Anda di halaman 1dari 75

Analgesik, antiinflamasi

http://www.farmasiku.com/index.php?target=categories&category_id=171

Analgesik adalah obat yang dapat mengurangi atau menghilangkan rasa nyeri dan
akhirnya akan memberikan rasa nyaman pada orang yang menderita.

Anti inflamasi adalah obat yang dapat menghilangkan radang yang disebabkan bukan
karena mikroorganisme (non infeksi).

Gejala inflamasi

Inflamasi dapat disertai dengan gejala panas, kemerahan, bengkak, nyeri/sakit,


fungsinya terganggu.
Proses inflamasi meliputi kerusakan mikrovaskuler, meningkatnya permeabilitas
vaskuler dan migrasi leukosit ke jaringan radang, dengan gejala panas, kemerahan,
bengkak, nyeri/sakit, fungsinya terganggu. Mediator yang dilepaskan antara lain
histamin, bradikinin, leukotrin, Prostaglandin dan PAF.

Penanganan inflamasi

1 Derivat Asam Salisilat à Aspirin, Benorilat, Diflunisal, Salsalat


2 Derivat Asam Propionat à As.Tiaprofenat, Fenbufen, Flurbiprofen, Ibuprofen,
Ketoprofen, Naproksen
3 Derivat.As.Fenamat à As.Mefenamat, Meklofenamat
4 Derivat As.Fenilasetat à Diklofenak, Fenklofenak
5 Derivat Oksikam à Piroksikam, Tenoksikam
6 Der.As.Asetat inden/indol à Indometasin, Sulindak, Tolmetin
7 Deriva Pirazolon à Azapropazon, Fenilbutazon, Oksifenbutazon

ABDIFLAM
CODE: C29
Harga Per Satuan Terkecil : Rp1,350.00
Abdiflam
Natrium diklofenak 25 mg; 50 mg.
Indikasi:
sakit pasca traumatik inflamatori, inflamasi dan bentuk degeneratif rematik, rematik non
artikular.
Dosis:
Dewasa: awal: sehari100-150 mg dalam dosis terbagi 2-3x;
Anak 14th: 75-100 mg sehari dalam dosis bagi 2-3x.
Kemasan:
5 x 10 tablet 50 mg.

AFI RHEUMA
CODE: C1
Harga Per Satuan Terkecil : Rp2,300.00
BELI
AFI RHEUMA KAPSUL
KOMpOSISI :
Tiap kapsul mengandung :
4 butil 1,2 difenilpirazolidina 3,5 dion ................... 100 mg
CARA KERJA OBAT :
Sebagai anti radang dan analgetik
INDIKASI :
Ankylosing spondylitis, acute gouty arthritis, active rheumatoid arthritis.
CARA PEMAKAIAN:
Dewasa 2-3 kali sehari 1 kapsul, sesudah makan atau diminum dengan susu,
seyogyanya sesuai petunjuk dokter.
EFEK SAMPING:
- Iritasi gastrointestinal (mual, muntah, rasa terbakar pada lambung).
- Retensi : Cairan, edema, rash.
- Gangguan hematologi yang serius (leukopenia, agranulositopenia, aplastik-anemia).
- Alergi
INTERAKSI OBAT:
Jangan diberikan bersama - sama dengan : Kumarinantikoagulan, insulin, fenitoin, oral
hipoglikemik.
KEMASAN :
Box isi 10 blister @ 12 kapsul
Reg. No. DKL 8901700901 A1
Simpanlah obat ini ditempat yang sejuk dan kering
HARUS DENGAN RESEP DOKTER

Allogon 500

Harga Per Satuan Terkecil : Rp700.00


BELI
ALLOGON 500 mg.

Komposisi
Mefenamic acid/Asam mefenamat
INDIKASI
Nyeri ringan, sedang sampai berat seperti sakit kepala, nyeri otot, artralgia (nyeri sendi),
sakit gigi, osteoartitis rematoid, gout, nyeri saat haid, nyeri setelah operasi, nyeri setelah
terjadi patah tulang, nyeri setelah melahirkan, neuralgia (nyeri pada saraf), dan nyeri
pada organ-organ dalam perut.
KONTRA INDIKASI
Gastritis, ulkus lambung, dan anemia hemolitik.
PERHATIAN
Kehamilan, dehidrasi, epilepsi, asma.

Interaksi obat :
antikoagulan oral.
EFEK SAMPING
Gangguan & perdarahan saluran pencernaan, ulkus peptikum, sakit kepala, gugup,
insomnia (sulit tidur), biduran/kaligata, kemerahan pada kulit, pembengkakan wajah.
INDEKS KEAMANAN PADA WANITA HAMIL
C: Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau
embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau
penelitian pada wanita dan hewan belum tersedia. Obat seharusnya diberikan bila
hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin.
KEMASAN
Kaplet 500 mg x 2 x 10 butir.
DOSIS
Dewasa : 250-500 mg tiap 6 jam sekali.
Anak-anak : 6,5 mg/kg berat badan tiap 6-8 jam sekali.
Nyeri saat
: diawali dengan 500 mg, kemudian 250 mg tiap 6 jam.
haid
PENYAJIAN
Dikonsumsi bersamaan dengan makanan
PABRIK
Konimex.

Analsik

CODE: C2
Harga Per Satuan Terkecil : Rp1,150.00
ANALSIK
Tiap kaptet mengandung :
Metampiron 500 mg
Diazepam 2 mg

FARMAKOLOGI
ANALSIK® adalah kombinasi Metampiron dan Diazepam.
Metampiron adalah suatu obat analgesik- antipiretik. Diazepam mempunyai kerja
sebagai antiansietas, juga memiliki sifat relaksasi otot rangka. Kombinasi ini
dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral.
INDIKASi :
Untuk meringankan rasa nyeri sedang sampai berat, ter-utama nyeri kolik dan nyeri
setelah operasi dimana di -perlukan kombinasi dengan tranquilizer.
KONTRA INDIKASI :
- Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam.
- Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg, wanita hamil
dan menyusui.
- Penderita dengan tekanan darah lebih rendah dari 100 mmHg.
- Glaukoma sudut sempit, keadaan psikosis akut.
EFEK SAMPING :
- Dapat menimbulkan agranulositosis.
- Reaksi hipersensitivitas, reaksi pada kulit,ngantuk,pusing,lelah yang berlebihan.
- Konstipasi, depresi, diplopia, hipotensi, jaundice, perubahan libido, mual, tremor,
retensi urin, vertigo.
PERHATIAN :
- Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan
ketergantungan fisik dan psikis.
- Hati-hati pada penderita yang pernah mengalami gangguan pembentukan
darah/kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu
dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka
lama untuk pengobatan nyeri akut.
- Walaupun jarang menimbulkan agranulositosis, sebaik-nya tidak digunakan
untuk jangka pahjang, karena dapat berakibat fatal.
- Selama minum obat ini jangan mengendarai kendaraan bermotor atau
menjalankan mesin.
- Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk
mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu lengan.
- Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai
kecenderungan melakukan bunuh diri.
- Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaan-
keaaaan hipereksitasi akut, ansietas,halusinasi dan gangguan tidur.

INTERAKSI OBAT :
Penggunaan bersama - sama dengan obat - obat yang mendepresi SSP atau alkohol
dapat meningkatkan efek Diazepam.
DOSIS :
1 kaplet,bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam, maksimum 4 kaplet
sehari.
HARUS DENGAN RESEP DOKTER
KEMASAN
Dusisi 10 strip @ 10 kaplet. No. Reg.: DPL8822208609A1.
PENYIMPANAN
Simpan pada suhu kamar (25°- 30°C).
Dibuat oleh :
PT SANBE FARMA
Bandung - Indonesia

Analspec

CODE: C3
Harga Per Satuan Terkecil : Rp1,250.00
ANALSIK

Tiap kaptet mengandung :


Metampiron 500mg
Diazepam 2 mg
FARMAKOLOGI
ANALSIK® adalah kombinasi Metampiron dan Diazepam.
Metampiron adalah suatu obat analgesik- antipiretik. Diazepam mempunyai kerja
sebagai antiansietas, juga memiliki sifat relaksasi otot rangka. Kombinasi ini
dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral.
INDIKASI :
Untuk meringankan rasa nyeri sedang sampai berat, ter-utama nyeri kolik dan nyeri
setelah operasi dimana di -perlukan kombinasi dengan tranquilizer.
KONTRA INDIKASI :
- Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam.
- Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg, wanita hamil
dan menyusui.
- Penderita dengan tekanan darah lebih rendah dari 100 mmHg.
- Glaukoma sudut sempit, keadaan psikosis akut.
EFEK SAMPING :
- Dapat menimbulkan agranulositosis.
- Reaksi hipersensitivitas, reaksi pada kulit,ngantuk,pusing,lelah yang berlebihan.
- Konstipasi, depresi, diplopia, hipotensi, jaundice, perubahan libido, mual, tremor,
retensi urin, vertigo.
PERHATIAN :
- Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan
ketergantungan fisik dan psikis.
- Hati-hati pada penderita yang pernah mengalami gangguan pembentukan
darah/kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu
dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka
lama untuk pengobatan nyeri akut.
- Walaupun jarang menimbulkan agranulositosis, sebaik-nya tidak digunakan
untuk jangka pahjang, karena dapat berakibat fatal.
- Selama minum obat ini jangan mengendarai kendaraan bermotor atau
menjalankan mesin.
- Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk
mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu lengan.
- Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai
kecenderungan melakukan bunuh diri.
- Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaan-
keaaaan hipereksitasi akut, ansietas,halusinasi dan gangguan tidur.
INTERAKSI OBAT :
Penggunaan bersama - sama dengan obat - obat yang mendepresi SSP atau alkohol
dapat meningkatkan efek Diazepam.
DOSIS :
1 kaplet,bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam, maksimum 4 kaplet
sehari.
HARUS DENGAN RESEP DOKTER
KEMASAN
Dusisi 10 strip @ 10 kaplet. No. Reg.: DPL8822208609A1.
PENYIMPANAN
Simpan pada suhu kamar (25°- 30°C).
Dibuat oleh :
PT SANBE FARMA
Bandung - Indonesia

Anastan

CODE: C4
Harga Per Satuan Terkecil : Rp250.00
ANASTAN

(Mefenamic Acid) 500 mg


Anastan adalah obat yang mengandung Acidum Mefenamicum, berkhasiat analgesic
dan anti inflamasi.
Komposisi :
- Tiap kaplet mengandung Acidum Mefenamicum 500 mg (Anastan Forte).
- Tiap kapsul mengandung Acidum Mefenamicum 250 mg.

Posologi :
Dewasa dan anak - anak diatas 14 tahun :
Anastan forte : Awal 1 kaplet (500 mg) kemudian Vi kaplet (250 mg) tiap 6
-
jam.
Indikasi :
Sebagai obat untuk meringankan rasa sakit seperti pada sakit gigi, sakit kepaia; nyeri
sesudah operasi dan dysmenorrhoea primer.
Peringatan dan Perhatian :
- Dalam pengooatan, bila cfiare maka pengobatan dihentikan.
- Digunakart tidak lebih dari 7 hari.
- Hati - hati pada penderita yang mendapat bronkospasma, aiergik rinrtis atau
urticaria karena obat non steroid anti inflamasi yang lain, karena kemungkinan
terjadi" cross sensitivity".
- Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui
dengan pasti.
Efek samping :
- Dapat timbul diare biasa hingga berat, terjadi tukak lambung dan pendarahan.
- Dapat timbul asma, anemia, albuminiea dan kencing darah.
- Dapat timbul agranucytosis, thrombocytopenia.
- Juga dapat timbul kantuk, nausea dezziness, nervous dan sakit kepala.
Kontra indikasi :
- Obat kontra indikasi bagi penderita sakit tukak lambung atau inflamasi pada
saluran cerna.
- Juga pada penderita gangguan fungsi ginjal atau pernah menderita sakit ginjal
atau hati.
- Penderita asma.
- Wanita mengandung atau sedang menyusui.
Enteraksi obat :
- Dengan obat anti coagulant, mengurangi kerja obat anti coagulant.
- Mempengaruhi test darah, sehingga hemoiytic anemia coombs positif.
- Mempengaruhi test urine, sehingga billirubin urine positif dan protein uria positif.
Cara penyimpanan :
Disimpan di tempat tertutup dan diluar pengaruh cahaya.
Kemasan :
Anastan forte : Dos isi 10 strip @ 10 kaplet.
Harus dengan resep dokter
No. Reg. : Anastan forte DKL 9207802304 A1

Antalgin

CODE: C5
Harga Per Satuan Terkecil : Rp150.00
Antalgin
Komposisi
Tiap tablet mengandung antalgin 500 mg.
Cara Kerja Obat :
Antalgin adalah derivat metansulfonat dan amidopirina yang bekerja terhadap susunan
saraf pusat yaitu mengurangi sensitivitas reseptor rasa nyeri dan mempengaruhi pusat
pengatur suhu tubuh. Tiga efek utama adalah sebagai analgesik, antipiretik dananti-
inflamasi.
Antalgin mudah larut dalam air dan mudah diabsorpsi ke dalam jaringan tubuh.
Indikasi :
Untuk menghilangkan rasa sakit, terutama kolik dan
sakit setelah operasi.
Dosis dan Cara Penggunaan :
Melalui mulut (per oral).
Dewasa : sehari 3 kali 1 tablet.
Peringatan dan Perhatian :
- Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka
sebaiknya tidak digunakan terus-menerus dalam jangka panjang.
- Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah
/ kelainan darah.
Efek Samping :
Gejala kepekaan yang manifestasinya kelainan pada kulit. Pada penggunaan jangka
panjang dapat menyebabkan agranulositosis.
Kontra indikasi :
- Pada penderita yang alergi terhadap derivat pirazolon. Kasus porfiria hati (amat
jarang) dan defisiensi bawaan glukosa-6-fosfat-dehidrogenase.
- Penderita yang hipersensitif.
- Bayi 3 bulan pertama atau dengan berat badandibawah 5 kg.
- WanitahamilteTutama^B bulan pertamanaTT6 minggu terakhir.
- Penderita dengan tekanan darah <100 mmHg.
Cara Penyimpanan :
Simpan pada suhu 25° - 30°C (kondisi penyimpanan,
normal).
Kemasan dan Nomor Registrasi
Antalgin 500 mg, kotak 10 blister @ 10 tablet
No. Reg.: GKL9420906010A1
Antalgin 500 mg, botol 1000 tablet
No.Reg.:GKL9420906010A1
HARUS DENGAN RESEP DOKTER
INDO FARMA BEKASI – INDONESIA

