Anda di halaman 1dari 39

UJI ENHANCER SEBAGAI PENYEBAB KESALAHAN

POSITIF PADA STRIP UJI IMUNOKROMATOGRAFI


DENGAN UJI BANDING REAL-TIME PCR

RINA MAULIDIYAH

DEPARTEMEN ILMU DAN TEKNOLOGI PANGAN


FAKULTAS TEKNOLOGI PERTANIAN
INSTITUT PERTANIAN BOGOR
BOGOR
2016
PERNYATAAN MENGENAI SKRIPSI DAN
SUMBER INFORMASI SERTA PELIMPAHAN HAK CIPTA

Dengan ini saya menyatakan bahwa skripsi berjudul Uji Enhancer sebagai
Penyebab Kesalahan Positif pada Strip Uji Imunokromatografi dengan Uji Banding
Real-time PCR adalah benar karya saya dengan arahan dari komisi pembimbing
dan belum diajukan dalam bentuk apa pun kepada perguruan tinggi mana pun.
Sumber informasi yang berasal atau dikutip dari karya yang diterbitkan maupun
tidak diterbitkan dari penulis lain telah disebutkan dalam teks dan dicantumkan
dalam Daftar Pustaka di bagian akhir skripsi ini.
Dengan ini saya melimpahkan hak cipta dari karya tulis saya kepada Institut
Pertanian Bogor dan LPPOM MUI.
Bogor, Juli 2016

Rina Maulidiyah
NIM F24120063
ABSTRAK
RINA MAULIDIYAH. Uji Enhancer sebagai Penyebab Kesalahan Positif pada
Strip Uji Imunokromatografi dengan Uji Banding Real-time PCR. Dibimbing oleh
JOKO HERMANIANTO dan RAAFQI RANASASMITA.

Strip uji imunokromatografi adalah salah satu metode deteksi babi pada
pangan. Metode ini mendeteksi babi secara cepat, mudah, dan murah, namun
memiliki kemungkinan terjadi kesalahan positif/ positif palsu. LPPOM MUI
menduga adanya kesalahan positif deteksi babi menggunakan strip uji pada bumbu
dari restoran yang bersertifikat halal MUI. Penelitian ini bertujuan mengidentifikasi
bahan yang menyebabkan kesalahan positif dan mengkaji penyebabnya. Pengujian
dilakukan pada sampel enhancer α, β, dan γ (bebas babi/halal), menggunakan strip
uji A, B, C, D, dan E. Sampel β terhadap strip uji A, B, dan E pada bobot 0.5 g
menunjukkan hasil positif ditandai dengan adanya garis merah pada test line dan
control line, seolah-olah mengandung babi. Sampel α dan γ terhadap strip uji A
pada bobot masing-masing 1.0 g dan 0.75 g menunjukkan hasil positif ditandai
dengan adanya garis merah pada test line dan control line, seolah-olah mengandung
babi. Uji banding real-time PCR menunjukkan bahwa tidak terdeteksi DNA babi
pada sampel α, β, dan γ. Kesalahan positif disebabkan oleh antibodi yang tidak
spesifik pada beberapa strip uji sehingga menyebabkan pengikatan terhadap antigen
non-target dan sifat asam amino X yang bermuatan sehingga menyebabkan
terbentuknya ikatan elektrostatik mengikuti model induce-fit.

Kata kunci : kesalahan positif, imunokromatografi, deteksi cepat, real-time PCR

ABSTRACT

RINA MAULIDIYAH. Testing Enhancer as a Component that Cause Positive False


Result in Immuno-cromatography Strip Test by Comparing Real-time PCR method.
Supervised by JOKO HERMANIANTO and RAAFQI RANASASMITA.

Immuno-chromatography strip test is one of method to test pork content in


foods. It is quick, convenient, and cheap to be used, however this method may result
a positive false. LPPOM MUI suspected that some components in the seasoning
matrice from a restaurant that is halal-certified by MUI may produce positive false.
This research aims to identify types of components that is able to cause positive
false and investigate the possible reasons. The pork-free/halal claimed sample α, β,
and γ was tested by using A, B, C, D, dan E strip test. Sample β on A, B, and E strip
test at 0.5 g sample showed positive false that is marked red color on the test line
and control line, as if it contains pork. Sample α and γ on A strip test at 1.0 g and
0.75 g for each sample showed positive false that is marked red color on the test
line and control line, as if it contains pork. Real-time PCR test confirmed that pork
DNA was not detected in all samples. The result indicated that antibody was not
specific on some strip tests until caused cross-reaction and electrostatic feature’s X
amino acid followed induce-fit model.

Key word : positive false, immuno-chromatography, rapid detection, real-time PCR


UJI ENHANCER SEBAGAI PENYEBAB KESALAHAN
POSITIF PADA STRIP UJI IMUNOKROMATOGRAFI
DENGAN UJI BANDING REAL-TIME PCR

RINA MAULIDIYAH

Skripsi
sebagai salah satu syarat untuk memperoleh gelar
Sarjana Teknologi Pertanian
pada
Departemen Ilmu dan Teknologi Pangan

DEPARTEMEN ILMU DAN TEKNOLOGI PANGAN


FAKULTAS TEKNOLOGI PERTANIAN
INSTITUT PERTANIAN BOGOR
BOGOR
2016
PRAKATA

Puji syukur penulis panjatkan kehadirat Allah SWT yang telah memberikan
rahmat dan karunia-Nya sehingga karya ilmiah ini berhasil diselesaikan. Penulis
mengucapkan terimakasih kepada:
1. Ayahanda Muhammad Makmun, Ibunda Jumhuriyah Hayati, Adik Muhammad
Aulia Nurrohman, Keluarga Bani Jami’an, dan Keluarga Bani Maftuh, atas do’a
dan dukungangannya
2. Dr Ir Joko Hermanianto selaku dosen pembimbing dan Raafqi Ranasasmita,
MBiomed selaku pembimbing lapang yang telah banyak memberikan arahan,
bimbingan dan evaluasi kepada penulis
3. Dr Puspo Edi Giriwono STP MAgr selaku dosen penguji yang telah banyak
memberikan saran perbaikan
4. Dr Ir Lukmanul Hakim MSi selaku direktur LPPOM MUI dan Ir Sumunar Jati
selaku wakil direktur LPPOM MUI yang telah bersedia menerima penulis untuk
melaksanakan kegiatan magang
5. Prof Dr Hj Purwantiningsih Sugita MS selaku Kepala Bagian Research and
Development Halal LPPOM MUI
6. Heryani SSi, Nahdya Khairani MSc, Femi Edison STP, M. Nashih Ulwan AMd
selaku Staf Research and Development Halal LPPOM MUI, serta staf LPPOM
MUI lainnya yang tidak dapat penulis sebutkan satu persatu
7. Para Dosen, staf Unit Pelayanan Terpadu Departemen Ilmu dan Teknologi
Pangan, serta rekan-rekan seperjuangan ITP 49, atas kebaikannya kepada
penulis selama menempuh pendidikan di IPB
8. Semua pihak yang telah membantu penulis dalam menyelesaikan penelitian ini

Semoga karya ilmiah ini mampu memberikan manfaat.

Bogor, Juli 2016

Rina Maulidiyah
DAFTAR ISI

DAFTAR TABEL vi
DAFTAR GAMBAR vi
DAFTAR LAMPIRAN vi
PENDAHULUAN 1
Latar Belakang 1
Perumusan Masalah 2
Tujuan Penelitian 2
Manfaat Penelitian 2
TINJAUAN PUSTAKA 3
Antigen-Antibodi 3
Strip Uji Imunokromatografi 3
Real-time Polymerization Chain Reaction (Real-time PCR) 4
METODE 5
Bahan 5
Alat 5
Prosedur Penelitian 5
Rancangan Penelitian 8
HASIL DAN PEMBAHASAN 9
Spesifikasi Strip Uji Imunokromatografi 9
Hasil Pengujian Strip Uji Imunokromatografi 11
Hasil Pengujian Real-time PCR 15
Kesalahan Positif pada Strip Uji Imunokromatografi 17
SIMPULAN DAN SARAN 19
Simpulan 19
Saran 20
DAFTAR PUSTAKA 21
LAMPIRAN 26
RIWAYAT HIDUP 29
DAFTAR TABEL
1 Spesifikasi strip uji 9
2 Hasil pengujian sampel positif babi pada strip uji 10
3 Data hasil pengujian sampel menggunakan strip uji 12
4 Data hasil pengujian α dan γ menggunakan strip uji A 13
5 Data hasil pengujian asam amino X menggunakan strip uji 14
6 Data hasil pengujian sampel menggunakan real-time PCR 16
7 Perbandingan hasil pengujian strip uji dan real-time PCR 17

DAFTAR GAMBAR
1 Skema strip uji dan mekanisme kerjanya 4
2 Diagram alir proses ekstraksi DNA 7
3 Skema rancangan penelitian 8
4 Channel VIC 15
5 Channel FAM 16

DAFTAR LAMPIRAN

1 Data ekstraksi DNA dan contoh perhitungannya 26


2 Pengaturan real-time PCR dengan software Biorad CFX 26
3 Sekuen asam amino serum albumin dan troponin I 27
4 Model ikatan induced-fit 28
PENDAHULUAN

