Anda di halaman 1dari 76

6/1/2016

12thDecember2011

DASARDASARILMUTANAH

DASARDASARILMUTANAH

DasarDasarIlmuTanah [http://dasar2ilmutanah.blogspot.com/]
[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Pada
Lahan Kering (Bagian 1) [http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah
padalahan_256.html]

(Bagian1dari5Tulisan)

I.PENDAHULUAN

1.1.TanahMineralMasamdanPenyebarannya
Tanah mineral masam banyak dijumpai di wilayah beriklim tropika basah, termasuk Indonesia. Luas areal tanah
bereaksi asam seperti podsolik, ultisol, oxisols dan spodosol, masingmasing sekitar 47,5, 18,4, 5,0 dan 56,4 juta ha
atauseluruhnyasekitar67%dariluastotaltanahdiIndonesia(Nursyamsietal,1996).Luasnyatanah
masam tersebut sebenarnya mempunyai potensi yang besar untuk pengembangan usaha pertanian, tetapi sampai
sekarang masih belum dapat dimanfaatkan secara maksimal mengingat beberapa kendala yang terdapat pada tanah
masam.Tanahordolainyangbersifatmasamadalahinseptisoldanentisol.
Keasaman tanah ditentukan oleh kadar atau kepekatan ion hidrogen di dalarn tanah tersebut. Bila kepekatan ion
hidrogendidalamtanahterlalutinggimakatanahakanbereaksiasam.Sebaliknya,bilakepekatanionhidrogenterIalu
rendahmakatanahakanbereaksibasa.PadakondisiinikadarkationOHlebihtinggidariionH+.
Tanah masam adalah tanah dengan pH rendah karena kandungan H+ yang tinggi. Pada tanah masam lahan kering
banyak ditemukan ion Al3+ yang bersifat masam karena dengan air ion tersebut dapat menghasilkan H+. Dalarn
keadaantertentu,yaituapabilatercapaikcjenuhanionAl3+tertentu,terdapatjugaionAlhidroksida,dengandemikian
dapatmenimbulkanvariasikemasamantanah(Yulianti,2007).
Didaerahrawatawa,tanahmasamumumnyadisebabkanolehkandunganasamsulfatyangtinggi.Didaerahinisering
ditemukantanahsulfatmasamkarenamengandung,lapisancatclayyangmenjadisangatmasarnbilarawadikeringkan
akibatsulfidamenjadisulfat.
KebanyakanpartikellempungberinteraksidenganionH+.Lempungjenuhhidrogenmengalamidekomposisispontan.
IonhidrogenmeneroboslapisanoktahedraldanmenggantikanatomAl.Aluminiumyangdilepaskankemudiandijerap
oleh kompleks lempung dan suatu kompleks lempungAlH terbentuk dengan cepat ion. Al3+ dapat terhidrolisis dan
menghasilkanionH.
ReaksitersebutmenyumbangpadapeningkatankonsentrasiionH+dalamtanah.Sumberkeasamanatauyangberperan
dalam menentukan keasaman pada tanah gambut adalah pirit (senyawa sulfur) dan asamasam organik. Tingkat
keasaman gambut mempunyai kisaran yang sangat lebar. Keasaman tanah gambut cendrung semakin tinggi jika
gambut semakin tebal. Asamasam organik yang tanah gambut terdiri dari atas asam humat, asam fulvat, dan asam
humin. Pengaruh pirit yaitu pada oksida pirit yang akan menimbulkan keasaman tanah hingga mencapai pH 2 3.
Pada keadaan ini hampir tidak ada tanaman budidaya yang dapat tumbuh baik. Selain menjadi penghambat
pertumbuhan tanaman, pirit menyebabkan terjadinya karatan (corrosion) sehingga mempercepat kerusakan alatalat
pertanianyangterbuatdarilogam.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

1/76

6/1/2016

DASARDASARILMUTANAH

Terdapat dua jenis reaksi tanah atau kemasaman tanah, yakni kemasaman (reaksi tanah) aktif dan potensial. Reaksi
tanah aktif ialah yang diukurnya konsentrasi hidrogen yang terdapat bebas dalam larutan tanah. Reaksi tanah inilah
yang diukur pada pemakaiannya seharihari. Reaksi tanah potensial ialah banyaknya kadar hidrogen dapat tukar baik
yangterjerapolehkomplekskoloidtanahmaupunyangterdapatdalamlarutan(Hanafiah,2007).
Selanjutnya dijelaskan juga oleh Hanafiah (2007) bahwa sejumlah senyawa menyumbang pada pengembangan reaksi
tanahyangasamataubasa.Asamasamorganikdananorganik,yangdihasilkanolehpenguraianbahanorganiktanah,
merupakankonstituentanahyangumumdapatmempengaruhikemasamantanah.Respirasiakartanamanmenghasilkan
C02 yang akan membentuk H2CO3 dalam air. Air merupakan sumber lain dari sejumlah kecil ion H+. Suatu bagian
yangbesardariionionH+yangdapatdipertukarkan.
H
HLempung>Lempung+3H+
H
IonionH+tertukarkantersebutberdisosiasimenjadiionionH+bebas.Dcrajationisasidandisosiasikedalamlarutan
tanahmenentukankhulukkemasamantanah.IonionH+yangdapatdipertukarkanmerupakanpenyebabterbentuknya
kemasamantanahpotensialataucadangan.Besarandarikemasamanpotensialinidapatditentukandengantitrasitanah.
Ionion H+ bebas menciptakan kemasaman aktif. Kemasaman aktif diukur dan dinyatakan sebagai pH tanah. Tipe
kemasamaninilahyangsangatmenentukandanmempengaruhipertumbuhandanperkembangantanaman.
Ada beberapa alat ukur reaksi tanah yang dapat digunakan. Alat yang murah ialah kertas lakmus yang bentuknya
berupa gulungan kertas kecil memanjang. Alat lain yang harganya sedikit mahal tetapi dapat dipakai berulang kali
denganhasilpengukuranlebihterjaminadalahpHtesterdansoiltester.
Pemakaian kertas lakmus sangat mudah, caranya yaitu : mengambil tanah lapisan dalam, lalu larutkan dengan air
murni (aquadest) dalam wadah. Biarkan tanahnya terendam di dasar wadah sehingga airnya menjadi bening kembali.
Setelah bening, air tersebut dipindahkan ke wadah lain secara hatihati agar tidak keruh. Selanjutnya, ambil sedikit
kertas lakmus dan celupkan ka dalam air tersebut. Dalam beberapa saat kertas lakmus akan berubah warna. Cocokan
warnapadakertaslakmusdenganskalayangadapadakemasankertaslakmus.Skalatersebuttelahdilengkapidengan
angkapHmasingmasingWarna.AngkapHtanahtersebutadalahangkadariwarnapadakemasanyangcocokdengan
warnakertaslakmusMisalnya,angkayangcocokadalah6makapHnya6.
Pemakaian soil tester untuk mendapat pH tanah agak berbeda dengan kertas lakmus. Bentuknya seperti pahat dan
berukuranpendek.Olehkarenaberbentukpadatan,adabagianyangruncing.Bagianruncinginilahyangditancapkan
ke tanah hingga pada batas yang dianjurkan. Setelah ditancapkan, sekitar tiga menit kernudian jarum skala yang
terletak di bagian atas alat ini akan bergerak. Angka yang ditunjukkan jarum tersebut merupakan pH dari tanah
tersebut.
PemakaianpHtesterlebihsederhanadansoiltesterpenggunaannyauntukmegukurnilaipHtanahdilahanyangtidak
terlaluluas,sekitar12ha.Walaupundemikian,alatinimasihbisadiandalkan.BagianyangmenunjukkanangkapH
berbentukkotakdenganjarumpenunjukangka.Bagiankotaktersebutdihubungkandenganbesisepanjang25cmyang
ujungnyaruncingdandilapisilogamelektroda.Besiinilahvangditancapkanketanah.Jumlahbesibisa12buah.
PenetapanpHtanahsekaranginidilakukandenganelektrodakaca.Elektrodainiterdiridarisuatubolakacatipisyang
berisiHCL.encer,dandidalamnyadisisipkankawatAgAgCl,yangberfungsisebagaielektrodanyadengantegangan
(voltase) tetap. Pada waktu bola kaca tersebut itu dicelupkan ke dalam suatu larutan, timbul suatu perbedaan antara
larutan di dalam bola dan larutan tanah di luar bola kaca. Sebelum pengukuran pH dilakukan, kedua elektroda
pertamatamaharusdimasukkankedalamsuatularutanyangdiketahuipHnya(misalnyakonsentrasiionH+=1g/L).
KegiataninidisebutpembakuanelektrodadanpetunjukpH(pHmeter).

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

2/76

6/1/2016

DASARDASARILMUTANAH

Dalam pengukuran pH, elektroda acuan dan elektroda indikator dicelupkan ke dalam suspensi tanah yang heterogen
yangterdiriataspartikelpartikelpadatterdispersidalamsuatularutanaquadest.Jikapartikelpartikelpadatdibiarkan
mengendap,pHdapatdiukurdalamcairansupernatantataudalamendapan(sedimen).Penempatanpasanganelektroda
dalamsupernatantbiasanyamemberikanbacaanpHyanglebihtinggidaripadapenempatandalamsedimen.Perbedaan
dalam bacaan pH ini disebut pengaruh suspensi. Pengadukan suspensi tanah sebelum pengukuran tidak akan
memecahkanmasalahtersebut,karenaprosedurinimemberikanbacaanyangtidakstabil(Hanafiah,2007).
Jenis tanah masam diantaranya terdapat pada tanah ordo Ultisol. Ultisol dibentuk oleh proses pelapukan dan
pembentukan tanah yang sangat intensif karena berlangsung dalam lingkungan iklim tropika dan subtropika yang
bersuhu panas dan bercurah hujan tinggi dengan vegetasi klimaksnya hutan rimba. Dalam lingkungan semacam ini
reaksi hidrolisis dan asidolisis serta proses pelindian (leaching) terpacu sangat cepat dan kuat. Asidolisis berlangsung
kuatkarenaairinfiltrasidanperkolasimengambilCO2hasilmineralisasibahanorganikberupaserasahhutandanhasil
pernafasanakartumbuhanhutan(Yulnafatmawita,2008).
Pelapukanmasamtanahmembebaskanbasadarimineraltanahsecaracepatapabiladidukungdengandayalindiyang
kuatmakaakanterbentuktanahyangmiskinharadanAlFesertaMnyangtinggidapatmeracuntanaman.Persoalan
akanbertambahberatjikabahaninduktanahsudahbersifatmasamkondisiinilahyangdijumpaidiSumatera.
Tanahultisolmemilikiciricirisebagaiberikut
1.pHrendah
2.KejenuhanAl,FedanMntinggi
3.Dayajerapterhadapfosfatkuat
4. Kejenuhan basa rendah kadar Cu rendah dalam tanah yang berasal dari bahan induk masam (feksil) atau batuan
pasir,Zncukupnamuntereluviasi.
5.KadarbahanorganikrendahdankadarNrendah
6.Dayasimpanairterbatas
7.Kedalamanefektifterbatas
8.Derajatagregasirendahdankemantapanagregatlemahbaikpadalahanberlerengmaupundatar.
Kerentananterhadaperosimembuattanahakansemakincepatberkurangkesuburannyaterutamapadalapisanatasdan
akanterakumulasidibagianyanglebihrendah(Notohadiprawiro,2006).
Kekahatan fosfor merupakan salah satu kendala terpenting bagi usaha tani di lahan masam. Hal ini karena sebagian
besarkoloiddanmineraltanahyangterkandungdalamtanahUltisolmempunyaikemampuanmenyematfosfatcukup
tinggi, sehingga sebagian besar fosfat dalam keadaan tersemat oleh Al dan Fe, tidak tersedia bagi tanaman maupun
biotatanah(HasanudindanGanggo,2004).
Menurut Subandi (2007) Tanah Ultisol umumnya mempunyai pH rendah yang menyebabkan kandunganAl, Fe,
danMn terlarut tinggi sehingga dapat meracuni tanaman. Jenis tanah ini biasanya miskin unsur hara esensial makro
sepertiN,P,K,Ca,danMgunsurharamikroZn,Mo,Cu,danB,sertabahanorganik.Meskipunsecaraumumtanah
Ultisol atau Podsolik Merah Kuning banyak mengandung Al dapat ditukar (Aldd) (2070%), namun hasil
penelitianmenunjukkan bahwa beberapa contoh tanah tersebut mengandung Aldd relatif rendah (< 20%). Tanah di
KP.KayuAgung,Indralaya,danPrabumulihSumateraSelatan,misalnya,mempunyaikejenuhanAlddberturutturut
11,08%, 1,01%, dan 17,26%, di Jawa Barat 13,40% dan 11 dari 28 contoh tanah lapisan atas yang berasal dari
LampungTengahjugamemilikikejenuhanAlddyangrendah.
Tekstur tanah ultisol bervariasi, berkisar dari pasiran (sandy) sampai dengan lempungan (clayey) .Fraksi lempung
tanah ini umumnya didominasi oleh mineral silikat tipe 1:1 serta oksida dan hidroksida Fe danAl , sehingga fraksi
lempungtergolongberaktivitasrendahdandayamemeganglengasjugarendah.Karenaumumnyamemilikikandungan
bahan organik rendah dan fraksi lempungnya beraktivitas rendah maka kapasitas tukar kation tanah (KTK) tanah
Podsolik juga rendah, sehingga relatif kurang kuatmemegang hara tanaman dan karenanya unsur haramudah tercuci.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

3/76

6/1/2016

DASARDASARILMUTANAH

Tanah Podsolik atau Ultisol termasuk tanah bermuatan terubahkan (variable charge), sehingga nilai KTK dapat
berubahbergantungnilaipHnya,peningkatanpHakandiikutiolehpeningkatanKTK,lebihmampumengikatharaK
dantidakmudahtercuci.
Ultisols(ultimusselesai)adalahtanahtanahyangberwarnakuningmerahdantelahmengalamipencucianyangsudah
lanjut.Dikenalluassebagaipodsolikmerahkuning.TanahtanahinimendominasilahankeringyangadadiSumatera,
Kalimantan dan Jawa. Total luas adalah sekitar 45.79 juta ha atau 24.3 % dari lahan Indonesia dan menyebar di
Kalimantan Timur (10.04 juta ha), Irian Jaya (7.62 juta), Kalimantan Barat (5.71 juta), Kalimantan Tengah (4.81
juta),danRiau(2.27jutaha).