Antrain
CODE: C6
Harga Per Satuan Terkecil : Rp10,200.00
ANTRAIN
TABLET - INJEKSI©
KOMPOSISI :
Tiap tablet mengandung :
Metamizole Na 500 mg
ANTRAINI Injeksi
Tiap ml mengandung:
Metamizole Na 500 mg
CARA KERJA OBAT :
Metamizole Na adalah derivat metansulfonat dari aminopirin yang mempunyai
khasiat analgesik. Mekanisme kerjanya adalah menghambat transmisi rasa sakit ke
susunan saraf pusat dan perifer. Metamizole Na bekerja sebagai analgesik,
diabsorpsi dari saluran pencernaan mempunyai waktu paruh 1-4 jam.
INDIKASI :
Untuk meringankan rasa sakit,terutama nyeri kolik operasi.
KONTRA INDIKASI :
- Penderita hipersensitif terhadap Metamizole Na.
- Wanita hamil dan menyusui.
- Penderita dengan tekanan darah sistolik < 100 mmHg.
- Bayi di bawah 3 buian atau dengan berat badan kurang dari 5 kg.
EFEK SAMPING :
- Reaksi hipersensitivitas: reaksi pada kulitmisal kemerahan.
- Agranulositosis.
PERINGATAN / PERHATIAN :
- Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk
mengobati rematik,lumbago,sakit punggung,bursitis,sindroma bahu lengan.
- Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka
sebaiknya tidak digunakan dalam jangka panjang.
- Hati-hati pada penderita yang pernah mengalami gangguan
pembentukan darah/kelainan darah. gangguan fungsi hati atau ginjal. Karena itu
perlu dilakukan pemeriksaan fungsi hati dan darah pada penggunaan yang lebih
lama dari penggunaan untuk mengatasi rasa sakit akut.
- Pada pemakaian jangka lama dapat menimbulkan sindrom neuropathy yang
akan berangsur hilang bila pengobatan dihentikan.
INTERAKSI OBAT :
Bila Metamizole Na diberikan bersamaan dengan Chlorpromazine dapat mengakibatkan
hipotermia.
ATURAN PAKAI :
Dewasa:
- Tablet : 1 tablet jika sakit timbul, berikutnya 1 tablet tiap 6-8 jam,maksimum 4
tablet sehari.
- Injeksi : 500 mg jika sakit timbul, berikutnya 500 mg tiap 6-8 jam,
maksimum 3 kali sehari, diberikan secara injeksi I.M. atau I.V.
KEMASAN :
ANTRAIN* Tablet
Kotak berisi 10 strip @ 10 tablet Reg.No.:DKL7617611210A1
HARUS DENGAN RESEP DOKTER

SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA


ANTRAIN* Injeksi
Kotak berisi 5 ampul @ 2 ml netto Reg. No.: DKL0117616843A1
JAUHKAN DARI JANGKAUAN ANAK - ANAK
HARUS DENGAN RESEP DOKTER
SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA
JANGAN DISIMPAN DALAM LEMARI PEMBEKU
Diproduksi Oleh :
PT. Interbat
Jl. H.R.M. Mangundiprojo no. 1
Buduran, Sidoarjo-61252 Jawa Timur, Indonesia

Argesid 500mg
Harga Per Satuan Terkecil : Rp1,100.00
ARGESID
Asam Mefenamat

KOMPOSISI :
ARGESID 250
Tiap kapsul mengandung Asam Mefenamat 250 mg.
ARGESID 500
Tiap Kaplet salut selaput mengandung Asam Mefenamat 500 mg
Farmakologi :
Asam Mefenamat merupakan anti inflamasi non-steroid, bekerja dengan cara
menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim
siklooksigenase sehingga mempunyai efek analgetik dan antiinflamasi.
Indikasi :
untuk meredakan rasa sakit seperti sakit gigi, sakit kepala, dismenore, meredakan rasa
nyeri seperti nyeri otot, nyeri sesudah operasi, nyeri saat melahirkan, nyeri karena
trauma.
Kontra indikasi :
Tukak lambung, radang gangguan ginjal, hipersensitif usus.
Efek samping :
Gangguan saluran cerna seperti iritasi lambung, kolik, usus, mual, muntah, diare,
pusing, sakit kepala, vertigo, dispepsia, ruam makulo papular. Pada penggunaan terus-
menerus dengan dosis 2000 mg atau lebih sehari dapat mengakibatkan agranulositosis
dan hemolitik anemia.
Peringatan dan Perhatian
- Tidak dianjurkan diberikan pada wanita hamil dan menyusui.
- Tidak boleh melebihi dosis yang dianjurkan dan lebih dari 7 hari, kecuali atas
petunjuk dokter. Keamanan penggunaan pada anak-anak di bawah 14 tahun
belum diketahui.
- Hati-hati pemberian pada penderita bronkhospasme, alergik rinitis, urtikaria atau
mendapat pengobatan antiinflamasi non-steroid lainnya, karena dapat terjadi
sensitivitas silang.
Interaksi Obat :
Obat-obatan antikoagulan oral seperti warfarin, asetosal.
Dosis :
Dewasa dan anak-anak di atas 14 tahun:
Dosis awal 500mg kemudian dilanjutkan 250 mg tiap 6 jam.
Kemasan:
ARGESID 250.
Box 10 Strip @10 Kapsul.
No. Reg.: DKL0033201I301A1

ARGESID 500
Box 10 Strip @10 Kaplet
No. Reg.: DKL0033201109A1
( Simpan di tempat sejuk (15-25)°C dan kering )
HARUS DENGAN RESEP DOKTER
PROMED
PT. PROMEDRAHARDJO FARMASIINDUSTRI
Sukabumi – Indonesia

Artrilox 15
CODE: C8
Harga Per Satuan Terkecil : Rp7,700.00
Artrilox®
Meloxicam
KOMPOSISI :
Setiap tablet Artrilox 7,5 mg mengandung Meloxicam 7,5 mg Setiap tablet Artrilox 15 mg
mengandung Meloxicam 15mg.
CARA KERJA OBAT :
Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam
enolat. Mekanisme kerja meloxicam sebagai efek anti-inflamasi, analgesik, dan
antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi
sebagai mediator peradangan. Proses penghambatan oleh meloxicam lebih selektif
pada COX2 daripada COX1. Penghambatan COX2 menentukan efek terapi NSAI,
sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal.
INDIKASI :
- Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut.
- Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik).
KONTRA INDIKASI :
- Ulkus lambung yang aktif.
- Pendarahan gastrointestinal, pendarahan pembuluh darah otak atau penyakit
pendarahan lainnya.
- Insufisiensi hepar yang berat.
- Insufisiensi ginjal berat yang tidak didialisa.
- Dikontraindikasikan pada pasien yang menunjukkan gejala asthma, polip
dihidung, angio-edema atau urtikaria bila diberikan asam asetilsalisilat
atau obat NSAI lainnya.
- Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). x Anak-
anak dan remaja yang berumur kurang dari 15 tahun.
- Masa kehamilan dan menyusui.

EFEK SAMPING :
- Saluran cerna : dispepsia, rasa mual, muntah-muntah, rasa sakit di
perut,konstipasi, rasa kembung, diare, bersendawa, esofagitis, ulkus gastro-
duodenal, pendarahan gastro-intestinal makroskopik, jarang terjadi kolitis.
- Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan
kadartransaminase dan btlirubin.
- Fungsi ginjal menjadi abnormal dengan peningkatan kadar serumkreatinin
dan/atau serum urea.
- Pada kulit : pruritus, ruam kulit, stomatitis, urtikaria, jarang terjadi
fotosensitisasi.
- Anemia, gangguan jumlah sel darah : lekosit, lekopenia dan trombosito penia.
Bila diberikan bersama-sama dengan obat mielotoksik yang potent, terutama
methotrexate, akan menyebabkan terjadinya sitopenia.
- Kardiovaskuler: edema, peningkatan tekanan darah, palpitasi, muka
kemerahan.
- Pernafasan : jarang terjadi timbulnya asma akut setelah pemberian aspirin atau
obat-obat NSAI lainnya termasuk meloxicam. Sistem susunan saraf pusat :
kepala terasa ringan, pusing, vertigo, tinitus, ngantuk.
PERINGATAN DAN PERHATIAN :

- Seperti pada umumnya obat-obat NSAI lainnya, diperlukan pengawasan untuk


pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien
yang sedang diterapi dengan antikoagulan. Pemberian meloxicam harus
dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. Bila
pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan
untuk penghentian pemberian meloxicam.
- Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat
berperan dalam menunjang perfusi ginjal. Pada pasien yang volume & aliran
darah ke ginjal menurun, pemberian NSAI dapat menyebabkan gagal ginjal dan
akan mengalami penyembuhan bila dihentikan pemberian NSAI. Pasien yang
beresiko tinggi adalah pasien yang dehidrasi, pasien dengan gagal jantung
kongestif, sirosis hati, sindrom nefrotik dan penyakit ginjal, juga pasien yang
mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung
terjadi hipovolemia. Pada pasien tersebut, volume diuresis dan fungsi ginjal
harus dimonitor secara hati-hati pada permulaan terapi.
- NSAI jarang menimbulkan nefritis interstitial, glomerulonefritis, nekrosis
medularis ginjal, sindrom nefrotik. Untuk penderita gangguan fungsi ginjal
stadium terakhir (dengan dialisa), dosis meloxicam tidak boleh melebihi 7,5
mg/hari. Pada pasien yang mengalami gangguan ginjal ringan atau sedang
(yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak
diperlukan penurunan dosis.
- Seperti hal obat-obat NSAI, penggunaan pada pasien yang lemah dan orang tua
harus hati-hati karena toleransi terhadap efek samping telah berkurang, dan
pada umumnya orang tua menderita gangguan fungsi ginjal, hati atau jantung.
- Seperti pada obat-obat NSAI, telah dilaporkan kadang terjadi peningkatan
serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal
dan bersifat sementara. Bila kondisi ini dalam waktu lama, pemberian Artrilox
harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut.
- Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo,
dianjurkan untuk menghentikan aktivitas.
- Penggunaan pada pasien yang lemah harus disertai pengawasan karena
toleransi terhadap efek samping meloxicam berkurang.
- Seperti halnya obat-obat NSAI lainnya, penggunaan pada orang lanjut usia
harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi
ginjal, hati ataupun jantung.
INTERAKSI OBAT :

- Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat
meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja
sinergis.
- Pemberian bersama ticlopidine (anti-koagulan oral), heparin secara sistemik,
trombolitik dapat meningkatkan resiko pendarahan. Bila pemberian bersama
obat anti koagulan tidak dapat dihindari, maka harus dimonitor efek
antikoagulan.
- Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium.
Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir
pengobatan dengan meloxicam.
- Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas
hematologi methotrexate, dianjurkan untuk memonitor jumlah sel darah.
- Kontrasepsi : menurunkan efektivitas alat KB IUD.
- Pada pasien yang dehidrasi, pengobatan dengan NSAI dapat menyebabkan
insufisiensi ginjal akut. Pada pasien yang diberikan meloxicam dan diuretik
bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada
awal terapi.
- Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker, ACE
inhibitor, vasodilator, diuretik) akan menyebabkan efek anti hipertensi turun
karena obat NSAI akan menghambat prostaglandin yang mempunyai efek
vasodilatasi.
- Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal, sehingga
akan mempercepat eliminasi meloxicam.
- Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas, sehingga
perlu dimonitor fungsi ginjal, karena obat NSAI dapat meningkatkan
nefrotoksisitas melalui efek prostaglandin di ginjal.
DOSIS DAN CARA PEMBERIAN :
Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari.
Artritis reumatoid :15 mg/hari.
Dosis terapeutik dapat dikurangi sampai 7,5 mg/hari tergantung respon klinis.
Osteoartritis:7,5 mg/hari. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. Pasien
yang mempunyai resiko meningkatnya efek samping :
dosis awal 7,5 mg per hari. Pasien dialisa dengan gagal ginjal berat:
dosis tidak boleh melebihi 7,5 mg per hari.
Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk
anak-anak. Tablet harus ditelan dengan air/minuman pada waktu makan.
Over Dosis :
Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan
penunjang lainnya karena belum diketahui antidotnya. Kerusakan pada
gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2.
KEMASAN :
Artrilox 7,5 mg Tablet Box, 2 Strip @ 10 Tablet
No.Reg.DKL9904125810A1
Artrilox 15 mg Tablet Box, 2 Strip @ 10 Tablet
No.Reg.DKL9904125810B1
SIMPAN DITEMPAT KERING DAN AMAN,
JAUHKAN DARI JANGKAUAN ANAK-ANAK
HARUS DENGAN RESEPDOKTER
Diproduksi oleh:
COMBIPHAR
BANDUNG-INDONESIA

http://www.farmasiku.com
Artrilox 7.5

CODE: C7
Harga Per Satuan Terkecil : Rp4,700.00
BELI
Artrilox®
Meloxicam

KOMPOSISI :

Setiap tablet Artrilox 7,5 mg mengandung Meloxicam 7,5 mg Setiap tablet Artrilox 15 mg
mengandung Meloxicam 15mg.

CARA KERJA OBAT :

Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam
enolat. Mekanisme kerja meloxicam sebagai efek anti-inflamasi, analgesik, dan
antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi
sebagai mediator peradangan. Proses penghambatan oleh meloxicam lebih selektif
pada COX2 daripada COX1. Penghambatan COX2 menentukan efek terapi NSAI,
sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal.

INDIKASI :

- Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut.


- Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik).

KONTRA INDIKASI :

- Ulkus lambung yang aktif.


- Pendarahan gastrointestinal, pendarahan pembuluh darah otak atau penyakit
pendarahan lainnya.
- Insufisiensi hepar yang berat.
- Insufisiensi ginjal berat yang tidak didialisa.
- Dikontraindikasikan pada pasien yang menunjukkan gejala asthma, polip
dihidung, angio-edema atau urtikaria bila diberikan asam asetilsalisilat
atau obat NSAI lainnya.
- Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). x Anak-
anak dan remaja yang berumur kurang dari 15 tahun.
- Masa kehamilan dan menyusui.

EFEK SAMPING :

- Saluran cerna : dispepsia, rasa mual, muntah-muntah, rasa sakit di perut,


konstipasi, rasa kembung, diare, bersendawa, esofagitis, ulkus gastro-
duodenal, pendarahan gastro-intestinal makroskopik, jarang terjadi kolitis.
- Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan
kadartransaminase dan btlirubin.
- Fungsi ginjal menjadi abnormal dengan peningkatan kadar serum kreatinin
dan/atau serum urea.
- Pada kulit : pruritus, ruam kulit, stomatitis, urtikaria, jarang terjadi
fotosensitisasi.
- Anemia, gangguan jumlah sel darah : lekosit, lekopenia dan trombosito penia.
Bila diberikan bersama-sama dengan obat mielotoksik yang potent, terutama
methotrexate, akan menyebabkan terjadinya sitopenia.
- Kardiovaskuler : edema, peningkatan tekanan darah, palpitasi, muka
kemerahan.
- Pernafasan:jarang terjadi timbulnya asma akut setelah pemberian aspirin atau
obat-obat NSAI lainnya termasuk meloxicam. Sistem susunan saraf pusat :
kepala terasa ringan, pusing, vertigo, tinitus, ngantuk.