Latar Belakang

Masyarakat Indonesia pada tahun 2015 pernah diresahkan dengan


pemberitaan di media mengenai isu kehalalan bumbu yang digunakan oleh sebuah
restoran yang telah bersertifikat halal. Dua jenis bumbu dari restoran tersebut
teridentifikasi positif ketika diuji menggunakan metode pengujian cepat deteksi
babi atau strip uji imunokromatografi. Ketika dilakukan uji banding dengan real-
time PCR, ternyata tidak ditemukan unsur babi pada bumbu tersebut (Pratama
2015). LPPOM MUI menduga ada bahan tertentu yang dapat menyebabkan
kesalahan positif pada metode pengujian cepat deteksi babi.
Metode pengujian cepat deteksi babi berupa strip uji imunokromatografi
muncul sebagai alternatif metode yang memungkinkan deteksi babi dilakukan
secara cepat, mudah, dan murah (Rao dan Hsieh 2007; Depamede 2011; Ali et al.
2012). Berbagai metode pengujian deteksi babi sebenarnya telah banyak
dikembangkan seperti kromatografi, isoelectric focusing, FTIR, electronic nose,
LC-MS/MS, ELISA, dan real-time PCR (Nakyinsige et al. 2012; Danezis et al.
2016), namun metode deteksi tersebut memerlukan instrumen kompleks (misalnya
reagen/ microplate reader/ thermocycler), membutuhkan keahlian khusus, waktu
lama dan biaya tinggi.
Prinsip imunokromatografi pada awalnya banyak diaplikasikan pada bidang
kesehatan (Peruski A dan Peruski L 2003; Yuhi et al. 2006; Shi et al. 2008; Jiang
et al. 2011; Ji et al. 2011; Lin et al. 2011; Kim et al. 2015). Untuk tujuan deteksi
babi pada bidang pangan, prinsip ini baru diaplikasikan beberapa tahun terakhir.
Prinsip imunokromatografi memanfaatkan ikatan antigen-antibodi. Antibodi yang
telah terimobilisasi pada membran nitroselulosa mengikat kompleks antibodi
konjugat-antigen babi, selanjutnya hasil pengujian diamati secara visual dengan
adanya penanda.
Ikatan antigen-antibodi bersifat spesifik, namun ada kemungkinan terjadi
kesalahan positif yang disebabkan oleh kesalahan antibodi dalam mengenali
antigen lain. Kesalahan positif atau positif palsu adalah kondisi di mana hasil
pengujian seolah-olah menunjukkan adanya unsur babi pada sampel, namun fakta
sebenarnya tidak terkandung unsur babi. Kesalahan positif pada prinsip
imunokromatografi mungkin saja terjadi, seperti yang pernah terjadi pada kasus
terdeteksinya alergen kacang tanah pada cookies yang tidak mengandung kacang
tanah (material blank) (Schubert-Ullrich et al. 2009), terdeteksinya antigen
Treponema pallidum pada pasien yang tidak mengidap penyakit sifilis melainkan
mengalami gejala klinis hemolisis (Lin et al. 2011), dan terdeteksinya norovirus
pada feses bayi yang ketika diuji banding dengan RT-PCR menunjukkan hasil
negatif norovirus (Niizuma et al. 2013).
Pengujian cepat deteksi babi dengan strip uji imunokromatografi secara
umum digunakan untuk identifikasi awal adanya unsur babi pada sampel daging
mentah dan olahan daging. Proses identifikasi awal dilakukan untuk meminimalisir
tenaga dan mempercepat waktu pengujian. Sampel olahan daging memiliki peluang
lebih besar terjadi kesalahan positif disebabkan memiliki matriks pangan yang
beragam. Matriks pangan yang sering ada pada pangan olahan daging adalah bahan
2

berupa penguat cita rasa (enhancer). Enhancer ditambahkan dengan tujuan


meningkatkan intensitas rasa umami. Bahan tersebut ada pada bumbu restoran yang
mengalami kasus kesalahan positif deteksi babi. Diduga, enhancer merupakan
bahan yang dapat memberikan kesalahan positif deteksi babi. Enhancer yang secara
umum sering digunakan di restoran atau industri pangan meliputi jenis α, β, dan γ.
Pengujian deteksi babi merupakan bagian yang berhubungan dengan proses
sertifikasi halal, sehingga metode deteksi yang digunakan harus mampu
memberikan hasil akurat. Kesalahan positif deteksi babi menjadi sangat penting
untuk diperhatikan, karena hasil pengujian menjadi acuan dalam penentuan status
kehalalan pangan. Adanya kesalahan positif dapat menyebabkan kesalahan dalam
pengambilan keputusan. Oleh karena itu, perlu dilakukan pengujian untuk
mengidentifikasi bahan penyebab kesalahan positif pada metode pengujian cepat
deteksi babi.

Perumusan Masalah

Masalah yang dapat dirumuskan adalah terjadinya kesalahan positif deteksi


babi pada bumbu dari sebuah restoran yang telah bersertifikat halal menggunakan
strip uji imunokromatografi. Bumbu dari restoran tersebut terdiri dari beberapa
komponen, salah satunya bahan penguat cita rasa (enhancer). Enhancer merupakan
bahan yang diduga dapat memberikan kesalahan positif deteksi babi. Enhancer
digunakan secara luas di restoran dan industri pangan. Dikhawatirkan beberapa
jenis enhancer memberikan kesalahan positif deteksi babi pada produk restoran dan
industri pangan, sehingga menyebabkan kerancuan dalam penentuan status
kehalalan pangan.

Tujuan Penelitian

Penelitian ini bertujuan mengidentifikasi enhancer sebagai bahan yang


menyebabkan kesalahan positif pada strip uji imunokromatografi dan mengkaji
penyebabnya.

Manfaat Penelitian

Penelitian ini diharapkan mampu memberikan informasi mengenai bahan dan


penyebab kesalahan positif pada strip uji imunokromatografi sebagai metode
pengujian cepat deteksi babi. Diharapkan pula penelitian ini dapat menjadi panduan
bagi LPPOM MUI dan Lembaga Pemeriksa Halal (LPH) masa mendatang agar
lebih berhati-hati dalam penggunaan metode pengujian cepat deteksi babi berbasis
imunokromatografi terhadap jenis pangan tertentu.
3

TINJAUAN PUSTAKA

Antigen-Antibodi

Antibodi merupakan senyawa yang muncul akibat respon terhadap senyawa


asing (antigen). Struktur antibodi seperti huruf Y, tersusun atas empat rantai
polipeptida yaitu dua rantai ringan identik dan dua rantai berat identik. Polipeptida
merupakan molekul yang terususun atas residu asam amino. Sisi aktif antibodi
pengikat antigen terletak pada bagian ujung polipeptida masing-masing rantai
ringan dan rantai berat, disebut paratop (Mariuzza et al. 1987; Wang et al. 2007).
Antigen adalah polipeptida yang memiliki sisi aktif sebagai kunci pengenalan
antibodi, disebut epitop (Cong et al. 2013). Interaksi antigen-antibodi dipengaruhi
oleh residu asam amino pada epitop, ukuran epitop, muatan, ikatan elektrostatik,
hidrogen, dan sifat hidrofobik (Oss 1995; Ramaraj et al. 2012). Antibodi hanya
dapat mengikat antigen pada epitop spesifik. Semakin kompleks susunan asam
amino epitop, maka antigen semakin mudah terikat oleh antibodi (Kreier 2002).

Strip Uji Imunokromatografi

Strip uji imunokromatografi merupakan metode cepat deteksi babi yang


mengunakan prinsip interaksi antigen-antibodi dengan memanfaatkan daya
kapilaritas. Komponen utama pada strip uji adalah tempat sampel, conjugation pad,
membran nitroselulosa, dan adsorption pad (Sajid et al. 2014). Tempat sampel
berfungsi membantu tansportasi larutan sampel ke bagian conjugation pad.
Conjugation pad mengandung antibodi konjugat yang telah dilekatkan label
(penanda). Apabila terdapat antigen babi pada sampel, maka antigen tersebut
membentuk kompleks dengan antibodi konjugat. Membran nitroselulosa
merupakan media untuk migrasi, di mana antibodi primer dan sekunder
diimobilisasikan pada bagian test line dan control line. Test line berfungsi sebagai
tempat deteksi antigen babi, sedangkan control line berfungsi sebagai indikator
migrasi larutan sampel telah selesai.
Hasil strip uji dilihat secara visual pada test line dan control line. Apabila
terdapat garis merah pada test line dan control line, maka hasil positif. Apabila
terdapat garis merah hanya pada control line, maka hasil negatif. Apabila terdapat
garis merah hanya pada test line atau tidak terdapat garis merah baik pada test line
maupun control line, maka hasil dianggap invalid (Peruski A dan Peruski L 2003;
Yang et al. 2011). Format strip uji Imunokromatografi merupakan adaptasi dari
direct sandwich ELISA. Tipe strip uji Imunokromatografi berdasarkan migrasi
sampel dapat berupa lateral flow dan flow through. Tipe lateral flow memanfaatkan
daya kapilaritas sepanjang membran nitroselulosa untuk migrasi larutan sampel,
sedangkan tipe flow through menggunakan teknik filtrasi larutan sampel yang
diteteskan tempat sampel (Zhang et al. 2006).
4

Gambar 1 Skema strip uji dan mekanisme kerjanya

Gambar diatas mengilustrasikan skema strip uji (A). Antigen melekat pada
tempat sampel atau sampel pad (B1), selanjutnya antibodi konjugat membentuk
kompleks dengan antigen dan bermigrasi sepanjang membran nitoselulosa (B2).
Kompleks antibodi konjugat-antigen babi kemudian ditangkap oleh antibodi primer
pada test line dan kelebihannya ditangkap oleh antibodi sekunder pada control line
(B3) (Yang et al. 2011).