Tanah Oxisols (oxide, oksida) adalah tanahtanah yang telah mengalami pencucian yang intensif dan miskin hara,
tinggikandunganALdanFe.SepertihalnyaUltisols,merekamendominasilahankeringdenganintensitascurahhujan
yangtinggi.Tanahtanahinisudahtua.Totalluastanahinisekitar14.11jutahaatau7.5%daritotallahanIndonesia
danmenyebardiSumateraSelatan(2.82jutaha),IrianJaya(2.41juta),KalimantanTengah(2.06juta),Kalimantan
Barat(1.79juta),Jambi(1.14juta),danLampung(1.01jutaha).
Spodosol merupakan tanah mineral yang mempunyai horizon spodik, suatu horizon dalam dengan akumulasi bahan
organic, dan oksidasi aluminium (Al) dengan atau tanpa oksidasi besi (Fe). Horizon iluvial ini dijumpai dibawah
horizon eluviasi, biasanya suatu horizon albik (berwarna merah muda, dengan demikian memadai bila disebut abu
kayu).Umumnyaterbentukdiwilayahiklimhumid,dibawahvegetasihutanbasahdanberkembangdaribahanendapan
dan batuan sediment kaya kuarsa yang dipercepat oleh adanya vegetasi yang menghasilkan serasah asam. Senyawa
senyawa organic tercuci kebawah bersama air perkolasi sehingga tanah permukaan menjadi berwarna terang, sedang
horizonbawahmenjadiberwarnagelapkarenaterjadinyaselaputorganicpadabutirbutirtanah.
Species tumbuhan yang berkadar ionion logam rendah, seperti pinus, kelihatannya merangsang pertumbuhan
spodosol. Dengan membusuknya daundaun yang rendah kadar ion logamnya, kemasaman tinggi akan terbentuk. Air
perkolasi membawa asamasam itu kebagian profil tanah yang lenig dalam. Horizon atas hancur karena pencucian
intensifolehasam.Sebagianbesarmineral,dipindahkankebagianlebihdalam.Oksidaaluminiumdanbesisertabahan
organicakandiendapkandihorizonbagianbawah,sehinggamenghasilkanprofilspodosolyangmenarik.
Mengikutidefinisikuantitatiftaksonomitanah,tanahdiklasifikasisebagaispodosol,apabilamemilikihorizondengan
semua sifat berikut : i. Tersementasi dengan kelembaban minimum 10 cm ii. Terletak langsung dibawah horizon
albik,pada50%ataulebihdarisetiappedonnyaiii.Batasatasberadadalamkedalaman<50cm,apabilakelasbesar
butirnyaberlempungkasar,skeletalberlempung,ataulebihhalusatau<200cm.Apabilakelasbesarbutirnyaberpasir,
dan iv. Batas bawah pada kedalaman 25 cm atau lebih, dari permukaan tanah. Dalam hal ini Spodosol mencakup
Tanahtanahyangdisebut:PodzoldanPodzolAirTanah.
SpodosoladalahTanahtanahyangsecaraunikberkembangdariendapanpasirkuarsa,dan/ataubatusedimenberupa
batu pasir kuarsa. Vegetasi alami yang tumbuh biasanya spesifik jenisnya. Yaitu vegetasi yang mampu berkembang
suburdiTanahmasam,sepertikantungSemardanPakupakuan.
Banyaktanahdaritimurlautamerikaserikat,termsukbagianutaramichigandanwinconsinyangdulunyadigolongkan
sebagai podsol, podsolik coklat dan podsol air tanah termasuk dalam spodosol. Sebagian dari mereka adalah orthod,
suatu spodosol umum. Akan tetapi beberapa adalah aquod, karena tanah ini selama musim tertentu jenuh dengan air
danmempunyaiciriciriyangberasosiasidengankebasahan,sepertiakumulasibahanorganikyangtinggi,becakbecak
pada horizon albik dan terbentuknya semacam lapisan keras (duripan) pada horizon albik. Daerahdaerah dari aquod
adalahFlorida.
Di Indonesia sendiri penyebaran endapan pasir dan batu pasir kuarsa yang secara geologis sangat luas, terdapat di
kalimantantengah,sertasetempatsetempatdikalimantanbaratdankalimantantimur.Dipulaulainnampaknyatidak
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

4/76

6/1/2016

DASARDASARILMUTANAH

luas penyebaranya dan setempat setempat terdapat disulawesi dan sumatra. Landform nya dimasukkan sebagai
dataran tektonik. Lanscape luas tanah spodosol seluruhnya diperkirakan 2,16 juta ha atau 1,1 % wilayah dataran
indonesia. Penyebaranya paling luas terdapat di kalimantan tengah sekitar 1,51 juta ha, kemudian dikalimantan barat
0,42jutadankalimantanTimur0,15jutaha.Disilawesitengah,tengah,selatandantenggaradipearkirakanterdapat
antara1125ribuha(Himatan,2006).
Dari empat subordo dalam kelompok spodosol, yang sering kali dibuka untuk pertanian adalah Haplorthods yaitu
spodosol yang terbentuk diwilayah beriklim basah, dengan curah hujan tunggi dan rezim kelembaban tanah udik dan
aquods yaitu spodosol basah atau jenuh air dengan drainase sangat terhambat dan sering kali mempunyai permukaan
airtanahberadadekatdenganpermukaantanah.
Data dari analisis tanah dari beberapa pedon Spodosol dari kalimantan tengah dan kalimantan barat menunjukkan
bahwa, Spodosol termasuk tanah dengan kelas besar butir berpasir, dengan kandungan fraksi pasir tinggi (6596 %).
Reaksi tanah menunjukkan masam ekstrem sampai sangat masam (pH 3,3 4,9) di seluruh lapisan tanah, cenderung
menaikkelapisanbawah.Padapermukaantanah,bisasanyaterdapatlapisanbahanorganik(OidanOe)tipis(510)cm
dan dibawahnya terdapat Horizon Al dengan kandungan bahan organik termasuk sedang sampai tinggi (3,1 9,5)%.
Langsung dibawah horizon ini terdapat horizon E, berwarna putih dan putih kekelabuan, dengan kandungan bahan
organikdangatrendah(0,20,95)%.RasioC/Ntergolongtinggi(1635).
Kandungan P dan Kpotensial di lapisan atas dan dilapisan bawah, sangat rendah sampai rendah. Jumlah basabasa
dapatditukartermasuksangatrendah(0,21,2cmol(+)/kgtanah).Kandungankeduaunsurharainidilapisanserasah,
selalulebihtinggidaripadalapisanbawahyangberpasir.KTKtanahsebagianbesarsangatrendahdilapisanpasir,dan
agaktinggisampaitinggipadalapisanserasahdandihorizonBs(sesquioksida).KBsemuanyasangatrendahsampai.
Potensi Kesuburan alami Spodosol dengan demikian disimpulkan sangat rendah sampai rendah penggunaan tanah
(Himatan,2006)

1.2.TinjauanUmumKesuburanTanah
Sebagaisumberdayaalamuntukbudidayatanaman,tanahmempunyaiduafungsi,yaitu:(1)sebagaisumberpenyedia
unsurharadanair,dan(2)tempatakarberjangkar.Salahsatuataukeduafungsiinidapatmenurun,bahkanhilang.
Hilangnya fungsi inilah yang menyebabkan produkvitas tanah menurun menjadi Tanah Marjinal. Dengan demikian,
TanahMarjinaluntukbudidayatanamanmerupakantanahyangmempunyaisifatsifatfisika,kimia,danbiologiyang
tidak optimal untuk kebutuhan pertumbuhan tanaman. Kalau tanah ini diusahakan untuk budidaya tanaman
memerlukan masukan teknologi, sehingga menambah biaya produksi. Selain itu, tanah ini juga tidak mempunyai
fungsiekologisyangbaikterhadaplingkungan.
Tanah Marjinal dapat terbentuk secara alami dan antropogenik (ulah manusia). Secara alami (pengaruh lingkungan)
yang disebabkan proses pembentukan tanah terhambat atau tanah yang terbentuk tidak sesuai untuk pertumbuhan
tanaman. Misalnya, bahan induk yang keras dan asam, kekurangan air, suhu yang dingin/membeku, tergenang dan
akumulasibahangambut,fraksitanahyangdihasilkandidominasiolehpasir,pengaruhsalinisasi/penggaraman.
Tanah Marjinal yang dimaksudkan adalah tanah yang terbentuk secara alami, bukan tanah yang menjadi marjinal
karena antropogenik. Dari 12 ordo tanah di dunia (Alfisols, Andisols, Aridisols, Entisols, Gelisols, Histosols,
Inceptisols, Mollisols, Oxisols, Spodosols, Ultisol, dan Vertisols) yang tergolong Tanah Marjinal antara lain adalah :
Aridisols,Entisols,Gelisols,Histosols,Inceptisols,danUltisols.
Secaraantropogenikadalahkarenaulahmanusiayangmemanfaatkansumberdayaalamyangtidakterkendali,sehingga
terjadi kerusakan ekosistem. Misalnya, deforestasi dan degradasi hutan, eksploitasi deposit bahan tambang,
terungkapnya unsur atau senyawa beracun bagi tanaman, pengeringan ekstrem pada tanah gambut, serta kebakaran.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

5/76

6/1/2016

DASARDASARILMUTANAH

Deforestasidandegradasihutanmenyebabkanterjadinyaerosiyangdipercepatdanpunahnyaorganismeyangberperan
dalampembentukantanahT=(i,b,r,o,w).
Aliran permukaan yang berasal dari curah hujan akan mengikis lapisan permukaan yang merupakan bagian tersubur
dari tanah. Fraksi tanah yang dahulu diangkut adalah yang halus dan ringan yaitu liat dan humus. Kedua fraksi ini
sangat berperan dalam menentukan kesuburan tanah, karena merupakan kompleks petukaran ion dan penahan unsur
hara. Dalam sedimen yang terangkut pada peristiwa erosi terdapat juga berbagai unsur hara dan bahan organik. Oleh
karena itu, tanah yang mengalami erosi akan menurun produktivitasnya menjadi tanah marjinal yang kalau erosi
selanjutnyatidakdikendalikan,tanahtersebutakanmenjadilahankritis.
Luas lahan kritis di Indonesia dari tahun ke tahun meningkat, sejalan dengan semakin mengganasnya deforestasi dan
degradasi hutan serta belum diterapkannya teknologi konservasi tanah yang memadai, terutama pada areal budidaya
tanamanpadalahanberlereng.DarihasilsurveiDirektoratKehutanantahun1985pada75DAS(sebagiandarijumlah
DASdiIndonesia)jumlahlahankritistelahmencapai16jutahadanmeningkat2,5%/tahun.Sedangkandarilaporan
Suranggajiwa(1975)luaslahankritispadaseluruhDASdiIndonesiamencapai30jutahadanmeningkat2%/tahun.
DapatdiprediksibetapaluasnyalahankritisdiIndonesiasaatini.
Produktivitas tanah merupakan kemampuan suatu tanah untuk menghasilkan produk tertentu suatu tanaman dibawah
suatu sistem pengelolaan tanah tertentu. Suatu tanah atau lahan dapat menghasilkan suatu produk tanaman yang baik
danmenguntungkanmakatanahdikatakanproduktif.Produktivitastanahmerupakanperwujudandarifaktortanahdan
nontanahyangmempengaruhihasiltanaman.

