlements, the customary tenure of Negeri Sembilan and its
Lengkongan lands.
When this particular enactment for the protection of Malay land rights was
introduced, some parties raised their doubts. It was argued that since the Malays were
already lagging behind economically, the Malay Reservation Enactment might further
aggravate their weak economic status. This argument is still put forward by opponents
of Malay reservation land until today.
2.0 BACKGROUND
Alor Setar is the capital city of Kedah DarulAman and the land of agriculture.
AlorSetar situated in the district of Kota Setar which is its‘ border in the east are District
of PokokSena and Pendang, whereby District of Yan in the south, and District of
KubangPasu in the north. With the coverage area about 424 kilometres squares it
consists of 28 mukims, 7 urbans and 6 sub-urbans. The total area of Malay Reservation
Land in district of Kota Setar is about 62,032.04 hectares. Malay Reservation Land
always has the connotation an obstacle to the agenda of general development. Many
people are not aware that Malay Reservation Land is a piece of entrusted land which is
ought to be preserved. Malay Reservation Land refers to a special category of land
confined within the boundaries of the state which can only be owned and dealt over by
Malays or persons deemed native residents of the state. Article 89(6) of the Federal
Constitution 1957 defines Malay reservation as land reserved for alienation to Malays or
to natives of the State in which it lies.
551
Area of Malay Reservation Land in Kedah
Initially, the size of Malay Reservation Land in Kedah is about 62,032.04

hectares. But the size that exists has no exact figures on the actual size of Malay
Reservation Land. This could have been caused by a change of the land features and
the lack of appropriate replacement with other pieces of land. A total of 137.571 hectares
of Malay Reservation Land was reported to have been sacrificed for development
purposes. The total of 276.881 hectares of the lost reserve land was subsequently
replaced. Based on the replacement of the Malay Reservation Land it shows that the
total acreage is increased however, the value of the land is decreased since the
replacement was made within the non-commercial or potential areas. The replacement
of the Malay Reservation Land always took place in the remote area in which the
character of the land is not similar with the one that has been abolished where high in
value and more potential.
3.0 PROBLEM STATEMENT
There are several factors that lead to the decreasing the Malay Reservation Land
area. As for exampke the Malay Reservation Land are sold for the immediate profit, sell
and lease to non Malays and land acquisition by the State Authority for the public
purpose and is not been replaced. (SitiNursyahidah, 2014).
4.0 METHODOLOGY
This research is to identify the main factor that lead to the decreasing of Malay
Reservation Land in the research area that is District of Kota Setar. In order to collect
the information regarding this issue, it involve the officer in the Land Office of Kota Setar.
From this research, the author will focus on the factors such as from the ownership and
the transaction of the Malay Reservation Land.
Data kajian diperolehdarisumber data primer dan data sekunder.Data primer

