Anda di halaman 1dari 6

PENERAPAN MODEL PEMBELAJARAN SIKLUS BELAJAR (LEARNING CYCLE) 5E DALAM MENINGKATKAN HASIL BELAJAR SISWA PADA MATAPELAJARAN TEKNOLOGI

INFORMASI DAN KOMUNIKASI


(Penelitian Kuasi Eksperimen Terhadap Siswa Kelas VII SMPN 1 Lembang Tahun Ajaran 2009/2010) Ari Wibowo Dr. H. Munir, MIT. Drs. Waslaluddin, M.T. Pendidikan Ilmu Komputer Pendidikan Ilmu Komputer Pendidikan Ilmu Komputer FPMIPA UPI FPMIPA UPI FPMIPA UPI liempaz@yahoo.com munir@upi.edu waslaluddin@upi.edu

ABSTRAK
Dalam proses pembelajaran, kegiatan belajar mengajar merupakan kegiatan yang paling pokok, karena berhasil tidaknya pencapaian tujuan pendidikan banyak bergantung kepada bagaimana proses belajar mengajar dirancang dan dijalankan secara profesional. Agar proses belajar mengajar dapat berjalan sesuai dengan tujuan yang ditetapkan, salah satu strateginya adalah dengan memilih model pembelajaran yang sesuai. Model pembelajaran Learning Cycle 5E[1]dipilih dalam penelitian ini karena merupakan model pembelajaran yang berpusat pada siswa (student centered) sehingga menjadikan peserta didik sebagai subjek bukan sematamata sebagai objek yang hanya menerima informasi dari pengajar. Tujuan penelitian ini adalah untuk mengetahui perbedaaan peningkatan hasil belajar siswa pada mata pelajaran Teknologi Informasi dan Komunikasi (TIK) antara yang menggunakan model pembelajaran Learning Cycle 5E dengan yang menggunakan model pembelajaran konvensional. Penelitian ini dilakukan di SMP Negeri 1 Lembang dengan menggunakan metode kuasi eksperimen.Sampel penelitian ini adalah siswa kelas VII H sebagai kelompok eksperimen dan kelas VII C sebagai kelompok kontrol. Dari hasil penelitian diketahui bahwa: (1) terdapat perbedaan rerata hasil belajar siswa yang menggunakan model pembelajaran Learning Cycle 5E dengan model pembelajaran konvensional. (2) Terjadi peningkatan hasil belajar pada siswa yang menggunakan model pembelajaran Learning Cycle 5E dibandingkan dengan siswa yang menggunakan model pembelajaran konvensional. Dengan demikian penerapan model pembelajaran Learning Cycle 5E dapat dijadikan sebagai salah satu alternatif pembelajaran untuk meningkatkan hasil belajarsiswa.

seperti itu, mengakibatkan paradigma mengajar masih tetap dipertahankan dan belum berubah menjadi peradigma membelajarkan siswa. Padahal dalam undang-undang No. 20 Tahun 2003 Bab I Pasal 1 dijelaskan sebagai berikut[2]: Pendidikan adalah usaha sadar dan terencana untuk mewujudkan suasana belajar dan proses pembelajaran agar peserta didik secara aktif mengembangkan potensi dirinya untuk memiliki kekuatan spiritual keagamaan, pengendalian diri, kepribadian, kecerdasan, akhlak mulia, serta keterampilan yang diperlukan dirinya, masyarakat, bangsa dan Negara. Dari pernyataan di atas, sangat jelas bahwa peserta didik harus diarahkan agar dapat mengembangkan potensi dirinya secara aktif. Dengan demikian berarti bahwa seharusnya yang lebih aktif dalam proses pembelajaran adalah siswa bukan guru. Akan tetapi,pada kenyataannya di lapangan masih banyak yang terjadi sebaliknya. Dengan demikian, perlu adanya suatu perubahan strategi pembelajaran dari yang berpusat pada guru (teacher centered) menjadi berpusat pada siswa (student centered). Pembelajaran berpusat pada siswa adalah pembelajaran yang lebih berpusat pada kebutuhan, minat, bakat, dan kemampuan peserta didik, sehingga pembelajaran akan menjadi sangat bermakna [3]. Dengan pembelajaran ini diharapkan semua potensi siswa dapat berkembang sesuai dengan latar belakang usia dan latar belakang lainnya dari masing-masing individu siswa. Karena dalam pembelajaran berpusat pada siswa peran guru hanya sebagai fasilitator dan pembimbing sedangkan yang lebih aktif adalah siswa. Salah satu alternatif dalam mengatasi permasalahan diatas adalah dengan menerapkan model pembelajaran learning cycle 5Eyang dikembangkan oleh Rodger W. Bybee [1].

Kategori dan Deskripsi Subjek


Bidang kajian pada paper ini adalah model pembelajaran

Kata kunci
Model PembelajaranLearning Cycle 5E, Matapelajaran TIK.