Real-time Polymerization Chain Reaction (Real-time PCR)

Real-time PCR merupakan teknik deteksi rantai gen atau segmen dari DNA.
Target segmen DNA babi Sus scrofa umumnya adalah sitokrom b (5’)-TAC CGC
CCT CGC AGC CGT ACA TCT C-(3’) (GenBank: GU135837.1). Prinsip kerja
real-time PCR adalah denaturasi, penempelan, dan pemanjangan (Emam dan Salam
2015). Denaturasi bertujuan memisahan ulir ganda menjadi ulir tunggal dengan
pemanasan pada suhu 90-100 0C (Farkas 2004). Dua ulir tersebut menjadi cetakan
untuk penempelan primer, umumnya terjadi pada suhu 55-65 0C. Selanjutnya,
proses pemanjangan produk PCR (amplikon) dilakukan oleh Taq-DNA polimerase.
Taq-DNA polimerase menyusun dNTP (bahan penyususun DNA berupa
nukleotida) menjadi ulir baru dengan sifat anti-sense (berlawanan dengan cetakan),
sehingga terbentuk dua ulir ganda yang saling terikat.
Proses denaturasi, penempelan, dan pemanjangan dilakukan berulang sampai
siklus tertentu, secara umum dilakukan amplifikasi sebanyak 35 siklus dalam satu
pengujian (Levin 2010). Amplifikasi meningkatkan jumlah DNA secara
eksponensial setiap siklusnya (Quinn et al 2011). Apabila amplifikasi 1 helai DNA
dilakukan dalam 35 siklus, maka copy DNA yang akan diperoleh sebanyak 235 (3.43
5

x 1010copy DNA). Hal tersebut menunjukkan bahwa real-time PCR merupakan


teknik deteksi babi dengan sensitifitas tinggi.
Real-time PCR memiliki probe yang ujungnya terikat pada quencher dan
reporter dye. Ketika terjadi hibridisasi akibat amplifikasi DNA, probe mengalami
hidrolisis oleh 5'3'-eksonuklease dari Taq-DNA polimerase. Pemisahan quencher
dan reporter dye akibat hidrolisis dapat meningkatkan sinyal fluoresensi.
Banyaknya DNA diketahui dari intensitas fluorosensi yang dipancarkan. Sinyal
selanjutnya diterima oleh detektor real-time PCR dan diterjemahkan menjadi grafik
yang dapat dibaca secara langsung (Quinn et al 2011).

METODE

Bahan

Bahan yang digunakan meliputi sampel enhancer α; β; γ; asam amino X yang


bebas babi/ telah bersertifikat halal MUI (nama dan merk sampel disamarkan
dengan persetujuan dosen pembimbing), sosis babi, air hangat, kit ekstraksi DNA
(buffer lisis; buffer pengikat; buffer pencuci; buffer pelarut; DTT; proteinase-K;
RNAse-A; etanol (pa) pro analisis 75%; etanol (pa) 100%), kit PCR (primer/ probe
mix [oligonukleotida; Tris-HCl; EDTA], PCR mix [MgCl2; dNTPS; DNA
Polimerase; gliserol; Tris-HCl; EDTA; Tris-basa], kontrol DNA [Oligonukleotida;
Tris-HCl; EDTA], dan air bebas DNA).

Alat

Alat yang digunakan adalah neraca analitik XB 220A, spatula disposable,


plastik, gelas cawan, gunting, tisu, botol steril, stopwatch, kamera, alat suntik,
milipor PTFE 0.45 µm, mikropipet 5 ml; 20 µl; 1000 µl, tip 5 ml; 20 µl; 1000 µl,
tabung 1.5 ml, tabung pengikat DNA, wadah penyangga tabung, thermoshaker,
vorteks SA8, alat sentrifugasi ST 16R dengan diameter 20 cm, inkubator dingin
N°ICE, sumur PCR, spektrofotometer genova nano, spinner SFC 1, strip uji
Imunokromatografi A, B, C, D, E (merk strip uji disamarkan dengan persetujuan
dosen pembimbing) dan real-time PCR CFX96.

Prosedur Penelitian

Strip uji A, B, D, E (Lateral Flow)


Sampel ditimbang pada bobot 0.5 g, kemudian dilarutkan ke dalam 3.0 ml
pelarut. Khusus strip uji B dan E digunakan air hangat (30-60 0C) sebagai pelarut,
lalu dikocok selama 30-60 detik atau sampai homogen. Setelah larutan homogen,
ujung membran nitroselulosa dicelupkan ke dalam permukaan larutan. Untuk strip
uji D, membran nitroselulosa tidak dicelupkan ke dalam ujung membran, melainkan
larutan diteteskan pada tempat sampel. Apabila larutan terlalu pekat, maka larutan
terlebih dahulu disaring menggunakan milipor dan alat suntik. Apabila larutan
6

masih tidak dapat bermigrasi pada membran nitroselulosa, maka larutan sampel
disentrifugasi. Setelah larutan sampel meresap ½ bagian membran, strip uji
diangkat dan diletakkan secara horizontal agar larutan bermigrasi pada membran
nitroselulosa. Pada saat strip uji diletakkan horizontal, stopwatch dinyalakan dan
mulai dihitung waktu pengujian. Strip uji diamati secara visual pada menit ke-25
(strip uji A), menit ke-10 (strip uji B), menit ke-15 (strip uji D), dan pada menit ke-
15 (strip uji E). Waktu pengujian yang digunakan sesuai dengan prosedur yang
ditentukan masing-masing produsen strip uji. Selanjutnya, hasil pengujian
didokumentasikan dengan kamera.

Strip uji C (Flow Through)


Sampel ditimbang pada bobot 0.5 g, kemudian dilarutkan ke dalam 3.0 ml
pelarut dalam vial. Larutan dikocok selama 30-60 detik sampai homogen, lalu
piringan kecil (filter) dimasukkan ke dalam larutan tersebut dan ditekan sampai ke
dasar vial. Supernatan diambil dengan pipet dan dipindahkan ke dalam pelarut
dilusi. Larutan selanjutnya dituangkan ke tempat sampel dan didiamkan sampai
terserap sempurna. Agen pewarna kemudian dituangkan ke tempat sampel dan
didiamkan sampai terserap sempurna. Sisa berupa padatan yang tidak terserap
kemudian dibersihkan. Selanjutnya, strip uji diamati secara visual pada menit ke-
60. Hasil pengujian didokumentasikan dengan kamera.

Real-time PCR
Komponen sampel yang digunakan dalam pengujian real-time PCR berupa
ekstrak DNA, sehingga perlu dilakukan ekstraksi DNA. Proses ekstraksi DNA pada
penelitian ini menggunakan kit ekstraksi, seperti yang dijelaskan diagram alir pada
gambar 2. Setelah diperoleh ekstrak DNA, selanjutnya dilakukan pengukuran
konsentrasi menggunakan spektrofotometer genova nano. Apabila diperoleh
konsentrasi melebihi 10 ng/µl, maka ekstrak DNA diencerkan dengan air bebas
DNA (Lampiran 1). Ekstrak DNA sebanyak 6µl dipipet ke dalam sumur PCR,
selanjutnya ditambahkan kit PCR berupa premiks dengan komposisi primer mix 4µl
dan PCR mix 10µl. Untuk memperoleh campuran homogen, dilakukan metode up-
down pipetting pada saat pemipetan premiks. Kontrol positif (oligonukleotida) dan
kontrol negatif air bebas DNA dimasukkan ke dalam salah satu sumur PCR sebagai
kontrol pengujian.
Selama proses persiapan pengujian, suhu DNA dalam sumur PCR harus
dalam keadaan dingin, sehingga digunakan N°ICE untuk menjaga suhu. Sumur
PCR ditutup, kemudian dilakukan pengecekan keberadaan gelembung udara.
Apabila ada gelembung udara, sumur PCR dihomogenisasi menggunakan spinner.
Sumur PCR dimasukkan kedalam tempat uji real-time PCR, lalu dilakukan
pengaturan komputer dengan software Bio-rad CFX manager. Pengaturan yang
dilakukan adalah berupa desain penempatan sumur PCR, pemberian kode sampel,
pengaturan suhu dan waktu, volume larutan sampel, serta pengaturan banyaknya
siklus amplifikasi. Desain penempatan sampel tergantung kebutuhan. Suhu dan
waktu yang digunakan adalah 950C (10 menit), 950C (15 menit), 610C (40 menit).
Volume larutan sampel yang digunakan adalah 20 µl dan penambahan siklus
amplifikasi sebanyak 34 siklus. Pada akhir setiap siklus dilakukan pembacaan
sinyal fluoresensi satu kali. Setelah pengaturan komputer selesai, selanjutnya
dilakukan proses pengujian.
7

Sampel 200g

Buffer lisis 3.2µ, DTT


Pencampuran 3.2µl, Proteinase-K
16µl, RNAse-A16µl
Inkubasi 65 0C 1 jam

Pencampuran Buffer pengikat 320µl

Inkubasi 65 0C 10 menit

Pencampuran Etanol pa 100% 320µl

Transfer 600µl larutan ke tabung


pengikat DNA

Filtrat Sentrifugasi 12000 rpm 2 menit

Pencampuran Buffer pencuci 500µl

Filtrat Sentrifugasi 12000 rpm 2 menit

Pencampuran Etanol pa 75% 500µl

Filtrat Sentrifugasi 12000 rpm 1 menit

Sentrifugasi 12000 rpm 3 menit


Filtrat

Pencampuran Buffer pelarut 100µl

Sentrifugasi 8000 rpm 3 menit

Ekstrak DNA

Gambar 2 Diagram alir proses ekstraksi DNA


8

Rancangan Penelitian

Pengujian menggunakan strip uji Imunokromatografi dilakukan sebagai


langkah identifikasi awal deteksi babi. Pengujian bahan α, β, dan γ dilakukan pada
bobot 0.5 g menggunakan strip uji A, B, C, D dan E. Bobot 0.5 g dipilih karena
berada pada kisaran yang berlaku untuk semua strip uji. Sampel yang tidak
menunjukkan hasil positif (muncul garis merah pada test line dan control line), diuji
kembali pada bobot yang lebih tinggi untuk mengetahui kemungkinan hasil positif
pada bobot yang berbeda. Sifat strip uji imunokromatografi adalah kualitatif atau
semi-kualitatif. Sifat semi-kualitatif bergantung pada bobot yang digunakan,
konsentrasi/bobot lebih tinggi berpeluang memberikan hasil positif dengan
intensitaf lebih tinggi pada sampel (Ou et al. 2016). Selanjutnya, dilakukan uji
menggunakan real-time PCR sebagai metode pembanding deteksi unsur babi.
Pengujian sampel mengikuti skema berikut.

Sampel

_ Identifikasi awal
menggunakan strip uji A,
B, C, D, dan E

Uji banding
+
menggunakan
real-time PCR

Tidak ada Ada unsur


unsur babi babi pada
Terjadi
pada sampel kesalahan sampel
positif

Gambar 3 Skema rancangan penelitian


9

HASIL DAN PEMBAHASAN

Spesifikasi Strip Uji Imunokromatografi

Strip uji yang digunakan memiliki spesifikasi yang berbeda-beda.