adalah hasil daripada bahan bacaansepertiartikelakhbar, jurnal, kertas seminar, buku
undang-undang dan sebagainya.Manakala data sekunder adalah hasil daripada
temubual bersama beberapa orang pegawai dari Pejabat Tanah dan Daerah antaranya
adalahdari PTD Segamat, PTD Pontiandan PTD Kulai.Selainitu data sekunder juga
diperoleh daripada pemilik Tanah RizabMelayu yang terdiridaripada 15 responden dari
daerah Segamat iaitupemiliktanahdariKampungBatu Lima, Kampung Tebing Tinggi,
Pagoh dan Labis. Selainitu, 15 respondenlagiterdiridaripadapemiliktanah di daerah Muar
yang merangkumi kawasan Kampung Raja, KampungPanchor, Kampung Bukit Gambir
dan Kampung Durian Chondong. Manakala 20 responden adalah pemilik tanah dari
daerah Pontian iaitu dariKampungChokoh, Pekan Nanas danKampung Ayer Baloi.
5.0 FINDINGS AND DISCUSSIONS
5.1 Ignorance of the purpose
Since the development becomes the main agenda in the state revenue, proprietor and
administrator have become ignorant about the importance of preserving the Malay
Reservation Land.
552
5.2 No repeal Enactment and incapable to compete
When the Enactment has been introduced many years ago, there is no changes
has been made to the Enactment to suit with the current situation. This situation leads to
the incompetency and incompatible with the needs of the current development. The
Malays soon developed a complacent attitude toward the reservation laws and thus
failed to make any effort to change or improve the law
5.3 Location and Low Prospect
Most of Malay Reservation Land is located in remote or village area. The high
prospect land and city area will not be gazetted as Malay Reservation Land. Only about
13% of land in the District of Kota Setar is being gazetted as Malay Reservation Land.
5.4 Land Swapping
The development in the rural areas for new township will encourage the
developer to apply to remove the status of Malay Reservation Land and replace the
reserved land in other area.
5.5 The effectiveness of restriction as stated in the Enactment
Kedah Malay Reservation Enactment provide for restriction in dealing with non-
Malays. The restriction includes the disposal of Malay Reservation Land to any non-
Malay.
5.6 The State Authority's power of disposal
Ruler in Council or the Yang di PertuanAgong in the case of the Federal Territory
is given discretion to alienate state land within a Malay reservation to any person, body,
corporation or company which is specified in the Third Schedule, and to declare any
company or corporation as Malay.The objective of the above amendment was to permit
development and to raise the economic status of the Malay Reservation Lands owners.
5.7 Market Value of Malay Reservation Land
Land Acquisition Act 1960 (amendment 1983), the state government has
statutorily guaranteed that the value of the Malay Reservation Land shall not be affected
by its status as a Malay Reservation Land.Most of the Malay reservation properties are
sold at lower or discounted price. As a result, the gap between Malay Reservation Land
and open title seems to increase year by year.The proprietors of the Malay Reservation
Land tend to sell out their land to third party as a result of being discriminated in land
transaction
5.8 Security of land title and the Malay Reservation Land
Malay Reservation Land has no priority over the security to the financial
institutions. Some of the financial instittutions refuse to recognize the security of the
Malay Reservation Land. Several cases have been brought to court.
5.9 Administrative Inefficiency
553
To improve government service to the public, a new system has been introduced
to keep all the titles properly and systematically. When there was the transition from the
manual to the system, many problems occurred and lots of mistakes have been
encountered nowadays.
6.0 RECOMMENDATIONS
 The role of State Authority to develop and protect the Malay Reservation Land by
providing opportunity to the owners to collaborate with government agencies.
 It is suggested that all financial institutions registered under the Finance 1989 (Act
372) or Islamic Bank Act (Act 276) must accept any charge of Malay Reservation
Land.
 It is also proposed that any corporation or company providing loan for land or
housing to its employees should be exempted from being required obtaining
approval from the State to create charge.
 The creation of power of attorney to non-Malays as stated in the Kedah Malay

Reservation Enactment that permits only for three years only. If the period of the
power of attorney that has been given to non-Malays has lapsed, the power of
attorney must be renewed.
 Malay companies can develop Malay Reservation Land. The state government
should give priority to develop Malay Reservation Land or give priority to the owners
of Malay reservation land to develop their land with the support from the state
government.
7.0 CONCLUSION
The future of the Malay Reservation Land lies in the hand of the Malays. The
Enactment contains many restrictions but do not provide a sufficient protection
against abuse and misappropriation. Malay Reservation Land has been marked with
red ink to show its importance. The trust to protect the land lies in the hands of many
different parties, such as the State Authority and the Ruler-in-Council. Land
administrators and politicians also have an important role to play in determining the
future of the Malay Reservation Land. Like the constitution, the enactments do not
create a major issue that impedes development.
8.0 REFERENCES
https://www.bharian.com.my/berita/nasional/2017/09/322270/keluasan-tanah-rizab-
melayu-di-johor-meningkat
Dr. Nor Asiah Mohamad and Dr. Bashiran Begum Mubarak Ali,(2009)
Malaysian Journal of Real Estate Vol. 4, No.2, The prospect and challenges of malay
reservation land in the 21st Century
Dr. Ismail Omar, (2015) Pezzottaite Journals, Enterprizing indigenous land in Kuala
Lumpur: Constraining factors of malay reservation land
554
Pakhriazad Hassan Zaki, MohdZakiHamzah, MohdHasmadi Ismail,

KhairilWahidinAwangAndHazandyAbd. Hamid, (2010) Malay customary tenure and
conflict on implementation of colonial land law in Peninsular Malaysia
http://www.sldb.com.my/index.php/en/fungsi-3/geran-komunal
Rosemary Hill, Petina L Pert, Jocelyn Davies, Catherine J Robinson, Fiona Walsh and
Fay Falco-Mammone, (2015) Indigenous land management in Australia, extent, scope,
diversity, barriers and success factors
7 Maori landownership and management in New Zealand, TaniraKingi, Institute of