PERINGATAN DAN PERHATIAN :

- Seperti pada umumnya obat-obat NSAI lainnya, diperlukan pengawasan untuk


pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien
yang sedang diterapi dengan antikoagulan. Pemberian meloxicam harus
dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. Bila
pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan
untuk penghentian pemberian meloxicam.
- Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat
berperan dalam menunjang perfusi ginjal. Pada pasien yang volume & aliran
darah ke ginjal menurun, pemberian NSAI dapat menyebabkan gagal ginjal dan
akan mengalami penyembuhan bila dihentikan pemberian NSAI. Pasien yang
beresiko tinggi adalah pasien yang dehidrasi, pasien dengan gagal jantung
kongestif, sirosis hati, sindrom nefrotik dan penyakit ginjal, juga pasien yang
mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung
terjadi hipovolemia. Pada pasien tersebut, volume diuresis dan fungsi ginjal
harus dimonitor secara hati-hati pada permulaan terapi.
- NSAI jarang menimbulkan nefritis interstitial, glomerulonefritis, nekrosis
medularis ginjal, sindrom nefrotik.
Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa), dosis
meloxicam tidak boleh melebihi 7,5 mg/hari.
Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien
dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan
penurunan dosis.
- Seperti hal obat-obat NSAI, penggunaan pada pasien yang lemah dan orang tua
harus hati-hati karena toleransi terhadap efek samping telah berkurang, dan
pada umumnya orang tua menderita gangguan fungsi ginjal, hati atau jantung.
- Seperti pada obat-obat NSAI, telah dilaporkan kadang terjadi peningkatan
serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal
dan bersifat sementara. Bila kondisi ini dalam waktu lama, pemberian Artrilox
harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut.
- Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo,
dianjurkan untuk menghentikan aktivitas.
- Penggunaan pada pasien yang lemah harus disertai pengawasan karena
toleransi terhadap efek samping meloxicam berkurang.
- Seperti halnya obat-obat NSAI lainnya, penggunaan pada orang lanjut usia
harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi
ginjal, hati ataupun jantung.
INTERAKSI OBAT :

- Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat
meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja
sinergis.
- Pemberian bersama ticlopidine (anti-koagulan oral), heparin secara sistemik,
trombolitik dapat meningkatkan resiko pendarahan. Bila pemberian bersama
obat anti koagulan tidak dapat dihindari, maka harus dimonitor efek
antikoagulan.
- Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium.
Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir
pengobatan dengan meloxicam.
- Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas
hematologi methotrexate, dianjurkan untuk memonitor jumlah sel darah.
- Kontrasepsi : menurunkan efektivitas alat KB IUD.
- Pada pasien yang dehidrasi, pengobatan dengan NSAI dapat menyebabkan
insufisiensi ginjal akut. Pada pasien yang diberikan meloxicam dan diuretik
bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada
awal terapi.
- Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker, ACE
inhibitor, vasodilator, diuretik) akan menyebabkan efek anti hipertensi turun
karena obat NSAI akan menghambat prostaglandin yang mempunyai efek
vasodilatasi.
- Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal, sehingga
akan mempercepat eliminasi meloxicam.
- Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas, sehingga
perlu dimonitor fungsi ginjal, karena obat NSAI dapat meningkatkan
nefrotoksisitas melalui efek prostaglandin di ginjal.

DOSIS DAN CARA PEMBERIAN :

Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari.


Artritis reumatoid :15 mg/hari.

Dosis terapeutik dapat dikurangi sampai 7,5 mg/hari tergantung respon klinis.

Osteoartritis:7,5 mg/hari. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. Pasien


yang mempunyai resiko meningkatnya efek samping :

dosis awal 7,5 mg per hari. Pasien dialisa dengan gagal ginjal berat:

dosis tidak boleh melebihi 7,5 mg per hari. Pemberian Artrilox hanya untuk orang
dewasa karena belum ada penelitian dosis untuk anak-anak. Tablet harus ditelan
dengan air/minuman pada waktu makan.
Over Dosis :

Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan
penunjang lainnya karena belum diketahui antidotnya. Kerusakan pada
gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2.

KEMASAN :

Artrilox 7,5 mg Tablet Box, 2 Strip @ 10 Tablet


No.Reg.DKL9904125810A1

Artrilox 15 mg Tablet Box, 2 Strip @ 10 Tablet


No.Reg.DKL9904125810B1

SIMPAN DITEMPAT KERING DAN AMAN,


JAUHKAN DARI JANGKAUAN ANAK-ANAK

HARUS DENGAN RESEP DOKTER

Di produksi oleh:

COMBIPHAR
BANDUNG-INDONESIA
Asam Mefenamat

Kapsul 250 mg.

Kaplet 500 mg.

KOMPOSISI :
- Tiap kapsui mengandung 250 mg Asam mefenamat
- "Flap kaplet 500 mg salut selaput mengandung 500 mg Asam mefenamat.

POSOLOGI :

Dewasa dan anak diatas 14 tahun


Dosis awal dianjurkan 500 mg kemudian dilanjutkan250 mg tiap jam sesudah makan.

INDIKASI :
Untuk menghitangkan segala macam nyeri dan ringan sampai sedang dalam kondisi
akut dan kronis. termasuk nyeri karena trauma, nyeri sendi, nyeri otot, sakit sehabis
operasi dan melahirkan, nyeri sewaktu haid. sakit kepala dan sakit gigi.

KONTRA INDIKASI :

Pada penderita dengati tukak lambung / usus. pendenta asma.penderita ginjal dan
penderita yang
hipersensitif.

EFEK SAMPING :

Umumnya Asam Mefenamat dapat dibenkan dengan baik pada dosis yang dianjurkan,
Pada beberapa kasus pernah dilaporkan terjadinya rasa mual, muntah, diare, pada
penggunaan jangka panjang yang terus menerus dengan dosis 2000 mg atau lebih
sehan dapat mengakibatkan agranulositosis dan hemolitik anemia.

PERINGATAN DAN PERHATIAN :

Jangan dibenkan pada penderita bronkospasme aliergik rhinitis, urticaria atau mendapat
obat non steroid anti-inflamasi yang lain karena kemungkinan terjadi sensitiyitas silang
Jangan digunakan pada wanita hamil dan menyusui. Keamanan penggunaan pada
anak-anak dibawah umur 14 tahun belum diketahui dengan pasti. Jangan digunakan
lebih dan dosis yang dianjurkan atau lebih dari 7 hari kecuali atas petunjuk dokter.

KEMASAN :
- Kapsul 250mg : Dus 10 strip® 10 Kapsui ; No. Reg : GKL9930011201 A1
- Kaplet 500 mg : Dus 10 strip® 10 Kaplet ; No Reg GKL 9830010709 A1

CARA PENYIMPANAN :

Simpan ditempat kering dansejuk, terhindar dari cahaya.


Harus dengan resep dokter.

P.T. PHYTO KEMO AGUNG FARM A


Jakarta - Indonesia
Asimat

CODE: C10
Harga Per Satuan Terkecil : Rp800.00
BELI
ASIMAT 500
KOMPOSISI :

Tiap kaplet salut selaput ASIMAT500 mengandung Mefenamic Acid 500 mg

CARA KERJA :

Mefenamic Acid adalah suatu analgetik yang mempunyai daya anti-inflamasi.

INDIKASI :

Untuk mengurangi nyeri dari ringan sampai sedang dalam kondisi akut dan kronis,
termasuk nyeri karena trauma, nyeri otot, sakit sehabis melahirkan, nyeri sewaktu haid,
sakit kepala dan sakit gigi.

POSOLOGI / DOSIS :

Dewasa dan anak-anak > 14 tahun : Dosis oral yang dianjurkan 500 mg kemudian
dilanjutkan 250 mg setiap 6 jam jika diperiukan.

KONTRA INDIKASI :

Pada penderita dengan tukak lambung / usus, penderita asma, penderita ginjal dan
penderita yang hipersensitif terhadap Mefenamic Acid.

EFEK SAMPING :

Efek samping yang timbul umumnya dapat ditolerir dengan baik pada dosis yang
dianjurkan. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual, muntah dan
diare, pusing, perdarahan lambung. Agranulositosis dan hemolitik anemia mungkin
dapat terjadi pada penggunaan dalam jangka waktu lama yang terus menerus dengan
dosis 2000 mg atau lebih sehari.
PERINGATAN DAN PERHATIAN :
- Jangan diberikan pada penderita bronkospasma, allergic rhinitis, urticaria atau
mendapat obat nonsteroid anti-inflamasi yang lain karena kemungkinan terjadi
sensitivitas silang.
- Jangan digunakan lebih dari dosis yang dianjurkan atau lebih dari 7 hah kecuali
atas petunjukdokter.
- Jangan digunakan pada wanita hamil dan menyusui.
- Keamanan pengguhaan pada anak-anak di bawah 14 tahun belum diketahui
dengan pasti.

INTERAKSI OBAT :

Antikoagulan oral.

CARA PENYIMPANAN :

Simpan di tempat sejuk dan kering, terlindung dari cahaya matahari.


Jauhkan obat dari jangkauan anak-anak.

PENGEMASAN DAN NOMOR REGISTRASI

Box, 10 strip @ 10 kaplet salut selaput ASIMAT 500, No. Reg. DKL9833300909A1

HARUS DENGAN RESEP DOKTER

Diproduksi oleh :

PT. MERSIFARMATM Sukabumi - Indonesia


BlI-24/02/05
AULIN TABLET 100 MG

Harga Per Satuan Terkecil : Rp4,550.00


BELI
AULIN TABLET 100 MG

KOMPOSISI :

Tiap tablet mengandung Nimesulide 100 mg

URAIAN :
4-NITRO-2-phenoxymethane sulponanilide

INDIKASI :

Aulin merupakan suatu obat anti inflamasi non steroid untuk berbagai kondisi yang
membutuhkan anti inflamasi, analgesika, antipiretika seperti osteoarthritis penyakit
rematikekstra-artikular, rasa nyeri dan inflamasi setelah intervensi bedah dan setelah
trauma akut dan dismenoria.

DOSIS & CARA PEMAKAIAN :

- Orang dewasa 1 tablet 2xsehari setelah makan (1 tablet 100 mg)


- Aulin tidak dianjurkan digunakan pada anak-anak dibawah 12 tahun

KONTRA INDIKASI :

- Pasien yang diketahui hipersensitif terhadap Nimesulide


- Pasien dengan riwayat reaksi hipersensitif (seperti bronkospasme,rhinitis, urticaria)
terhadap OAINS dan acetosal
- Pasien dengan tukak lambung atau usus,ulserasi berulang, atau pendarahan
gastrointetinal, pendarahan serebrovaskular, atau pendarahan aktif lainnya atau
gangguan pendarahan
- Pasien dengan gangguan koagulasi berat
- Pasien dengan kelainan fungsi ginjal berat (CCT <30 ml/menit)
- Pasien dengan insufisiensi hepar sedang atau berat
- Penggunaan pada anak-anak

KEMASAN & NO REG. ;

Setiap box berisi 2 blister @ 10 tablet 100 mg Nimesulide, DKI 0051900210A1

PABRIK :

Helsinn Birex Pharmaceuticals

HARUS DENGAN RESEP DOKTER


Benostan 500

Harga Per Satuan Terkecil : Rp1,250.00


BELI

BENOSTAN tab

KOMPOSISI

Mefenamic acid/Asam mefenamat


INDIKASI

Nyeri, migren, demam.

KONTRA INDIKASI

Ulkus peptikum atau ulserasi usus, penyakit radang usus besar, kerusakan hati atau
ginjal.

PERHATIAN

Kehamilan, dehidrasi, asma, epilepsi.

Interaksi obat : antikoagulan oral.

EFEK SAMPING

Gangguan & perdarahan saluran pencernaan, ulkus peptikum, sakit kepala, mengantuk,
pusing, gugup,gangguan penglihatan, ruam kulit, diskrasia darah, penyakit ginjal.

INDEKS KEAMANAN PADA WANITA HAMIL

Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau
embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau
penelitian pada wanita dan hewan belum tersedia. Obat seharusnya diberikan bila
hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin.

KEMASAN

Tablet 500 mg 10stp

DOSIS
• Dewasa : 3 kali sehari 250 -500 mg.
Anak berusia 6 bulan atau 6,5 mg/kg berat badan/hari dalam 3-4 dosis
• :
lebih terbagi.
Dismenore (nyeri saat
• : 3 kali sehari 500 mg.
haid), nyeri rematik

PENYAJIAN

Dikonsumsi bersamaan dengan makanan


PABRIK
Bernofarm.
Bimastan

CODE: C11
Harga Per Satuan Terkecil : Rp200.00
BELI
BIMASTAN©

KOMPOSISI :
- Tiap kapsul mengandung: MefenamicAcid 250 mg.
- Tiap kaptab salut selaput mengandung: MefenamicAcid 500 mg.
- Tiap kaptab mengandung:
- MefenamicAcid 500 mg.

CARA KERJA OBAT :

Bimastan merupakan kelompok anti inflamasi non steroid, bekerja dengan cara
menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym
siklooksigenase sehingga mempunyai efek analgesik, anti infiamasi dan antipiretik.

INDIKASI :

Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala, sakit gigi,
dismenore primer, termasuk nyeri karena trauma, nyeri otot dan nyeri sesudahoperasi.

KONTRA INDIKASI :

Pasien yang hipersensitif terhadap Mefenamie Acid.


- Penderita yang dengan Asetosal mengalami bronkospasme, alergi rhinitis
dan urtikaria.
- Penderita dengan tukak lambung dan usus.
- Penderita dengan gangguan ginjal yang berat.

TAKARAN PEMAKAIAN :

Dewasa dan anak-anak > 14 tahun:


Dosis awai: 500 mg, kemudian dianjurkan 250 mg tiap
6 jam sesuai dengan kebutuhan.

EFEK SAMPING :
- Sistem pencernaan : mual, muntah, diare dan rasa sakit pada abdominal.
- Sistem hematopetik : leukopenia, eosinophilia, trombocytopenia dan
agranulocytopenia.
- Sistem saraf : rasa mengantuk, pusing, penglihatan kabur dan insomnia.

PERINGATAN DAN PERHATIAN :


- Sebaiknya diminum sesudah makan.
- Hati-hati digunakan pada wanita hamil dan menyusui.
- Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui
dengan pasti.

KONTRA INDIKASI :

Penggunaan bersama antikoagulan oral dapat memperpanjang "Prothrombin".

OVER DOSIS :

Jika terjadi over dosis maka pasien harus dirangsang muntah atau pasien diberi arang
aktif (karbon absorben) untuk menyerap obat.

KEMASAN :
Dus isi 10strip® "10 kapsul 250mg
No. Reg. DKL 8931402001 A1
Dus isi 10 strip @ 10 kaptab 500 mg
No. Reg. DKL 8931402104 A1
Dus isi 50 blister @ 10 250 mg
kapsul
No. Reg. DKL 8931402001 A1
Dus isi 40 blister @ 10 kaptab salut selaput 500 mg
No. Reg. DKL 9731407209 A1
Dus isi 10 blister @ 10 kaptab salut selaput 500 mg
No. Reg. DKL 0431407209 A1
Botol isi 1.000 kapsul 250 mg
No. Reg. DKL 8931402001 A1

SIMPAN DITEMPAT SEJUK (15 - 25)°C DAN KERINGTERLINDUNG DARI CAHAYA

HARUS DENGAN RESEP DOKTER

PT. BIMA MITRA FARMA


TANGERANG - INDONESIA
Bio mega

CODE: C12
Harga Per Satuan Terkecil : Rp300.00
BELI
BIO MEGA

KOMPOSISI :
Tiap tablet salut selaput mengandung :
Metampiro 500 mg
Vitamin B1 50 mg
Vitamin B6 50 mg
Vitamin B12 100 mcg

INDIKASI :

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama
pada keadaan rasa sakit yang berat.

KONTRA INDIKASI :

* Penderita hipersensitif
* Bayi di bawah 3 bulan, atau dengan berat badan di bawah 5 kg
* Wanita hamil dan menyusui
* Penderita dengan tekanan darah sistolik 100 mmHg

EFEK SAMPING :

Agranulositosis, reaksi kepekaan, mengantukdan pusing."

PERINGATAN DAN PERHATIAN :


- Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk
mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu, lengan.
- Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka
sebaiknya tidak digunakan dalam jangka panjang terusmenerus.
- Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah
/ kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu dilakukan
pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari
penggunaan untuk mengatasi rasa sakit akut.

INTERAKSI OBAT :

Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan


hipotermia serius.
DOSIS :

Dewasa: Sehari 3 kali 1 tablet salut selaput.

KEMASAN :

Dus, isi 10 strip @ 10 tablet salut selaput NO. REG. DKL9631106809 A1

Simpan di tempat yang sejuk dan kering

HARUS DENGAN RESEP DOKTER

PT. GRAHA FARMA


SOLO - INDONESIA
Biomega 10 Kaplet

Harga Per Satuan Terkecil : Rp300.00


BELI
Biomega

KOMPOSISI :

Tiap tablet salut selaput mengandung :

Metampiron
Vitamin B1
Vitamin B6
Vitamin B12

INDIKASI :

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada
keadaan rasa sakit yang berat.