Tanah produktif harus mempuyai kesuburan yang menguntungkan bagi pertumbuhan tanaman. Akan tetapi tanah
subur tidak selalu berarti produktif. Tanah subur akan produktif jika dikelaola dengan tepat, menggunakan jenis
tanaman dan teknik pengelolaan yang sesuai. Kesuburan tanah adalah kemampuan atau kualitas suatu tanah
menyediakanunsurharatanamandalamjumlahyangmencukupikebutuhantanaman,dalambentuksenyawasenyawa
yang dapat dimanfaatkan tanaman dan dalam perimbangan yang sesuai untuk pertumbuhan tanaman tertentu dengan
didukungolehfaktorpertumbuhanlainnya(YuwonodanRosmarkam2008).
Tanah yang sehat akan memberikan sumbangan yang besar tehadap kualitas tanah. Kualitas tanah dapat sebagai sifat
atau atribut inherent tanah yang dapat digambarkan dari sifatsifat tanah atau hasil observasi tidak langsung, dan
sebagaikemampuantanahuntukmenampakkanfungsifungsiproduktivitaslingkungandankesehatan.
Winarso (2005) menjelaskan bahwa pengukuran kualitas tanah merupakan dasar untuk penilaian keberlanjutan
pengelolaantanahyangdapatdiandalkanuntukmasamasayangakandatang,karenadapatdipakaisebagaialatuntuk
menilai pengaruh pengelolaan lahan. Pada umumnya proses degradasi tanah dalam sistem pertanian dapat disebabkan
oleh erosi, pemadatan, penurunan ketersediaan hara atau penurunan kesuburan, kehilangan bahan organik tanah dan
lainlain.
Aryantha(2002)menjelaskanadatigakonsepuntukmemperbaikikesuburantanahyaituyangberwawasanlingkungan
atau berkelanjutan adalah Low External Input Agriculture (LEIA) dan Low Ezternal Input Sustainable Agriculture
(LEISA),danpertanianmodrenyangtergantungdenganbahankimiaadalahHighExternalInputAgriculture(HEIA)
LEIAadalahsistemyangmemanfaatkansumberdayalokalyangsangatintensifdengansedikitatausamasekalitidak
menggunakan masukan dari luar sehingga tidak terjadi kerusakan sumberdaya alam. Pendauran hara di dalam
usahatani dengan sumbersumber yang berasal dari luar usaha tani. Kegiatan ini berguna untuk menambahkan hara
kepada tanah dari luar usaha tani. Bahanbahan yang digunakan: sampah, kompos, limbah, dll. Pendauran hara di
dalam usaha tani dengan sumbersumber yang berasal dari usaha tani itu sendiri. Pendauran ini dapat dilewatkan
denganternakataupengembaliansisasisabiomassahasilpanen.Carainitidakmenambahkanharakepadatanah,tetapi
hanyamengembalikanharayangtidakterangkutkeluarbersamadenganhasilpanen.Pendauranharadidalampetak
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

6/76

6/1/2016

DASARDASARILMUTANAH

pertanaman.Kegiataninibiasanyamelibatkantanamanlegum(covercrop)untukmemenuhisebagianbesarkebutuhan
Npadatanamanpokok.
HEIA adalah Merupakan sistem pertanian yang menggunakan masukan dari luar (secara berlebihan). Umumnya
berupa bahanbahan agrokimia konvensional yang memang disengaja dibuat untuk input produksi. Sistem ini sangat
tergantung senyawa kimia sintetis (pupuk, pestisida, zat pengatur tumbuh). Dapat berpengaruh buruh pada
keseimbanganlingkungandankesehatanmanusia.
LEISA adalah Pertanian dengan masukan rendah tetapi mengoptimalkan pemanfaatan sumberdaya alam (tanah, air,
tumbuhan dan hewan), manusia (tenaga, pengetahuan dan keterampilan) yang tersedia ditempat dan layak secara
ekonomis, mantap secara ekologis, adil secara sosial dan sesuai dengan budaya lokal. Ciriciri sitem ini (a) berusaha
mengoptimalkan pemanfaatan sumberdaya lokal dengan mengkombinasikan berbagai komponen sistem usahatani
(tanaman, hewan, tanah, air, iklim dan manusia) sehingga saling melengkapi dan memberikan efek sinergi yang luar
biasa,(b) berusaha mengoptimalkan pemanfaatan sumberdaya lokal dengan mengkombinasikan berbagai komponen
sistem usahatani (tanaman, hewan, tanah, air, iklim dan manusia) sehingga saling melengkapi dan memberikan efek
sinergiyangluarbiasa.
Prinsip dasar LEISA adalah menjamin kondisi tanah yang mendukung pertumbuhan tanaman, khususnya dengan
mengelola bahan organik dan meningkatkan kehidupan mikroorganisme di dalam tanah (soil regenerator),
mengoptimalkan ketersediaan dan menyeimbangkan aliran unsur hara, khususnya melalui penambatan Nitrogen,
pendaur ulangan unsur hara dan pemanfaatan pupuk luar sebagai pelengkap,, meminimalkan kerugian sebagai akibat
radiasi matahari, udara dan air dengan pengelolaan iklim mikro, pengelolaan air dan pengendalian erosi, saling
melengkapidansinergidalampenggunaansumberdayagenetikyangmencakuppenggabungandalamsistempertanian
terpadudengantingkatkeanekaragamanfungisonaltinggi.

1.3.KualitasdanKarekteristikLahan
Kualitas lahan adalah sifatsifat pengenal atau attribute yang bersifat kompleks dari sebidang lahan. Setiap kualitas
lahan mempunyai keragaan ( performance) yang berpengaruh terhadap kesesuaiannya bagi penggunaan tertentu dan
biasanya terdiri atas satu atau lebih karakteristik lahan (land characteristics ). Kualitas lahan ada yang bisa diestimasi
atau diukur secara langsung di lapangan, tetapi pada umumnya ditetapkan berdasarkan karakteristik lahan (FAO,
1976).
Sitorus(1985)menjelaskanadaempatkelompokkualitaslahanutama:(a)Kualitaslahanekologisyangberhubungan
dengan kebutuhan tumbuhan seperti ketersediaan air, oksigen, unsur hara dan radiasi (b) Kualitas yang berhubungan
dengan kualitas pengelolaan normal, seperti kemungkinan untuk mekanisasi pertanian (c) Kualitas yang berhubungan
dengan kemungkinan perubahan, seperti respon terhadap pemupukan, kemungkinan untuk irigasi dan lainlain (d)
Kualitaskonservasiyangberhubungandenganerosi.
Karakteristiklahanyangeratkaitannyauntukkeperluanevaluasilahandapatdikelompokkankedalam3faktorutama,
yaitu topografi, tanah dan iklim. Karakteristik lahan tersebut terutama topografi dan tanah) merupakan unsur
pembentuksatuanpetatanah(Ritung,2003).
Topografiyangdipertimbangkandalamevaluasilahanadalahbentukwilayah
(relief)ataulerengdanketinggiantempatdiataspermukaanlaut.Relieferathubungannyadenganfaktorpengelolaan
lahan dan bahaya erosi. Sedangkan faktor ketinggian tempat di atas permukaan laut berkaitan dengan persyaratan
tumbuhtanamanyangberhubungandengantemperaturudaradanradiasimatahari.

Ketinggiantempatdiukurdaripermukaanlaut(dpl)sebagaititiknol.Dalamkaitannyadengantanaman,secaraumum
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

7/76

6/1/2016

DASARDASARILMUTANAH

sering dibedakan antara dataran rendah (<700> 700 m dpl.). Namun dalam kesesuaian tanaman terhadap ketinggian
tempat berkaitan erat dengan temperatur dan radiasi matahari. Semakin tinggi tempat di atas permukaan laut, maka
temperatursemakinmenurun.Demikianpuladenganradiasimataharicenderungmenurundengansemakintinggidari
permukaanlaut.Ketinggiantempatdapatdikelaskansesuaikebutuhantanaman.Misalnyatanamantehdankinalebih
sesuai pada daerah dingin atau daerah dataran tinggi. Sedangkan tanaman karet, sawit, dan kelapa lebih sesuai di
daerahdataranrendah.
Iklim sebagai salah satu faktor lingkungan fisik yang sangat penting dapat mempengaruhi pertumbuhan tanaman.
Bebrapa unsur iklim yang penting adalah curah hujan, suhu, dan kelembaban. Di daerah tropika umumnya radiasi
tinggi pada musim kemarau dan rendah pada musim penghujan. Namun demikian mengingat sifat saling berkaitan
antaraunsuriklimsatudenganyanglainnya,makadalamuraianikliminiakandiuraikanunsurunsuriklimyangyang
berkaitandenganpertumbuhantanaman.
Tanaman kina dan kopi, misalnya, menyukai dataran tinggi atau suhu rendah, sedangkan karet, kelapa sawit dan
kelapa sesuai untuk dataran rendah. Pada daerah yang data suhu udaranya tidak tersedia, suhu udara diperkirakan
berdasarkan ketinggian tempat dari permukaan laut. Semakin tinggi tempat, semakin rendah suhu udara rataratanya
danhubunganinidapatdihitungdenganmenggunakanrumusBraak(1928):26,3C(0,01xelevasidalammeterx0,6
C)Suhuudararatarataditepipantaiberkisarantara2527C.
Datacurahhujandiperolehdarihasilpengukuranstasiunpenakarhujanyang
ditempatkan pada suatu lokasi yang dianggap dapat mewakili suatu wilayah tertentu. Pengukuran curah hujan dapat
dilakukan secara manual dan otomatis. Secara manual biasanya dicatat besarnya jumlah curah hujan yang terjadi
selama1(satu)hari,yangkemudiandijumlahkanmenjadibulanandanseterusnyatahunan.Sedangkansecaraotomatis
menggunakanalatalatkhususyangdapatmencatatkejadianhujansetiapperiodetertentu,misalnyasetiapmenit,setiap
jam,danseterusnya.
Untuk keperluan penilaian kesesuaian lahan biasanya dinyatakan dalam jumlah curah hujan tahunan, jumlah bulan
keringdanjumlahbulanbasah.Oldeman(1975)mengelompokkanwilayahberdasarkanjumlahbulanbasahdanbulan
kering berturutturut. Bulan basah adalah bulan yang mempunyai curah hujan >200 mm, sedangkan bulan kering
mempunyaicurahhujan<100mm.Kriteriainilebihdiperuntukkanbagitanamanpangan,terutamauntukpadi.
BerdasarkankriteriatersebutOldeman(1975)membagizoneagroklimatkedalam5kelasutama(A,B,C,DdanE).
SedangkanSchmidt&Ferguson(1951)membuatklasifikasiiklimberdasarkancurahhujanyangberbeda,yaknibulan
basah (>100 mm) dan bulan kering (<60 mm). Kriteria yang terakhir lebih bersifat umum untuk pertanian dan
biasanyadigunakanuntukpenilaiantanamantahunan.
Faktortanahdalamevaluasikesesuaianlahanditentukanolehbeberapasifatataukarakteristiktanahdiantaranyajenis
tanah, drainase tanah, tekstur, kedalaman tanah dan retensi hara (pH, KTK), serta beberapa sifat lainnya diantaranya
alkalinitas, bahaya erosi, dan banjir/genangan. Data jenis tanah dapat di lihat melalui peta satuan lahan khusus jenis
tanah,seperticontohpetajenistanahpropinsiJambiKabupatenMuaroJambi.
Drainasetanahmenunjukkankecepatanmeresapnyaairdaritanahataukeadaantanahyangmenunjukkanlamanyadan
seringnya jenuh air. Kelas drainase tanah disajikan pada Tabel 5. Kelas drainase tanah yang sesuai untuk sebagian
besar tanaman, terutama tanaman tahunan atau perkebunan berada pada kelas 3 dan 4. Drainase tanah kelas 1 dan 2
serta kelas 5, 6 dan 7 kurang sesuai untuk tanaman tahunan karena kelas 1 dan 2 sangat mudah meloloskan air,
sedangkankelas5,6dan7seringjenuhairdankekuranganoksigen.