Natural Resources,Massey University, Palmerston North, New Zealand
National Land Code 1965
Kedah Malay Reservation Enactment No.63
Malayan Law Journal Reports/1990/Volume 3
Unpublished legal documents from Kedah State Legal Advisor‘s Office
-CS22-
Administrative Reform Towards Strengthening the Transformation of The
Institution of Penghulu in Kedah
Nadziatul Shazwani binti Nor Aman

Kedah Darul Aman
Abstract
The institution of Penghulu is the oldest and longest in the history of administration in
Malaysia. Its history dates back as early as 50 century A.D. However, rapid urbanization, lower
entry level requirements, and inadequate staffing diminish the power and influence of
Penghulus. They are no longer seen as the authoritative figure for rural development and their
functions and existence have been questioned. Building upon this framework, this paper
attempts to examine the extent to which the Institution of Penghulu is still relevant in Kedah
state administration. To answer this objective, the researcher utilizes a qualitative method that
involves personal interviews of 10 current and former Penghulus as well as former state
secretary. The findings of the interviews are classified based on three major themes: entry level
requirements, human resource development, and symbol of reference. Specifically, the
respondents indicate that the low entry level requirement to become a Penghulu causes the
position to be looked down by administrative officers in the state. The position of Penghulu is
only at the assistant administrative level, thus making them subservient to the young junior
officers in the state who sometimes are not well-versed in the affairs of villages. Secondly, many
of the Penghulus lack critical trainings such as information technology, counselling, decision
making, conflict resolution, and leadership. As such, they are not well equipped to face
problems in the villages. Finally, Penghulus were traditionally a source of reference for people to
come and get advice on a variety of issues. Nowadays, a rapid migration of people from the
555
rural areas to town has diminished the power and influence of Penghulus. They are no longer
seen as the authority in the villages. Based upon the findings, the study recommends two major
reforms. First, the state government has to increase the entry level requirement to ensure that
the position of Penghulu is upgraded to the officer status. Second, once the position is
upgraded, the state government needs to provide continuous training to better equip the
Penghulus with relevant knowledge, skills, and abilities to ensure that they can perform their
jobs with improved and increased competency. Proper infrastructure such as technology,
accessible offices, and adequate manpower needs to be provided to commensurate with the
elevated status. Once these reforms take place, it is hopeful that the institution of Penghulu can
be looked upon highly by the society and the Penghulus can again be relevant as the agent of
change in the development of rural areas in Kedah.
Keywords: Administrative Reform, Penghulu, Kedah
1.0 Introduction
The political structure of Kedah was typical of the Malay political system in which the
largest unit was the state or more accurately ‗Negeri Kedah dan jajahan-jajahan takluknya‘.
Under the district administration is a sub district headed by Penghulu. The appointment of
Penghulu is suggested by regional authorities who were from royal family and approved by
Sultan. The regional authorities would collect either a share of annual crops, fruits and livestock
from the cultivators.
The Penghulu has wide jurisdiction including religious matters such as preventing acts of
superstition and associating Allah, gambling, drinking liquor, smuggling, arresting and
prosecuting people who do not fast and pray. There were many duties and responsibilities of the
Penghulu which include to assist the police orders, to enquire into any offences and bring
offenders to justice, and to protect the society, to ensure the tenants pay their tenth of the
produce, to settle all cases of marriage and religious matters and to keep a list of all persons in
his district, age, trade, time of departure, all births, deaths and marriages.
During the Colonial Period, the roles of Penghulu have been changed as well as the
power of appointment. In the previous time before the colonial period, the Sultan has the power
to appoint the Penghulu to administer the sub district on behalf of the Sultan. However, during
the Colonial Period the British government appointed the Penghulu and not through the
inheritance as he had often been before but by the qualification and administrative capability.
After the Independent, the Penghulu thus became a government officer. They were now the
agent of the government and not only the representative of the local society. Nowadays, the
appointment of Penghulu is made through Suruhanjaya Perkhidmatan Awam. However in some
states such as Kedah, the appointment of Penghulu is made by the consent of the Sultan.
The roles of Penghulu now are more focused on the administrative rather than acted on
behalf of the Sultan in the Pre Colonial Period. However, the traditional characteristics of the
Penghulu are still been followed. Penghulu still act as the middleman between the local society
and the government. Penghulu also play a role of development agent, unity agent and
sometimes Penghulu is the source of inspiration to the people. Local society in the rural areas
556
idolised the Penghulu who is very kind, generous, hardworking, friendly and easy to mingle
around with the community. If there are any problems or issues arise in the village, the local
society will refer these problems and issues to the Penghulu and Penghulu will be the problem
solver. This situation will bring opportunity to the Penghulu to shape the society as outlined by
the government policy which this is his advantage to affect the local society who is under his
duty and this is the important asset to effectively his task.
2.0 Problem Statement
Firstly, the impact of urbanization has diminished the power and influence of Penghulu.
For example, it used to be that villagers tend to go to Penghulu to make report regarding birth,
death, marriage and divorce. However, these cases are now being handle by specific