Kemampuan deteksi strip uji dipengaruhi oleh target antigen, limit deteksi, pelarut,
bobot yang digunakan, dan waktu deteksi (Tabel 1).

Tabel 1 Spesifikasi strip uji


Bobot Bobot yang
Jenis Limit Waktu
yang digunakan
No Strip Target deteksi Pelarut Deteksi
disarankan (gram)
uji (W/W) (menit)
(gram) α β γ
a
1 A Processed 0.5% Kit A 0.5-1.0 0.5 0.5 0.5 25
Air
2 B Universal 0.1% 0.1-0.5 0.5 0.5 0.5 10
hangatb
3 C Universal 1.0% Kit Ca 0.5 0.5 0.5 0.5 60
a
4 D Processed 0.5% Kit D 0.5 0.5 0.5 0.5 15
Air
5 E Processed 0.1% 0.5-1.0 0.5 0.5 0.5 15
hangatb
Sumber: Manual alat
a
Tidak dijelaskan komposisi kit secara pasti
b
Air hangat yang digunakan pada suhu 30-600 C

Strip uji A, D, dan E memiliki spesifikasi khusus untuk pengujian sampel


daging mentah (raw) dan olahan daging (processed), sedangkan strip uji B dan C
tidak memiliki spesifikasi khusus untuk jenis pangan tertentu (universal). Target
deteksi antigen babi untuk kategori daging mentah dan olahan daging berbeda.
Secara umum, target deteksi antigen babi untuk daging mentah adalah serum
albumin (Sakakibara et al 2012; Lim dan Ahmed 2016), sedangkan untuk olahan
daging adalah troponin I (Chen dan Hsieh 2000, 2001, 2002). Troponin I
merupakan protein berukuran 24 KD yang diambil dari jaringan otot dan bersifat
tahan terhadap pemanasan. Pada strip uji universal, target deteksi antigen babi
adalah troponin I (Zvereva et al. 2015). Serum albumin tidak cocok untuk target
deteksi pada olahan daging karena mudah terdenaturasi oleh proses pemanasan
(Lim dan Ahmed 2016)
Masing-masing strip uji memiliki limit deteksi yang berbeda, sesuai dengan
klaim produsen. Limit deteksi adalah konsentrasi analit terendah yang dapat
dideteksi oleh strip uji. Pelarut yang digunakan pada masing-masing strip uji juga
berbeda. Hal tersebut mempengaruhi kemampuan ekstraksi antigen pada sampel.
Pelarut strip uji A, C, dan D berupa kit yang disediakan oleh produsen, sedangkan
strip uji B dan E menggunakan air hangat pada suhu 30-600 C. Komposisi pelarut
yang disediakan produsen tidak dapat diketahui, namun reagen yang sering
digunakan untuk proses ekstraksi antigen mamalia adalah campuran air hangat,
Natrium Klorida (NaCl), Phosphate Buffer Saline (PBS), dan
Ethylenediaminetetraacetic Acid (EDTA) (Rao dan Hsieh 2007).
10

Bobot sampel yang disarankan oleh produsen strip uji berkisar 0.1-1.0 g.
Bobot 0.5 g dipilih karena berada pada kisaran yang berlaku untuk semua strip uji.
Dilihat dari waktu deteksinya, strip uji C memiliki waktu pengujian yang cukup
lama. Pada kurun waktu tersebut dikhawatirkan ada kontaminasi dari lingkungan,
sehingga pengujian sedapat mungkin dihindarkan dari hal yang berpeluang
memberikan kontaminasi.
Pengujian sampel positif babi (olahan daging babi/ sosis babi) dilakukan
terhadap strip uji A, B, D, dan E, untuk memastikan bahwa strip uji benar-benar
dapat mendeteksi babi. Penelitian setiawan (2009) juga telah membuktikan bahwa
strip uji A dapat medeteksi adanya babi. Pada penelitian ini, tidak dilakukan
pengujian sampel positif babi terhadap strip uji C, karena strip uji tersebut tidak
tersedia. Hasil pengujian dapat dilihat sebagai berikut.

Tabel 2 Hasil pengujian sampel positif babi pada strip uji


Sampel Sampel olahan daging babi
Strip Uji A B D E
Bobot (g) 0.5 0.5 0.5 0.5
Gambar

Hasil a P P P P
Waktu Deteksi
5 2 7 5
(Menit)
Garis merah Garis merah Garis merah Garis merah
control line control line control line control line
Catatan
dan Test line dan Test dan Test line dan Test line
jelas line jelas jelas jelas
a
P = positif/terdeteksi, N = negatif/tidak terdeteksi

Keempat stri uji memberikan hasil positif pada sampel positif babi, yang
ditandai dengan adanya garis merah pada test line dan control line. Munculnya garis
merah pada test line dan control line menandakan bahwa terdapat kandungan babi
pada sampel olahan daging babi. Warna garis merah berbeda-beda yang diberikan
strip uji dipengaruhi oleh jenis (label) penanda yang digunakan dan pelarut yang
digunakan. Secara umum, jenis label yang sering digunakan pada deteksi babi
adalah Gold Nano Particle (GNP) (Ali et al. 2012).
11

Hasil Pengujian Strip Uji Imunokromatografi

Data hasil pengujian sampel pada bobot 0.5 g menunjukkan bahwa sampel β
memberikan hasil positif seolah-olah mengandung unsur babi terhadap strip uji A,
B, dan E, yang dibuktikan dengan adanya garis merah pada test line dan control
line (tabel 3). Garis merah test line pada strip uji A, B, dan E masing-masing muncul
pada menit ke-2, ke-12, dan ke-2. Garis merah test line pada sampel β terlihat jelas
terhadap strip uji A, namun terlihat samar terhadap strip uji B dan E. Intensitas garis
merah test line dipengaruhi oleh pelarut yang digunakan strip uji. Pelarut strip uji
A berupa kit yang disediakan oleh produsen, sedangkan pelarut strip uji B dan E
berupa air hangat. Pelarut yang menggunakan reagen tertentu seperti EDTA
memiliki kemampuan ekstraksi yang lebih baik dibandingkan air hangat, sehingga
mampu meningkatkan sensitifitas strip uji. Semakin sensitif suatu strip uji, maka
semakin mudah mendeteksi komponen (Rao dan Hsieh 2007).
Sampel α dan γ pada bobot 0.5 g menunjukkan hasil negatif terhadap semua
strip uji, yang dibuktikan dengan hanya adanya garis merah pada control line.
Pengujian sampel α terhadap strip uji B pada menit ke-15 menunjukkan adanya
garis merah pada test line, namun pada menit ke-25 dan seterusnya garis merah
tersebut hilang, sehingga hasil pengujian dianggap negatif. Hilangnya garis merah
testline disebabkan oleh ikatan antigen-antibodi tidak spesifik. Antibodi mengenali
komponen lain sebagai komponen babi, namun ketika ikatan tidak kuat maka ikatan
tersebut lepas. Ikatan yang mempengaruhi antigen-antibodi adalah ikatan non-
kovalen (Oss et al. 1995).
Sifat semi-kualitatif strip uji bergantung pada konsentrasi/bobot yang
digunakan. Konsentrasi/bobot yang lebih tinggi berpeluang memberikan hasil
positif dengan intensitas lebih tinggi (Ou et al. 2016). Oleh karena itu, sampel α dan
γ diuji coba pada bobot 1.0 g menggunakan strip uji A, untuk mengetahui peluang
sampel memberikan hasil positif pada bobot yang lebih tinggi. Sampel α
memberikan hasil positif terhadap strip uji A seolah-olah mengandung babi,
sedangkan sampel γ menunjukkan hasil invalid pada bobot 1.0 g. Hasil invalid
(tidak ada garis merah pada test line dan control line) disebabkan oleh larutan
sampel γ terlalu pekat, sehingga larutan tidak bermigrasi pada membran
nitroselulosa. Sampel γ diuji kembali dengan menurunkan bobot menjadi 0.75 g.
Sampel γ merupakan sampel yang berisi padatan sulit dilarutkan, sehingga butuh
perlakuan khusus dalam tahap persiapan sampel seperti disaring atau disentrifugasi.
Hasil pengujian sampel dilihat pada tabel 4.
12

Tabel 3 Data hasil pengujian sampel menggunakan strip uji


Jenis Strip
A B C D E
Uji
Sampel α β γ α β γ α β γ α β γ α β γ
Bobot (g) 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5
Gambar

Hasil a N P N N P N N N N N N N N P N
Waktu
Deteksi - 2 - - 12 - - - - - - - - 2 -
(Menit)
Test line
Test pada Test
Test line
Catatan - line - menit - - - - - - - - line -
samar
jelas ke-25 samar
hilang
a
P = positif/terdeteksi, N = negatif/tidak terdeteksi
13

Tabel 4 Data hasil pengujian α dan γ menggunakan strip uji A

Strip Uji A
Sampel α γ
Bobot (g) 1.0 0.75

Gambar

Hasil a P P
Waktu Deteksi (Menit) 15 25
Test line Test line
Catatan
jelas Samar
a
P = positif/terdeteksi, N = negatif/tidak terdeteksi

Sampel α dan γ menunjukkan hasil positif terhadap strip uji A pada bobot
masing-masing 1.0 g dan 0.75 g, seolah-olah mengandung babi. Garis merah pada
test line masing-masing muncul pada menit ke-15 dan menit ke-25. Garis tersebut
pada sampel α terlihat jelas, sedangkan pada sampel γ terlihat samar. Hasil
pengujian membuktikan bahwa sampel α dan γ juga dapat memberikan hasil positif
terhadap strip uji A, seolah-olah seperti mengandung babi. Sampel α dan γ
kemungkinkan memberikan hasil positif pada strip uji lain, namun pada penelitian
ini tidak dilakukan.
Sampel α merupakan hasil hidrolisis protein berupa asam amino dan sebagian
kecil polipeptida. Metode hidrolisis protein di industri secara umum dengan metode
penambahan HCl, karena menghasilkan rendemen tinggi dan lebih murah dari
metode enzimatis. Komponen yang paling dominan pada sampel α adalah asam
amino X yaitu 26-55% (Koo et al. 2011). Sampel α yang dibuat menggunakan
metode hidrolisis memiliki fraksi asam amino X yang lebih tinggi, karena kondisi
asam dapat menyebabkan deaminasi asam amino lain menjadi asam amino X
(Aaslyng et al. 1998; Jarunrattanari 2005).
Sampel β merupakan hasil dari reaksi penggaraman asam amino X dan
natrium hidroksida. Asam amino dapat diperoleh dari proses ekstraksi sumber alami,
sintesis kimia, fermentasi, atau katalisis enzimatik. Untuk memperoleh asam amino
X, proses ekstraksi yang digunakan adalah fermentasi. Asam amino X
disuspensikan kedalam air, selanjutnya dilarutkan. Natrium hidroksida
ditambahkan pada larutan agar terjadi proses netralisasi. Hasil netralisasi berupa
sampel β dimurnikan dengan karbon aktif, selanjutnya dikristalkan. Hasil berupa
kristal β kemudian diberi perlakuan vakum pada suhu 600 C sebelum didinginkan.
14

Sampel β disentrifugasi dan dikeringkan untuk menghasilkan bubuk sampel β.