Tekstur merupakan komposisi partikel tanah halus (diameter 2 mm) yaitu pasir, debu dan liat. Tekstur dapat
ditentukan di lapangan seperti disajikan pada Tabel 4, atau berdasarkan data hasil analisis di laboratorium dan
menggunakansegitigatekstur.Pengelompokankelasteksturadalah:Halus(h):Liatberpasir,liat,liatberdebu.Agak
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

8/76

6/1/2016

DASARDASARILMUTANAH

halus (ah) : Lempung berliat, lempung liat berpasir, lempung liat berdebu. Sedang (s) : Lempung berpasir sangat
halus, lempung, lempungberdebu, debu. Agak kasar (ak) : Lempung berpasir. Kasar (k) : Pasir, pasir berlempung.
Sangathalus(sh):Liat(tipemineralliat2:1).
Bahankasaradalahpersentasikerikil,kerakalataubatuanpadasetiaplapisan
tanah,dibedakanmenjadi:sedikit:<>60%.Ketebalangambut,dibedakanmenjadi:tipis:<>400cm.

KarakteristikKelasDrainaseTanah
1.Cepat(excessivelydrained):
Tanah mempunyai konduktivitas hidrolik tinggi sampai sangat tinggi dan dayamenahan air rendah. Tanah demikian
tidak cocok untuk tanaman tanpa irigasi.Ciri yang dapat diketahui di lapangan, yaitu tanah berwarna homogen
tanpabercakataukaratanbesidanaluminiumsertawarnagley(reduksi).

2.Agakcepat(somewhatexcessivelydrained):
Tanah mempunyai konduktivitas hidrolik tinggi dan daya menahan air rendah.Tanah demikian hanya cocok untuk
sebagian tanaman kalau tanpa irigasi. Ciri yang dapat diketahui di lapangan, yaitu tanah berwarna homogen tanpa
bercakataukaratanbesidanaluminiumsertawarnagley(reduksi).

3.Baik(welldrained):
Tanahmempunyaikonduktivitashidroliksedangdandayamenahanairsedang,lembab,tapitidakcukupbasahdekat
permukaan. Tanah demikian cocok untuk berbagai tanaman. Ciri yang dapat diketahui di lapangan, yaitu tanah
berwarna homogen tanpa bercak atau karatan besi dan/atau mangan serta warna gley (reduksi) pada lapisan 0 sampai
100cm.

4.Agakbaik(moderatelywelldrained):
Tanahmempunyaikonduktivitashidroliksedangsampaiagakrendahdandayamenahanair(poriairtersedia)rendah,
tanahbasahdekatpermukaan.Tanahdemikiancocokuntukberbagaitanaman.Ciriyangdapatdiketahuidilapangan,
yaitutanahberwarnahomogentanpabercakataukaratanbesidan/ataumangansertawarnagley(reduksi)padalapisan
0sampai50cm.

5.Agakterhambat(somewhatpoorlydrained):
Tanahmempunyaikonduktivitashidrolikagakrendahdandayamenahanair(poriairtersedia)rendahsampaisangat
rendah, tanah basah sampai ke permukaan. Tanah demikian cocok untuk padi sawah dan sebagian kecil tanaman
lainnya.Ciriyangdapatdiketahuidilapangan,yaitutanahberwarnahomogentanpabercakataukaratanbesidan/atau
mangansertawarnagley(reduksi)padalapisan0sampai25cm.

6.Terhambat(poorlydrained):
Tanah mempunyai konduktivitas hidrolik rendah dan daya menahan air (pori air tersedia) rendah sampai sangat
rendah,tanahbasahuntukwaktuyangkecukuplamasampaipermukaan.Tanahkemikiancocokuntukpadisawahdan
sebagian kecil tanaman lainnya. Ciri yang dapat diketahui di lapangan, yaitu tanah mempunyai warna gley (reduksi)
danbercakataukaratanbesidan/ataumangansedikitpadalapisansampaipermukaan.

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

9/76

6/1/2016

DASARDASARILMUTANAH

7.Sangatterhambat(verypoorlydrained):
Tanahdengankonduktivitashidroliksangatrendahdandayamenahanair(poriairtersedia)sangatrendah,tanahbasah
secara permanen dan tergenang untuk waktu yang cukup lama sampai ke permukaan. Tanah demikian cocok untuk
padisawahdansebagiankeciltanamanlainnya.Ciriyangdapatdiketahuidilapangan,yaitutanahmempunyaiwarna
gley(reduksi)permanensampaipadalapisanpermukaan.

Tingkat bahaya erosi dapat diprediksi berdasarkan kondisi lapangan, yaitu dengan cara memperhatikan adanya erosi
lembar permukaan (sheet erosion), erosi alur (rill erosion), dan erosi parit (gully erosion). Pendekatan lain untuk
memprediksitingkatbahayaerosiyangrelatiflebihmudahdilakukanadalahdenganmemperhatikanpermukaantanah
yanghilang(ratarata)pertahun,dibandingkantanahyangtidaktererosiyangdicirikanolehmasihadanyahorizonA.
HorizonAbiasanyadicirikanolehwarnagelapkarenarelativemengandungbahanorganikyanglebihtinggi.

Bersambungkebagian2yangdapatdilihatpadapustakadibawahini:

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Pada

Lahan Kering (Bagian 2) [http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah


padalahan_3537.html]

(Bagian2dari5Tulisan)

II.PermasalahanPadaTanahMineralMasam
Tanah masam di Indonesia memiliki ciriciri tekstur lempungan, struktur gumpal, permeabilitas rendah, stabilitas
agregat baik, pH rendah, KPK rendah, aras N, P, Ca, Mg sangat rendah, vegetasi alami alangalang (Imperata
cylindrica) dan hutan (Hardjowigeno, 1993), fraksi lempung didominasi oleh mineralmineral bermuatan terubahkan
sepertikaolinit,gibsitdanataugoetit(Ismailetal.,1993).TanahinidiIndonesiaterbentukdidaerahyangbercurah
hujan tinggi (25003000 mm per tahun), topografi berombak hingga berbukit dengan ketinggian 50350 mm di atas
mukaairlaut,batuanindukgranit,abuvulkanatauandesit.
PengelolaantanahtanahmineralmasamuntukkepentinganpertanianmenghadapikendalapHyangrendah,keracunan
Al,Mn,dan/atauFe,sertakekahatanunsurunsurharapentingsepertiN,P,Ca,danatauMgdanMo.Upayauntuk
mengatasipersoalankesuburantanahtanahmasamadalahdenganmengkombinasikanantarapraktekusahatanidengan
penerapan bioteknologi tanah yang menekankan pada komponen mengamankan suplai N di dalam sistem tanah
tanamandenganpengayaanfiksasiN2secarabiologis(Notohadiprawiro,1990).Teknologiinimencakupsegalaupaya
untuk memanipulasi jasad renik dalam tanah dan proses metabolik mereka untuk mengoptimumkan produktivitas
pertanaman.
Lahankeringtergolongsuboptimalkarenatanahnyakurangsubur,bereaksimasam,mengandungAl,Fe,danatauMn
dalamjumlahtinggisehinggadapatmeracunitanaman.Lahanmasampadaumumnyamiskinbahanorganikdanhara
makro N, P, K, Ca, dan Mg. Pemberian bahan ameliorasi kapur, bahan organik, dan pemupukan N, P, dan K
merupakankunciuntukmemperbaikikesuburanlahankeringmasam.
Usaha pertanian di tanah Ultisol akan menghadapi sejumlah permasalahan.Tanah Ultisol umumnya mempunyai pH
rendahyangmenyebabkankandunganAl,Fe,danMnterlaruttinggisehinggadapatmeracunitanaman.Jenistanahini
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

10/76

6/1/2016

DASARDASARILMUTANAH

biasanya miskin unsur hara esensial makro seperti N, P, K, Ca, dan Mg unsur hara mikro Zn, Mo, Cu, dan B, serta
bahan organik . Meskipun secara umum tanah Ultisol atau Podsolik Merah Kuning banyak mengandung Al dapat
ditukar (Aldd) (2070%), namun hasil penelitianmenunjukkan bahwa beberapa contoh tanah tersebut mengandung
Alddrelatifrendah(<20%).
Tanah di KP. Kayu Agung, Indralaya, dan Prabumulih Sumatera Selatan, misalnya, mempunyai kejenuhan Aldd
berturutturut 11,08%, 1,01%, dan 17,26% di Jawa Barat 13,40% dan 11 dari 28 contoh tanah lapisan atas yang
berasaldariLampungTengahjugamemilikikejenuhanAlddyangrendah(Taufiqetal.2003).
Tekstur tanah ultisol bervariasi, berkisar dari pasiran (sandy) sampai dengan lempungan (clayey). Fraksi lempung
tanah ini umumnya didominasi oleh mineral silikat tipe 1:1 serta oksida dan hidroksida Fe danAl, sehingga fraksi
lempungtergolongberaktivitasrendahdandayamemeganglengasjugarendah.Karenaumumnyamemilikikandungan
bahan organik rendah dan fraksi lempungnya beraktivitas rendah maka kapasitas tukar kation tanah (KTK) tanah
Podsolik juga rendah, sehingga relatif kurang kuatmemegang hara tanaman dan karenanya unsur haramudah tercuci.
Tanah Podsolik atau Ultisol termasuk tanah bermuatan terubahkan (variable charge), sehingga nilai KTK dapat
berubahbergantungnilaipHnya,peningkatanpHakandiikutiolehpeningkatanKTK,lebihmampumengikatharaK
dantidakmudahtercuci(Subandi,2007).
Memperhatikanpermasalahanyangdihadapipadalahankeringmasamsepertiyangdisebutkandidepan,makadalam
pengelolaannyauntukpertanaman,secarateknis,terdapatduapendekatanpokokyaknipemilihanjeniskomoditasatau
varietasyangadaptifsertaperbaikankesuburantanahdenganameliorasidanpemupukan.
Indonesia memiliki lahan kering masam cukup luas yaitu sekitar 99,6 juta hektar dan tersebar di Kalimantan,
Sumatera, Maluku, Papua, Sulawesi, Jawa dan Nusa Tenggara (Soebagyo,et al., 2004 Hidayat dan Mulyani, 2005).
Salah satu ordo tanah yang cukup luas penyebarannya adalah Ultisols. Ditinjau dari luasnya, Ultisol mempunyai
potensiyangbesaruntukpengembanganpertanianlahankering.Namundemikian,pemanfaatanlahaninimenghadapi
kendala karakteristik tanah yang dapat menghambat pertumbuhan tanaman terutama tanaman pangan bila tidak
dikelola dengan baik. Beberapa kendala sifat fisik tanah yang sering dijumpai antara lain adalah kemantapan agregat
yangrendah,tanahmudahmenjadipadatdanpermeabilitastanahyanglambat.
PadaumumnyalahankeringmasamdidominasiolehtanahUltisol,yangdicirikanolehkapasitastukarkation(KTK)
dan kemampuan memegang/menyimpan air yang rendah, tetapi kadar Al dan Mn tinggi. Oleh karena itu, kesuburan
tanah Ultisol sering kali hanya ditentukan oleh kadar bahan organik pada lapisan atas, dan bila lapisan ini tererosi
maka tanah menjadi miskin hara dan bahan organik. Di samping itu, kekahatan fosfor merupakan salah satu kendala
terpenting bagi usaha tani di lahan masam. Hal ini karena sebagian besar koloid dan mineral tanah yang terkandung
dalam tanah Ultisol mempunyai kemampuan menyemat fosfat cukup tinggi, sehingga sebagian besar fosfat dalam
keadaantersematolehAldanFe,tidaktersediabagitanamanmaupunbiotatanah(Notohadiprawiro,2006).
Kendala pengembangan lahan Podzolik Merah Kuning beriklim basah dengan topograsi bergelombang cukup
kompleks.Kesalahandalampengelolaanmerupakanpenyebabdegradasilahanyangmendasar.Didaerahtropikabasah
yangtopografinyabervariasidaridatar,bergelombanghinggabergunung,erositanahmerupakansalahsatupenyebab
degradasilahanyangdominandisampingpenyebablainsepertipencucianharadanakumulasiunsurunsurberacun.
Lahan kering Podzolik Merah Kuning beriklim basah didominasi oleh tanah masam PMK dengan bahan induk yang
miskin unsur hara (Partohardjono et al, 1994). Oleh karena itu lahan ini tergolong lahan marginal yang tingkat
produktivitasnya rendah. Kesuburan tanah ini secara alamiah sangat tergantung pada lapisan atas yang kaya bahan
organik tetapi bersifat labil. Kalau lahan ini diolah untuk budidaya, kandungan bahan organik yang memadai,
produktivitaslahancepatpulamenurundanakhirnyamenjadilahankritis.
Tanaman yang dibudidayakan pada lahan kering PMK yang krits tidak mampu berproduksi secara optimal jika
dikelola secara konvensional (Hakim et al, 1997). Sedangkan pembuatan teras dan galengan memerlukan biaya yang
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