government agencies such as National Registration Department and Islamic Religious Affairs
Department. In addition to that, job referral is normally been part of the responsibility of
Penghulu especially for those who are seeking for employment. But now prospective employee
can go and get the referral from any government officers.
Secondly, in regards to entry level qualification for Penghulu, the position of Penghulu
only requires a diploma. Such requirement down grade the position of Penghulu in the district
administration. Even though Penghulu tend to have years of experiences in dealing with rural
development issues, there still become subservient to the younger junior officer. These causes
problem when their advices or recommendations are being ignored by the officers.
Thirdly, the issue of inadequate staffing also impacts the ability of Penghulu to effectively
perform their job and responsibilities. As of today, the office of Penghulu only has one staff. This
clearly inhibit the ability of the Penghulu to solve a lot of administrative and developmental
issues put forward by the villages in the sub district. Many of the actions are delayed due to the
shortage of manpower. This has caused arise in the number of complaint received in the District
Office.
The objective of this paper is to examine the extent to which the Institution of Penghulu
is still relevant in Kedah state administration.
3.0 Literature Review
The institution of Penghulu have been said to be the oldest and the longest in history of
administration in Malaysia. Perhaps it was the oldest in the Malay sultanate era as the Kedah
Ancient Kingdom started as early as 50 century A.D. According to the history of Malay
557
sultanate, Kedah was the oldest sultanate in Malaysia which started about 1400 years ago with
the two Malay head of community named Tun Derma Dewa and Tun Perkasa (Mohd Shariff
Abu Samah, 2012).
In the Malay sultanate era, the appointment of Penghulu is made by the Regional
Authorities and was approved by the Sultan. However, during the Colonial Period, the Penghulu
was appointed by the British and they become a government servant. After independent,
Penghulu was appointed by election held in the mosque on Friday. The villagers will raised their
hands and choose the candidate whom they like to be the Penghulu. It was important for the
British who had to launch colonial administration under such unstable condition, to find key
people locally and to rule the country through them. Therefore, the British chose Penghulu for
this task and the basic unit chosen for administration to be managed by Penghulu was sub
district. The Penghulu posted in each sub districts were to play the most important role in the
colonial rule in the local society.
The year 1969 is the year of change when the appointment of Penghulu was made by
Suruhanjaya Perkhidmatan Awam Kedah until today. In the year 2008, the position of Penghulu
is called ―Penolong Pegawai Tadbir (N27) Penghulu‖. However, this position was changed to
―Penghulu (NP27)‖ in the year 2009. This position was changed again in the year 2016 to
―Penghulu (NP29)‖ until to date. The qualification for the position of Penghulu is STPM or
STAM, 4 ―senawi‖ and Diploma in Public Administration. However, there are about 60% of the
Penghulu are a degree holders.
Penghulu are advised not to involve with the politics. However, they must be sensitive to
the current political situation. Therefore, Penghulu needs to have good relationship with the
politician especially with the Assemblyman for the sake of the development in the district. The
Penghulu who is creative and innovative can use his influence for the unity of the people and to
deliver the government messages through society‘s events and programmes organized by
Penghulu (Dr. Muhamad bin Hamzah, 2008).
4.0 Methodology
The methodology used for this case study is qualitative methods. Qualitative
methodology is using interviews and observations to collect data. Qualitative methods provide
rich, contextual explorations of the topic that are often personally or culturally meaningful. In
order to complete this case study, several interviews had been carried out for the past three
months in order to obtain the information about this topic. There are few important persons that
had been interviewed such as the Pokok Sena District Officer, the Penghulu in the District of
558
Pokok Sena, the former State Secretary of Kedah, the former and well-known Penghulu and
finally the historian of Kedah. Apart from these interviews, the data are also obtain from articles,
journals, books and books from Arkib Negara.
Table 1: List of Personal Interviews
Respondent Position
1. Pokok Sena District Officer
2. Penghulu of Gajah Mati
3. Penghulu of Jabi
4. Penghulu of Derang
5. Penghulu of Bukit Lada
6. Penghulu of Tualang
7. Penghulu of Lesong
8. Former Kedah State Secretary
9. Former Well-known Penghulu
10. Kedah Historian
5.0 Findings and Discussions
559
Based upon the interviews, the researcher has identified three major themes: entry level
requirements, human resource development and symbol of reference. Each specific themes is
underlined below.
i. Theme 1: Entry level requirement
Respondent 9 who has started his service as Penghulu in the year 1969 and he was the
President of the Malaysian Penghulu Association for 14 years until the end of his service. From
his point of view, he said that it would be great if the post of Penghulu could be upgraded. This
is because the Penghulu now are facing many challenges in this new era. Before this, Penghulu
was well-known to all local society in his sub district. However, recently, some of the local
society does not know who the Penghulu in the sub district is. It happened because of the
Penghulu‘s mistakes as they do not know how to be the head of the sub district, do not mingle
around with all local society, lack of public relation skills and low self-esteem. Respondent 3
also agreed to this statement that entry level requirement should be upgraded to degree holder
as Penghulu will need to deal with many challenges and issues in the new era. Meanwhile,
Respondent 8 said that the title Penghulu needs to be changed to Officer in order to expand and
administer the district.
ii. Theme 2: Human Resource Management
Many of the Penghulus lack critical trainings such as information technology,