KONTRA INDIKASI :
- Penderita hipersensitif
- Bayi dibawah 3bulan,atau dengan berat badan dibawah 5kg
- Wanita hamil dan menyusui
- Penderita dengan tekanan darah sistolik 100 mmHg

EFEK SAMPING :

Agranulositosis, reaksi kepekaan, mengantuk dan pusing.

PERINGATAN DAN PERHATIAN :


- Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk
mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu, lengan.
- Hati-hati pada penderita yang pernah mengalami gangguan pembentukan
darah / kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu
dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih
lama dari penggunaan untuk mengatasi rasa sakit akut.

INTERAKSI OBAT :

Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan


hipotermia serius.

DOSIS :

Dewasa: Sehari 3 kali 1 tablet salut selaput.

KEMASAN :

Dus, isi 10 strip @ 10 tablet salut selaput


NO. REG. DKL 9631106809 A1

Simpan di tempat yang sejuk dan kering

HARUS DENGAN RESEP DOKTER

PT. GRAHA PARMA


SOLO - INDONESIA
Biropyron

Harga Per Satuan Terkecil : Rp300.00


BELI
BIROPYRON
Kaplet Salut Selaput
KOMPOSISI:
Tiap kaplet salut selaput mengandung:
Methampyrone 500 mg
Thiamine HCl 50 mg
Pyridoxine HCl 100 mg
Cyanocobalamine 100 mcg

INDIKASI:
Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia.

KONTRA INDIKASI:
- Penderita hipersensitif
- Wanita hamil dan menyusui
- Penderita dengan tekanan darah sistolik < 100 mm Hg

EFEKSAMPING:
Reaksi hipersensitif pada kulit, misalnya kemerahan dan agranulositosis.

DOSIS: ,
1 kaplet 3x sehari

PERINGATAN DAN PERHATIAN:


- Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati
rematik, lumbago, sakit punggung, bursitis, sindroma bahu lengan.
- Karena dapat menimbulkan agranulositosis dan berakibat fatal, maka sebaiknya tidak
digunakan dalam waktu panjang dan terus menerus.
- Hati- hati pada penderita yang pernah mengalami gangguan pembentukan darah /
kelainan darah, gangguan fungsi hati, ginjal, karena itu perlu dilakukan pemeriksaan uji
fungsi hati atau ginjal dan darah pada penggunaan yang lebih lama dari penggunaan
untuk mengatasi rasa sakit akut.
- Pada pemakaian jangka lama dapat timbul sindrom neuropathy yang akan berangsur
hilang bila pengobatan dihentikan.

KEMASAN:
Dus isi 10 Strip® 10 Kaplet
No. Reg. DKL0231406809 A2
Botol isi 1.000 kaplet
No. Reg. DKL0231406809 A1

SIMPAN DITEMPAT SEJUK (15-25)°C DAN KERING TERLINDUNG DARI CAHAYA

HARUS DENGAN RESEP DOKTER

PT. BIMA MITRA FARMA


TANGERANG - INDONESIA
Bodrex

CODE: C13
Harga Per Satuan Terkecil : Rp5,500.00
BELI
BODREX
Meringankan SAKIT KEPALA, SAKIT' GIGI dan menurunkan DEMAM

KOMPOSISI :

Tiap tablet lapis dua mengandung :


Parasetamol 600 mg
Kofein 50 mg

CARA KERJA OBAT :

bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan


sakit kepala, sakit gigi. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan
demam.

INDIKASI :

Meringankan SAKIT KEPALA, SAKIT GIGI dan menurunkan DEMAM.

DOSIS YANG DIANJURKAN :


• Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari
• Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari
• Atau sesuai petunjuk dokter.

KONTRAINDIKASI :
• Penderita gangguan fungsi hati yang berat.
• Penderita Hipersensitif.

EFEK SAMPING :
• Dosis besardanjangka lama menyebabkan kerusakan fungsi hati.
• Reaksi hipersensitifitas.

PERINGATAN DAN PERHATIAN :


• Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak
berkurang, segera hubungi dokter/unit pelayanan kesehatan terdekat.
• Penggunaan obat ini pada penderita yang mengkonsumsi alkohol, dapat
meningkatkan resiko kerusakan fungsi hati.
• Hati-hati penggunaan obat ini pada penderita penyakit ginjal.
SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C)

KEMASAN :

Kotak berisi 2 blister @ 10 tablet


Reg. No. DBL 8522700810 A1

Dibuat oleh

P.T. TEMPO SCAN PACIFIC Tbk, Bekasi-lndonesia atas lisensi dari DR. FRITZ BODE
GmbH/ CHEM. PHARM. FABRIK / Rheinfelden / Germany
P91108000
Bodrex Extra

CODE: C111
Harga Per Satuan Terkecil : Rp3,700.00
BELI
BODREX EXTRA

KOMPOSISI

tiap tablet mengandung :

paracetamol.....................350 mg
ibuprofen.........................200 mg
caffeine...........................50 mg

CARA KERJA OBAT

paracetamol merupakan analgetik-antipiretik dan ibuprofen merupakan obat


golongan analgetik-antipiretik dan anti inflamasi non steroid (AINS) yang
memiliki efek analgetik(menghilangkan rasa nyeri),antipiretik(demam) dan
anti inflamasi(mengurangi proses peradangan).efek analgesik dari paracetamol
dan ibuprofen bejerja sinergis dengan caffeine dalam meredakan sakit kepala

INDIKASI
meredakan sakit kepala

DOSIS dan ATURAN PAKAI

dewasa dan anak-anak >12 tahun : 1-2 kaplet, 3-4 kali sehari
anak-anak 6-12 tahun : 1/2-1 kaplet, 3-4 kali sehari

EFEK SAMPING

gangguan saluran cerna seperti mual,muntah,nyeri ulu hati,kemerahan pada


kulit dan gangguan darah

INTERAKSI OBAT

efek toksik dari paracetamol dapat meningkat pada pemberian bersam-sama


dengan obat yang menyebabkan kerusakan hati

SIMPAN PADA SUHU DI BAWAH 30'C

Reg.No.DTL0622719204A1

PT.Tempo Scan Pacific Tbk.


Bekasi-Indonesia
Bodrex Flu batuk

CODE: C14
Harga Per Satuan Terkecil : Rp1,200.00
BELI
BODREX

Meringankan SAKIT KEPALA, SAKIT' GIGI dan menurunkan DEMAM

KOMPOSISI :

Tiap tablet lapis dua mengandung :


Parasetamol 600 mg
Kofein 50 mg

CARA KERJA OBAT :

bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan


sakit kepala, sakit gigi. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan
demam.

INDIKASI :

Meringankan SAKIT KEPALA, SAKIT GIGI dan menurunkan DEMAM.

DOSIS YANG DIANJURKAN :


• Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari
• Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari
• Atau sesuai petunjuk dokter.

KONTRAINDIKASI :
• Penderita gangguan fungsi hati yang berat.
• Penderita Hipersensitif.

EFEK SAMPING :
• Dosis besardanjangka lama menyebabkan kerusakan fungsi hati.
• Reaksi hipersensitifitas.

PERINGATAN DAN PERHATIAN :


• Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak
berkurang, segera hubungi dokter/unit pelayanan kesehatan terdekat.
• Penggunaan obat ini pada penderita yang mengkonsumsi alkohol, dapat
meningkatkan resiko kerusakan fungsi hati.
• Hati-hati penggunaan obat ini pada penderita penyakit ginjal.

SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C)

KEMASAN :

Kotak berisi 2 blister @ 10 tablet Reg. No. DBL 8522700810 A1

Dibuat oleh
P.T. TEMPO SCAN PACIFIC Tbk, Bekasi-lndonesia atas lisensi dari DR. FRITZ BODE
GmbH/ CHEM. PHARM. FABRIK / Rheinfelden / Germany
P91108000

Bodrex migra

CODE: C15
Harga Per Satuan Terkecil : Rp1,300.00
BELI
BODREX

Meringankan SAKIT KEPALA, SAKIT' GIGI dan menurunkan DEMAM

KOMPOSISI :
Tiap tablet lapis dua mengandung :
Parasetamol 600 mg
Kofein 50 mg

CARA KERJA OBAT :

bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan


sakit kepala, sakit gigi. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan
demam.

INDIKASI :

Meringankan SAKIT KEPALA, SAKIT GIGI dan menurunkan DEMAM.

DOSIS YANG DIANJURKAN :


• Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari
• Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari
• Atau sesuai petunjuk dokter.

KONTRAINDIKASI :
• Penderita gangguan fungsi hati yang berat.
• Penderita Hipersensitif.

EFEK SAMPING :
• Dosis besardanjangka lama menyebabkan kerusakan fungsi hati.
• Reaksi hipersensitifitas.

PERINGATAN DAN PERHATIAN :


• Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak
berkurang, segera hubungi dokter/unit pelayanan kesehatan terdekat.
• Penggunaan obat ini pada penderita yang mengkonsumsi alkohol, dapat
meningkatkan resiko kerusakan fungsi hati.
• Hati-hati penggunaan obat ini pada penderita penyakit ginjal.

SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C)

KEMASAN :

Kotak berisi 2 blister @ 10 tablet Reg. No. DBL 8522700810 A1

Dibuat oleh

P.T. TEMPO SCAN PACIFIC Tbk, Bekasi-lndonesia atas lisensi dari DR. FRITZ BODE
GmbH/ CHEM. PHARM. FABRIK / Rheinfelden / Germany
P91108000
Cargesik 500 Kaplet

CODE: C111
Harga Per Satuan Terkecil : Rp250.00
BELI
Cargesik

KOMPOSISI:
Tiap kaplet mengandung
Asam Mefenamat................................................................... 500 mg
Tiap kapsul mengandung
Asam Mefenamat................................................................... 500 mg

Asam Mefenamat merupakan kelompok anti-inftamasi non steroid, bekerja dengan cara
menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym
siklooksigenase sehingga mempunyai efek analgesik, anti-inflamasi dan antipiretik.

INDIKASI
Meredam nyeri ringan sampai sedang sehubungan dengan sakit kepala, sakit gigi,
dismenore primer, termasuk nyeri karena trauma, nyeri otot dan nyeri sesudah operasi.

KONTRA INDIKASI:
- Penderita yang hipersensitif terhadap asam mefenamat.
- Penderita yang dengan aspirin mengalami bronkospasme, alergi rhinitis dan urtikaria.
- Penderita dengan tultaK lambung dan usus.
- Penderita dengan gangguan ginjal yang berat.

EFEK SAMPING :
- Sistem pencemaan : mual, muntah, diare dan rasa sakit pada abdominal.
- Sistem hematopoetik : Leukopenia, eosinophilia, trombocytopenia dan
agranulocytopenia.
- Sistem saraf: rasa mengantuk, pusing, penglihatan kabur dan insomnia.

PERINGATAN DAN PERHATIAN :


- Sebaiknya diminum sesudah makan.
- Hati-hati jika digunakan pada wanita hamil dan menyusui,
- Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahul dengan
pasti.

INTERAKSI OBAT :
Penggunaan bersamaan antikoagulan oral dapat memperpanjang "prothrombln*.

OVERDOSIS:
Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang
aktlf (karbo adsorben) untuk menyerap obat.

DOSIS:
Secara umum-dapat digunakan dosis pemakaian sebagai berikut:
Dewasa dan anak-anak > 14 tahun :
Dosis awal: 500 mg, kemudian dianjurion 250 mg tiap 6 jam sesuai dengan kebutuhan.
Atau menurut petunjuk dokter. Pemakaian sebaiknya sesudah makan.

KEMASAN & No. Reg.


- Botol plastik @ 500 kapsul
No. Reg. : DKL 9123401701 Al
- Dus, isl 10 strip @ 10 kaplet
No. Reg.: DKL 9323402504 Al
- Dus, isi 10 blister @ 10 kaplet
No. Reg.: DKL 9323402504 A2
HARUS DENGAN RESEP DOKTER
SIMPAN PADA SUHU KAMAR (25 - 30)°C
Semarang - Indonesia
Carroll Super Pills Botol

CODE: C17
Harga Per Satuan Terkecil : Rp11,000.00
BELI
CARROLL'S SUPER PILLS

Pill ini adalah ramuan dari Prof. Dokter Carroll, USA, dengan melalui percobaan selama
bertahun - tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang
baik. Dengan ramuan yang berhasil itu, Prof. Dokter Carroll menambahkan vitamin Bl
(Thiamine Mononitrate) dan Nicotinamide, sehingga selain menyembuhkan Corroll's
Super Pills juga menambah nafsu makan, yang dapat memulihkan kembali tenaga dan
mempercepat penyembuhan.

Pill ini cocok untuk :

Sakit pinggang, encok pada pangkal paha, rheumatik atau sering buang air diwaktu
malam.

Cara pemakaian :

Dewasa :
1 pill sebelum makan, 2 kali sehari.
1 pill sebelum tidur, diminum dengan air hangat.

Keadaan yang sedikit berat boleh makan :

2 pill sebelum makan, 3 kali sehari.


2 pill sebelum tidur, diminum dengan air hangat.
Dianjurkan minum banyak air.

PERHATIAN :

Setelah menelan pill ini, warna kencing menjadi biru atau hijau. Perubahan warna ini
adalah reaksi normal, dan tidak menguatirkan.
No. Reg. D 7811980

DIPRODUKSI OLEH :

ARTOIS FARMA
TANGERANG - INDONESIA
Carroll Super Pills Sachet

CODE: C16
Harga Per Satuan Terkecil : Rp1,250.00
BELI
CARROLL'S SUPER PILLS

Pill ini adalah ramuan dari Prof. Dokter Carroll, USA, dengan melalui percobaan selama
bertahun - tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang
baik. Dengan ramuan yang berhasil itu, Prof. Dokter Carroll menambahkan vitamin Bl
(Thiamine Mononitrate) dan Nicotinamide, sehingga selain menyembuhkan Corroll's
Super Pills juga menambah nafsu makan, yang dapat memulihkan kembali tenaga dan
mempercepat penyembuhan.

Pill ini cocok untuk :

Sakit pinggang, encok pada pangkal paha, rheumatik atau sering buang air diwaktu
malam.

Cara pemakaian :

Dewasa :

1 pill sebelum makan, 2 kali sehari.


1 pill sebelum tidur, diminum dengan air hangat.
Keadaan yang sedikit berat boleh makan :

2 pill sebelum makan, 3 kali sehari.


2 pill sebelum tidur, diminum dengan air hangat.
Dianjurkan minum banyak air.

PERHATIAN :

Setelah menelan pill ini, warna kencing menjadi biru atau hijau. Perubahan warna ini
adalah reaksi normal, dan tidak menguatirkan.
No. Reg. D 7811980

DIPRODUKSI OLEH :

ARTOIS FARMA
TANGERANG - INDONESIA
CATAFLAM 25

CODE: C30
Harga Per Satuan Terkecil : Rp2,300.00
BELI
Cataflam

Kalium diklofenak 25 mg, 50 mg/tablet.

Indikasi :

pengobatan jangka pendek untuk nyeri dan inflamasi

Efek samping :

kadang-kadang nyeri epigastrium, sakit kepala, pusing atau vertigo, ruam kulit.

Dosis :

Dewasa :

awal :100-150 mg sehari.


Tidak boleh untuk anak.

Kemasan :

Dos 5x10 tablet 25 m.