1.2 Rumusan Masalah


Berdasarkan latar belakang permasalahan di atas, maka dapat dirumuskan permasalahan sebagai berikut. 1) Apakah terdapat perbedaan rerata hasil belajar antara siswa yang pembelajarannya menggunakan model learning cycle 5E dengan siswa yang pembelajarannya menggunakan model konvensional? 2) Apakah terdapat perbedaan peningkatan rerata hasil belajar antara siswa yang pembelajarannya menggunakan model learning cycle 5E dengan siswa yang pembelajarannya menggunakan model konvensional?

1. PENDAHULUAN
1.1 Latar Belakang
Dalam proses pembelajaran, kegiatan belajar mengajar merupakan kegiatan yang paling pokok, karena berhasil tidaknya pencapaian tujuan pendidikan banyak bergantung kepada bagaimana proses belajar mengajar dirancang dan dijalankan secara profesional. Agar proses belajar mengajar dapat berjalan sesuai dengan tujuan yang ditetapkan, salah satu strateginya adalah dengan memilih model pembelajaran yang sesuai. Guru mempunyai tugas untuk memilih model pembelajaran yang tepat sesuai dengan materi yang disampaikan demi tercapainya tujuan pendidikan. Selain itu, guru harus dapat menciptakan suasana pembelajaran yang membuat siswa lebih aktif, kreatif, menarik, dan menyenangkan. Akan tetapiberdasarkan pengalaman yang diperoleh di lapangan, pembelajaran yang disajikan oleh guru di kelas masih menggunakan metode yang monoton misalnya metode ceramah.Dengan menggunakan metode yang monoton

1.3 Batasan Masalah


Dalam upaya memperjelas dan mempermudah penelitian maka penulis membatasi permasalahan sebagai berikut: 1) Hasil belajar yang diteliti adalah ranah kognitif yang meliputi jenjang pengetahuan (C1), pemahaman (C2), aplikasi (C3). 2) Model pembelajaran yang digunakan pada kelompok eksperimen adalah learning cycle 5E (Engage, Explore, Explain, Extend, dan Evaluate).

3)

Media pembelajaran yang digunakan bukan pokok dari penelitian ini, tetapi hanya sebagai alat bantu dalam proses belajar mengajar.

2. LANDASAN TEORITIS
2.1 Hasil Belajar
Menurut Sudjana [4] hasil belajar adalah kemampuan yang dimiliki siswa setelah ia menerima pengalaman belajarnya. Hasil belajar oleh Bloom [5] diklasifikasikan ke dalam tiga domain (ranah) yaitu ranah kognitif, afektif, dan psikomotorik. Bloom membagi masingmasing ranah ke dalam berbagai tingkatan-tingkatan kategori sebagai berikut: 1) Ranah Kognitif Ranah kognitif adalah ranah yang mencakup kegiatan mental (otak). Dalam ranah kognitif terdapat enam jenjang proses berpikir, keenam jenjang tersebut adalah: a. Pengetahuan/hafalan/ingatan (C1) b. Pemahaman (C2), c. Penerapan/aplikasi (C3) d. Analisis (C4) e. Sintesis (C5) f. Evaluasi (C6) 2) Ranah Afektif Adalah ranah yang berkaitan dengan sikap, minat, perhatian, emosi, penghargaan, proses internalisasi, dan pembentuk karakteristik diri. 3) Psikomotorik Adalah ranah yang berkaitan dengan keterampilan (skill) dan kemampuan bertindak individu.

bahan-bahan pembelajaran yang telah disediakan sebelumnya. Pada fase ini juga siswa diberi kesempatan untuk bekerja sama dalam kelompok-kelompok kecil tanpa pengajaran langsung dari guru untuk menguji prediksi, melakukan dan mencatat pengamatan serta ide-ide melalui kegiatan-kegiatan seperti praktikum dan telaah literatur. 3) Explain (menjelaskan) Fase yang didalammnya berisi ajakan atau dorongan terhadap siswa untuk menjelaskan konsep-konsep dan definisi-defini awal yang mereka dapatkan ketika fase ekplorasi dengan menggunakan kata-kata mereka sendiri, selanjutnya guru menjelaskan konsep dan definisi yang lebih formal untuk menghindari perbedaan konsep yang dipahami oleh siswa. 4) Extend (memperluas) Fase yang tujuannya ingin membawa siswa untuk menggunakan definisi-definisi, konsep-konsep, dan keterampilan-keterampilan yang telah dimiliki siswa dalam situasi baru melalui kegiatan seperti praktikum lanjutan dan problem solving. Fase ini dapat meliputi penyelidikan, pemecahan masalah, dan membuat keputusan. 5) Evaluate (menilai) Fase penilaian terhadap seluruh pembelajaran dan pengajaran. Pada fase ini dapat digunakan berbagai strategi penilaian formal dan informal. Guru diharapkan secara terusmenerus dapat mengobservasi dan memperhatikan siswa terhadap pengetahuan dan kemampuannya. Kelima tahapan siklus belajar 5E dapat digambarkan seperti dibawah ini.