counselling, decision making, conflict resolution, and leadership. As such, they are not well
equipped to face problems in the villages. These were told by the Respondent 8 whom had
served the government from the year 1962 until 1992. He had become the State Secretary from
the year 1989 until 1992. He told that the Penghulu will convey messages and demands from
the local society that they needed proper roads and bridges as part of the infrastructure. He said
that Penghulu needs to know all administration system, technology, development, skills and
knowledgeable. Penghulu must have the urge to help the poor by giving speech or advice for
them to change their style of living to a better lifestyle.
iii. Symbol of Reference
According to an interview with Respondent 1, he said that the institution of Penghulu is

very important and need to be maintained as it acts as intermediaries between the District Office
and the local society. Although some may say that the institution of Penghulu is no longer
relevant in this new era of information technology, however, the District Officer said that
560
Penghulu is an important person to the local society. The local society especially who live in the
village and rural area mostly will refer to the Penghulu if they need to repair or build new house,
a new road, to repair the road, to repair surau or masjid, to ask for help in term of children‘s
education, land issues, social problems, small estate distribution and to increase their life‘s
revenue. Penghulu in each sub districts will convey all of the villagers‘ voice to the District
Officer. From there the District Officer will know the needs and people‘s complaints that need to
be solved.
Respondent 2 who is the senior Penghulu in the district said that local society needs
Penghulu to tell problems and find solutions to the problems as Penghulu is the middle person
between the local society and the government. Respondent 6 said that it will be easier for the
local society to tell and submit their problems to the Penghulu as Penghulu is the head of the
sub district which they are always meet the local society at the village. Respondent 5 and
Respondent 7 said that not all local society live near the town and some of them live in the rural
area which are far from town and they do not have the transport to go to the relevant agencies
asking for help. This means that the Penghulu is the easiest person that they will turn for help.
Respondent 4 said that this is the responsibilities of Penghulu to help ease the burden of the
local society by providing what are needed by them. Respondent 10 agreed to this statement
when Penghulu is a symbol of reference to the villagers since the traditional administration
system during the Malay sultanate era.
6.0 Recommendations
Based upon the study, it has recovered two major reforms. Firstly, the state government
has to increase the entry level requirements to ensure the position of Penghulu is upgraded to
the officer status. The Penghulu in Kedah are more than 60% are degree holders. Therefore,
the Human Resource Department need to upgrade the post of Penghulu to a higher level and
the candidates must have a degree in order to apply the post of Penghulu.
Since future changes are unpredictable, then knowledge and skills become increasingly
important to determine what modifications should be accepted and implemented and which
should be rejected by the Penghulu. However, Penghulu as the development agent must
determine the big challenges and to make sure the changes carried out and implemented are
really beneficial to the people. Penghulu must change their attitude and become more
responsible and work harder.
561
Secondly, once the position is upgraded, the state government needs to provide
continuous training to better equip the Penghulu with relevant knowledge, skills and abilities to
ensure that they can perform their jobs with improved and increased competency. When the
position of Penghulu has been upgraded, the Penghulu will be more knowledgeable in some
critical areas which should be given priority such as religion, societal and economy.
Skills in various fields are a necessity and advantage to Penghulu. This is because the
field of duty of the Penghulu is like a consultant who provides advice and guidance to his
customers. The planning and implementation of projects and religions is a good and relevant
example. These skills can also be obtained through training and workshops that can be
attended locally and overseas. Usually, the Human Resource Department in Wisma Darul Aman
and INSPIN will organise these training and workshops.
Attitude is a subjective element of being a very important component in the construction