Presentase asam amino X pada sampel β berkisar 47.0-92.7% (Ault 2004; Populin
et al. 2007).
Sampel γ merupakan hasil pemecahan dari yeast cell. Inti sel dari yeast cell
yang terekstrak berupa asam amino (sebagian besar asam amino X), peptida,
nukleotida, dan komponen terlarut lainnya (Tanguler dan Erten 2008; Makendran
2012; Sayed et al. 2012). Presentase asam amino X pada sampel γ berkisar 5%
(Eurasyp [tahun tidak diketahui]). Berdasarkan komposisi dari ketiga sampel,
komponen khas yang sama dari ketiganya adalah asam amino X yang merupakan
pembentuk rasa umami. Asam amino X dicurigai sebagai salah satu komponen
yang dapat dikenali antibodi sehingga menyebabkan reaksi silang. Reaksi silang
adalah terjadinya ikatan antibodi dengan antigen selain antigen target (Holmseth et
al. 2005).
Intensitas garis merah pada test line yang berbeda pada ketiga sampel
disebabkan kandungan asam amino X yang berbeda. Sampel β memiliki presentase
asam amino X paling tinggi, sampel α memiliki presentase asam amino X lebih
tinggi dibandingkan sampel γ, sehingga lebih mudah dikenali antibodi. Pengujian
asam amino X terhadap strip uji selanjutnya dilakukan pada bobot 0.5 g, untuk
mengetahui respon antibodi terhadap asam amino X murni (tabel 5).

Tabel 5 Data hasil pengujian asam amino X menggunakan strip uji

Sampel Asam amino X


Strip Uji A B C D E
Bobot (g) 0.5 0.5 0.5 0.5 0.5
Gambar

Hasil a P N N N N
Waktu
Deteksi 5 - - - -
(Menit)
Garis merah
control line
Catatan - - - -
dan Test line
sangat samar
a
P = positif/terdeteksi, N = negatif/tidak terdeteksi
15

Pengujian asam amino X memberikan hasil positif terhadap strip uji A,


namun garis merah pada test line dan control line yang diperoleh sangat samar. Hal
tersebut disebabkan sulitnya pendeteksian asam amino sebagai komponen
sederhana. Antibodi secara umum dapat mengenali antigen pada epitop yang terdiri
daei 15 residu asam amino. Apabila hanya ada satu asam amino murni yang diuji,
maka antibodi sangat sulit mendeteksi asam amino (Fabio et al. 2014).

Hasil Pengujian Real-time PCR

Uji banding menggunakan real-time PCR dilakukan untuk memastikan


adanya kesalahan positif deteksi babi pada ketiga sampel. Data hasil pengujian real-
time PCR dengan dua kali ulangan menunjukkan bahwa tidak terdeteksi DNA babi
pada sampel α, β dan γ. Hasil tersebut valid, karena semua sampel mengalami
respon positif pada channel VIC. Respon positif ditunjukkan dengan grafik yang
memotong baseline. VIC merupakan indikator bahwa tidak ada kerusakan baik
pada reagen maupun pada perangkat alat real-time PCR, serta tidak ada inhibisi dari
sampel. Apabila semua sampel menunjukkan reaksi pada channel ini, maka
pengujian dianggap valid. Grafik channel VIC memberikan respon positif pada
siklus yang berbeda-beda disebabkan peneliti kurang terlatih misalnya dalam proses
pemipetan reagen (Gambar 4).

α2

β2

NTC
γ2
α1
β1
Kontrol pos.
γ2

Gambar 4 Channel VIC

Channel FAM berisi pengujian kontrol dan hasil pengujian sampel. Kontrol positif
pada channel FAM memberikan respon garis merah yang memotong baseline
(positif) dan kontrol negatif memberikan respon berupa garis biru yang tidak
memotong baseline (negatif) (gambar 5). Hasil pengujian kontrol sesuai dengan
yang dipersyaratkan pada pengujian real-time PCR.
16

Kontrol pos.

α2
γ1
β2
α1
β1
γ2

NTC

Gambar 5 Channel FAM

Hasil pengujian sampel α, β, dan γ dengan dua ulangan dilihat berdasarkan


grafik channel FAM. Channel FAM menunjukkan bahwa tidak terdeteksi DNA
babi pada semua sampel, dibuktikan dengan garis yang tidak memotong baseline
(garis biru). Data hasil pengujian sampel menggunakan real-time PCR adalah
sebagai berikut (Tabel 6).

Tabel 6 Data hasil pengujian sampel menggunakan real-time PCR


Kontrol Kontrol Channel Channel
Sampel Keputusan
Positif Negatif VIC FAM
Tidak terdeteksi DNA
α + - + -
babi
Tidak terdeteksi DNA
β + - + -
babi
Tidak terdeteksi DNA
γ + - + -
babi
a
+ = grafik memotong baseline, - = grafik tidak memotong baseline

Uji banding menggunakan real-time PCR dipilih karena mampu mendeteksi


organisme/ komponen secara spesifik. Target primer yang mewakili DNA
organisme babi secara umum adalah DNA pada mitokondria yang disebut sitokrom
b. Sitokrom b memiliki sifat unik untuk setiap spesies dan bersifat kekal, sehingga
sulit kemungkinan terjadi mutasi (Erwanto et al. 2012). Metode ini juga mampu
mendeteksi secara sensitif, karena pengujian dilakukan pada copy DNA dengan
jumlah besar. Metode PCR banyak digunakan sebagai pembanding pengujian
metode lain, misalnya digunakan sebagai uji pembanding deteksi norovirus pada
feses bayi dengan metode imunokromatografi (Niizuma et al. 2013). .
17

Kesalahan Positif pada Strip Uji Imunokromatografi

Kesalahan positif/ positif palsu pada prinsip imunokromatografi terjadi ketika


ada reaksi silang antigen dengan antibodi. Reaksi silang adalah kondisi di mana
terjadi ikatan antara antibodi dengan antigen selain antigen target (Holmseth et al.
2005). Kesalahan positif deteksi babi pada penelitian ini diketahui dengan
membandingkan data hasil pengujian menggunakan strip uji imunokromatografi
dan real-time PCR. Sampel α, β, dan γ sebenarnya merupakan sampel bebas
babi/halal, namun untuk memastikan hasil pengujian, dilakukan uji banding dengan
real-time PCR. Perbandingan hasil pengujian sampel α, β, dan γ menggunakan strip
uji dan real-time PCR adalah sebagai berikut.

Tabel 7 Perbandingan hasil pengujian strip uji dan real-time PCR


Pengujian menggunakan strip ujia Pengujian Keterangan
Nama mengguna-
Sampel A B C D E kan real-
time PCR
Terjadi
α Pb N N N N N kesalahan
positif
Terjadi
β P P N N P N kesalahan
positif
Terjadi
γ Pc N N N N N kesalahan
positif
a
P = positif/terdeteksi, N = negatif/tidak terdeteksi pada bobot 0.5 g
b
pengujian sampel α pada bobot 0.5 g tidak memberikan hasil positif, namun pada 1.0 g
memberikan hasil positif terhadap strip uji A
c
pengujian sampel γ pada bobot 0.5 g tidak memberikan hasil positif, namun pada 0.75 g
memberikan hasil positif terhadap strip uji A

Reaksi silang terjadi karena peran antibodi dan antigen yang terlibat ikatan
dengan antibodi. Antibodi merupakan senyawa yang muncul akibat respon terhadap
senyawa asing atau antigen (Mark et al. 1996). Untuk keperluan penelitian
laboratorium, antibodi umumnya dibentuk dengan menginduksi antigen pada
hewan, sehingga muncul reaksi kekebalan berupa antibodi. Jenis antibodi dapat
berupa poliklonal dan monoklonal. Strip uji imunokromatografi dapat
menggunakan keduanya, namun strip uji pada penelitian ini tidak memberikan
informasi jenis antibodi yang digunakan. Sebagai referensi, penelitian Depamede
(2011) menggunakan antibodi poliklonal untuk mendeteksi adulturasi babi pada
daging sapi dan daging ayam.
Antibodi poliklonal secara umum dibuat dengan menginjeksikan antigen
target ke dalam tubuh hewan seperti kelinci dan sapi. Pada hewan tersebut
dilakukan bleeding out untuk mengambil darah, selanjutnya antibodi diambil dari
serum darah. Antibodi poliklonal yang diperoleh memiliki sifat heterogen. Tipe
antibodi meliputi IgM, IgA, IgD, IgE, dan IgG, namun penyebutan antibodi secara
umum merujuk pada immunoglobulin (IgG) karena paling banyak ditemukan dalam
18