2.2 Teori Belajar Konstruktivisme


Pendekatan teori konstruktivisme pada dasarnya menekankan pentingnya siswa membangun sendiri pengetahuan mereka lewat keterlibatan aktif proses belajar mengajar [6]. Sehingga proses belajar mengajar lebih diwarnai student centered daripada teacher centered. Terdapat beberapa model pembelajaran yang dilandasi konstruktivisme [7] yaitu model siklus belajar (learning cycle), model pembelajaran generatif (generative learning model), model pembelajaran interaktif (interactive learning model), model CLIS (Children Learning in Science), dan model strategi pembelajaran kooperatif atau CLS (Cooperative Learning Strategies). Masingmasing model tersebut memiliki kekhasan tersendiri, tetapi semuanya mengembangkan kemampuan struktur kognitif untuk membangun pengetahuan sendiri melalui berpikir rasional. Gambar. Learning Cycle 5E Menurut Cohen dan Clough penerapan model learning cycle memberi keuntungan sebagai berikut [8]: 1. Meningkatkan motivasi belajar karena pebelajar (siswa) dilibatkan secara aktif dalam proses pembelajaran 2. Membantu mengembangkan sikap ilmiah pebelajar 3. Pembelajaran menjadi lebih bermakna Adapun kekurangan penerapan model learning cycle yang harus selalu diantisipasi adalah sebagai berikut [8]: 1. Efektifitas pembelajaran rendah jika guru kurang menguasai materi dan langkah-langkah pembelajaran 2. Menuntut kesungguhan dan kreativitas guru dalam merancang dan melaksanakan proses pembelajaran 3. Memerlukan pengelolaan kelas yang lebih terencana dan terorganisasi 4. Memerlukan waktu dan tenaga yang lebih banyak dalam menyusun rencana dan melaksanakan pembelajaran.

2.3 Model Pembelajaran Siklus Belajar (Learning Cycle)


Learning Cycle merupakan rangkaian tahap-tahap kegiatan (fase) yang diorganisasi sedemikian rupa sehingga siswa dapat menguasai kompetensi-kompetensi yang harus dicapai dalam pembelajaran dengan jalan berperanan aktif [8]. Siklus belajar 5E yang dikembangkan oleh Rodger W Bybee [1]memiliki fase-fase sebagai berikut: 1) Fase engage (mengajak) Fase pengenalan terhadap pelajaran yang akan dipelajari yang sifatnya memotivasi atau mengaitkannya dengan halhal yang membuat siswa lebih berminat untuk mempelajari konsep dan memperhatikan guru dalam mengajar. Fase ini dapat dilakukan dengan memberikan pertanyaan, memberikan gambaran tentang materi yang akan dipelajari, membaca, demonstrasi, atau aktivitas lain yang digunakan untuk membuka pengetahuan siswa dan mengembangkan rasa keingintahuan siswa. Fase ini juga diigunakan untuk mengetahui tingkat pengetahuan dan pikiran siswa mengenai konsep yang akan dipelajari. 2) Fase explore (menyelidiki) Fase yang membawa siswa untuk memperoleh pengetahuan dengan pengalaman langsung yang berhubungan dengan konsep yang akan dipelajari. Fase ini dapat dilakukan dengan mengobservasi, bertanya, dan menyelidiki konsep dari

3. METODOLOGI PENELITIAN
3.1 Metode dan Desain Penelitian
Metode yang digunakan pada penelitian ini adalah metode kuasi eksperimen. Sedangkan bentuk desain quasi eksperimen yang digunakan adalah Nonequivalent Control Group Design. Desain tersebut hampir sama dengan Pretest-Posttest Control Grup Design, hanya saja pada desain ini kelompok eksperimen maupun kelompok kontrol tidak dipilih secara random [9].

3.2 Populasi dan Sampel Penelitian


Populasi dalam penelitian ini adalah siswa kelas VII SMP Negeri 1 Lembang tahun ajaran 2009/2010, yang terdiri dari delapan kelas.

Sedangkan sampel dalam penelitian ini adalah kelas VII H sebagai kelompok eksperimen dan kelas VII C sebagai kelompok kontrol yang diambil secara purposive sampling dari keseluruhan kelas VII. Masing-masing kelas berjumlah 30 siswa. 3.3 Instrumen Penelitian Instrumen penelitian adalah alat atau fasilitas yang digunakan oleh peneliti dalam mengumpulkan data agar pekerjaannya lebih mudah dan hasilnya lebih baik dalam arti lebih cermat, lengkap, dan sistematis sehingga lebih mudah untuk diolah [10]. Adapun instrumen yang digunakan dalam penelitian ini adalah: 1) Tes Tes yang digunakan dalam penelitian ini adalah tes berbentuk pilihan ganda, yang dimaksudkan untuk mengetahui sejauh mana siswa telah terbentuk setelah mempelajari sesuatu. Dalam penelitian ini terdapat dua kali tes yaitu pretes dan postes.

2)

3)

4)

2)

Lembar observasi Lembar obseservasi yang digunakan terdiri dari: a. Lembar Aktivitas Guru Digunakan untuk mengetahui aktivitas guru selama proses pembelajaran TIK berlangsung, apakah sudah sesuai dengan model pembelajaran learning cycle 5E atau belum. b. Lembar Aktivitas Siswa Digunakan untuk mengetahui aktivitas siswa selama proses pembelajaran TIK dengan model pembelajaran learning cycle 5E berlangsung. Angket Angket yang digunakan dalam penelitian ini terdiri dari 10 pernyataan dengan tujuan untuk mengetahui tanggapan siswa setelah mengikuti pembelajaran TIK dengan model pembelajaran learning cycle 5E.