CATAFLAM 50

CODE: C31
Harga Per Satuan Terkecil : Rp4,350.00
BELI
Cataflam

Kalium diklofenak 25 mg, 50 mg/tablet.

Indikasi :

pengobatan jangka pendek untuk nyeri dan inflamasi.

Efek samping :

kadang-kadang nyeri epigastrium, sakit kepala, pusing atau vertigo, ruam kulit.

Dosis:

Dewasa :

awal : 100-150 mg sehari.


Tidak boleh untuk anak.

Kemasan :

Dos 5x10 tablet 50 m.


Cataflam D 50

Harga Per Satuan Terkecil : Rp4,200.00


BELI
CATAFLAM D

KANDUNGAN :

Diclofenac / Diklofenak.

INDIKASI :

Pengobatan jangka pendek pada peradangan & nyeri sesudah operasi, keadaan
meradang setelah trauma (terpukul/terbentur/teririrs) yang disertai rasa sakit/nyeri,
osteoartritis (penyakit sendi degeneratif yang disertai dengan kelainan tulang
berdekatan), gout akut, reumatisme non artikular & sindroma nyeri pada tulang
belakang.

KONTRA INDIKASI :

Ulkus lambung atau usus.

PERHATIAN :
• Gejala/riwayat penyakit lambung-usus, penyakit Crohn.
• Gangguan fungsi hati, jantung, atau ginjal.
• Asma.
• Usia lanjut.
Dianjurkan untuk memonitor secara teratur fungsi hati & hitung darah selama

penggunaan jangka panjang.
• Hamil, menyusui.
• Porfiria.
• Kehilangan volume ekstraseluler.
• Kemampuan mengendarai & menggunakan mesin mungkin terpengaruh.

Interaksi obat :

Lithium, Metotreksat, Digoksin, Siklosporin, diuretika, antikoagulan, antidiabetes oral.

EFEK SAMPING :
• Kadang-kadang : gangguan saluran pencernaan, sakit kepala, pusing, vertigo,
ruamkulit, peningkatan serum transaminase.
• Jarang : ulkus peptikum, perdarahan lambung-usus, pankreatitis, abnormalitas fungsi
ginjal, reaksi hipersensitifitas, hepatitis.
• Kasus-kasus tertentu : gangguan perasaan atau penglihatan, eritema multiform,
diskrasia darah, purpura (keadaan yang ditandai dengan
bercak-bercak perdarahan dalam kulit atau selaput lendir), eritroderma, sindroma
Lyell, sindroma Stevens-Johnson, meningitis aseptik,
pneumonitis, gangguan sistem kardiovaskular (jantung dan pembuluh darah).

INDEKS KEAMANAN PADA WANITA HAMIL :

Baik penelitian reproduksi hewan tidak menunjukkan risiko pada janin maupun penelitian
terkendali pada wanita hamil atau hewan
coba tidak memperlihatkan efek merugikan (kecuali penurunan kesuburan) dimana tidak
ada penelitian terkendali yang mengkonfirmasi
risiko pada wanita hamil semester pertama (dan tidak ada bukti risiko pada trisemester
selanjutnya).

KEMASAN :

Tablet 50 mg x 50 biji.

DOSIS :
• Dewasa: dosis awal 2-3 tablet.
• Anak berusia lebih dari 14 tahun : 2 tablet.
Diberikan dalam 2-3 dosis terbagi.

PABRIK
Novartis.

Catanac 50mg

CODE: C18
Harga Per Satuan Terkecil : Rp2,400.00
BELI
CATANAC

KOMPOSISI :
Tablet CATANAC 25 mg
Tiap tablet salut enterik mengandung :
Kalium Diclofenac1
Tablet CATANAC 50 mg
Tiap tablet salut enterik mengandung :
Kalium Diclofenac

FARMAKOLOGI :

Kalium Diclofenac merupakan anti inflamasi yang bukan golongan steroid. Bekerja
menghambat biosintesa pros-taglandin yang merupakan faktor terbesar penyebab
inflamasi, nyeri dan demam. Selain anti inflamasi, juga menunjukkan efek analgesik
pada nyeri sedang dan berat.

INDIKASI :

Sebagai pengobatan jangka pendek untuk kondisi-kondisi akut seperti:


- Nyeri inflamasi setelah trauma, seperti terkilir.
- Nyeri dan inflamasi setelah operasi, seperti operasi gigi atau tulang. Sebagai
ajuvan pada nyeri inflamasi yang berat dari infeksi telinga, hidung atau
tenggorokan.

KONTRA INDIKASI :

Hipersensitif terhadap diclofenac. Peptic ulcer.

EFEK SAMPING :

Gangguan pada saluran pencernaan, sakit kepala, vertigo, peptic ulcer, pruritus dan
depresi. Kadang-kadang peningkatan enzim SGOT, SGPT.

PERINGATAN DAN PERHATIAN :


Penderita dengan riwayat gangguan saluran cerna, tukak lambung, gangguan fungsi
jantung dan ginjal. Pada pemakaian jangka panjang, sebaiknya dilakukan pemeriksaan
fungsi hati dan darah secara periodik. Tidak dianjurkan untuk wanita hamil dan
menyusui.

INTERAKSI OBAT :

Bila diberikan bersama produk lain yang mengandung Lithium, Methotrexate,


Cyclosporin atau Digoxin, diclo-fenac akan mempertinggi konsentrasi obat-obat tersebut
dalam plasma. Bila diberikan bersama diuretik dan B Bloker, dapat
mempengaruhi/mengurangi efek kedua obat ini. Bila diberikan bersama Neomycin,
Cholestiramin dan liquid parafin, akan berkurang absorbsinya.

TAKARAN PEMAKAIAN :

Dewasa : 100-150 mg dibagi atas 2-3 kali sehari.


Kasus ringan dan anak lebih dari 14 th : 75-100 mg dibagi atas 2-3 kali sehari.

KEMASAN :

Dus 30 tablet CATANAC 25 mg (3 strip @ 10 tablet salut


enterik)
No. Reg. DKL 9806707515A1
Dus 30 tablet CATANAC 50 mg (3 strip @ 10 tablet salut
enterik)
No. Reg. DKL 9806707515B1

HARUS DENGAN RESEP DOKTER SIMPAN Dl TEMPAT SEJUK DAN KERING

Dibuat oleh :

P.T. SOHO INDUSTRI PHARMASI


Jakarta - Indonesia Untuk:
P.T. ETHICA
Jakarta - Indonesia
CELEBREX 100

CODE: C32
Harga Per Satuan Terkecil : Rp7,950.00
BELI

Celebrex

Selekoksib 100 mg; 200mg.


Indikasi:

penobatan ostoeartritis dan artritis rematoid..

Kontra Indikasi :

Hipersensivitas, pasien penderita asma, urtikaria.

Perihal :

Dapat menyebakan intoksikasi saluran cerna, reaksi anafilaktik, jangan diberikan pada
wanita hamil karena dapat menyebabkan kelahiran prematur.

Efek samping :

Intoksikasi saluran cerna, intoksikasi kardovaskuler, intoksikasi sistem saraf periferal.

Dosis :

Osteoartritis:1x sehari 200 mg atau 2z sehari 100 mg; artritis reumatoid 2x sehari 100-
200 mg.

Kemasan :

Dos 3x10 kapsul 100 mg.


Cetalgin

Harga Per Satuan Terkecil : Rp850.00


BELI
CETALGIN-T

KOMPOSISI :

Na Metamizol 500 mg
Vitamin B1 60 mg
Vitamin B6 15 mg
Vitamin B12 15 mg
Kafein 50mg

INDIKASI :

Sakit kepala, neuralgia, sakit pinggang, rasa sakit/nyeri yang berkaitan dengan penyakit
lainnya.

KONTRA INDIKASI :

Kelainan perdarahan, porfiria.

PERHATIAN :

Hipersensitif terhadap Aspirin.

Interaksi obat :

Klorpromazin.

EFEK SAMPING :

Reaksi alergi, agranulositosis, perdarahan lambung-usus.

KEMASAN :

Kaplet 10 x 10 biji.

DOSIS

• Dewasa 3 kali sehari 1 kaplet.

• Anak berusia 8-12 tahun 1-2 kali sehari &frac12-1 kaplet.

PENYAJIAN :

Dikonsumsi bersamaan dengan makanan

PABRIK: Soho
Cetalmic 500 mg

CODE: C19
Harga Per Satuan Terkecil : Rp1,100.00
BELI
CETALMICT
KOMPOSISI :
• CETALMIC® 250 kapsul
Tiap kapsul mengandung asam mefenamat 250 mg

• CETALMIC® 500 kaplet salut selaput


Tiap kaplet mengandung asam mefenamat 500 mg

FARMAKOLOGI :

CETALMIC® mengandung asam mefenamat yang mempunyai khasiat analgesik, anti


inflamasi dan antipiretik. Sebagai analgesik, asam mefenamat merupakan satu-satunya
derivat fenamat yang memiliki daya kerja baik central maupun perifer. Asam mefenamat
cepat diabsorpsi, kadar puncak tercapai setelah 2 jam. Kira - kira 50% diekskresi dalam
urine dan 20% ditemukan dalam faeces. Asam mefenamat terikat sangat kuat pada
protein plasma, waktu paruh dalam plasma adalah 3-4 jam.

INDIKASI :

Untuk menghilangkan berbagai rasa sakit dan nyeri dari ringan sampai sedang termasuk
sakit kepala, sakit gigi, nyeri setelah operasi dan melahirkan, nyeri haid, nyeri trauma,
nyeri otot. Juga sebagai antipiretik pada keadaan demam.

KONTRA INDIKASI :

Penderita tukak lambung/usus, penderita yang hipersensitif, penderita asma, penderita


ginjal.

EFEK SAMPING :

Pada beberapa kasus pernah dilaporkan terjadinya rasa mual, muntah, diare, pusing,
perdarahan lambung, agranulasitosis, hemolotik anemia.

PERINGATAN DAN PERHATIAN :

Jangan diberikan pada penderita bronkospasma, rhinitis alergi atau mendapat obat non
steroid anti inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. Jangan
digunakan pada wanita hamil/menyusui. Keamanan pada anak-anak dibawah 14 tahun
belum diketahui dengan pasti. Jangan digunakan lebih dari 7 hari kecuali atas petunjuk
dokter.

TAKARAN PEMAKAIAN :

Dewasa dan anak di atas 14 tahun : Dosis awal 500 mg, dilanjutkan 250 mg tiap 6 jam.
Sebaiknya diberikan pada waktu makan.

KEMASAN :
• CETALMIC® 250 mg kapsul Box, 10 strip @ 10 kapsul DKL9224209401A1

• CETALMIC8 500 mg kaplet salut selaput Box, 10 strip @ 10 kaplet salut selaput
DKL 9224209509A1

HARUS DENGAN RESEP DOKTER

SIMPAN DI BAWAH SUHU 30°C TERLINDUNG DARI CAHAYA

PT SOHO INDUSTRI PHARMASI


JAKARTA-INDONESIA
Cybufen 300mg

Harga Per Satuan Terkecil : Rp5,350.00


BELI
INDICATIONS
CYBUFEN is indicated for acute and long-term use in the relief of signs and symptoms
of osteoarthritis and rheumatoid arthritis. CYBUFEN may also be used for other painful
inflammatory conditions
CONTRAINDICATIONS
CYBUFEN should not be used in patients who have exhibited hypersensitivity during
previous administration. Due to the possibility of cross sensitivity, CYBUFEN should not
be given to patients in whom aspirin or other nonsteroidal anti-inflammatory drugs have
induced an asthmatic syndrome, rhinitis, urticaria, angioedema or exacerbation of nasal
polyps. CYBUFEN is also contraindicated in patients with active peptic ulcer,
Danalgin

CODE: C20
Harga Per Satuan Terkecil : Rp1,050.00
BELI
Danalgin
Metampiron Diazepam
Komposisi :

Tiap kaplet mengandung :


Metampiron 500 mg
Diazepam 2 mg

Farmakologi :

DANALGIN bekerja sebagai anatgetik dan tranquillizer.


Metampiron bekerja sebagai analgetik, diabsorpsi dari saluran pencernaan dan
mempunyai waktu paruh 1 - 4 jam.
Diazepam dimetabolisme terutama di hati dan terikat pada reseptor di daerah spinal
cort, serebelum, sistem limbik dan korteks serebral. Mempunyai aktivitas sebagai
ansiolitik dan hipnotik. Konsentrasi plasma puncak diazepam dicapai setelah 15 - 19
menit. Waktu paruh bervariasi antara 20-70 jam, tetapi metabolit aktif yang dominan
yaitu desmetil diazepam mempunyai waktu paruh 30 -100 jam. Waktu paruh diazepam
dan desmetil diazepam biasanya meningkat pada neonatus, usia lanjut dan penderita
dengan gangguan hati yang berat.

Indikasi :

Untuk meringankan rasa sakit sedang sampai berat terutama nyeri kolik dan sakit
setelah operasi dimana dipehukan kombinasi dengan tranquillizer.
Kontra indikasi :

- Penderita hipersensitif.
- Bayi dibawah 6 buian.
- Wanita hamil dan menyusui.
- Penderita dengan tekanan darah sistolik < 100 mmHg.
- Depresi pernapasan.
- Gangguan pulmoner akut.
- Glaukoma sudut sempit.
- Keadaan psikosis akut.

Peringatan dan perhatian :

- Jangan mengemudikan kendaraan atau menjalankan mesin selama minum obat


ini.
- Ttdak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk
mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu-lengan.
- Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka
sebaiknya tidak digunakan dalam jangka panjang terus menerus.
- Hati-hati pada penderita yang pernah mengalami gangguan pembentukan
darah/ kelainan darah, gangguan fungsi hati atau ginjal.
Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada
penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut.
- Hati-hati penggunaan pada penderita depresi berat atau yang mempunyai
kecen-derungan melakukan bunuh diri.
- Obat ini dapat menyebabkan kelemahan otot dan ketergantungan secara fisik
dan psikologis.
- Hentikan pengobatan jika terjadi reaksi-reaksi paradoksikal seperti keadaan-
keadaan hipereksitasi akut, ansietas, halusinasi dan gangguan tidur.

Efek samping :
- Reaksi hipersensitivitas : reaksi pada kulit misal kemerahan.
- Mengantuk, ataksia, keleiahan.
- Agranulositosis, konstipasi, depresi, dipiopia, hipotensi, jaundice, perubahan
libido, mual, tremor, retensi urin, vertigo.

Interaksi obat:

Penggunaan bersama obat-obat depresan SSP atau alkoho! dapat meningkatkan efek
depresan.

Dosis :

Jika sakit 1 kaplet, berikutnya 1 kaplet tiap 6-8 jam, maksimum 4 kaplet sehari.
Kemasan:
Kotak berisi 10 strip x 10 kaplet. Reg. No. : DPL8804405304A1
Kotak berisi 50 strip x 10 kaplet. Reg. No. : DPL8804405304A1
Kaleng berisi 500 kaplet. Reg. No. : DPL8804405304A1
Botol berisi 75 kaplet. Reg. No. : DPL8804405304A1

Simpan pada suhu kamar (maks. 30°C).

HARUS DENGAN RESEP DOKTER

DANKOS
PT DANKOS FARMA, JAKARTA-INDONESIA
Datan forte

CODE: C21
Harga Per Satuan Terkecil : Rp1,250.00
BELI
DATAN®KapIet
ASAM MEFENAMAT
Komposisi :

Tiap kaplet DATAN mengandung 250 mg Asam Mefenamat.


Tiap kaplet DATAN forte mengandung 500 mg Asam Mefenamat.