11/76

6/1/2016

DASARDASARILMUTANAH

tinggidanpetanitidakmemilikicukupbiaya.
SifatkimiadanfisikatanahPMKyangjelekmerupakankendalamisalnyatanahyangbereaksimasamsampaisangat
masam. Kandungan dan kejenuhan aluminiumnya tinggi yang dapat meracuni tanaman dan daya fiksasi yang tinggi
terhadapPhospor.
Kandungan bahan organik, KTK dan kejenuhan basahnya umumnya rendah. Mineral liat umumnya didominasi oleh
kaolinit yang tidak banyak memberikan sumbangan terhadap kesuburan tanah serta sebagian besar tanah ini
mempunyaikapasitasmemegangairyangrendahdanpekaterhadaperosi(AriefdanIrman,1997).Dampaklangsung
dari wilayah yang mengalami erosi adalah terjadinya suatu areal yang secara bertahap menjadi tandus dengan
konsekuensipendudukyangtinggaldisekitarnyaakanmenjadimiskin(PandangdanSubandi,1997).
Mineral Kaolin telah lama dikenal akan reaktivitasnya terhadap fosfat, karena kaolin merupakan mineral lempung
yang merajai terutama pada tanahtanah mineral masam seperti Ultisols, Alfisols dan Oxisols maka reaktivitasnya
terhadap fosfat perlu dipertimbangkan sebagai landasan pengelolaan P pada tanahtanah ini. Wild (1950) melakukan
penelitiantentangreaksifosfatdenganlempungaluminosilikatdanberkesimpulanbahwamontmorillonitdankaolinit
menjerap P dalam jumlah yang hampir sama apabila ukuran partikelnya serupa. Ia mengusulkan dua mekanisme
retensi P oleh mineralmineral lempung, yaitu pertukaran ion fosfat dengan gugus hidroksil pada lapisan gibbsite
dan/atau sebagai anion tertukarkan yang mengimbangi muatan positif hasil protonasi ion. Muljadi et al. (1966)
berkesimpulan bahwa isotherm retensi P adalah sama untuk kaolinit, gibbsite dan pseudoboehmite, perbedaannya
adalahpadajumlahtapakretensi.
Oksidaoksidabesidanaluminiummaupunlempungaluminosilikat,yangmerupakankomponenutamafraksilempung
tanahtanah mineral masam, mampu menjerap P. Meskipun demikian perlu disadari bahwa terdapat perbedaan
kekuatanikatanretensiyangbersumberpadaperbedaansifatikatanantaraanionfosfatdenganoksidaoksidabesidan
lempung alumino silikat. Perbedaan ini akan menimbulkan perilaku dan tanggapan yang berbeda terhadap perlakuan
pemberian fosfat ke dalam tanah sebagai pupuk. Dalam hubungan ini nisbah antara oksida besi dan lempung silikat
perludipertimbangkansebagaidasarpengelolaanPterutamapadatanahtanahmineralmasam.Penelitianinidilakukan
untuk menentukan kemampuan retensi P dari kaolin dan oksidaoksida besi yang diperoleh dari tanahtanah mineral
masamdiIndonesia.
Tanaman kedelai mempunyai prospek yang cukup besar untuk dikembangkan di tanah Ultisol asal dibarengi dengan
pengelolaantanamandantanahyangtepat.UmumnyatanahtersebutmempunyaipHyangsangatmasamhinggaagak
masam, yaitu sekitar 4.15.5, jumlah basabasa dapat ditukar tergolong rendah hingga sedang dengan komplek
adsorpsi didominasi oleh Al, dan hanya sedikit mengandung kation Ca dan Mg. Kapasitas tukar kation (KTK) dan
kejenuhanbasa(KB)lapisanatastanahumumnyarendahhinggasedang(Subagyoetal.,2000).
Kekahatan kalium merupakan kendala yang sangat penting dan sering terjadi di tanah Ultisol. Masalah tersebut erat
kaitannyadenganbahaninduktanahyangmiskinK,harakaliumyangmudahtercucikarenaKTKtanahrendah,dan
curahhujanyangtinggididaerahtropikabasahsehinggaKbanyakyangtercuci.Upayauntukmeningkatkanproduksi
kedelai di tanah masam dapat dilakukan melalui pengelolaan tanaman yang sesuai dan manipulasi tanah yang tepat.
Pemupukan kalium memegang peranan yang sangat penting dalam meningkatkan produksi kedelai di tanah Ultisol.
Hara kalium merupakan hara makro bagi tanaman yang dibutuhkan dalam jumlah banyak setelah N dan P
(Nursyamsi,2006)

Bersambungkebagian3yangdapatdilihatpadapustakadibawahini:

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

12/76

6/1/2016

DASARDASARILMUTANAH

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Pada

Lahan Kering (Bagian 3) [http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah


padalahan_6757.html]

(Bagian3dari5Tulisan)

III.PerkembanganPenelitianTanahMineralMasam
Hasil penelitian Arimurti et al (2006) menunjukkan bahwa tanah tersebut mempunyai sifat yang sangat masam (pH
4,2),halinidapatdisebabkantanahtersebutmempunyaikapasitastukarkationyangtinggidanmempunyaikejenuhan
basarendahdanbereaksimasam(Sanchez,1976).Hasilanalisisjugamenunjukkanbahwatanahinimempunyaisifat
berikut:Ctinggi,Nsangatrendah,PtersediadanPtotalyangsangatrendah.
Selanjutnyadijelaskanpulabahwaperlakuanbakteripelarutfosfat(BPF)mampumeningkatkanpertumbuhantanaman
jagung pada tanah masam, yang tampak pada parameter tinggi tanaman 10 dan 45 HST, berat basah trubus, berat
keringtrubus,beratbasahakar,beratkeringakar,luasdaunsertakadarPtrubus.PerlakuandenganpupukPternyata
mampu meningkatkan pertumbuhan hanya pada parameter tinggi tanaman 10 dan 17 HST serta kadar P trubus.
Perlakuan masingmasing SP36 maupun rock fosfat sama baiknya dalam meningkatkan tinggi tanaman 10 dan 17
HSTsertakadarPtrubus.PerlakuankombinasipupukPdenganBPFdapatmeningkatkanpertumbuhanyangtampak
pada parameter berat kering trubus. Semua kombinasi perlakuan jenis pupuk P dengan BPF sama baiknya dalam
meningkatkanberatkeringtrubuspadatanahmasam.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

13/76

6/1/2016

DASARDASARILMUTANAH

Hasanudin (2003) melakukan penelitian tentang ketersediaan dan serapan P pada tanaman jagung di tanah ultisol
melalui inokulasi mikoriza dan pemberian bahan organik. Terlihat bahwa ketersediaan P dan serapan P meningkat
denganperlakuantersebutdiikutipulapeningkatanpadaketersediaanNsertahasiltanamanjagung.
Hasil penelitian Joy (2005) bahwa pada tanah masam terjadi penurunan kandungan Aldd tanah dan peningkatan
kandungan Ptersedia tanah dipengaruhi oleh interaksi antara takaran Palam dengan jenis kapur, sedangkan
peningkatan nilai pH tanah dipengaruhi oleh efek mandiri Palam dan jenis kapur. Pengapuran dengan dolomit
meningkatkanpHtanahlebihtinggidibandingkanpengapurandengankalsit.Secaraumum,semakintinggitakaranP
alam,semakintinggipulanilaipHtanah.
Peningkatan takaran P alam akan menurunkan kandungan Aldd tanah, terutama jika dikombinasikan dengan kapur,
baik kalsit maupun dolomit. Efek peningkatan takaran Palam juga berpengaruh terhadap peningkatan kandungan
Ptersediatanahpadasetiaplevelpengapuran.MeningkatnyanilaipHtanahmenyebabkanpenurunankandunganAldd
tanahsedangkanpenurunannilaiAlddtanahakanmeningkatkankandunganPtersediatanah.
Penelitian Siradz (2003) memperlihatkan bahwa baik mineral lempung golongan kaolin maupun oksidaoksida besi
mampu menjerap P. Kapasitas retensi P dari oksidaoksida besi sekitar 10 kali lipat lebih besar dari kaolin, tetapi
keberadaan kaolin di dalam tanahtanah mineral masam sekitar 18 kali lipat dibandingkan dengan oksida besi. Oleh
karenaitusebenarnyajumlahPyangdijerapolehkaolinjauhlebihbesardibandingkandenganoksidaoksidabesi.
Tanah Latosol merupakan tanah yang telah mengalami pelapukan yang intensif, bereaksi asam dan terjadi pencucian
yang kuat terutama basabasa K, Ca dan Mg. Kendala lain untuk budidaya pertanian adalah kekurangan unsur hara P
akibatterjadinyafiksasiolehminerallempungkaolinitdanionionFedanA1akibatpHyangrendah.Hasilpenelitian
Sumaryo dan Suryono (2000) tentang pengaruh pupuk P dan Dolomit pada hasil tanaman kacang tanah di tanah
latosol menunjukkan bahwa pengaruh sangat nyata dari dosis pupuk dolomit pada semua parameter yang diamati
dikarenakan pemberian dolomit dapat menambah unsur hara Ca dan Mg yang di dalam tanah Latosol sangat rendah
sampairendahsertadimungkinkandapatmemperbaikisifatfisikdankimiatanah.
UltisolmerupakantanahterluasdariseluruhlahankeringyangadadiPropinsiJambiyangmempunyaipotensibesar
untukuntukdijadikanlahanpertanianproduktifyangberkelanjutandanmenunjangprogramketahanpangannasional.
Salah satu kendala adalah permeabilitas tanah yang lambat. Penelitian Junedi (2008) menunjukkan bahwa untuk
memperbaiki permeabilitas tanah dapat dilakukan dengan penambahan kompos jerami padi saja, kapur saja maupun
diberikansecarabersamasama.
Pemberian kompos jerami padi 20 ton1 ha masih mampu meningkatan permeabilitas tanah, demikian pula dengan
pemberian kapur sampai 2xAldd. Akan tetapi jika kompos jerami padi diberikan bersama sama dengan kapur maka
pemberian10ton1hakomposjeramipadidan1xAlddkapursudahmampumeningkatkanpermeabilitastanah.
Penelitian Bertam et al (2005) pada tanah masam di Bengkulu dengan seri tanah Kandanglimun Bengkulu yang
memilikipHsangatmasam,kadarbahanorganikrendahsampaisedang,kadarNtotalrendah,kadarPtersediasangat
rendah,Catertukarrendah,MgdanKtertukarrendah,KTKrendahdantekstursiltloam.Diberiperlakuandengan
inokulasimikorizadanrhizobiaindigeneuspadabeberapavarietaskedelai,memperlihatkanbahwaterjadipeningkatan
kesuburan tanah yang ditandai dengan meningkatnya N total, P tersedia, KTK , pH meningkat ke arah netral, serta
terjadipeningkatanpertumbuhandanproduksikedelaijikadibandingkandengankontrol.
Hasil penelitian Wulandari (2001) pada tanah ultisol menjelaskan bahwa inokulasi bakteri pelarut fosfat jenis
Pseudomonas diminuta dan Pseudomonas cepaceae yang diikuti dengan pemberian pupuk fosfat dapat meningkatkan
ketersediaanfosfatdanmeningkatkanproduksitanamankedelaisertameningkatkanefisiensipupukPyangdigunakan.
Pelarutan fosfat oleh Pseudomonas didahului dengan sekresi asamasam organik, diantaranya asam sitrat, glutamat,
suksinat,laktat,oksalat,glioksilat,malat,fumarat.Hasilsekresitersebutakanberfungsisebagaikatalisator,pengkelat
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

14/76

6/1/2016

DASARDASARILMUTANAH

dan memungkinkan asamasam organik tersebut membentuk senyawa kompleks dengan kationkation Ca2+, Mg2+,
Fe2+,danAl3+sehinggaterjadipelarutanfosfatmenjadibentuktersediayangdapatdiserapolehtanaman.
Hasanudin dan Gonggo (2004) meneliti tentang pemanfaatan mikrobia pelarut fosfat dan mikoriza untuk perbaikan
fosfor tersedia, serapan fosfor tanah ultisol dan hasil jagung. Dari hasil penelitiannya terdapat pengaruh tunggal dan
interaksi dari pemberian mikrobia pelarut fosfat dan mikoriza terhadap serapan P dan hasil jagung. Nilai tertinggi
terdapatpadaperlakuanmikrobiapelarutfosfat15mltanaman1danmikoriza20gtanaman1terhadapserapanPdan
hasiljagungmasingmasingsebesar0,3881ppmdan280,15gtanaman1.
Noor (2003) meneliti tentang pengaruh fosfat alam dan kombinasi bakteri pelarut fosfat dengan pupuk kandang
terhadap P tersedia dan pertumbuhan kedelai pada ultisol. Dari hasil penelitiannya di dapat bahwa fosfat alam dan
kombinasi bakteri pelarut fosfat dengan pupuk kandang mampu meningkatkan P tersedia tanah , jumlah dan bobot
kering bintil akar dan bobot kering tanaman kedelai. Pemberian bakteri pelarut fosfat dan pupuk kandang secara
sendirisendiri maupun kombinasinya meningkatkan P tersedia berturutturut 26%, 34% dan 48% dibandingkan
dengankontrol.Kombinasibakteripelarutfosfatdenganpupukkandangmeningkatkanbobotkeringtanamankedelai
29%dibandingkankontrol.