5)

3)

berdistribusi normal atau tidak. Uji normalitas ini menggunakan Uji Chi Kuadrat. Uji Homogenitas Uji Homogenitas dimaksudkan untuk mengetahui apakah sampel hasil penelitian pada kelompok kontrol dan kelompok eksperimen mempunyai varians yang sama atau tidak. Pengujian ini dilakukan apabila sampel data berdistribusi normal, apabila tidak berdistribusi normal maka langsung dilakukan uji statistik non parametrik. Uji homogenitas ini menggunakan uji F. UjiStatistik Parametrik Uji ini dilakukan apabila sampel data hasil penelitian yang diperoleh berdistribusi normal dan memiliki varians populasi yang homogen. Uji ini menggunakan uji t-test independent sample. Uji Statistik Non Parametrik Uji statistik non parametrik dilakukan apabila sampel berasal dari populasi yang tidak berdistribusi normal, maka untuk menguji perbedaan dua rata-rata menggunakan uji MannWhitney. Sedangkan apabila sampel berasal dari populasi yang berdistribusi normal dan variansi populasinya tidak homogen maka dilakukan uji t. Analisis Data Gain Untuk mengetahui apakah hasil belajar kelompok eksperimen lebih baik dari kelompok kontrol, maka dilakukan analisis data indeks gain dari masing-masing kelompok tersebut. Dengan mengetahui rata-rata nilai G (normalized gain) dari masing-masing kelompok, maka akan dapat diketahui keefektivan hasil belajar dari masing-masing kelompok tersebut. Untuk nilai G dapatdihitungdenganmenggunakanrumusberikut[11]:

3.4 Prosedur Penelitian


1) TahapPersiapan Tahapini menyangkut kegiatan-kegiatan yang dilakukan sebelum dimulai penelitian, yaitu: melakukanstudipendahuluandanpustaka, mengidentifikasimasalah, mengurussuratperizinanuntukpenelitian, melakukanobservasikesekolah yang akandijadikansebagaitempatpenelitian, membuatrencanapembelajaran, membuatinstrumenpenelitian, danmelakukanujicobainstrumentersebut. TahapPelaksanaan Tahapinimerupakanpelaksanaanpembelajaran TIK menggunakan model pembelajaranlearning cycle 5E.untuklebihdetailnyadibahaspadabab 4. TahapPengolahan Data HasilPenelitian Tahap ini menyangkut kegiatan-kegiatan setelah dilakukan penelitian terhadap data yang diperoleh. Tahap pengolahan data dilakukan dengan tujuan untuk menjawab seluruh rumusan masalah serta memperoleh kesimpulan akhir yang didapat berdasarkan penelitian yang telah dilakukan.

Keterangan: G Postscore % Prescore %

= Nilai normalized gain = Persentasenilai posttest = Persentasenilai pretest

2)

5.5.2 AnalisisHasilObservasi Hasildarilembarobservasimerupakan data pendukungdalampenelitianiniuntukmemperkuat data pengumpulpokok.Aspek-aspek yang tidakteramatidaripenelitiandilihatdarihasilobservasi.Observasi terhadapaktivitas guru dalampembelajarandanobservasiterhadapaktivitassiswaselama pembelajaranberlangsungdiamatioleh observer kemudiandideskripsikan 5.5.3 AnalisisHasilAngket Hasilanalisis data angketdalampenelitianinimerupakan data penunjang yang digunakanuntukmengetahuitanggapansiswaterhadap model pembelajaranlearning cycle 5E yang telahditerapkankepadamerekadalammatapelajaran TIK kelas VII submateriidentifikasiperangkatkeraskomputer.Angketdiberika npadasiswakelompokeksperimendiakhirpembelajaran, angket yang diberikanterdiridari 10 (sepuluh) pernyataan yang harusdijawabolehsiswa.

3)

3.5 Teknik Analisis Data Hasil Penelitian


Analisis data hasil penelitian dilakukan terhadap instrumen tes, lembar observasi, dan angket. Data yang diperoleh pada penelitian ini merupakan data yang sifatnya kuantitatif dan kualitatif. Data kuantitatif diperoleh dari tes penguasaan konsep baik pretes maupun postes, sedangkan data kualitatif diperoleh dari lembar observasi dan angket. 3.5.1 Analisis Hasil Tes Kognitif Siswa Analisis data hasil tes kognitif siswa dalam penelitian ini meliputi: 1) Uji Normalitas Uji Normalitas dimaksudkan untuk mengetahui apakah sampel data hasil penelitian berasal dari populasi yang

4. LEARNING CYCLE 5E DALAM MATA PELAJARAN TIK


Penerapan model pembelajaran learning cycle 5E pada matapelajaran TIK dalam penelitian ini dilakukan sebanyak 3 kali pertemuan. Untuk pelaksanaannya adalah sebagai berikut. 1) Fase Engage Membuka pelajaran dengan mengucapkan salam