Farmakologi :

DATAN dengan zat aktif Asam Mefenamat, mempunyai daya kerja sebagai analgetik
yang kuat dengan disertai efek anti inflamasi dan antipiretik. DATAN dapat diabsorbsi
dengan baik oleh saluran pencernaan. Kadar maksimal dalam darah akan tercapai
dalam waktu 2 jam setelah pemberian. Sekitar 50 % dari dosis yang diberikan akan
diekskresikan melalui urine dalam bentuk inetabolit terkonyugasi dalam waktu 48 jam.

Indikasi :

Menghilangkan segala macam rasa nyeri baik akut


maupun kronis,seperti : nyeri karena trauma, nyeri
sendi,nyeri otot, keseleo, nyeri sehabis operasi dan
melaliirkan, nyeri sewaktu haid, sakit kepala dan sakit
gigi.

Kontraindikasi :

Penderita tukak lambung dan usus, liipersensitif, renal


disease.

Peringatan dan perhatian :


- Efek samping adalah minimal pada dosis yang dianjurkan.
- Iritasi lambung jarang terjadi dan dapat dikiirangi dengan menelannya bersama
makanan.
- Diare dapat terjadi pada penggunaan jangka panjang yang terus menerus dengan
dosis 2.000 mg atau lebih perhari dan merupakan indikasi untuk menghentikan
pengobatan.
- Keamanan penggunaan DATAN pada wanita hamil belum diketahui.
- Keamanan pada anak di bawah usia 14 tahun belum terbukti.

EFEK SAMPING :

Pada beberapa orang dapat menyebabkan iritasi


lambung,kolik usus,diare,mual dan sakit kepala.

DOSIS :
Dewasa: Dosis awal yang dianjurkan adalah 500 mg,kemudian dilanjutkan dengan 250 -
500 mg setiap 6 jam.

Kemasan :

Kaplet DATAN : Dus berisi 10 strip @ 10 kaplet.


Reg. No. DKL8921004I04A1.
Kaplet DATAN forte: Dus berisi 10 strip @ 10 kaplet.
Reg. No. DKL8921004104B1

Penyimpanan:

Simpanlah di tempat yang sejuk (15-25 * C) dan kering.

HARUS DENGAN RESEP DOKTER

Diproduksi oleh :

PT PYRIDAM FARMATbk.
Cianjur-lndonesia
Dentacid 500

Harga Per Satuan Terkecil : Rp1,100.00


BELI

DENTACID™

Komposisi

Tiap kaplet mengandung Asam mefenamat ............. 500 mg

Cara kerja obat

Asam mefenamat merupakan kelompok antiinflamasi non steroid, bekerja dengan cara
menghambat sintesa
prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase
sehingga mempunyai efek
analgesik, antiinflamasi dan antipiretik.

Indikasi

Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala, sakit gigi,
dismenore primer,
termasuk nyeri karena trauma, nyeri ototdan nyeri sesudah operasi.

Kontraindikasi

- Pasien yang hipersensitif terhadap asam mefenamat.


- Penderita yang dengan asetosal mengalami bronkospasme, alergi rhinitis dan urtikaria.
- Penderita dengan tukak lambung dan usus.
- Penderita dengan gangguan ginjal yang berat.

Dosis

Dewasa dan anak-anak ± 14 tahun:


Dosis awal 50 mg, kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan.

Efek samping

Sistem pencernaan: mual, muntah, diare dan rasa sakit pada abdominal.
Sistem hematopoetik: leukopenia, eosinophilia, trombocytopenia dan agranulo-
cytopenia.
Sistem saraf: rasa mengantuk, pusing, penglihatan kabur dan insomnia.

Peringatan dan perhatian

- Sebaiknya diminum sesudah makan.


- Hati-hati jika digunakan pada wanita hamil dan menyusui.
- Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui dengan
pasti.

Interaksi obat

Penggunaan bersamaan dengan antikoagulan oral dapat memperpanjang


"prothrombin".

Overdosis

Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang
aktif
(karbo absorben) untuk menyerap obat.

Penyimpanan

Simpan pada suhu kamar (di bawah 30°C).


Lindungi dari cahaya.

Kemasan

Dus isi 10 strip x 10 kaplet

HARUS DENGAN RESEP DOKTER.

Reg. No.: DKL0704426004A1

Diproduksi oleh:
PT. HEXPHARM JAYA
Cipanas - Indonesia
Untuk:
PT. DANKOS FARMA
Jakarta - Indonesia

Dipasarkan oleh:
PT KALBE FARMA Tbk.
Bekasi - Indonesia
Divoltar 50mg

CODE: C22
Harga Per Satuan Terkecil : Rp1,500.00
BELI
DIVOLTAR®
Diklofenak natrium
tablet salut enterik

Komposisi :

Tiap tablet salut enterik mengandung :


Diklofenak natrium 25 mg atau 50 mg

Farmakologi :

DIVOLTAR® adalah obat antiinflamasi nonsteroid dengan struktur kimia yang baru
(suatu derivat asam asetat). Obat ini mempunyai sifat antiinflamasi, analgesik dan
antipiretik yang kuat. Seperti obat-obat antiinflamasi nonsteroid lainnya, DIVOLTAR®
merupakan penghambat prostaglandin sintetase.
Sebagai tablet salut enterik, DIVOLTAR" hancur dan melarut langsung dalam usus
halus, dimana diklofenak diabsorpsi dengan oepat. Dengan demikian, iritasi lambung
dikurangi. Diklofenak mengalami metabolisme lintasan pertama dalam hati. Kadar
puncak dalam plasma dicapai setelah 1 - 4 jam. Obat ini 99,7% terikat pada protein
plasma dan waktu paruh eliminasinya 1 - 2 jam. Diklofenakdimetabolisme hampir
sempurna dalam hati: ekskresi obat yang utuh melalui ginjal kurang dari 1%.

Indikasi :

1. Penyakit reumatik inflamatoar dan degeneratif: artritis reumatoid, termasuk bentuk


juvenil; ankilosing spondilitis; osteoartritis; dan penyakit pirai akut.
2. Kelainan muskulo-skeletal akut: periatritis, tendinitis, tenosinovitis, bursitis, salah
urat, dan dislokasi.
3. Menghilangkan/mengurangi rasa nyeri dan inflamasi nonreumatik.
Kontra indikasi :

1. Ulkus peptikum atau perdarahan saluran cerna.


2. Hipersensitivitas terhadap diklofenak.
3. Penderita asma yang mengalami serangan asma, urtikaria, atau rinitis akut bila
mendapat asetosal atau obat-obat antiinflamasi nonsteroid lainnya.

Peringatan dan perhatian :

1. Gunakan dengan hati - hati pada:

- penderita dengan gangguan saluran cerna atau dengan riwayat ulkus


peptikum.
- penderita dengan insufisiensi hati, jantung atau ginjal yang parah.
- penderita usia lanjut (lebih mudah mengalami efek samping obat-obat
antiinflamasi nonsteroid).

Penderita yang mendapat pengobatan jangka panjang dengan DIVOLTAR®,


2. seperti halnya dengan obat-obat antiiflamasi nonsteroid lainnya, harus dimonitor
sebagai tindakan berjaga-jaga (mis. fungsi ginjal, hati dan hitung darah).
DIVOLTAR® tidak boleh diberikan selama kehamilan kecuali bila mutlak
3.
diperlukan.
4. DIVOLTAR® dapat meningkatkan kadar plasma lithium atau digoksin.

Efek samping:
Pada awal pengobatan, dapat terjadi nyeri epigastrium, sendawa, nausea dan diare,
nyeri kepala atau pusing. Efek samping ini biasanya ringan. Reaksi kulir, retensi cairan
dan peningkatan serum transaminase kadang-kadang terjadi. Userasi dan perdarahan
saluran cerna, ikterus, hepatitis, gagal ginjal dan sindroma nefrotik juga terjadi. Bila ini
terjadi, DIVOLTAR® harus dihentikan. Leukopenia, trombositopenia, dan anemia
aplastik dapat juga terjadi, tetapi sangat jarang.

Dosis dan cara pemberian Dewasa :


Dosis awal 75 -150 mg sehari, dibagi dalam 2 - 3 dosis.
Untuk terapi jangka panjang, dosis biasanya 75 -100 mg sehari.
Anak 1 tahun atau lebih :1 - 3 mg/kg sehari, dibagi dalam 2 - 3 dosis.
Tablet harus ditelan seluruhnya sewaktu makan atau setelah makan.

Kemasan :
Tablet 25 mg : Tablet 50 mg :
Dosisi 5 strip x 10 tablet salut enterik.
Reg. No. DKL8811606917A1
Dos isi 5 strip x 10 tablet salut enterik.
Reg. No. DKL8811606917B1

PT KALBE FARMA Tbk.


Bekasi - Indonesia
Lindungi dari cahaya.
Simpan pada suhu kamar (di bawah 30°C).
HARUS DENGAN RESEP DOKTER.
Dofen Forte 400mg

CODE: 121
Harga Per Satuan Terkecil : Rp400.00
BELI
DOFEN® 200
DOFEN® FORTE
Tablet salut selaput

DOFEN adalah tablet bersalut selaput (film coat) yang mempunyai khasiat sebagai
analgetika-antipiretika dan antiinflamasi.

Komposisi:
DOFEN® 200
Tiap tablet salut selaput mengandung: Ibuprofen 200 mg
DOFEN® FORTE
Tiap tablet salut selaput mengandung: Ibuprofen 400 mg

Indikasi:

Reumatik artritis, osteoartritis dan gout artritis.


Rasa nyeri ringan sampai sedang dan rasa nyeri pada waktu haid.

Kontra indikasi:

Jangan diberikan kepada penderita yang hipersensitif terhadap ibuprofen atau penderita
dengan sindroma polip hidung, angiodema, serta reaktivitas bronkospastik terhadap
asam asetilsalisilat atau antiinflamasi non steroid lainnya.

Dosis :
Dewasa : 0,9 - 2,4 gram sehari, dibagi dalam beberapa dosis. Dosis penunjang
0,6 - 1,2 gram sehari.
Anak-anak : 20 mg/kg bobot badan sehari, dibagi dalam beberapa dosis. Untuk
anak yang bobot badannya kurang dari 30 kg, maksimum diberikan
sebanyak 500 mg sehari.

Atau menurut petunjuk dokter.

Efek samping:

Efek samping yang biasa timbul adalah gangguan saluran cerna, sakit kepala atau
vertigo.
Juga dapat menimbulkan ruam kulit, pruritus, gangguan fungsi ginjal tetapi ini jarang
terjadi.
Pada dosis yang berlebihan dapat terjadi gejala saluran cerna dan gejala susunan saraf
pusat.

Peringatan dan perhatian:


- Hati-hati bila digunakan pada penderita dengan riwayat dekompensasi jantung
atau hipertensi.
- Hati-hati bila digunakan pada penderita dengan gangguan fungsi ginial dan
perlu dilakukan monitor yang ketat.
- Tidak boleh digunakan pada penderita yang diketahui hipersensitif terhadap
aspirin atau antiinflamasi non steroid lainnya
- Hati-hati bila digunakan pada penderita dengan kelainan faktor intrinsik untuk
pembekuan darah.
- Pada penderita dengan riwayat penyakit saluran cerna bagian atas perlu
dilakukan pengawasan yang ketat.

Kemasan dan Nomor Registrasi:


DOFEN 200 : Kotak, 10 strip @ 10 tablet, DKL8505001617A1
DOFEN FORTE: Kotak, 10 strip @ 10 tablet, DKL8505001617B1

HARUS DENGAN RESEP DOKTER.

SIMPAN PADA SUHU DI BAWAH 30°C, TERLINDUNG DARI CAHAYA.

Dibuat oleh:
DEXAMEDICA
JL. BAMBANG UTOYO 138
PALEMBANG-INDONESIA
Dogmatil

CODE: C23
Harga Per Satuan Terkecil : Rp3,650.00
BELI
DOGMATIL

SULPIRIDE 3 bidang pengobatan utama :


ITUKAK SALURAN PENCERNAAN PSIKIATRI

VERTIGO

■ Tukak saluran pencernaan


Pengobatan pada waktu serangan :
2 - 3 ampul/hari selama 1 - 2 minggu.
Terapi penunjang :
3 kapsul @ 50 mg/hari selama 3 minggu.
Terapi lanjutan :
1 - 3 kapsul/hari selama 3 - 4 minggu.
• Kelainan psikofungsionil
• Kelainan tingkah laku yang ringan.
• Keadaan depresi yang reaktif.
• Neurosa dengan harnbatan psikomotor.
• Sindroma post gegar-otak.
• Depresi pada geriatrik.

Dewasa : 2 - 4 kapsul @ 50 mg/hari,


dibagi dalam beberapa dosis.
Anak-anak : 5 -10 mg/kg b.b./hari,
dibagi dalam beberapa dosis.
■ Kelainan psikiatri utama
Pengobatan pada waktu serangan :
• Psikosa akut dengan gejala-gejala 3 - 6 ampul/hari.
delusi, halusinasi, kebingungan.
• Depresi karena berbagai sebab,
Terapi penunjang per oral:
• Skizofrenia akut, keadaan delusi 2 - 4 tablet @ 200 mg/hari,
dibagi daTam beberapa dosis.
(waham) kronis.
• Kelainan tingkah laku yang berat.
• Psikosa pada masa anak-anak, remaja
Anak-anak : 10 mg/kg b.b./hari,
dan keadaan pra-psikosa.
dibagi dalam beberapa dosis.
■ Vertigo karena berbagai sebab
3- 6 kapsul/hari.

TOLERANSI :

- Pada terapi jangka panjang atau pada pengobatan ulangan tidak menimbulkan
adiksi.
- Tanpa kontraindikasi maupun incompatibility.
- Kewaspadaan tetap terpelihara bahkan sering kali meninggi.
- Tidak mempengaruhi sistim neurovegetative.

EFEK SAMPING :

Kadang-kadang dapat menyebabkan gangguan siklus menstmasi atau efek extra


pyramidal ringan yang mudah hilang.
KEMASAN:
Tablet dalam strip berisi 20 @ 200 mg (khusus pemakaian psikiatri) No. Reg. D
-
7811131
-Ampul 6 @ 100 mg/2 ml No. Reg. D 6015425
-Kapsul dalam strip berisi 20 dan 100 @ 50 mg. No. Reg. D 6015158
SIMPAN Dl BAWAH SUHU 30°C, TERLINDUNG DARI CAHAYA

Tablet dan Kapsul di produksi oleh : PT SOHO INDUSTRI PHARMASI JAKARTA-


INDONESIA
Injeksi diproduksi oleh
: PT ETHICA- JAKARTA, untuk PT SOHO INDUSTRI PHARMASI JAKARTA-
INDONESIA
Dengan lisensi dari DELAGRANGE, SESIF - PARIS - FRANCE
DELAGRANGE
Dolana Kapsul

CODE: C122
Harga Per Satuan Terkecil : Rp3,450.00
BELI
Dolana

KOMPOSISI :
Setiap Kapsul mengandung : Tramadol Hidroklorida 50 mg
Setiap Suppositoria mengandung : Tramadol Hidroklorida 100 mg
Setiap 1 mL Larutan injeksi DOLANA 50 mg
Tramadol Hidroklorida 50 mg
mengandung :
Setiap 2 mL Larutan injeksi DOLANA 100 mg
Tramadol Hidroklorida 100 mg
mengandung :

CARA KERJA OBAT :

Tramadol HCl adalah analgesik yang bekerja sentral, dengan sifatnya sebagai agonis
partial pada reseptor opioid (reseptor U) yang berperan pada efek analgesik. Disamping
itu juga bekerja pada reseptor monoaminergik di susunan saraf pusat. Dengan
menghambat "reuptake", noradrenaline pasca sinaptik dan memblok reseptor
serotonergik, memperkuat efek analgesik Tramadol HCl namun dengan efek samping
opioid yang minimal.