Widawati dan Suliasih (2005) meneliti tentang Augmentasi Bakteri Pelarut Fosfat (BPF) Potensial sebagai Pemacu
Pertumbuhan Caysin (Brasica caventis Oed.) di Tanah Marginal dengan pH rendah. Dari hasil penelitiannya didapat
bahwa Empat isolat BPF jenis Bacillus pantotheticus, Klebsiella aerogenes, Chromobacterium lividum dan B.
Megateriumsebagaiinokulanpadat,mampumemacupertumbuhantanamancaysin.Inokulanyangberisi4isolatBPF
jenisBacilluspantotheticus,Klebsiellaaerogenes,Chromobacteriumlividum,danB.megateriummerupakaninokulan
terbaik sebagai biofertilizer dan menghasilkan berat daun segar 1 tanaman terbesar dari 4 tanaman perpot (g), berat
daunsegar4tanamanperpot,danberattanamansegarseluruhtanamanperpot(daun+batang+akar)sebesar139,22
g, 575,48 g, dan 606,42 g atau ada kenaikan 877,67% 903,63% 930,63 dari tanaman kontrol 3/R = tanaman tanpa
pupuk/inokulan 354,67% 208,30% 217,23% dari tanaman kontrol 2/Q = tanaman dengan pupuk kompos dan
61,81% 203,75% 207,84% dari tanaman kontrol 1/P = tanaman dipupuk kimia. Ada kenaikan pada tanaman segar
seluruh tanaman per pot (daun + batang + akar) sebesar 32,87% dari tanaman yang diinokulasi dengan isolat BPF
tunggalmaupuncampuran23isolatBPF.
Penelitian Sudirja et al (2006) menunjukkan bahwa respon pemberian kompos kulit buah kakao, kascing, dan pupuk
kandang ayam berpengaruh terhadap pH tanah. Semakin besar dosis perlakuan pupuk organik yang diberikan, maka
pH tanah pun semakin meningkat. Sejalan dengan pemikiran Sufiadi (1999), pemberian bahan organik dengan dosis
yangmeningkatakanmeningkatkanpelepasankationkedalamlarutantanah,sehinggacukupuntukmeningkatkanpH
danakibatnyamuatanpermukaannegatifmenjadilebihbesar.

Bersambungkebagian4yangdapatdilihatpadapustakadibawahini:

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Pada

Lahan Kering (Bagian 4) [http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah


padalahan_3924.html]

(Bagian4dari5Tulisan)

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

15/76

6/1/2016

DASARDASARILMUTANAH

IV.PengelolaanKesuburanTanahMineral
4.1.PemakaianPupukOrganikdanAnorganik
Sumber pupuk organik dapat berasal dari kotoran hewan, bahan tanaman dan limbah, misalnya pupuk kandang,
hijauan tanaman rerumputan, semak ,perdu dan pohon, limbah pertanaman dan limbah agroindustri. Tanah yang
dibenahidenganpupukorganikmempunyaistrukturyangbaikdansifatmenahanairyanglebihbesardaripadatanah
yangkandunganbahanorgaiknyarendah.
Pada umumnya pupuk organik mengandung hara makro yang rendah, tetapi mengandung hara mikro yang cukup
sangat diperlukan oleh tanaman, sebagai bahan pembenah tanah pupuk organik dapat mencegah erosi, mencegah
pengerakanpermukaantanah(crusting)danretakantanah,mempertahankankelengasantanah.
Karekteristikumumyangdimilikiolehpupukorganikadalah:
1. Kandungan hara rendah. Kandungan hara pupuk organik pada umumnya rendah tetapi bervariasi tergantung jenis
bahandasarnya.
2. Ketersediaan unsur hara lambat. Hara yang berasal dari bahan organik diperlukan untuk kegiatan mikrobia tanah
untukdirubahdaribentukorganikkomplekyangtidakdapatdimanfaatkantanamanmenjadibentuksenyawaorganik
dananorganikyangsederhanayangdapatdiabsorpsiolehtanaman.
3. Penggunaan pupuk organik sebaiknya harus diikuti dengan pupuk anorganik yang lebih cepat tersedia untuk
menutupikekuranganharadaripupukorganik.
Pupuk kandang merupakan hasil samping yang cukup penting dari budidaya hewan peliharaan baik unggas maupun
non unggas, terdiri dari kotoran padat dan cair dari hewan ternak yang bercampur sisa makanan, dapat menambah
unsur hara dalam tanah . Pemberian pupuk kandang selain dapat menambah tersedianya unsur hara, juga dapat
memperbaiki sifat fisik tanah. Beberapa sifat fisik tanah yang dapat dipengaruhi pupuk kandang antara lain
kemantapanagregat,bobotvolume,totalruangpori,plastisitasdandayapegangair.
Kandunganunsurharapupukkandangakanberbedadenganberbedanyajenisdanwujudbahanpupukkandang.
Pemupukanyangdianjurkanpadabudidayatanamanjagung,untukpupukorganic(pupukkandang/kompos)20ton
/ha.Sedangkanuntukpupukanorganik:Urea300kg/ha,TSP100kg/ha,KCI50kg/ha.Pupukdasardiberikan
sebelumtanamataubersamaantanamsejumlah20ton/hapupukorganic,100kg/haUrea,100kgTSP,dan50kg/
ha KCl dengan membuat larikan atau ditugalkan kemudian ditutup kembali dengan tanah dengan jarak 10 cm dari
garis tanam / lubang tanam. Pupuk susulan diberikan 3 minggu setelah tanam berupa Urea 100 kg / ha, diteruskan
pupuksusulankeduapadatanamanberumur5minggusejumlah100kgUrea/ha(DinasPertanianJember,2007).
Hasil penelitian Mayadewi (2007) pupuk kandang ayam meningkatkan pertumbuhan hasil tanaman jagung manis
sebesar47,03%biladokombinasikandenganjaraktanam50x40cm.
Barus (2005) menjelaskan bahwa efisiensi penggunan pupuk dapat ditingkatkan dengan melakukan serangkaian uji
tanah untuk suatu sistem haratanahtanaman. Pada dasarnya tahapan kegiatan uji tanah meliputi (1) Pengambilan
contohtanahyangmewakililokasiberdasarkanhasilsurveyterdahulu,(2)Analisakimiatanahdilaboratoriumdengan
metodeyangtepatdanteruji,(3)Interpretasihasilanalisisdan(4)Rekomendasipemupukan.
Hasil penelitian Hasanudin et al (2007) menunjukkan bahwa pemberian pupuk kandang pada berbagai dosis mampu
menurunkanAlddsekaligusmeningkatkanpHtanahwalaupunpeningkatanpHtanahtidaksedrastispenurunanAldd.
PeningkatanpHdiikutidenganpeningkatanPtersediatanah.
Pemberian bahan organik pada tanah masam dapat meningkatkan serapan P dan hasil tanaman jagung karena setelah
bahan organik terdecomposisi akan menghasilkan beberapa unsur hara seperti N, P dan K serta menghasilkan asam
humat dan fulvat yang memegang peranan penting dalam pengikatan Fe dan Al yang larut dalam tanah sehingga
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

16/76

6/1/2016

DASARDASARILMUTANAH

ketersediaanPakanmeningkat(Hasanudin,2003).
Seperti halnya pupuk organik, pemakaian pupuk anorganik hanya diperlukan untuk memenuhi kebutuhan minimum
haratertentusepertiN,P,danK,sehinggadiberkanpadatakaranyangrendah.PupukN(urea)untuktanamanlegum
diperlukan sebagi stater sehingga diberikan pada saat tanam dengan takaran 1520 kg/ha, sedangkan untuk tanaman
nonlegum takarannya lebih tinggi. Pemakaian pupuk P (Palam) minimal 60 kg P/ha untuk dua musim tanam,
demikian pula pupuk KCl dengan takaran 6090 kg/ha. Takaran pupuk anorganik secara tepat perlu diteliti lebih
lanjut. Pengapuran mungkin diperlukan, tetapi hanya sebatas memenuhi kebutuhan tanaman, bukan untuk
meningkatkanpHtanahmaupunmengurangikadarAltanah.
Pemupukan P juga memegang peranan penting dalam meningkatkan pertumbuhan dan produksi tanaman. Fosfor
berperanpadaberbagaiaktivitasmetabolismetanamandanmerupakankomponenklorofil.SebagianbesarharaPdari
pupuk P yang diberikan difiksasi di dalam tanah sehingga hanya 1020% pupuk P yang diberikan diserap tanaman.
Oleh sebab itu pemberian yang etrus menerus dalam jumlah berlebih akan terakumulasi dalam tanah dan dapat
merubah status P tanah dari rendah ke tinggi sehingga tanaman tidak lagi tanggap terhadap pemupukan P (Barus,
2005).
Pemberian pupuk P yaitu pupuk SP36 dan pupuk Rock fosfat mampu meningkatkan pertumbuhan tanaman jagung
terlihatdaraiparametertinggitanaman10dan17harisetelahtanamsertakadarPtrubus(Arimurtietal,2006).

4.2.Pengapuran
Salahsatukegiatanreklamasilahanuntukmemperbaikiataumemulihkankembalitanahtanahyangtidaksuburagar
secaraoptimaldapatmendukungpertumbuhantanamanadalahdenganpenambahanamelioransepertipemberiankapur
pertanian. Secara tidak langsung kapur dapat mengurangi keracunan Al, meningkatkan ketersediaan P, meningkatkan
pHtanahdansecaralangsungkapurdapatmeningkatkanketersediaanharaCa.
Pengapuran ditekankan kepada penggunaan kapur biasa CaCO3 , seterusnya tanah masih perlu terus dipupuk.
Pengapuran hendaknya dipandang hanya untuk menetralisasikan tanah secara cepat dan seterusnya jangan tergantung
lagipadabanyaknyakapur,walaupunkualitaslahancepatmenurunkembali.KapurdapatmenetralisirAlmelaluiion
OH membentuk Al(OH)3 tidak aktif yang dihasilkan dari pelepasan CO32 yang selanjutnya Al menjadi tidak larut
dan Aldd semakin berkurang (Hasanudin et al, 2007). Selanjutnya dijelaskan juga bahwa untuk meningkatkan pH
tanahdari4,6menjadi5,8diperlukandosiskapur2xAldd.
Kapur berfungsi memantapkan stabilitas tanah, tetapi daya kerjanya lebih cepat dari pada kerja bahan organik.
Kelemahannya adalah bila tanah berkualitas rendah, yang ditandai dengan tingkat kesuburan rendah, maka dengan
pengapuran saja hanya memungkinkan pertumbuhan tanaman yang normal. Sebaliknya penggunaan bahan organik
tanpadidahuluidenganpengapuranmenghasilkanpemantapanstabilitastanahsecaralambat,tetapidampakpositifnya
berlangsung jangka panjang. Oleh karena itu pengapuran pada tanah masam sebaiknya diikuti dengan pemberian
pupukorganikagarstabilitastanahterjagadanpertumbuhansertaproduksitanamanakanterjamin(Kuswandi,1993).