Menjelaskan maksud dan tujuan pembelajaran Siswa membentuk kelompok, masing-masing kelompok berjumlah 4 orang Memberi arahan dan motivasi kepada siswa untuk belajar dan bekerjasama secara optimal didalam kelompok masing-masing dalam mempelajari matapelajaran TIK sub pokok materi perangkat keras komputer. Melakukan apersepsi dan mengaitkannya dengan materi yang akan dipelajari Membangkitkan minat dan rasa ingin tahu siswa terhadap topik yang akan dipelajari dengan menampilkan media pembelajaran berupa flash tentang perangkat keras komputer. 2) Fase Eksplore Siswa mempelajari materi tentang perangkat keras komputer yang tersedia didalam media pembelajaran atau buku pelajaran TIK. Guru memberikan lembar kerja pada setiap kelompok. Masing-masing kelompok melakukan pengamatan langsung terhadap perangkat keras yang terdapat didalam chasis/cassing. Hal ini bertujuan untuk menyusun pemahaman siswa terhadap materi yang sedang dipelajari. 3) Fase Explain Siswa melakukan diskusi dengan teman sekelompoknya untuk menjawab lembar kerja dan membuat kesimpulan dari pengamatan yang telah mereka lakukan. Siswa menjelaskan hasil pengamatan yang telah dilakukan dengan kata-kata mereka sendiri Guru menjelaskan materi pelajaran secara formal untuk menghindari perbedaan pemahaman masing-masing siswa terhadap materi yang sedang dipelajari. 4) Fase Extend Siswa melakukan praktik identifikasi perangkat keras yang terdapat didalam chasis/cassing dan menjelaskan fungsi dari masing-masing perangkat keras tersebut. 5) Fase Evaluate Pada fase ini guru mengobservasi dan memperhatikan siswa terhadap pengetahuan dankemampuannya. Untuk mengetahui seberapa jauh materi yang diserap oleh siswa setelah mengikuti pembelajaran, guru melakukan tanya jawab secara lisan Bersama-sama dengan siswa menyimpulkan materi pelajaran yang telah dipelajari Guru menutup pertemuan dengan mengucapkan salam Dalam pelaksanaan model pembelajaran learning cycle 5E pada pertemuan ke-1 terdapat fase yang tidak terlaksana yaitu fase engage yaitu pada bagian memotivasi dan melakukan apersepsi terhadap siswa dalam mempelajari materi pelajaran TIK pada pokok pembahasan perangkat keras komputer, hal tersebut dikarenakan alokasi waktu yang tersedia tidak cukup karena terpakai untuk pretes. Selain itu aktivitas siswa pada pertemuan pertama masih belum aktif, hal tersebut terlihat tidak adanya siswa yang mengajukan pertanyaan dan masih sedikitnya siswa yang berani menjawab pertanyaan yang diajukan oleh guru. Pada pertemuan selanjutnya semua fase dapat terlaksana, dikarenakan peneliti mengatur alokasi waktu yang tersedia dengan baik.

perhitungan data, maka didapat statistik deskriptif data pretes kelompok eksperimen dan kelompok kontrol sebagai berikut: Tabel. Statistik Deskriptif Data Pretes

Dari tabel diatas dapat terlihat bahwa nilai rata-rata pretes kelompok eksperimen dengan kelompok kontrol tidak memiliki selisih yang sangat mencolok, yaitu 10,93 untuk kelompok eksperimen dan 10,87 untuk kelompok kontrol. Hal itu mencerminkan bahwa keadaan awal antara kedua kelompok tersebut cenderung sama. Dilihat dari simpangan bakunya, kelompok eksperimen memiliki simpangan baku lebih besar dibandingkan dengan kelompok kontrol, yaitu 2,258 untuk kelompok eksperimen dan 2,013 untuk kelompok kontrol. Hal itu mencerminkan bahwa sebelum pelaksanaan pembelajaran, kemampuan belajar TIK kelompok eksperimen lebih menyebar (bervariasi) daripada kemampuan siswa yang belajar TIK pada kelompok kontrol. 2) Data Hasil Postes Data postes ini diperoleh dari tes tertulis berupa pilihan ganda sebanyak 20 soal.Berdasarkan hasil penelitian dan perhitungan data, maka didapat statistik deskriptif data postes kelompok eksperimen dan kelompok kontrol sebagai berikut: Tabel. Statistik deskriptif Data Postes

Dari tabel diatas dapat dilihat bahwa rata-rata nilai postes kelompok eksperimen lebih besar daripada rata-rata nilai kelompok kontrol, yaitu 14,87 pada kelompok eksperimen dan 13,37 pada kelompok kontrol. Dilihat dari simpangan bakunya, kelompok eksperimen memiliki simpangan baku lebih besar dibandingkan dengan kelompok kontrol, yaitu 2,501 untuk kelompok eksperimen dan 2,428 untuk kelompok kontrol. Hal itu mencerminkan bahwa setelah pelaksanaan pembelajaran, kemampuan belajar TIK kelompok eksperimen lebih menyebar (bervariasi) daripada kemampuan siswa yang belajar TIK pada kelompok kontrol. 3) Data Peningkatan Hasil Belajar (Gain) Berdasarkan hasil penelitian dan perhitungan data, maka didapat statistik deskriptif data indeks gain kelompok eksperimen dan kelompok kontrol sebagai berikut: Tabel. Statistik deskriptif Data Indeks Gain

5. HASIL PENELITIAN
Hasil penelitian yang diperoleh berupa data kuantitatif dan data kualitatif. Data dalam penelitian ini diperoleh dari uji statistik terhadapap hasil pretes, postes, dan gain pada kelompok eksperimen dan kontrol. Selain itu, data pendukung dalam penelitian ini diperoleh dari lembar observasi dan angket.