tubuh organisme. Antibodi memiliki susunan hipervariabel berupa HV1, HV2, dan
HV3. Tiga gulungan hipervariabel membentuk Complementarity Determining
Region (CDR) berkontribusi membentuk Antibody Binding System (ABS) atau
paratop yang berfungsi mengenali antigen. HV3 sering mengalami mutasi sehingga
sangat mudah dipengaruhi antigen (Rifai 2011).
Kesalahan positif deteksi babi pernah terjadi pada sampel gelatin dengan
metode dot blot. Metode dot blot merupakan uji untuk mendeteksi kespesifikan
antigen dan antibodi. Tiga jenis antigen yang diuji dalam percobaan tersebut adalah
negatif kontrol, gelatin sapi, dan gelatin babi. Antibodi yang digunakan adalah
antibodi poliklonal anti-gelatin babi. Pada gelatin sapi dan gelatin babi, pengujian
menunjukkan hasil positif seolah-olah mengandung babi. Peneliti menduga
campuran antibodi tidak murni sehingga dapat merespon antigen lain/ tidak spesifik
(Syamsuri dan Wardhani 2013). Hal tersebut yang kemungkinan terjadi pada
pengujian enhancer terhadap strip uji imunokromatografi.
Selain antibodi, reaksi silang disebabkan pula oleh komponen sebagai antigen
yang dapat dikenali oleh antibodi. Antigen merupakan polipeptida yang memiliki
sisi aktif pada bagian permukaan sehingga dapat dikenali antibodi, disebut epitop
atau antigen determinan (Wang et al. 2007; Rifai 2011; Cong Et al 2013). Epitop
dapat terbentuk dari turunan karbohidrat, lemak, asam nukleat dan protein, namun
secara umum berasal dari turunan protein. Meskipun epitop dapat berupa selain
protein, namun tetap membutuhkan protein pembawa agar dapat dikenali oleh
antibodi. Berdasarkan komposisi dari ketiga sampel, asam amino X merupakan
komponen yang paling potensial menyebabkan kesalahan positif, karena jumlahnya
dominan dan merupakan turunan protein (asam amino dan/ peptida). Salah satu
faktor yang paling mempengaruhi pengenalan antibodi terhadap antigen adalah
urutan asam amino pada epitop (Coico dan Sunshine 2009).
Asam amino X dijumpai cukup banyak pada sekuen asam amino serum
albumin dan troponin I babi jenis Sus scrofa, sebagai antigen target strip uji
imunokromatografi berdasarkan data www.uniprot.org (Lampiran 3). Asam amino
X diwakili dengan huruf E pada sekuen asam amino tersebut. Namun demikian,
keberadaan asam amino X yang relatif banyak pada sekuen serum albumin dan
troponin I tidak dapat digunakan sebagai acuan utama dalam menentukan asam
amino X sebagai kunci pengenalan sebagai antigen babi.
Asam amino X merupakan komponen yang bersifat antigenik (dapat
menginduksi antibodi). Kemampuan antibodi dalam mengikat asam amino X
diteliti oleh Huisman et al. (2010). Pada penelitian tersebut beberapa hapten
(molekul kecil penginduksi antibodi) dikonjugasikan dengan protein pembawa
sehingga dapat dikenali oleh antibodi. Salah satu molekul hapten yang digunakan
adalah asam amino X. Hasil pengujian tersebut menunjukkan bahwa asam amino
X memiliki affinitas yang cukup baik terhadap antibodi. Titer yang digunakan pada
asam amino X untuk berikatan dengan antibodi lebih sedikit dibandingkan titer
pada hapten lain. Titer atau konsentrasi yang sedikit digunakan menandakan
kemudahan asam amino X dalam berikatan dengan antibodi. Jumlah titer pada asam
amino X yang sedikit disebabkan oleh sifat muatan negatif yang ekstrim pada asam
amino X.
Asam amino X merupakan asam amino yang bermuatan sehingga mampu
membentuk ikatan elektrostatik. Ikatan elektrostatik adalah salah satu ikatan yang
dapat menyumbang energi tinggi, sehingga menjadi salah satu ikatan yang paling
19

dominan pada antigen-antibodi (Oss 1995; Ramaraj et al. 2012). Pada penelitian ini
tidak dilakukan pengujian mengenai mekanisme ikatan asam amino X dan antibodi
secara molekular. Namun demikian, apabila dilihat secara teori pola interaksi reaksi
silang asam amino X mengikuti model ikatan induced-fit (lampiran 4). Model
ikatan induced-fit terjadi ketika affinitas antigen-antibodi rendah. Affinitas adalah
kemampuan mengikat antigen terhadap antibodi (Bax et al. 2012).
Apabila ikatan antigen-antibodi cenderung memiliki affinitas rendah di mana
antibodi tidak spesifik dan ada komponen asing dengan sifat elektrostatik, maka
komponen tersebut dapat mengubah sisi aktif pada antibodi. Selanjutnya, sisi aktif
antibodi berubah menjadi komplemen komponen dan mengikat komponen tersebut
(Wang et al. 2007; Coico dan Sunshine 2009). Penelitian lain juga menyebutkan
banhwa asam amino X memiliki affinitas yang tinggi terhadap antibodi (Weaver et
al. 1998; Carozzi et al. 2008). Selain itu, asam amino X bersama asam amino tirosin
dan alanin sering menyebabkan reaksi silang ketika diteliti dengan detektor isotop
I135 (Zeiger dan Maurer 1982). Oleh karena itu, asam amino X merupakan
komponen yang paling mungkin menyebabkan reaksi silang pada enhancer.
Sampel β merupakan sampel yang mudah mengalami reaksi silang
dibandingkan sampel lainnya. Hal tersebut karena sampel β memiliki presentase
asam amino X paling tinggi diantara sampel lainnya. Pengujian deteksi babi pada
sampel β merk lain menggunakan strip uji A pernah dilakukan oleh internal
laboratorium halal LPPOM MUI. Hasil pengujian menunjukkan bahwa sampel β
memberikan hasil positif terhadap strip uji A. Uji banding menggunakan real-time
PCR menunjukkan hasil negatif babi berdasarkan penelitian internal laboratorium
halal LPPOM MUI, sehingga hal tersebut berhasil membuktikan bahwa sampel β
merk lain pun dapat menyebabkan kesalahan positif terhadap strip uji
imunokromatografi.

SIMPULAN DAN SARAN

Simpulan

Sampel β memberikan hasil positif terhadap strip uji A, B, dan E pada bobot
0.5 g ditandai dengan adanya garis merah pada test line dan control line seolah-olah
mengandung babi, padahal sampel bebas babi/halal. Hal yang sama terjadi pula
pada sampel α dan γ terhadap strip uji A pada bobot masing-masing 1.0 g dan 0.75
g. Ketiga sampel diuji banding dengan real-time PCR dan memberikan hasil negatif
babi, sehingga dapat dipastikan bahwa ketiga sampel bebas babi. Sampel β
terindikasi mengalami kesalahan positif jika diuji dengan strip uji A, B, dan E.
Sampel α dan γ terindikasi mengalami kesalahan positif jika diuji dengan strip uji
A. Reaksi silang yang terjadi disebabkan kemungkinan antibodi yang tidak spesifik
dan asam amino X sebagai komponen yang meyebabkan kesalahan positif.
Antibodi yang tidak spesifik menyebabkan pengikatan terhadap antigen non-target,
sementara sifat asam amino X yang bermuatan menyebabkan terbentuknya ikatan
elektrostatik mengikuti model induce-fit.
20

Saran

Beberapa hal yang disarankan penulis meliputi:


1. Perlu dilakukan pengujian sampel positif babi pada semua strip uji
imunokromatografi
2. Perlu dilakukan penelitian untuk menentukan rentang bobot sampel yang dapat
memberikan kesalahan positif pada α, β, dan γ pada berbagai strip uji
3. Perlu kehati-hatian dalam pengujian sampel yang mengandung bahan penguat
cita rasa (yang mengandung unsur umami). Jika diperoleh hasil positif pada strip
uji imunokromatografi, sebaiknya dilakukan uji banding dengan metode yang
lebih spesifik misalnya real-time PCR untuk memastikan adanya unsur babi.
4. Perlu dilakukan penelitian menggunakan X-ray crystallography untuk
mengetahui interaksi asam amino X dengan antibodi, untuk mengetahui
mekanisme pengikatannya.
21

DAFTAR PUSTAKA

Ali ME. Hashim U, Mustafa s, Che Man YB, Islam KN. 2012. Gold nanoparticle
sensor for the visual detection of pork Adulteration inmeatball formulation.
Journal of Nanomaterial. Doi:10.1155/2012/103607.
Aaslyng MD, Marten M, Poll L, Mielsen PM, Flyge H, Larsen LM. 1998. Chemical
and sensory characterization of hydrolyzed vegetable protein, a savory
flavoring. Journal Agricultural Food Chemistry. 1998 (46): 481-489. Doi:
10.1021/jf970556e.
Ault A. 2004. The monosodium glutamate story: the commercial production of β
and other amino acids. Journal of Chemical Education. 81 (3): 347-355.
Bax HJ, Keeble AH, Gould HJ. 2012. Cytokinergic IgE action in mast cell
activation. Frontiers in Immunology. 3 (2012): 229. Doi:
10.3389/fimmu.2012.00229.
Carozzi VA, Canta A, Oggioni N, Ceresa C, Marmioroli P, Konvalinka J, Zoia C,
Bossi M, Ferrarese C, Tredici G, Cavaletti G. 2008. Expression and
distribution of ‘high affinity’ glutamate transporters GLT1, GLAST, EAAC1
and peripheral nervous systemof GCPII in the rat. Journal of Anatomy. 213
(2008): 539-546. Doi: 10.1111/j.1469-7580.2008.00984.x.
Chen FC, Hsieh YHP. 2000. Detection of pork in heat-processed meat products by
monoclonal antibody-based ELISA. Journal of AOAC International. 83
(2000): 1.
Chen FC, Hsieh YHP. 2001. Separation and characterization of a porcine-specific
thermostable muscle protein from cooked pork. Journal of Food Science. 66
(2001): 6.
Chen FC, Hsieh YHP. 2002. Porcine troponin I: a thermostable species marker
protein. Meat Science. 61 (2002): 55-60.
Choico R, Sunshine. 2015. Immunology: A Short Course 7th Edition. New York
(USA): John Willey and Sons Ltd. Hlm: 29-36.
Cong Y, Yi H, Qing Y, Li L. 2013. Identification of the critical amino acid residues
of immunoglobulin E and immunoglobulin G epitopes on as1-casein by
alanine scanning analysis. Journal Diary Science 96: 6870-6876. Doi:
10.3168/jds.2013-688.
Danezis GP, Tsagkaris AS, Camin F, Brusic V, Georgiou CA. 2016. Food
authentication: techniques, trends & emerging approaches. Doi:
10.1016/j.trac.2016.02.026.
Depamede SN. 2011. Development of a rapid immunodiagnostic test for pork
components in raw beef and chicken meats: a preliminary study. Media
Peternakan. 34 (2): 83-87. Doi: 10.5398/medpet.2011.34.2.83.
Emam SM, Salam OH. 2015. Real-time PCR: A rapid and sensitive method for
diagnosis of dermatophyte induced onychomycosis, a comparative study.
Alexandria Journal of Medicine, siap terbit. Doi:
10.1016/j.ajme.2015.05.001.
Erwanto Y, Abidin MZ, Sismindari, Rohman A. 2012. Pig species identification in
meatballs using polymerase chain reaction-retriction fragment length
polymorphism for halal authentication. International Food Reseach Journal.
19 (3): 901-906.
22