4.3.PupukHayatiPenyediaHaraTanaman
Mikrobia tanah yang menguntungkan dapat dikategorikan sebagai biofertilizer atau pupuk hayati. Menurut Yuwono
(2006)secaragarisbesarfungsimenguntungkantersebutdapatdibagimenjadibeberapa:
1.Penyediahara
2.Peningkatketersediaanhara
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

17/76

6/1/2016

DASARDASARILMUTANAH

3.Pengontrolorganismepengganggutanaman
4.Penguraibahanorganikdanpembentukhumus
5.Pemantapagregattanah
6.Perombakpersenyawaanagrokimia
BeberapamikroorganismetanahsepertiRhizobium,AzospirillumdanAzootobacter,Mikoriza,Bakteripelarutfosfat,
bila dimanfaatkan secara tepat dalam system pertanian akan membawa pengaruh yang positif baik bagi ketersediaan
hara yang dibutuhkan tanaman, lingkungan edapik, maupun upaya pengendalian beberapa jenis penyakit. Sehingga
akan dapat diperoleh pertumbuhan dan produksi tanaman yang optimal dan hasil panen yang lebih sehat.
Mikroorganismetersebutseringdisebutsebagaibiofertilizerataupupukhayati(Sutanto,2002).
DaribeberapahasilpenelitianmenunjukkanbahwabakteripelarutfospatdapatmeningkatkanketersediaanPdidalam
tanah dan dapat meningkatkan efisiensi penggunaan pupuk P serta dapat meningkatkan pertumbuhan dan produksi
tanaman. Penggunaan pupuk hayati berupa inokulan bakteri fospat dengan tanpa pemberian pupuk TSP dapat
meningkatkanhasiljagungyangsetaradenganpemberianTSP(Prihartini,2003).
HasilpenelitianArimurtietal(2006)padaperlakuanbakteripelarutfosfat(BPF)mampumeningkatkanpertumbuhan
tanamanjagungpadatanahmasam,yangtampakpadaparametertinggitanaman10dan45HST,beratbasahtrubus,
beratkeringtrubus,beratbasahakar,beratkeringakar,luasdaunsertakadarPtrubus.PemberianBPFP.putidasama
baiknya dengan P. Aeruginosa atau gabungan keduanya dalam meningkatkan tinggi tanaman 10 dan 45 HST. Untuk
meningkatkanberatbasah,beratkeringtrubusdanakarpalingbaikmenggunakanP.putida.
Asosiasisimbiotikanatarajamurdansistemperakarantanamantinggidiistilahkandenganmikoriza.Dalamfenomena
inijamurmenginfeksidanmengkoloniakartanpamenimbulkannekrosissebagaimanabiasaterjadipadainfeksijamur
patogen,danmendapatpasokannutrisisecarateraturdaritanaman.Asosiasiiniakandapatmeningkatanketersediaan
hara P dan lainnya serta meningkatkan serapannya. MVA membantu pertumbuhan tanaman dengan memperbaiki
ketersediaanharafosfordanmelindungiperakarandariseranganpatogen(HadiyantodanHairiyah,2007).
Hasil penelitian Hasanudin dan Gonggo (2004) menjelaskan pemberian inokulasi mikrobia pelarut fosfat 15 ml
tanaman1daninokulasimikoriza20gtanaman1dapatmeningkatkanserapanPdanhasiljagung.
Rhizobium yang berasosiasi dengan tanaman legum mampu menfiksasi 100300 Kg N/Ha dalam satu musim tanam
dan meninggalkan sejumlah N untuk tanaman berikutnya. Permasalahan yang perlu diperhatikan adalah efisiesnsi
inokulanRhizobiumuntuktanamantertentu.Rhizobiummampumencukupi80%kebutuhannitrogentanamanlegum
dan meningkatkan produksi antara 1025%. Tanggapan tanaman sangat bervariasi tergantung pada kondisi tanah dan
efektifitaspopulasiasli(Sutanto,2002).
Kenaikan hasil tanaman setelah diinokulasi Azotobacter terjadi pada tanaman jagung, cantel, padi, bawang putih,
tomat,terongdankubis.ApabilaAzotobacterdanAzospirillumdiinokulasisecarabersamasama,makaAzospirillum
lebihefektifdalammeningkatkanhasiltanaman.Azospirillummenyebabkankenaikanhasilcukupbesarpadatanaman
jagung,gandumdancantel(Sutanto,2002).

Selanjutnya dijelaskan juga oleh Tim Peneliti Pengembangan Sumberdaya Lahan Pertanian (2008) bahwa pemakaian
pupuk hayati pada lahan kering masam sebaiknya yang telah terbukti dapat menjalankan fungsi ekologis, merupakan
mikrobahasilseleksiyangbenarbenarungguldalammembantupertumbuhantanaman.
Pupuk hayati meliputi bakteri penambat N, mikroba pelarut fosfat, dan cendawan mikoriza arbuskula. Bakteri
penambat N2. Bakteri ini mencakup bakteri yang membentuk bintil akar, bersimbiose dengan tanaman legum, dan
bakteri penambat N yang hidup bebas di dalam tanah. Oleh karena itu, budi daya tanaman legum (kacangkacangan)
dapat menggunakan Rhizobium spp. Namun, perlu diperhatikan bahwa hubungan antara tanaman legum dan
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

18/76

6/1/2016

DASARDASARILMUTANAH

Rhizobium bersifat sangat spesifik, artinya satu spesies Rhizobium hanya dapat bersimbiose dengan spesies legum
tertentu. Oleh karena itu, penggunaan Rhizobium sp. harus disesuaikan dengan spesies legum yang akan
dibudidayakan. Bakteri penambat N yang hidup bebas seperti Azotobacter, Azospirillum, dan Beijerinckia dapat
digunakanpadatanamandarifamiliGramineae(rumputrumputan)sepertipadi,jagung,dansorgum.
Mikrobapelarutfosfat.Telahbanyakdihasilkanpupukhayatiyangmengandungmikrobapelarutfosfat.Mikrobaini
ada yang hidup bebas di dalam tanah atau hidup di daerah perakaran (rhizobakteri). Mikroba tersebut dapat
menghasilkansenyawaorganikyangdapatmelarutkanPtanah,sehinggaketersediaanPbagitanamanmeningkatdan
mengurangitakaranpenggunaanpupukP.
Cendawanmikorizaarbuskula(CMA).CMAmerupakansuatubentukasosiasicendawandenganakartanamantingkat
tinggi. Kemampuan asosiasi tanaman CMA ini memungkinkan tanaman memperoleh hara dan air yang cukup pada
kondisi lingkungan yang miskin unsur hara dan kering, perlindungan terhadap patogen tanah maupun unsur beracun,
dansecaratidaklangsungmelaluiperbaikanstrukturtanah.
Hal ini dimungkinkan karena CMA mempunyai kemampuan menyerap hara dan air lebih tinggi dibanding akar
tanaman. Keunggulan kemampuan CMA dalam pengambilan hara, terutama hara yang bersifat tidak mobil seperti P,
Zn, dan Cu, disebabkan CMA memiliki struktur hifa yang mampu menjelajah daerah di antara partikel tanah,
melampauijarakyangdapatdicapaiakar(rambutakar),kecepatantranslokasiharaenamkalikecepatanrambutakar,
dan nilai ambang batas konsentrasi hara yang dapat diserap CMA lebih rendah (setengah ambang batas konsentrasi
hara yang dapat diserap akar). CMA secara tidak langsung juga dapat meningkatkan ketersediaan Ptanah melalui
produksienzimfosfataseolehakartanaman.CMAjugaberperandalammembantupemenuhankebutuhanairpadasaat
kekeringankarenabertambahnyaluaspermukaanpenyerapanairolehhifaeksternal.
Satu spesies CMA dapat berasosiasi dengan berbagai tanaman sehingga satu macam CMA dapat digunakan untuk
berbagai jenis tanaman. Pada saat ini telah dihasilkan berbagai inokulan CMA,umumnya dari spesies Glomus,
Gigaspora,danAcaulospora.

4.4.TeknikPengelolaanTanah
Apabila dihadapkan pada kondisi tanah masam, ketersediaan hara rendah, bahan organik tanah rendah, dan tanah
memilikislopetertentusertaberadapadadaerahdenganintensitashujantinggi,makasecarateknikpengolahantanah
yangdilakukanharusberprinsippeningkatankesuburantanahdanadanyapelaksanaankonservasitanahdanair.
Pada prinsipnya untuk meningkatkan atau mempertahankan kemampuan tanah dapat dilakukan teknik pengelolaan
tanah secara mekanik dan vegetatif. Secara mekanik pembuatan teras misalnya teras gulud, teras bangku atau teras
individu dan pembuatan saluran drainase. Sedangkan secara vegetatif adalah penerapan pola tanam yang menutup
permukaan tanah sepanjang tahun baik dengan hijauan maupun vegetasi misalnya dengan pergiliran tanaman ,
tumpangsariataupenanamanbudidayalorong.
Konservasi tanah secara mekanik adalah semua perlakuan fisik mekanis dan pembuatan bangunan yang ditujukan
untuk mengurangi aliran permukaan guna menekan erosi dan meningkatkan kemampuan tanah mendukung usahatani
secaraberkelanjutan.
Beberapahalyangperludiperhatikandalampembuatanterasgulud(Gambar8)menurutSinukaban(1994):
(1)Terasguludcocokditerapkanpadalahandengankemiringan1040%.
(2) Pada tanah yang permeabilitasnya tinggi, guludan dapat dibuat menurut arah kontur. Pada tanah yang
permeabilitasnyarendah,guludandibuatmiringterhadapkontur,tidaklebihdari1%kearahsaluranpembuangan.Hal
iniditujukanagarairyangtidaksegeraterinfiltrasikedalamtanahdapattersalurkankeluarladangdengankecepatan
rendah.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

19/76

6/1/2016

DASARDASARILMUTANAH

Teras bangku atau teras tangga dibuat dengan cara memotong panjang lereng dan meratakan tanah di bagian
bawahnya, sehingga terjadi deretan bangunan yang berbentuk seperti tangga. Pada usahatani lahan kering, fungsi
utamaterasbangkuadalah:(1)memperlambataliranpermukaan(2)menampungdanmenyalurkanaliranpermukaan
dengan kekuatan yang tidak sampai merusak (3) meningkatkan laju infiltrasi dan (4) mempermudah pengolahan
tanah.
Teras bangku dapat dibuat datar (bidang olah datar, membentuk sudut 0o dengan bidang horizontal), miring ke
dalam/goler kampak (bidang olah miring beberapa derajat ke arah yang berlawanan dengan lereng asli), dan miring
keluar(bidangolahmiringkearahlerengasli).Terasbiasanyadibangundiekosistemlahansawahtadahhujan,lahan
tegalan,danberbagaisistemwanatani.
Terasindividuadalahterasyangdibuatpadasetiapindividutanaman,terutamatanamantahunan.Jenisterasinibiasa
dibangundiarealperkebunanataupertanamanbuahbuahan.
Pengelolaantanahsecaravegetatifdapatmenjaminkeberlangsungankeberadaantanahdanairkarenamemilikisifat:
(1)memeliharakestabilanstrukturtanahmelaluisistemperakarandenganmemperbesargranulasitanah,(2)penutupan
lahan oleh seresah dan tajuk mengurangi evaporasi, (3) disamping itu dapat meningkatkan aktifitas mikroorganisme
yang mengakibatkan peningkatan porositas tanah, sehingga memperbesar jumlah infiltrasi dan mencegah terjadinya
erosi(Rahim,2006).
Pergilirantanamanatautanamberurutanadalahsistembercocoktanamdenganmenanamduaataulebihjenistanaman
pada sebidang tanah selama satu tahun tanaman musim kedua ditanam sebelum panen tanaman musim pertama.
Contohnyaadalahtumpanggilirantaratanamanjagungyangditanampadaawalmusimhujandankacangtanahyang
ditanam beberapa minggu sebelum panen jagung. Sistem ini bertujuan untuk meningkatkan intensitas penggunaan
lahan dan menjaga agar permukaan tanah selalu tertutup tanaman. Selain itu, sistem ini juga dimaksudkan untuk
mempercepat penanaman tanaman pada musim kedua, sehingga masih mendapatkan air hujan dengan jumlah yang
cukupuntukpertumbuhandanproduksinya.
Tanam bersisipan atau tumpang sari adalah sistem penanaman lebih dari satu macam tanaman pada lahan yang sama
secara simultan, dengan umur tanaman yang relatif sama dan diatur dalam barisan atau kumpulan barisan secara
berselangselingseperi:padigogo+jagungjagung+kacangtanah.Padamusimpertamadiawalmusimhujan,padi
gogoditanamsecaratumpangsaridenganjagung.
Menambahtanamanpenguatteras,tanamanyangmemenuhisyaratsebagaipenguatterasadalah:
a.Mempunyaisistemperakaranintensif,sehinggamampumengikatair.
b.Tahanpangkassehinggatidakmenaungitanamanutama.
c.Bermanfaatdalammenyuburkantanahmaupunsebagaipenghasilmakananternak.
Tanamanpenguatterasyangdianjurkanditanamantaralainlamtorogung,gamal,akasia,kaliandra,rumputgajahdan
rumputbenggala.
Salahsatucarauntukmemperbaikistrukturtanah,mempertinggikemampuantanahdalammenyerapairyaitudengan
menggunakan pupuk organik berupa pupuk hijau atau pupuk kandang serta penggunaan sisasisa tanaman yang
diletakkan di atas tanah sebagai serasah (mulsa) sehingga dapat mempertahankan kelembaban tanah. Dengan cara ini
penguapanairtanahdapatdiperkecilsehinggaairtanahtetaptersediabagitumbuhnyatanaman.
Teknologi yang diintroduksikan ke lahan kering masam DAS bagian hulu haruslah teknologi yang mampu
mengendalikan erosi, mudah dilaksanakan, murah dan dapat diterima oleh petani. Salah satu teknologi yang tersedia
adalahsistempertanamanlorongatauAlleycropping.
Anonimous (2009) menjelaskan bahwa alley cropping merupakan salah satu sistem agroforestry yang menanam
tanamansemusimatautanamanpangandiantaraloronglorongyangdibentukolehpagartanamanpohonanatausemak
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