of a person or character, in particular the character of a civil servant such as a moderate,
positive, responsible and willing to sacrifice is a form of superior attitude. Penghulu need to
have all of these characters in order to be the best Penghulu that can serve the people and the
government. By attending all the trainings and courses that has been organized by the state
government, the Penghulu will change their attitude and develop to be a better Penghulu.
7.0 Conclusion
The relevancy of the Institution of Penghulu in Kedah depends upon a number of

reforms. First, the institutional reform should seek to change the current entry level
requirements to a university degree. This is important to ensure that the work and
responsibilities of the Penghulu are reflected by their professional status. The official position of
Penghulu that is based on a minimum bachelor degree will held uplift the professional status
and prestige of the Penghulu.
Second, the increased qualification of the Penghulu should be also be equipped with
necessary knowledge, skills and abilities. The important of training in areas such as information
technology, counselling, decision making, strategic development, conflict resolution and
leadership will better equip the Penghulu to solve and real issues in the sub district. Once these
reforms take place, it is hopeful that the Institution of Penghulu can be looked upon highly by the
society and the Penghulu can again be relevant as the agent of change in the development of
rural areas in Kedah.
562
References
A Bakar Sarpon, (2008) Penghulu dan penggawa: selaku pentadbir, pengurus dan
pemudahcara rakyat, bengkel pemantapan program latihan Penolong Pegawai Tadbir
N27 di INTAN Kampus Wilayah Selatan.
Haji Ghazali bin Mohd Noor, (2008) Penghulu sebagai pembantu kepada Pegawai Daerah dan
Pentadbir Tanah Daerah, bengkel pemantapan program latihan Penolong Pegawai
Tadbir N27 di INTAN Kampus Wilayah Selatan.
Mohd Shariff Abu Samah, (2012) Modenisasi pentadbiran negeri Kedah 1895 – 1954, UUM
Press, Sintok.
Muhamad bin Hamzah, (2008) Institusi penghulu: dahulu, kini dan masa depan, bengkel
pemantapan program latihan Penolong Pegawai Tadbir N27 di INTAN Kampus Wilayah
Selatan.
R.Bonney,(1971) Kedah 1771 – 1821: the search for security and independence, Oxford
University Press.
-TAMAT-
563

NCGD Prosiding PDF

Diunggah oleh

Informasi Dokumen

Judul Asli

Hak Cipta

Format Tersedia

Bagikan dokumen Ini

Bagikan atau Tanam Dokumen

Opsi Berbagi

Apakah menurut Anda dokumen ini bermanfaat?

Apakah konten ini tidak pantas?