[Eurasyp] European Association for Specialty Yeast Product. [tahun terbit tidak
diketahui][Internet]. [diunduh 2016 Maret 30]. Tersedia pada:
www.yeastextract.info.
Fabio D, Tea P, Klaus Z, Walter K. 2014. Structure of allergens and structure based
epitope predictions. Methods. 66 (2014): 3–21. Doi:
10.1016/j.ymeth.2013.07.024.
Farkaz D H. 2004. DNA from A to Z. Washington DC (USA): American Assosiation
for Clinical Chemistry Press.
Holmseth S, Dehnes Y, Bjornsen LP, Boulland JL, Furness DN, Bergles D, Danbolt
NC. 2005. Specificity of antibodies: unexpected cross-reactivity of antibodies
directed against the excitatory amino acid transporter 3 (EAAT3).
Neuroscience. 136 (2005) 649–660. Doi:
10.1016/j.neuroscience.2005.07.022.
Huisman H, Wynveen P, Setter PW. 2010. Studies on the immune response and
preparation of antibodies against a large panel of conjugated
neurotransmitters and biogenic amines: specific polyclonal antibody response
and tolerance. Journal of Neurochemistry. 112 (2010): 829-841. Doi:
10.1111/j.1471-4159.2009.06492.x.
Jarunrattanasri A, Cadwallader KR, Theerakulkait C. 2005. Aroma and amino acid
composition of hydrolyzed vegetable protein from rice bran. Symposium
series American Chemical Society, Washington DC.
Ji K, Chen J, Gao C, Liu X, Xia L, Liu Z, Li L, Yang S. 2011. A two-site
monoclonal antibody immunochromatography assay for rapid detection of
peanut allergen Ara h1 in Chinese imported and exported foods. 29 (2011);
541-545. Doi: :10.1016/j.foodchem.2011.04.055.
Jiang T, Liang Z, Ren W, Chen J, Zhi X, Qi G, Yang Y, Liu Z, Liu X, Cai X. 2011.
Development and validation of a lateral flow immunoassay using colloidal
gold for the identification of serotype-specific foot-and-mouth disease virus
O, A and Asia 1. 171 (2011): 74-80. Doi: 10.1016/j.jviromet.2010.10.002.
Kim YR, Park S, Fagutao F, Nho SW, Jang HB, Cha IS, Thompson KD, Adams A,
Bayley A, Jung TS. 2015. Development of an immunochromatography assay
kit for rapid detection of ranavirus. Journal OF Virology Methods. 223
(2015): 33-39. Doi: 10.1016/j.jviromet.2015.07.009.
Koo SH, Bae IY, Lee S, Lee DH, Hur BS, Lee HG. 2011. Evaluation of wheat
gluten hydrolysates as taste-active compounds with antioxidant activity.
Journal Food Science and Technology. Doi: 10.1007/s13197-011-0515-9.
Kreier J P. 2002. Infection, Resistance, and Immunity 2th Edition. New York
(USA): Taylor & Francis.
Levin R E. 2010. Rapid Detection and Characterization of Foodborne Pathogens
by Molecular Techniques. Boca Raton (FL): CRC Press Taylor & Francir
Group.
Lim SA, Ahmed MU. 2016. A label free electrochemical immunosensor for
sensitive detection of porcine serum albumin as a marker for pork adulteration
in raw meat. Food Chemistry, siap terbit. Doi:
http://dx.doi.org/10.1016/j.foodchem.2016.03.063.
Lin L, Tong M, Fu Z, Dan B, Zheng W, Zhang C, Yang T, Zhang Z. 2011.
Evaluation of a colloidal gold immunochromatography assay in the detection
of Treponema pallidum specific IgM antibody in syphilis serofast reaction
23

patients: a serologic marker for the relapse and infection of syphilis.


Diagnostic Microbiology and Infectionus Disease. 70 (2011): 10-16.
Doi:10.1016/j.diagmicrobio.2010.11.015.
Makendran R. 2012. Title: Enzymatic Conversion of RNA from Γ to Guanosine
Monophosphate (a flavoring agent). Sweeden (SE): Department of Chemical
and Biological Engineering Chalmers University of Technology.
Mariuzza, RA, Phillips Sev, Poljak Rj. 1987. The structural basis of antigen
antibody recognition. Annual Review Biophysics Chemistry. 16 (1987): 139-
59.
Mark D B, Mark A D, Smith C M. 1996. Biokimia Kedokteran Dasar: Sebuah
Pendekatan Klinis. Pendit BU, penerjemah. Jakarta (ID): EGC. Terjemahan
dari: Basic Medical Biochemistry: A Clinical Approach.
Nakyinsige K, Che Man Y, Sazili AQ. 2012. Halal authenticity issues in meat and
meat products. Meat Science. 91 (2012): 207-2014.
doi:10.1016/j.meatsci.2012.02.015.
Niizuma T, Obinata K, Ikari H, Kamata A, Lee T, Kinoshita K, Shimizu T. 2013.
False positive of an immunochromatography kit for detection of norovirus in
neonatal feces. Journal Infect Cemother. 19 (2013): 171-173. Doi:
10.1007/s10156-012-0439-y.
Oss CJ. 1995. Hydrophobic, hydrophilic and other interactions in epitope-paratope
binding. Molecular Immunology. 32 (3): 199-211.
Ou L, Lv Q, Wu C, Hao H, Zheng Y, Jiang Y. 2016. Development of a lateral flow
immunochromatographic assay for rapid detection of Mycoplasma
pneumoniae-specific IgM in human. Journal of Microbiological Methods.
124 (2016): 35-40. Doi: 10.1016/j.mimet.2016.03.006.
Populin T, Moret S, Truant S, Conte LS. 2007. A survey on the presence of free
glutamic acid in foodstuffs, with and without added monosodium glutamate.
Food Chemistry. 104 (2007): 1712-1717. Doi:
10.1016/j.foodchem.2007.03.034.
Ramaraj T, Angel T, Dratz EA, Jesaitis AJ, Mumey B. 2012. Antigen–antibody
interface properties: composition, residue interactions, and features of 53
non-redundant structures. Biochimia et Biophysica Acta. 1824 (2012): 520-
532. Doi: 10.1016/j.bbapap.2011.12.007.
Rao Q, Hsieh YH. 2007. Evaluation of a commercial lateral flow feed test for rapid
detection of beef and sheep content in raw and cooked meats. Meat Science.
76 (2007): 489-494. Doi: 10.1016/j.meatsci.2006.12.011.
Rifa’i M. 2011. Autoimun & Bioregulator. Malang (ID): UB Press. Hlm 49-57.
Peruski AH, Peruski LF. 2003. Immunological methods for detection and
identification of infectious disease and biological warfare agents. Clinical and
Diagnostic Laboratory Immunology 10 (2013): 506-513. Doi:
10.1128/CDLI.10.4.506–513.2003.
Pratama 2015. Inilah dua sampel bumbu solaria yang dinyatakan haram. [Internet].
[diunduh 2016 Mar 30]. Tersedia pada:
http://kaltim.tribunnews.com/2015/11/24/ini-dua-sampel-solaria-yang-
dinyatakan-haram.
Quinn PJ, Markey BK, Leonard FC, FitzPatrick ES, Fanning S, Hartigan PJ. 2011.
Veterinary Microbiology and Microbial Disease 2nd Edition. New York
(USA): John Willey and Sons Ltd.
24