Dari tabel diatas dapat dilihat bahwa rata-rata indeks gain kelompok eksperimen lebih besar daripada rata-rata indeks gain kelompok kontrol, yaitu 0,473 pada kelompok eksperimen dan 0,299 pada kelompok kontrol. Dilihat dari simpangan bakunya, kelompok eksperimen memiliki simpangan baku lebih besar dibandingkan dengan kelompok kontrol, yaitu 0,19 untuk kelompok eksperimen dan 0,17 untuk kelompok kontrol. Rata-rata indeks gain kedua kelompok tersebut dapat digambarkan sebagai berikut:

Gain
0.6 0.4 0.2 0 0,473 0,299 Eksp Kont

5.1 Deskripsi Data Hasil Penelitian


1) Data Hasil Pretes Data pretes ini diperoleh dari tes tertulis berupa pilihan ganda sebanyak 20 soal.Berdasarkan hasil penelitian dan

kelompok

Gambar. Rata-rata Indeks Gain Kelompok Eksperimen dan Kelompok Kontrol 5.2 Analisis Data Hasil Penelitian Deskripsi data hasil penelitian yang telah diuraikan sebelumnya merupakan gambaran secara umum dari suatu data sampel tanpa ada kesimpulan yang dapat digeneralisasikan. Selanjutnya, agar data dapat digunakan sebagai dasar pengambilan keputusan yang lebih bermakna, maka perlu dilakukan pengujian data sampel secara statistik. 1) Analisis Data Hasil Pretes a. Uji Normalitas Uji normalitas dalam penelitian ini menggunakan uji Uji Chi Kuadrat karena sampel berukuran besar (30), dan menggunakan taraf signifikansi 5%. Hasil uji normalitas data skor pretes pada kelompok eksperimen dan kelompok kontrol adalah sebagai berikut: Tabel. Hasil Uji Normalitas Data Pretes X2 hitung X2 hitung Keterangan 2hitung 2tabel => 3,011 11,07 Normal 2hitung 2tabel => Tidak 22,493 11,07 Normal

c.

Uji Perbedaan Dua Rata-rata Hasil uji statistik parametrik data skor postes dengan menggunakan uji tdapat dilihat pada tabel berikut: Tabel. Hasil Uji Perbedaan Dua Rata-Rata Data Postes

Berdasarkan Tabel diatas terlihat bahwa nilai signifikansinya (2-tailed) adalah 0,022, karena lebih kecil dari 0,025 berarti terdapat perbedaan antara rata-rata kemampuan akhir siswa dalam pelajaran TIK pada kelompok eksperimen dan kelompok kontrol. 3) Analisis Data Peningkatan Hasil Belajar (Gain) a. Uji Normalitas Hasil uji normalitas data skor postes pada kelompok eksperimen dan kelompok kontrol adalah sebagai berikut: Tabel. Hasil Uji Normalitas Data Indeks Gain Kelompok X2 hitung X2 hitung Keterangan 2hitung 2tabel => Eksperimen 7,573 11,07 Normal 2hitung 2tabel => Kontrol 29,997 11,07 Tidak Normal b. Uji Perbedaan Dua Rata-Rata Hasil uji statistik non parametrik data gain dengan menggunakan uji Mann-Whitney dapat dilihat pada tabel berikut: Tabel. Hasil Uji Kesamaan Dua Rata-Rata Indeks Gain

Kelompok Eksperimen Kontrol

b. Uji Homogenitas Berdasarkan hasil uji homogenitas terhadap nilai varians pretes dan varians postes eksperimen diperoleh Fhitung < Ftabel (1,23 < 1,85), Maka dapat dikatakan bahwa nilai pretes kelompok eksperimen dan kontrol yang digunakan pada penelitian ini adalah homogen. c. Uji Kesamaan Dua Rata-Rata Hasil uji statistik non parametrik Mann-Whitney.data skor pretes pada kelompok eksperimen dan kelompok kontrol dapat dilihat pada tabel berikut: Tabel. Hasil Uji Kesamaan Dua Rata-Rata Datapretes