INDIKASI :

Untuk mengatasi nyeri berat, baik akut maupun kronik serta nyeri setelah operasi.

KONTRA INDIKASI :
- Intoksikasi akut bila digunakan bersama dengan alkohol, preparat hipnotik,
analgesik atau obat-obat lain yang bekerja pada susunan saraf pusat.
- Penderita dengan depresi pernapasan terutama jika ada cyanosis dan sekresi
bronkial yang berlebihan.
- Penderita yang mendapat pengobatan penghambat MAO.
- Penderita yang hipersensitif terhadap tramadol atau opiat.
- Hendaknya tidak diberikan selama serangan asma bronkial atau kegagalan
jantung sekunder sampai penyakit, paru-paru kronik

EFEK SAMPING

- Berkeringat, pusing, mual, muntah, mulut kering dan lelah.


- Dispepsia obstipasi, sedasi, pruritus, kemerahan, sakit kepala.
- Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi tramadol dengan
cepat.

PERINGATAN DAN PERHATIAN :

- Tramadol tidak boleh digunakan pada penderita ketergantungan obat.


- Meskipun termasuk antagonis opiat, tramadol tidak dapat menekan gejala
"withdrawal" akibat pemberian morfin.
- Hati-hati bila digunakan pada penderita trauma kepala, peningkatan tekanao
intrakranial, gangguan fungsi ginjal dan hati yang berat atau hipersekresi
bronkus karena dapat meningkatkan resiko kejang atau syok (renjatan )
- Dapat terjadi penurunan fungsi paru-paru apabila penggunaan tramadol
dikombinasi dengan obat depresi SSP lainnya atau bila melebihi dosis yang
dianjurkan.
- Pertimbangkan manfaat dan resiko yang mungkin terjadi bila digunakan pada
wanita hamil dan menyusui karena 0,1 % tramadol diekskresikan melalui ASI.
- Selama minum obat ini jangan mengendarai kendaraan bermotor atau
menjalankan mesin.
- Pada penderita dengan gangguan fungsi ginjal / hati perlu dilakukan
penyesuaian dosis.

INTERAKSI OBAT :

Dengan obat-obat yang bekerja pada susunan saraf pusat seperti Trankuilizer, hipnotik
maka efek sedasi/kelelahan kemungkinan meningkat. Tramadol HCl tidak boleh
diberikan pada pasien yang menerima MAO Inhibitors.
DOLFENAL

CODE: C33
Harga Per Satuan Terkecil : Rp1,000.00
BELI
Dolfenal
Asam mefenamat 500 mg.

Indikasi :

nyeri, peradangan.

Kontra indikasi :

Tukak/inflamasi saluran cerna, hipersensivitas, kerusakan hati dan ginjal.

Perihal :
tukak lambung, asma, de3hidrasi.

Efek samping :
Gangguan saluran cerna,perdarahan saluran cerna,diskrasia
darah,mengantuk,pusing,sakit kepala,gangguan penglihaan,reaksi kulit,nefropati.

Dosis :

4x sehari : Dewasa dan anak >14 tahun : kemudian 250 mg.

Kemasan :
Dos 100 tablet.
Dolika Kapsul

CODE: C123
Harga Per Satuan Terkecil : Rp2,700.00
BELI
DOLIKA
INJEKSI / KAPSUL

KOMPOSISI

Tiap ml Dolika 50 Injeksi


Tramadol HCI 25 mg
mengandung :
Tiap ml Dolika 100 Injeksi
Tramadol HCI 5 mg
mengandung :
Tiap kapsul mengandung : Tramadol HCI 50 mg
CARA KERJA OBAT

Tramadol HCI merupakan Non-Opioid Analgetika yang bekerja pada reseptor opioid.

INDIKASI

- Nyeri akut dan kronik berat.


- Nyeri pasca operasi.
- Nyeri akibat tindakan diagnostik, biasanya diberikan dalam bentuk injeksi

DOSIS PEMAKAIAN

Dosis yang diberikan sebaiknya disesuaikan dengan intensitas nyeri Bila tidak ada
petunjuk lain dari dokter, dosis Dolika yang diberikan adalah sebagai berikut : Dosis
untuk orang dewasa dan anak umur di atas 14 tahun :

DOLIKA KAPSUL :
Dosis tunggal : 1 kapsul
Dosis harian : sampai 8 kapsul

Dosis tersebut biasanya cukup untuk meredakan nyeri. Apabila masih terasa nyeri,
dapat ditambahkan injeksi 1 ml Dolika atau 1 kapsul Dolika setelah selang waktu 30 - 60
menit. Pada penderita dengan gangguan fungsi ginjal atau hati, perlu dilakukan
penyesuaian dosis. Dosis harian sebesar 400 mg/hari jangan dilampaui.

Lama pengobatan :

Pada pengobatan Dolika jangka panjang, kemungkinan terjadinya ketergantungan tidak


dapat disingkirkan. Karenanya dokter harus menetapkan lamanya pengobatan, atau bila
pengobatan perlu dihentikan sementara. Dolika tidak boleh diberikan lebih lama
daripada yang diperlukan.

EFEK SAMPING
- Sama seperti analgesik sentral lainnya, efek samping berikut dapat terjadi pada
pengobatan Dolika : mual, muntah, dispepsia, obstipasi, lelah, sedasi, pusing,
pruritus, berkeringat, kulit kemerahan, mulut kering dan sakit kepala.
- Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi Tramadol dengan
cepat.
- Meskipun tramadol berinteraksi dengan reseptor opiat, sampai sekarang terbukti
insidens ketergantungan setelah penggunaan Dolika jarang dijumpai.

KONTRA INDIKASI

Intoksikasi akut dengan alkohol, hipnotika, analgesik atau obat-obat yang


mempengaruhi SSP lainnya.
Penderita yang mendapat pengobatan penghambat MAO.
Penderita yang hipersensitif terhadap tramadol atau opiat.

INTERAKSI OBAT

Penggunaan injeksi Dolika bersama dengan obat-obat yang bekerja pada SSP (seperti
tranquiliser,
hipnotika) dapat meningkatkan efek sedasinya.
Sebaliknya penggunaan tramadol bersama dengan tranquiliser juga dapat
meningkatkan efek analgesiknya.

CARA PENYIMPANAN

Jauhkan dari jangkauan anak-anak.


Simpan di tempat kering dan sejuk, terhindar dari cahaya.
Dolo fenac

CODE: C24
Harga Per Satuan Terkecil : Rp3,100.00
BELI
DOLO FENAC

iniamme Monomtrate + Lyanocobalamin


Vitamin Neurotropik + NSAID

Komposisi :

Setiap tablet salut enterik


mengandung:
OiclofenacSodium 50 mg
Pyridoxol HCI 50 mg
Thiamine Mononitrate 50 mg
Vitamin B12 1 mg

Mekanisme Kerja :

Diclofenac merupaKan obat anti inflamasi non steroid, mempunyai efek sebagai anti
rematik, anti inflamasi
analgesik. Untun oengobatan inflamasi dan penyakit-penyakit rematik degeneratif. Efek
anti inflamasi serta
efek farmakologis lainnya berhubungan dengan efek penghambatan sintesa
prostaglandin.
Thiamin penting untuk metabolisme karbohidrat, dalam tubuh dikonversi menjadi bentuk
aktifnya thiamin
pirofosfat yang merupakan koenzim pada reaksi dekarboksilasi asam aketo.
Pyridoxol HCI di dalam tubuh diubah menjadi pyridoxol fosfat, yang merupakan koenzim
reaksi karboksilasi
dan transaminasi. berfungsi terutama dalam metabolisme protein dan asam amino.
Vitamin B.s diperiukan dalam sintesis asam nukleat dan mielin, dengan demikian
mempengaruhi pematangan
sel dan memelihara keutuhan jaringan syaraf.

Indikasi :

Meringankan rasa sakitsedangsampai beratyangdisertai neuritisdan/atau neuralgia.


Dosis dan Pemberian
Tiga tablet per hari, lebih baik setelah makan. Pasien dapat diobati dalam waktu lama
iika diperiukan sesuai anjurandokter.

Perhatian :

Diclofenac dapat menyebabkan retensi cairan, edema, dan gangguan koagulasi pada
pasien dengan penyakit kardiovaskular atau hipertensi.
pemberian Diclofenac bersama NSAID lainnya tidak direkomendasikan.pada pasien
dengan dehidrasi, akan meningkatkan resiko toksisitas ginjal.
Obat ini harus diberikan dengan hati-hati pada pasien dengan gangguan ginjal, hati dan
jantung penderita usia lanjut,Penderita dengan luka atau pendarahan pada saluran
cerna. Pada anak, efektivitas dan banannya belum diketahui.

Perhatian atau larangan penggunaan selama hamil dan menyusui :


Obat tidak boleh digunakan selama kehamilan dan menyusui. Sebelum meresepkan
obat ini, kondisi sistim pencernaan, hati dan ginjal harus diteliti terlebih dahulu.

Perhatian dan kemungkinan efek karsinogenik, mutagenik dan teratogenik dan


efek pada fertilitas:

Tidak ada bukti efek karsinogenik, mutagenik dan teratogenik atau efek fertilitas pada
studi manusia atau hewan.

Efek samping :

Ada laporan tersendiri mengenai reaksi pada pemberian parenteral thiamin dan vitamin
B12 untuk jangka panjang; hal ini dihubungkan dengan hipersensitifas yang jarang
terjadi. Pemberian pyridoxol dosis tinggi dapat menyebabkan smdroma neuropati
sensoris tertentu, meskipun studi histopatologik tidak menunjukkan adanya hubungan
smdroma tersebut dengan semua tingkatan degenerasi neuronal. Pada penghentian
pyridoxol, ada perbaikan bertahap pada disfungsi neuronal dan pemulihan secara
menyeluruh pada pasien-pasienini.
Erupsi kulit dan reaksi hipersensitifitas lain yang diketahui disebabkan oleh formulas! ini.
Polycythemia vera.

Sistem pencernaan :

sakit perut, mual, muntah, diare, dispepsia, flatulence, anoreksia, retensi urin- jarang
terjadi : gastroduodenal hemoragik (perdarahan gastro-duodenal), perdarahan usus,
hematemesis ulkus perforasi, diare berdarah.Kadang-kadang terjadi: colitis ulserativa
atau Crohn's procto'colitis' gingivostomatitis, lesi esophagus, glositis, konstipasi.

Sistem saraf pusat :

dizziness,pusing,sakit kepala,kelelahan.Kasus yang jarang:parestesia,gangguan


sensoris dan visuat, gangguan ingatan, disorienteasi.TJhnifus, insomma.Tfitasi psikotik,
gangguan rasa.

Kulit (kasus tersendiri) :

vesicular eruptions, eczema, erythema multiforme, sindroma Stevens-Johnson toxic


epidermal necrolysis, erythroderma (exfoliative dermatitis), alopecia, reaksi fotosensitif,
purpura. Ginjal (kasusjarang): hematuria, proteinuria, insufisiensi renal akut.
Hati (kasus jarang) :

peningkatan aktifitas aminotransferase (glutamic-pyruvic dan glutamic-oxaloacetic


transaminases), hepatitis, dengan atau tanpa penyakit kuning.

Darah ( kasus tersendiri) :

thrombocytopenia,leucopenia,hemolyticanemia,aplastic anemia,agranulocytosis.

Hipersensitifitas (kasus jarang) :

arterial hypotension, edema, reaksi anafilaksis.

Kontraindikasi :

Hipersensitifitas terhadap obat ini. Polycythemia vera. Vitamin B12 tidak boleh diberikan
pada tingkat awal penyakit Leber (atrophl hereditari dari saraf optik).
Qastroduodenal/peptic ulcer. Pasien yang mengalami bronchial, urticaria atau rhinitis
yang dipicu oleh asam asetilsalisilik atau derifatnya.

Interaksi :

Thiamin dilaporkan berpotensi terjadinya penghambatan neuromuscular, meskipun


signifikansinya tidakjelas. Pyridoxol fosfat menyebabkan dekarboksilasi perifer levodopa
sehingga menurunkan efikasi pada pengobatan penyakit Parkinson. Pemberian
carbidopa dengan levodopa secara bersamaan menghambat efek pyridoxol Pyridoxol
HCI tidak boleh diberikan pada dosis lebih tinggi daripada 5 mg per hari pada pasien
yang sedanq diobati dengan levodopa saja. Pengobatan dengan pyridoxol HCI 200 mg
per hari selama satu bulan menurunkan sampai 50% konsentrasi serum phenobarbital
dan phenytoin. Cycloserine dan hydralazine adalah vitamin B, antagon.s dan pemberian
pyridoxine menurunkan efek samping neuronal dengan penggunaan obat-obat ini.
Penggunaan penicillamine yang diperpanjang dapat menyebabkan kekurangan vitamin
B,. Jika pyridoxol diberikan bersama cyclosporine, kadar plasma ada kemungkinan
menurun.
Absorpsi vitamin B„ di sistim gastrointestinal dapatditurunkan dengan pemberian berikut
ini aminoglikosida colchicme, golongan potasium lepas lambat, asam aminosalisilik dan
garamnya, antikonvulsan (phenytoin' phenobarbital, primidone), iritasi pada usus halus
oleh kobalt, dan oleh asupan aikohol yang berlebihan selama lebih dan 2 minggu.
Pemberian neomycin dan colchicine secara simultan memperburuk absorbs! vitamin B
secara oral. Asam askorbat dapat menghancurkan jumlah vitamin B12 secara signifikan
dan faktor intrinsik dalam kondisi in vitro; harus diperhatikan kemungkinan ini pada saat
meresepkan dosis tinggi asam askorbat dengan vitamin B12. Prednisone dilaporkan
meningkatkan absorpsi vitamin B12 dan sekresi faktor intrinsik pada beberapa pasien
dengan anemia pernicious, tetapi tidak pada pasien dengan gastrectomy parsial atau
total Kepentingan klinis dan observas* ini tidak diketahui. Pemberian kloramfenikol dan
vitamin B„ secara simultan dapat memperburuk responhemopoietic terhadap vitamin.

Pemberian diclofenac dengan obat-obat lithium-based atau digoxin atau siklosporin atau
metotreksat secara simultan dapat menyebabkan peningkatan plasma obat-obat ini.
Monitoring yang cukup direkomendasikan untuk kasus-kasus ml. Penggunaan
antiinflamasi nonsteroid lain secara bersamaan dapat meningkatkan
resikoefeksampingvangtidakdiinginkan. Pasien diobati dengan antikoagulan harus
dimonitor dengan ketat Obat-obat antnnflamasi nonsteroid harus dihentikan 24 jam
sebelum memulai pengobatan dengan metotreksat untuk mencegah peningkatan
plasma cytostatic dan kejadian efektoksik. Overdosisatau ingestion taksengaja:Gejala
dan Penanganan (Antidot)

Tidak ada kasus yang dilaporkan tentang overdosis dengan thiamin atau vitamin B,,
Neuropathy sensoris dan sindroma neuropati sensoris lainnya yang disebabkan
pemberian pyridoxol megadoses akan sembuh dan pulih kembali dengan penghentian
pengobatan.