Sajid M, Kawde AN, Daud M. 2014. Designs, formats and applications of lateral
flow assay: a literature review. Journal of Saudi Chemical Society, siap terbit.
Doi: 10.1016/j.jscs.2014.09.001.
Sakakibara Y, Mochiduki K, Shibai Y, Iwamoto H. 2012. Method of detecting raw
pork and detection kit therefor. United States Paten Application Publication.
15 (2012).
Sayed ET, Saito Y, Tsujiguchi T, Nakagawa N. 2012. Catalytic activity of Γ in
biofuel cell. Journal of Bioscience and Bioengineering. 114 (5): 521-525.
Doi:10.1016/j.jbiosc.2012.05.021.
Schubert-ullrich P, Rudolf J, Ansari P, Geller B, Fuhrer M, Molonelli A,
Baumgartner S. 2009. Commercialized rapid immunoanalytical tests for
determination of allergenic food proteins: an overview. Analytical Bio-
analytical Chemistry. 395 (2009): 69-81. Doi: 10.1007/s00216-009-2715-y.
Setiawan LE. 2013. Validasi porcine detection kit pada analisis cemaran babi dalam
produk daging sapi [Skripsi]. Bogor (ID): Institut Pertanian Bogor.
Shi C, Zhao S, Zhang K, Hong G, Zhu Z. 2008. Preparation of colloidal gold
immunochromatography strip for detection of methamidophos residue.
Journal of Environmental Science. 20 (2008): 1392-1397.
Tanguler H, Erten H. 2008. Utilisation of spent brewer’s yeast for γ production by
autolysis: The effect of temperature. Food and Bioproduct Processing. 86
(2008): 317-321. Doi: 10.1016/j.fbp.2007.10.015.
Wang W, Singh S, Zeng DL, King K, Nema S. 2007. Antibody structure, instability,
and formulation. Journal of Pharmateutical Sciences. 96 (1). Doi:
10.1002/jps.
Weaver CD, Gundersen V, Verdoorn TA. 1998. A high affinity glutamate/aspartate
transport system in Pancreatic islets of langerhans modulates glucose-
stimulated Insulin secretion. Journal of Biological Chemistry. 273 (3): 1647-
1653.
Uniprot. Sequence Amino Acid. [Internet]. [diunduh 2016 Maret 30]. Tersedia pada:
www.uniprot.org.
Yang Q, Gong X, Song T, Yang J, Zhu S, Li Y, Cui Y, Li Y, Zhang B, Chang J.
2011. Quantum dot-based immunochromatography test strip for rapid,
quantitative and sensitive detection of alpha fetoprotein. Biosensors and
Bioelectronics. 30 (2011) 145–150. Doi: 10.1016/j.bios.2011.09.002.
Yuhi T, Nagatani N, Endo T, Kerman K, Takata M, Konaka H, Namiki M,
Takamura Y, Tamiya E. 2006. Gold nanoparticle based
immunochromatography using a resin modified micropipette tip for rapid and
simple detection of human chorionic gonadotropin hormone and prostate-
specific antigen. Science and Technology of Advanced Materials. 7 (2006):
276-281. Doi: 10.1016/j.stam.2005.12.008.
Zeiger AR, Maurer PH. 1982. Immunogenicity of four sequential their recognition
at the T lymphocyte and antibody levels polypeptides in inbred guinea-pigs
and antibody level. Journal of Immunogenetics. 9 (1982): 457-464.
Zhang C, Zhang Y, Wang S. 2006. Development of multianalyte flow-through and
lateral-flow assays using gold particles and horseradish peroxidase as tracers
for the rapid determination of carbaryl and endosulfan in agricultural
products. Journla Agricultural and Food Chemistry. 54 (2006): 2502-2507.
25

Zvereva E, Kovalev L, Ivanov A, Kovaleva, Zhedev A, Shishkin S, Lisitsyn A,


Chernukha I, Dzantiev B. 2015. Enzyme immunoassay and proteomic
characterization of troponin I as a marker of mammalian muscle compounds
in raw meat and some meat products. Doi: 10.1016/j.meatsci.2015.03.001.
26

LAMPIRAN

Lampiran 1 Data ekstraksi DNA dan contoh perhitungannya

Bobot Konsentrasi Kemurnian Vol Vol


Sampel Ulangan Keterangan
(mg) DNA DNA DNA air
1 0.2009 13.639 1.352 Perlu diencerkan 21.9 8.1
α Langsung diuji dengan
2 0.2120 10.761 1.249 - -
real-time PCR
Langsung diuji dengan
1 0.2096 7.379 1.349 - -
real-time PCR
β
Langsung diuji dengan
2 0.2099 3.299 3.055 - -
real-time PCR
1 0.2008 167.450 1.544 Perlu diencerkan 1.8 28.2
γ
2 0.2012 162.000 1.748 Perlu diencerkan 1.8 28.2

Sampel α ulangan 1
Perlu diencerkan pada konsentrasi 10 ng/µl sebanyak 30µl
V1 x M1 = V2 x M2
V2 x M2
V1 = 𝑀1
30µl x 10ng/µl
V1 =
13.639 𝑛𝑔/µl
V1 = 21.9 µl
Komposisi = 21.9µl ekstrak DNA dan 8.1µl air bebas DNA

Lampiran 2 Pengaturan real-time PCR dengan software Biorad CFX


27

Lampiran 3 Sekuen asam amino serum albumin dan troponin I

Babi (Sus Scrofa) Sapi (Bos Taurus)


>sp|P08835|ALBU_PIG Serum albumin >sp|P02769|ALBU_BOVIN Serum
OS=Sus scrofa GN=ALB PE=1 SV=2 albumin OS=Bos taurus GN=ALB PE=1
(Babi) SV=4 (Sapi)

MKWVTFISLLFLFSSAYSRGVFRRDTYKSEIAH MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIA
RFKDLGEQYFKGLVLIAFSQHLQQCPYEEHVKL HRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHV
VREVTEFAKTCVADESAENCDKSIHTLFGDKLC KLVNELTEFAKTCVADESHAGCEKSLHTLFGD
AIPSLREHYGDLADCCEKEEPERNECFLQHKND ELCKVASLRETYGDMADCCEKQEPERNECFLS
NPDIPKLKPDPVALCADFQEDEQKFWGKYLYEI HKDDSPDLPKLKPDPNTLCDEFKADEKKFWGK
ARRHPYFYAPELLYYAIIYKDVFSECCQAADKA YLYEIARRHPYFYAPELLYYANKYNGVFQECC
ACLLPKIEHLREKVLTSAAKQRLKCASIQKFGE QAEDKGACLLPKIETMREKVLASSARQRLRCA
RAFKAWSLARLSQRFPKADFTEISKIVTDLAKV SIQKFGERALKAWSVARLSQKFPKAEFVEVTK
HKECCHGDLLECADDRADLAKYICENQDTISTK LVTDLTKVHKECCHGDLLECADDRADLAKYIC
LKECCDKPLLEKSHCIAEAKRDELPADLNPLEH DNQDTISSKLKECCDKPLLEKSHCIAEVEKDA
DFVEDKEVCKNYKEAKHVFLGTFLYEYSRRHPD IPENLPPLTADFAEDKDVCKNYQEAKDAFLGS
YSVSLLLRIAKIYEATLEDCCAKEDPPACYATV FLYEYSRRHPEYAVSVLLRLAKEYEATLEECC
FDKFQPLVDEPKNLIKQNCELFEKLGEYGFQNA AKDDPHACYSTVFDKLKHLVDEPQNLIKQNCD
LIVRYTKKVPQVSTPTLVEVARKLGLVGSRCCK QFEKLGEYGFQNALIVRYTRKVPQVSTPTLVE
RPEEERLSCAEDYLSLVLNRLCVLHEKTPVSEK VSRSLGKVGTRCCTKPESERMPCTEDYLSLIL
VTKCCTESLVNRRPCFSALTPDETYKPKEFVEG NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFS
TFTFHADLCTLPEDEKQIKKQTALVELLKHKPH ALTPDETYVPKAFDEKLFTFHADICTLPDTEK
ATEEQLRTVLGNFAAFVQKCCAAPDHEACFAVE QIKKQTALVELLKHKPKATEEQLKTVMENFVA
GPKFVIEIRGILA FVDKCCAADDKEACFAVEGPKLVVSTQTALA

E = (61/607) x 100% = 10.05% E = (59/607) x 100% = 9.72%


>tr|Q4JH15|Q4JH15_PIG Troponin I >tr|F8SWQ8|F8SWQ8_BOVIN Fast
OS=Sus scrofa GN=TNNI2 PE=2 SV=1 skeletal troponin I OS=Bos
(Babi) taurus PE=2 SV=1 (Sapi)

MGDEEKRHRAITARRQHLKSVMLQIAATELEKE MGDEEKRHRAITARRQHLKSVMLQIAATELEK
VGRRESEKQNYLSEHCPPLHLPGSMSEVQELCK EEGRREAEKQNYLSGHCPPLHLPGSMSE
QLHAKIDAAEEEKYDMEIKVQKSTKELEDMNQK VQELCRQLHAKIDAAEEEKYDMEIRVQKSTKE
LFDLRGKFKRPPLRRVRMSADAMLKALLGSKHK LEDMNQKLFDLRGKFKRPPLRRVRMSAD
VCMDLRANLKQVKKEDTEKERDLRDVGDWRKNI AMLKALLGSKHKVCMDLRANLKQVKKEDTEKE
EEKSGMEGRKKMFETES RDLRDVGHWRKNIEEKSGMEGRKKMFES

E = (24/182) x 100% = 13.18% E = (23/180) x 100% = 12.78%


28

Lampiran 4 Model ikatan induced-fit


29

RIWAYAT HIDUP

Penulis dilahirkan di Rembang pada tanggal 23


Agustus 1994 dari ayah Muhammad Makmun dan ibu
Jumhuriyyah Hayati. Penulis adalah anak pertama dari dua
bersaudara. Tahun 2012 penulis lulus dari SMA N 1
Rembang dan pada tahun yang sama penulis lulus masuk
Institut Pertanian Bogor (IPB) melalui jalur Undangan,
diterima di Departemen Ilmu dan Teknologi Pangan,
Fakultas Teknologi Pertanian.
Selama mengikuti perkuliahan, penulis aktif
mengikuti organisasi dan kepanitiaan. Organisasi yang
pernah diikuti antara lain IPB Farmer Student 2013-2014,
Forum Bina Islami Fateta 2014-2015, Himpunan Keluarga Rembang di Bogor
2012-sekarang. Kepanitian yang pernah diikuti meliputi Fateta Art Contest 2013,
Lomba Cepat Tepat Ilmu Pangan XXI 2013, Career Development and
Training2014, Halal is Scientific 2014, Techno-F 2014, Baur 2014.
Penulis aktif mengikuti lomba karya ilmiah tingkat mahasiswa. Beberapa
prestasi yang pernah diraih adalah Juara II Lomba Karya Tulis Ilmiah Universitas
Diponegoro tahun 2015, Finalis 15 besar Scientific Great Moment 6 Universitas
Brawijaya tahun 2015, dan Finalis 10 Besar ITS Expo Paper Competition 2015.
Penulis aktif mengajar mata kuliah kimia Tingkat Persiapan Bersama IPB di
bimbingan belajar Mafia Clubs 2013-2015. Penulis juga pernah menjadi asisten
praktikum Pendidikan Agama Islam (PAI) tahun 2014-2015. Penulis merupakan
penerima beasiswa Goodwill International Scholarship 2015.