Berdasarkan tabel diatas terlihat bahwa nilai signifikansinya (2-tailed) adalah 0,001, karena lebih kecil dari 0.025berarti terdapat perbedaan antara rata-rata peningkatan hasil belajar siswa dalam pelajaran TIK pada kelompok eksperimen dan kelompok kontrol. 5.3Data Hasil observasi 1) Observasi Aktifitas Guru Berdarkan hasil observasi aktivitas guru selamapembelajaran di kelas secara umum sudah sesuai dengan tahapan kegiatan pembelajaran dengan model learning cycle 5E.Pada pertemuan pertama terdapat tahapan yang tidak terlaksana, dikarenakan guru baru pertama kali menggunakan model learning cycle 5E, selain itu karena penguasaan kelas yang dilakukan guru masih belum maksimal dan belum bisa mengatur alokasi waktu dengan baik. Dengan melakukan perbaikan pada pertemuan berikutnya, maka kegiatan pembelajaran berjalan dengan baik. 2) Observasi Aktivitas Siswa Aktivitas siswa pada pertemuan pertama masih kurang aktif, hal tersebut dapat dilihat adanya aspek-aspek yang tidak terlaksana mungkin dikarenakan belum terbiasa dengan model pembelajaran learning cycle 5E. Namun pada pertemuan selanjutnya siswa mulai terbiasa dan aktif dalam mengikuti pembelajaran dengan model learning cycle 5E. 5.4 Data Angket Hasil dari pengolahan angket respon siswa terhadap penerapan model pembelajaran learning cycle pada mata pelajaran TIK adalah sebagai berikut: Pernyataan ke-1 Bagaimana pendapat anda dengan model pembelajaran yang telah kita lakukan?. Dari pernyataan tersebut

pada tabel diatasterlihat bahwa nilai signifikansi (sig. 2tailed) dengan uji Mann-Whitneyadalah 1,00. Lebih besar dari 0,05, yang berarti H0 diterima. Maka dapat disimpulkan bahwa tidak ada perbedaan skor pretesantara kelompok kontrol dan eksperimen. 2) Analisis Data Hasil Postes a. Uji Normalitas Hasil uji normalitas data skor postes pada kelompok eksperimen dan kelompok kontrol adalah sebagai berikut: Tabel. Hasil Uji Normalitas Data Postes Kelompok X2 hitung X2 hitung Keterangan 2hitung 2tabel => Eksperimen 5,542 11,07 Normal 2hitung 2tabel => Kontrol 11,055 11,07 Normal b. Uji Homogenitas Berdasarkan hasil uji homogenitas terhadap nilai varians postes diperoleh Fhitung < Ftabel (1,46 < 1,85), Maka dapat dikatakan bahwa nilai postes kelompok eksperimen dan kontrol yang digunakan pada penelitian ini adalah homogen.

diperoleh data bahwa sebanyak 5 orang (16,67%) menyatakan sangat setuju, 23 orang (76,67%) menyatakan setuju, dan 2 orang (6,67%) menyatakan ragu-ragu. Pernyataan ke-2 Apakah proses belajar TIK dengan model pembelajaran learning cycle5E, telah membingungkan anda saat belajar. Dari pernyataan tersebut diperoleh data bahwa sebanyak 1 orang (3,33%) menyatakan sangat setuju, 6orang (20%) menyatakan setuju, 15 orang (50%) menyatakan ragu-ragu, 6 orang (20%) menyatakan tidak setuju, dan 2 orang (6,67%) menyatakan sangat tidak setuju. Pernyataan ke-3 Selama belajar TIK dengan menggunakan pembelajaran model learning cycle 5E, apakah motivasi belajar anda jadi lebih meningkat. Dari pernyataan tersebut diperoleh data bahwa sebanyak 8 orang (26,67%) menyatakan sangat setuju, 20 orang (66,67%) menyatakan setuju, dan 2 orang (6,67%) menyatakan ragu-ragu. Pernyataan ke-4 Dengan menggunakan pembelajaran model learning cycle 5E dalam pelajaran TIK, telah membuat anda menjadi lebih aktif dalam belajar. Dari pernyataan tersebut diperoleh data bahwa sebanyak 6 orang (20%) menyatakan sangat setuju, 18 orang (60%) menyatakan setuju, dan 6 orang (20%) menyatakan ragu-ragu. Pernyataan ke-5 Dengan menggunakan pembelajaran model learning cycle 5E dalam pelajaran TIK, membuat anda menjadi lebih berani dalam mengajukan ataupun menjawab pertanyaan. Dari pernyataan tersebut diperoleh data bahwa sebanyak 11 orang (36,67%) menyatakan setuju, dan 19 orang (63%) menyatakan ragu-ragu. Pernyataan ke-6 Dengan menggunakan pembelajaran model learning cycle 5E dalam pelajaran TIK, membuat proses belajar mengajar menjadi lebih menyenangkan. Dari pernyataan tersebut diperoleh data bahwa sebanyak 4 orang (13,33%) menyatakan sangat setuju, 22 orang (73,33%) menyatakan setuju, dan 4 orang (13,33%) menyatakan ragu-ragu. Pernyataan ke-7 Dengan praktikum seperti pada pembelajaran model learning cycle 5E, membuat anda lebih terampil. Dari pernyataan tersebut diperoleh data bahwa sebanyak 4 orang (13,33%) menyatakan sangat setuju, 20 orang (66,67%) menyatakan setuju, 5 orang (16,67%) menyatakan ragu-ragu, dan 1 orang (3.33%) menyatakan tidak setuju. Pernyataan ke-8 Bagaimana pendapat anda dengan adanya kerja kelompok pada saat mengerjakan LKS?. Dari pernyataan tersebut diperoleh data bahwa sebanyak 13 orang (43.33%) menyatakan sangat setuju, 12 orang (40%) menyatakan setuju, 4 orang (13,33%) menyatakan ragu-ragu, dan 1 orang (3.33%) menyatakan tidak setuju. Pernyataan ke-9 Apakah dengan pembelajaran model learning cycle 5E lebih memudahkan anda dalam memahami materi pelajaran perangkat keras komputer. Dari pernyataan tersebut diperoleh data bahwa sebanyak 1 orang (3,33%) menyatakan sangat setuju, 22 orang (73.33%) menyatakan setuju, 6 orang (20%) menyatakan ragu-ragu, dan 1 orang (3.33%) menyatakan tidak setuju. Pernyataan ke 10 Bagaimana pendapat anda, apabila model pembelajaran learning cycle5E digunakan pada materi pelajaran TIK selanjutnya. Dari pernyataan tersebut diperoleh data bahwa sebanyak 5 orang (16,67%) menyatakan sangat setuju, 18 orang (60%) menyatakan setuju, dan 7 orang (23,33%) menyatakan raguragu. Berdasarkan persentase keseluruhan jawaban siswa kelompok eksperimen terhadap angket yang berjumlah 10 pernyataan, dapat disimpulkan bahwa siswa menunjukkan respon positif terhadap