Hak Cipta:

Format Tersedia

NCGD Prosiding PDF

Diunggah oleh

Hak Cipta:

Format Tersedia

National Conference on Governance and Development 2018 29-30 October 2018 SOG-UUM

KERTAS KERJA UMUM (GENERAL PAPERS)

Kata kunci: Aedes, Amalan Penjagaan Kebersihan, Selangor, Wabak Denggi

Keywords: Aedes, Hygiene Care Practices, Selangor, Dengue Outbreaks

Amalan penjagaan kebersihan adalah perkara penting dalam kehidupan seseorang

Persampelan adalah dilakukan dengan berpandukan kepada pendapat Babbie (1986),

Jadual 2.Saiz Sampel Bagi Kawasan Kajian Mengikut Daerah

Daerah *Jumlah penduduk 2010 % Saiz sampel

3. HASILDAN PERBINCANGAN KAJIAN

Berdasarkan dapatan kajian berkenaan tahap amalan penjagaan kebersihan oleh

Jadual 3.Tahap Amalan Penjagaan Kebersihan Berkaitan Penyakit Denggi di Selangor

Secara keseluruhannya, kajian ini membincangkan aspek amalan penjagaan kebersihan

Penilaian Terhadap Kualiti Persekitaran dan Kehidupan Berasaskan

Tuan Pah Rokiah Syed Hussain1dan Hamidi Ismail2

Selaras dengan perkembangan pembandaran di Malaysia pada masa kini pelbagai

Kata Kunci: Jenayah, keselamatan awam, Konsep Bandar Selamat, Malaysia

2. ASAS PEMBENTUKAN BANDAR SELAMAT

3. KONSEP BANDAR SELAMAT DI NEGARA MAJU

4. PELAKSANAAN BANDAR SELAMAT DI MALAYSIA

5. ANALISA KADAR JENAYAH KE ARAH MEREALISASIKAN BANDAR SELAMAT DI

Berdasarkan analisa kadar jenayah selama 12 tahun bagi negeri di Semenanjung

**Nota:Mengikut Tarikh Kertas Siasatan Dari 1/1/2004 Hingga 31/12/2004

Nota:Mengikut Tarikh Kertas Siasatan Dari 1/1/2005 Hingga 31/12/2005

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2006 Hingga 31/12/2006

Nota:Mengikut Tarikh Kertas Siasatan Dari 1/1/2007 Hingga 31/12/2007

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2008 Hingga 31/12/2008

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2009 Hingga 31/12/2009

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2010 Hingga 31/12/2010

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2011 Hingga 31/12/2011

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2012 Hingga 31/12/2012

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2013 Hingga 31/12/2013

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/1/2014 Hingga 31/12/2014

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/01/2015 Hingga 31/12/2015

Nota: Mengikut Tarikh Kertas Siasatan Dari 1/01/2016 Hingga 31/12/2016

Rumusannya, berdasarkan analisis kadar jenayah kekerasan dan hartabenda selama 12

Abdul Rahman Embong. (2011). Pembandaran dan kehidupan bandar di Semenanjung

Sarday, J. (2017). Ciri-ciri bandar selamat. http://md.jaissarday. com.2017 (1/6/2018).

Sa’idu Idris1 and Salisu Ahmed Kabiru2

Key Words:Microfinance, Inclusive finance, Paradigm shift, and Poverty reduction

1.1. Problem in Context

2.1. Conceptual Issues

Microfinance is generally aimed at providing financial services to the poor or low-income

2.2. Microfinance and Poverty Reduction: The Correlate

i. Make financial services accessible to a large segment of the potentially productive

2.3.1. Policy Target

2.3.2. Policy Strategies

i. License and regulate the establishment of Microfinance Banks (MFBs);

Raman Mariyappan1, Zainal Md. Zan2 and Amirulikhsan Zolkafli3

Environmental management arguably is very much related to sustainable issues which

Key Words:Environmental Management, Volunteerism

Raman Mariyappan (2016) illustrated that volunteerism is much needed aspect to be

Management education for sustainable development, sustainable consumption in higher

Table 1Voluntarism and Environmental Management of the Penang Highlands

Willing to contribute a small portion of income to HNA 243 (31.9)

Involvement as volunteer helps the government in HNA 7 (0.9)

Environmental preservation activities are not HNA 1 (0.1)

Education towards volunteerism should start from HNA 1 (0.1)

The willingness to pay more for buying eco-friendly HNA 36 (4.7)

Self-esteem in the preservation of highland HNA 1 (0.1)

Voluntary Action as a high-level environmental HNA 0 (0.0)

Communities should act rationally in preserving the HNA 1 (0.1)

Generally volunteerism functions in a society where values such as caring, sharing,

Raman Mariyappan1and Arua Devi Varatharajoo2