Pada kasus intoksikasi akut dengan diclofenac, pengobatan pennnjang dan simptomatik
harus dilakukan Tidak ada gambaran spesifik mengenai hal itu. Tindakan berikut ini
harus dilakukan: bilas lambung dan pemberian charcoal aktif. Pengukuran pendukung
harus dilakukan untuk mengobati hipotensi, insufisiensi qinial konvulsi, iritasi
gastrointestinal, dan supresi pernafasan.
Diclofenac menurunkan aktivitas obat-obat diuretik.

Kemasan :

Boks lO blister® lO tablet salut enterik


Dolo Meganeuron

Harga Per Satuan Terkecil : Rp750.00


BELI

DOLO MEGANEURON
Kaplet Salut Selaput

KOMPOSISI :
Tiap Kaplet Salul Selaput
mengandung:
Methampyrane 500 mg
TniamineHCI 50 mg
Pyridoxine HCl 100 mg
Cyanooobalamine 100 mg

FARMAKOLOGI :

Methampyrone bekerja sebagai analgesia. Diabsorpsl dan saluran pencemaan.


mempunyai waktu paruh 1 -4 jam.
Thiamine HCl, Pyrldoxine HCl dan Cyanocobalamine dalam dosis besar dapat
membantu memelihara fungsi sel-sel saraf.

INDIKASI :

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada
keadaan sakit yang berat.

KONTRA INDIKASI :

- Penderita hipersensitif.
- Bayi dibawah 6 bulan.
- Wanita hamil dan menyusui.
- Penderita dengan tekanan darah sistolik < 100 mmHg.

PERINGATAN DAN PERHATIAN :


- Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk
mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu-lengan.
- Karena dapat menimbulkarragranulositosis yang berakibat fatal, maka
sebaiknya tidak digunakan dalam jangka waktu terus menerus.
- Hati-hati dengan penderita yang pernah mengalami gangguan pembentukan
darah/kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu
dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lama
untuk mengatasi rasa sakit akut.
EFEK SAMPING :
- Reaksi hipersensitifitas: reaksi pada kulit misal kemerahan.
- Agranulositosis.

DOSIS :

1 Kaplet salut selaput 3 kali sehari

KEMASAN :

Dus, 10 strip @ 10 kaplet salut selaput


No.Reg.: DKL 9815706509 A1
SIMPAN DITEMPAT YANG SEJUK DAN KERING
HARUS DENGAN RESEP DOKTER

Produksi:

PT. EMBA MEGAFARMA


SEMARANG - INDONESIA
R.032.1
Dolocap

Harga Per Satuan Terkecil : Rp1,900.00


BELI
DOLOCAP
capsul

KOMPOSISI :

Tiap kapsul mengandung:


Tramadol HCI 50 mg

FARMAKOLOGI :

Tramadol HCI merupakan suatu analgetik opioid.


INDIKASI :

Digunakan untuk:
• Nyeri akut dan kronik yang berat.
• Nyeri pasca bedah.

KONTRA INDIKASI:

• Penderita yang hipersensitif terhadap Tramadol atau opiat.


• Penderita dengan depressi pernapasan, terutama dengan adanya cyanosis.
• Penderita yang mendapat pengobatan MAO inhibitor.
• Intoksikasi akut dengan alkohol, hipnotika, atau obat-obat analgetik opiat atau
obat-obatyang mempengaruhi SSP lainnya.

EFEK SAMPING :

• Pada dosis normal, seperti pada golongan analgesik opiat (analgesik sentral)
dapat terjadi: mual, muntah, sembelit, dispepsia, drowsiness, confusion,
mungkin juga dapat terjadi spasme uterik atau biliary.
• Mulut kering, berkeringat, kulit kemerahan, vertigo, palpitasi, brandikardia
orthostatic, hypotension, hypotermia, kelelahan dan miosis.
• Pada dosis lebih besar dapat menyebabkan depressi pernapasan dan hipotensi
dengan kegagalan sirkulasi dan koma.
• Pada anak-anak dan bayi dapat terjadi kejang-kejang.

DOSIS :

Dosis yang diberikan disesuaikan


dengan intensitas nyeri lazimnya :
• 1 kapsul sehari (maksimum 8 kapsul per hari).

Dosis tersebut di atas biasanya cukup untuk meredakan nyeri, apabila masih terasa
nyeri dapat ditambahkan 1 kapsul setelah selang 30 - 60 menit.

OVER DOSIS :

• Pada pemberian over dosis dapat terjadi miosis, muntah, kolaps kardiovaskular,
sodasi, koma, kejang dan depressi pernapasan.
• Untuk mengatasi depressi pernapasan dan syok dengan Naloxone HCI,
Nalorphine HBr, Levallorphan tartrat, sedangkan kejang dapat ditekan dengan
pemberian Benzodiazepin.
• Keracunan akut lewat mulut dapat diatasi dengan pengosongan lambung.

INTERAKSI OBAT :
• Efek depressi / sedasi diperkuat dengan adanya obat-obat yang bekerja pada
SSP seperti : alkohol, obat-obat hipnotika, tranquillizer, antidepressan trisiklik
dan anestetika.
• Sebaliknya penggunaan Tramadol bersama dengan tranquillizer juga dapat
meningkatkan efekanalgesiknya.

PERHATIAN :

• Tramadol tidak boleh digunakan pada penderita ketergantungan obat.


• Meskipun termasuk antagonis opiat, Tramadol tidak dapat menekan gejala
"witdrawal" akibat pemberian morfin.
• Pemberian pada wanita hamil harus dipertimbangkan manfaat dan resiko yang
mungkin terjadi.
• Hati -hati pemberian pada ibu menyusui karena 0,1% Tramadol diekskresikan
melalui ASI.
• Dapat terjadi penurunan fungsi paru bila Tramadol digunakan bersama dengan
obat-obat penekan SSP lainnya atau bila penggunaan melebihi dosis yang
dianjurkan.
• Hati-hati bila digunakan pada penderita trauma kepala, peningkatan tekanan
intra kranial, gangguan fungsi ginjal dan hati yang berat, hipersekresi bronkus
karena dapat meningkatkan resiko kejang atau syok.
• Selama minum obat ini jangan mengendarai kendaraan bermotor atau
menjalankan mesin.
• Pada pengobatan jangka panjang, dapat menyebabkan ketergantungan. Oleh
karena itu dokter harus menentukan dengan jelas lama pengobatan. Tidak
boleh diberikan lebih lama dari petunjuk dokter.

KEMASAN :

Dos berisi 5 blister® 10 kapsul

PENYIMPANAN :

Simpanlah di tempat yang sejuk, kering dan terlindung dari cahaya.

HARUS DENGAN RESEP DOKTER.


Dolodon

CODE: C25
Harga Per Satuan Terkecil : Rp250.00
BELI
DOLODON

kapsul * captab * suspensi capsule * captab * suspension

KOMPOS1SI :

DOLODON 250 Kapsul : Tiap kapsul berisi 250 mg Asam Mefenamat


DOLODON 500 Captab : Tiap captab mengandung 500 mg Asam Mefenamat
Tiap sendok takar (5ml) suspensi mengandung 50 mg
DOLODON Suspensi :
Asam Mefenamat.

FARMAKOLOGI :

DOLODON berisi Asam Mefenamat yang merupakan derivat asam antrani-lat, yaitu
analog amin asam salisilat, yang mempunyai daya antipiretik dan anatgesik dengan
potensi yang sama dengan aspirin dan dengan sedikit daya anti inflamasi. Dibandingkan
dengan aspirin, Asam Mefenamat ku-rang menyebabkan terjadinya pendarahan
gastrointestinal. Asam Mefenamat diserap dari traktus gastro intestinal dan kadar dalam
sirkulasi mencapai puncaknya dalam waktu 2 jam setelah pemberian obat. Dalam waktu
48 jam, ± 50 % dari dosis yang diberikan ditemukan kembaii dalam urine, terutama
dalam bentuk metabolitnya.
DOLODON Suspensi dengan rasa pisang yang enak dan manis disiapkan untuk anak-
anak dan penderita yang mengalami kesulitan menelan kapsul atau captab.

INDIKASI :

Untuk menghilangkan rasa nyeri pada sakit kepaia, sakit gigi, nyeri rematik, nyeri pasca
bedah dan persalinan, nyeri waktu haid, demam pada anak-anak dan dewasa.

KONTRA INDIKASI :

Penderita tukak lambung


PERINGATAN & PERHATIAN :

* Dapat mengurangi jumiah trombosit, terutama bila digunakan bersama-an


antikoagulan koumarin, dosis koumarin hams dikurangi.
* Hati-hati pada penderita gangguan fungsi hati dan ginjal.
* Sebaiknya tidak diberikan pada wanita hamil dan wanita menyusui.
* Hati-hati pada penderita asma karena akan memperburuk keadaan.
* Pemberian harap dihentikan setelah 7 hari tidak memberikan hasil.

EFEK SAMPING :

* Dapat menyebabkan iritasi tractus gastro intestinal


* Skin rash dan diare dapat terjadi dan akan hiiang jika pengobatan dihentikan.

DOSIS :

Dewasa : Mula-mula 500 mg, kemudian 250 mg setiap 6 jam


6,5 mg Asam Mefenamat per kilogram berat badan, 3 kali se-hari
Anak-anak :
dengan interval 6 sampai 8 jam, paling lama 7 hari.
Atau menurut petunjuk dokter.

PENYIMPANAN :

Simpan pada suhu dibawah 30°C.

SEDIAAN dan KEMASAN :

* DOLODON 250 Kapsul -


Dus berisi 10 strip x 10 kapsul
:
Reg. No. D 7812379
- Botol plastik isi 500 kapsul Reg. No. D 7812379-1
* DOLODON 500 -
Dus berisi 10 strip x 10 captab
Captab :
Reg. No. DKL 8714504104 A1
* DOLODON -
Botoi isi 60 ml netto
Suspensi :
Reg. No. DKL 8714504033 A1

HARUS DENGAN RESEP DOKTER


Produksi :

PT MECOSIN
INDONESIA JAKARTA
Dolofen-F

CODE: C26
Harga Per Satuan Terkecil : Rp500.00
BELI

DOLOFEN – F

Ibu profen 400 mg.

INDIKASI :

Menghilangkan rasa nyeri dan gejala arthritis reumetoid dan osteoarthritis.

DOSIS :

3 x sehari 1 kaplet / kapsul .

KEMASAN :

( HNA + ) Dos 10 x 10 kapsul


Duplopyrin Strip

CODE: C111
Harga Per Satuan Terkecil : Rp2,500.00
BELI
Duplopyrin

KOMPOSISI :
Tiap tablet DUPLOPYRIN mengandung :
Fenilbutazon 125 mg
Etoksibensamid 125 mg
Aluminium Hidroksida Gel kering 100 mg
Magnesium Trisilikat 5H2O 150 mg
INDIKASI

Penyakit Rheumatik termasuk rheumatoid arthritis, gouty arthritis, osteo arthritis,


ankylosing spondylitis.

KONTRA INDIKASI

Hipertensi, tukak lambung, hipersensitivitas serta gangguan fungsi jantung, ginjal dan
hati.

INTERAKSI OBAT :

- Dapat meningkatkan etek tolbutamide dan kumarin.


- Dapat menghambat absorpsi tetrasiklin dan vitamin-vitamin serta memperlambat
absorpsi quinidin.

PERINGATAN & PERHATIAN :


- Hati-hati penggunaan pada penderita ulkus peptikum, gangguan fungsi ginjal,
hati atau kardiovaskuler, juga pada penyakit tiroid dapat terjadi penahanan
fungsi sumsum tulang.
- Harus berhati-hati pemberiannya pada penderita dengan gastritis.
- Magnesium Trisilikat dalam bentuk garam magnesium mudah diserap dan bila
terjadi gangguan fungsi ginjal dapat menyebabkan keracunan magnesium.

ATURAN PAKAI :
Dewasa : 1 tablet 3 kali sehari.
Disesuaikan dengan usia dan berat badan. Atau menurut petunjuk
Anak-anak :
dokter.

CARA PENYIMPANAN :

Simpan di tempat kering, pada suhu kamar (25-30°C) dan terlindung dan bahaya

KEMASAN :

Kaleng plastik isi 1000 tablet ; No. Reg. : D. 2815773


Dus isi 24 blister @10 tablet ; No. Reg. : D. 2815773-1
HARUS DENGAN RESEP DOKTER

PT. Coronet Crown


PHARMACEUTICAL INDUSTRIES
SURABAYA - INDONESIA
Eflagen 25

CODE: C112
Harga Per Satuan Terkecil : Rp1,250.00
BELI
EFLAGEN

Tiap tablet mengandung :


Kalium Diklofenak...................................25 mg/ 50 mg

FARMAKOLOGI

EFILAGEN mengandung Kalium Diklofenak yaitu suatu anti-inflamasi nonsteroidal


CAINS, Secara farmakologi Diklofenak menunjukkan aktivitas anti-inflamasi. analgesik
dan antipiretik. Seperti obat-obat AINS yang lain mekanisme kerja belum diketahui. akan
tetapi penghambatannya terhadap sintesa prostaglandin (siklo-oksigenase) dapat
dikaitkan dengan aktivitas anti-inflamasi.

INDIKASI

EFLAGEN diindikasikan :

- Sebagai pengobatan jangka *


nyeri Inflamasi setelah trauma, seperti
pendek untuk kondisi akut
terkilir,
sebagai berikut:
* nyeri dan inflamasi setelah operasi, seperti
operasi gigi dan tulang.
- Sebagai adjuvant pada nyeri
Inflamasi berat dari Infeksi
telinga, hidung atau
tenggorokan.

KONTRA-INDIKASI

- Hipersensitivitas terhadap Kalium Diklofenak.


- Tukak lambung, penderita dalam serangan asma, urtikarta atau rinitis akut
yang ditimbulkan oleh asam asetil salisllat atau obat-obat lain yang
menghambat sintesa prostaglandin.

EFEK SAMPING

Efek samping yang mungkin terjadi pada :


- nyeri lambung, diare, mual, muntah, kram perut,
Saluran pencernaan:
dispepsia,
- Sistem saraf pusat: pusing. sakit kepala, vertigo, telinga berdenging.
- Kulit: urtikaria. eksim, eritema multiformis.
- Ginjal: gangguan fungsi ginjal.
- Hati: peningkatan enzim SGOT, SGPT dan hepatitis (Jarang).
- trombositopenia. leukopenia, anemia, agra-nulositosis
Darah:
(sangat jarang).
- edema (Jarang). impoten, palpitasi, nyeri dada,
Lain-lain:
hipertensi.

INTERAKSI OBAT
- Pemberian bersamaan dengan litium atau digoksin dapat meningkatkan
konsentrasi litium atau digosin dalam plasma.
- Pemberian bersamaan dengan diuretik hemat kalium dapat disertai dengan
kenaikan kadar kalium dalam darah.
- Pemberian bersamaan dengan AINS sistemik dapat meningkatkan terjadinya
efek samping.
- Pemberian bersamaan dengan antikoagulan perinah dilaporkan dapat
meningkatkan resiko perdarahan.
- Pemberian bersamaan dengan metotreksat dapat meningkatkan toksisitas
metotreksat.

DOSIS

- dosis awal 100 -150 mg/hari dalam 2 - 3


Dewasa :
dosis terbagi,
- Pada kasus-kasus sedang dan untuk
75 - 100 mg / hari,
anak-anak usia > 14 tahun:
- tidak boleh diberikan pada anak-anak usia
Anak-anak :
< 14 tahun.

HARUS DENGAN RESEP DOKTER

KEMASAN

EFLAGEN 35: Dus Isi 5 strip @ 10 tablet


No, Reg.: DKLV722222015A1
EFLAGEN 50: Dus isi 5 strip @ 10 tablet
No, Reg.: DKL9722222015B1