pembelajaran TIK dengan menggunakan model pembelajaran learning cycle5E.

6. KESIMPULAN
Berdasarkan hasil analisis data yang telah dilakukan dapat disimpulkan: 1) Terdapat perbedaan rerata hasil belajar antara siswa yang mengikuti pembelajaran TIK dengan menggunakan model learning cycle 5E dengan siswa yang pembelajarannya menggunakan model konvensional. Hal ini dilihat dari hasil rata-rata postes yang diperoleh kelompok eksperimen yaitu 14,87 dan kelompok kontrol yaitu 13,37. Selain itu diperkuat dengan uji parametrik terhadap data postes menggunakan uji tIndependent Sample t testdiperoleh nilai signifikansi (2tailed) sebesar 0,022 berada pada daerah penolakkan, karena lebih kecil dari 0,025. 2) Terjadi peningkatan hasil belajar pada siswa kelompok eksperimen yang mengikuti pembelajaran TIK dengan model pembelajaran learning cycle 5E dibandingkan dengan siswa kelompok kontrol yang menggunakan model pembelajaran konvensional. Hal ini dapat dilihat dari rata-rata peningkatan prestasi belajar (gain) kelompok eksperimen yaitu 0,473 dan kelompok kontrol yaitu 0,299. Selain itu diperkuat dengan uji non parametrik terhadap gain menggunakan uji Mann-Whitney diperoleh nilai signifikansi sebesar 0,001 berada pada daerah penolakkan, karena lebih kecil dari 0,025.

7. REFERENSI
[1] Haerawati, Nen Ulfah. 2009. Penerapan Model Siklus Belajar 5E Untuk Meningkatkan Proses Berpikir Kritis Siswa Pada Pembelajaran Fisika. Skripsi Jurusan Pendidikan Fisika UPI Bandung: Tidak diterbitkan Tim Redaksi Fokusmedia. 2006. Himpunan Peraturan Perundang-undangan Tentang Guru dan Dosen. Bandung : Fokusmedia. Munir. 2008. Kurikulum Berbasis Teknologi Informasi dan Komunikasi. Bandung: Alfabeta. Wahyono, Rembun. 2000. Pembelajaran Konsep Reproduksi Tumbuhan Biji Dengan Pendekatan Keterampilan Proses Untuk Meningkatkan Hasil Belajar Siswa. Tesis: Tidak diterbitkan. PPS UPI Bandung : tidak diterbitkan. Sudijono, Anas. 2007. Pengantar Evaluasi Pendidikan. Jakarta: PT. Raja Grafindo Persada. Trianto. 2007. Model-model Pembelajaran Inovatif Berorientasi Konstruktivistik. Jakarta: Prestasi Pustaka. Nuryani, R. 2005. Strategi Belajar Mengajar Biologi. IKIP Malang. Fauziatul Fajaroh dan I Wayan Dasna. 2007. Pembelajaran Dengan Model Siklus Belajar (Learning Cycle). Jurusan Kimia FMIPA UM. Tersedia di: http://lubisgrafura.wordpress.com/2007/09/20/pembelajarandengan-model-siklus-belajar-learning-cycle/ (05 November 2009, 9:04:34) Sugiyono. 2008. Metode Penelitian Pendidikan (Pendekatan Kuantitatif, Kualitatif, dan R&D). Bandung: Alfabeta Arikunto, Suharsimi. 2006, Prosedur Penelitian Suatu Pendekatan Praktik. Jakarta: PT.Rineka Cipta. Hake, R. R. 1998. Analyzing Change Gain Skores [online]. Tersedia: http://www.physics.indiana.edu/~sdi/AnalyzingChangeGain.pdf.

[2]

[3] [4]

[5] [6] [7] [8]

[9] [10] [11]