20/76

6/1/2016

DASARDASARILMUTANAH

(Kang et al., 1984). Tanaman pagar dipangkas secara periodik selama pertanaman untuk menghindari naungan dan
mengurangikompetisiharadengantanamanpangan/semusim.Leucaenaleucocephalayangpertamadiujidalamsistem
AlleycroppinginidanmenyusulkemudianGlinsidiasepium.
Beberapa hasil penelitian menunjukkan bahwa sistem ini sangat efektif mengendalikan erosi. Di Filipina, Alley
cropping dapat menurunkan erosi sebanyak 69%, yang terdiri atas 48% disebabkan oleh pengaruh penutupan tanah
olehmulsa,8%disebabkanolehperubahanprofiltanahdan4%olehpenanamansecarakontour.DiIndonesiasistem
ini sudah diyakini efektif mengendalikan erosi (Sukmana and Suwardjo, 1991) dapat meningkatkan produktivitas
tanah dan tanaman serta dapat diadopsi oleh petani di lahan kering. Beberapa hasil penelitian yang dilakukan telah
menunjukkanbahwaAlleycroppingsangatefektifdalammengendalikanerosi.
Efektivitas pengendalian erosi tersebut sangat tergantung kepada jenis tanaman pagar yang digunakan, jarak antara
tanamanpagardanpadasaatawal,kemiringanlahan.Efektivitaspengendalianerosidapatmencapai>95%dibanding
apabilatidakmenggunakanAlleycropping.
Alegre dan Rao (1995) menunjukkan bahwa Alley cropping menahan kehilangan tanah 93% dan air 83%
dibandingkan dengan pertanaman tunggal semusin. Efektivitas pengendalian erosi ini selain karena hal yang telah
disebutkan diatas juga karena terbentuknya teras secara alami dan perlahanlahan setinggi 2530 cm pada dasar
tanaman pagar. Rendahnya erosi disebabkan oleh hasil pangkasan yang sukar melapuk yang berfungsi sebagai mulsa,
sehinggatanahterlindungdariairhujandanpemadatantanahkarenaulahpekerjaselamaoperasidilapangan.Barisan
tanamanpagarmenurunkankecepatanaliranpermukaansehinggamemberikankesempatanpadaairuntukberinfiltrasi.
Selanjutnyatanamanpagarmenyebabkanairtanahselaluberkuranguntukkebutuhanpertumbuhannyaselamamusim
kemarausehinggasisteminimenyeraplebihbanyakairhujankedalamtanahdanakhirnyamenurunkanerosi.
Selain efektif mengendalikan erosi, Alley cropping juga ternyata dapat meningkatkan produktivitas tanah dan
tanaman. Sistem ini dapat memperbaiki sifat fisik tanah yaitu menurunkan BD (bulk density) dan meningkatkan
konduktivitashidrauliktanah.
HasilpenelitianAgasetal.(1997)tentangsifatsifattanahdanairdibawahAlleycroppingpadatanahoxilosmiring
menunjukkan bahwa pada umumnya sifatsifat tanah tidak dipengaruhi oleh jenis legum/taman pagar, tetapi
dipengaruhi oleh posisi dalam lorong. Lebih dekat pada barisan tanaman pagar, mempengaruhi distribusi air. Air
tersediapadakedalaman1015cmadalah0,160,13dan0,08m3masingmasingpadabaginbawah,tengahdanatas
dari lorong. Transmisivitas air menurun dari 0,49 mm/detik pada bagian bawah menjadi 0,12 mm/detik pada bagian
atas dari lorong. Kandungan air tanah dan tekanan air tanah menurun pada bagian lorong yang dekat pada tanaman
pagar.Haliniakanmenyebabkankompetisiairantaratanamanpagardengantanamanpanganpadalorong.
Selain perbaikan sifat fisik tanah, penelitianpenelitian terdahulu juga memperlihatkan bahwa Alley cropping dapat
meningkatkanunsurharadidalamtanah.Contohkondisipertanamanalleycropping.

Bersambungkebagian5yangdapatdilihatpadapustakadibawahini:

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

21/76

6/1/2016

DASARDASARILMUTANAH

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Pada

Lahan Kering (Bagian 5) [http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah


padalahan_15.html]

(Bagian5dari5Tulisan)

V.Kesimpulan
1. Tanah mineral masam yang terdapat pada iklim tropik adalah jenis tanah ultisol, oxisols dan spodosol serta
inseptisol.KarekteristiktanahmineralmasamadalahpHrendah,bahanorganikrendahdankahatunsurharamakro
maupunmikrosertatingginyakandunganAldanFe.
2. Pengelolaan tanahtanah mineral masam untuk kepentingan pertanian menghadapi kendala pH yang rendah,
keracunanAl,Mn,dan/atauFe,sertakekahatanunsurunsurharapentingsepertiN,P,Ca,danatauMgdanMo
3. Alternatif yang dapat dilakukan untuk mengatasi tanah masam guna mendukung pertumbuhan dan produksi
tanamanadalahpemberianpupukorganikdananorganik,pengapuran,pemberianpupukhayatidanpengelolaantanah
yangberazaspeningkatankesuburantanahdanmelakukantindakankonservasitanahdanair.

DAFTARPUSTAKA
Arimurti,S, Setyati,D dan Mujib,M. 2006. Efettivitas bakteri pelarut fosfat dan pupuk P terhadap pertumbuhan
tanamanjagung(Zeamays)padatanahmasam.UniversitasJemberJurusanFMIPA.
Arief, A. Dan Irman. 1997. Ameliorasi Lahan Kering Masam untuk Tanaman Pangan. Prosiding Simposium
PenelitianTanamanPanganIII.PuslitbangTanamanPangan.BalitbangtanDeptan.Hal.16651675.
Arief.2008.GeografitanahIndonesia.feiraz.files.wordpress.com(diaksesMei2009)
Anonimous.2009.BudidayaLorong.bebasbanjir2025.files.wordpress.com(diaksesMei2009)
Bertam,YH. Kusuma,C.Setiadi,Y.Mansur,I dan Sopandie,D. 2005. Introduksi pasangan CMA dan Rhizobia
Indigenous untuk peningkatan pertumbuhan dan hasil kedelai di ultisol Bengkulu. Jurnal Ilmu Pertanian Indonesia.
7(2):94103.
Barus,J.2005.RespontanamanpaditerhadappemupukanPpadatingkatstatusharaPtanahyangberbeda.JurnalAkta
Agrosia.8(2):5255.
DinasPertanianJember.2007.BudidayaTanamanJagung.http://warintek.bantul.go.id [http://warintek.bantul.go.id/]
(diakses8April2009).

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

22/76

6/1/2016

DASARDASARILMUTANAH

Hasanudin.Ganggo,B.2004. Pemanfaatan Mikrobia Pelarut Fospat dan Mikoriza untuk Perbaikan Fospor
tersedia,SerapanFosporTanahUltisoldanHasilJagung.UniversitasBengkulu.JurnalIlmuPertanianIndonesia.4(2):
97103.
Hasanudin. 2003. Peningkatan ketersediaan dan serapan N dan P serta hasil tanaman jagung melalui inokulasi
mikoriza,azotobacterdanbahanorganicpadaultisol.JurnalIlmuPertanianIndonesia.5(2):8389.
Hasanudin,MitrianidanBarchiaF.2007.PengaruhpengapurandanpupukkandangterhadapketersediaanharaPpada
timbunantanahpascatambangbatubara.JurnalAktaAgrosia.EdisikhususNo1:14.
Handayanto,E.Hairiyah,K.2007.BiologiTanahLandasanPengelolaanTanahSehat.PustakaAdipura.
Hardjowigeno,S.1993.KlasifikasiTanahdanPedogenesis.AkademikaPressindo,Jakarta.273p.
Hanafiah,AK.2007.DasarDasarIlmuTanah.Edisi2.RajaGravindoPersada.Jakarta.pp139165.
Himatan. 2006. Pembentukan dan Profil Tanah. Himpunan Ilmu Tanah Universitas Padjajaran.
Hiatan06.files.wordpress.com(diaksesMei2009).
Hidayat, A. Dan A. Mulyani. 2005. Lahan Kering untuk Pertanian. Teknologi Pengelolaan Lahan Kering: Menuju
PertanianProduktifdanRamahLingkungan.PuslitbangTanahdanAgroklimat,BadanLitbangPertanian,Departemen
Pertanian.pp835.
Hakim, N., G. Ismail., Mardinus dan H. Muchtar. 1997. Perbaikan Lahan Kritis dengan Rotasi Tanaman dalam
BudidayaLorong.ProsidingSimposiumPenelitianTanamanPanganIII.Puslitbangtan.Deptan.Hal.16561664.
Ismail, H.., J. Shamshuddin & S.R. Syed Oman. 1993. Allevation of SoilAcidity in Ultisol and Oxisol for Corn
Growth.Plant&Soil151:5565.
Joy,B.2005.PerbedaanresponketerkaitanpH,Aldd,sertaPtersediadaritanahmasamakibataplikasiPalam,kalsit
dandolomite.JurnalBionatura7(3):249258.
Junedi, H. 2008. Pemanfaatan kompos dan jerami padi dan kapur guna memperbaiki permeabelitas tanah ultisol dan
hasilkedelai.ProsedingSeminarNasionalSainsdanTeknologiII.UniversitasLampung1718November2008.
.
Kuswandi.1993.PengapuranTanahPertanian.KanisusYogyakarta.Edisi1.
Mayadewi,NA.2007.Pengaruhjenispupukkandangdanjaraktanamterhadappertumbuhangulmadanhasiljagung
manis.JurnalAgritrop.28(4):163169.
Notohadiprawiro,T.2006.Ultisol,FaktadanImplikasiPertaniannya.BuletinPusatPenelitianMarihat.No.6.2006.
Notohadiprawiro,T.1990.FarmingAcidSoilsforFoodCrop:AnIndonesianExperience.In:ManagementofAcid
SoilsintheHumidTropicsofAsiaE.T.Croswell&E.Pusparajah(Eds.)AciarMonograph13:6268.
Nursyamsi, D S.M. Nanan. Sutisni dan I P.G. WidjajaAdhi. 1996. "Erapan P dan Kebutuhan Pupuk P Untuk
TanamanPanganpadaTanahtanahAsam".DalamJurnalTanahTropika.TahunIINo.2.PusatPenelitianTanahdan
Agroklimat.Bogor.
Nursyamsi, D. 2006. Kebutuhan hara kalium tanaman kedelai di tanah ultisol. Jurnal Ilmu Tanah dan Lingkungan.
6(2):7181.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

23/76

6/1/2016

DASARDASARILMUTANAH

NoorA.2003.PengaruhfosfatalamdankombinasibakteripelarutfosfatdenganpupukkandangterhadapPtersedia
danpertumbuhankedelaipadaultisol.BuletinAgronomi.31(3):100106.
Prihartin.2003. Mikroorganisme Meningkatkan Efisiensi Pemupukan Fospat.Pusat Penelitian dan Pengembangan
TanahdanAgroklimak.Bogor
Partohardjono, S., I.G. Ismail., Subandi., M.O. Adnyana dan D.A. Darmawan. 1994. Peranan Sistem Usahatani
TerpadudalamUpayaPengentasanKemiskinandiBerbagaiAgroekosistem.ProsidingSimposiumPanelitianTanaman
PanganIII.PuslitbangtanDeptan.Hal143182.
Pandang, M.S.,dan Subandi. 1997. Sistem Usahatani Konservasi Menunjang Pendapatan Petani Lahan Kering.
ProsidingSimposiumPenelitianTanamanPanganIIIBuku6.Puslitbangtan.Deptan.Hal.16761686.
RachmanS.2002.PenerapanPertanianOrganik.Edisi5.KanisusJakarta.Pp177184.
Rahim,ES.2006.PengendalianErosiTanah.Edisi3.BumiAksaraJakarta.pp91106.
Sutanto,R..2002.PenerapanPertanianOrganik.Edisi3.KanisusJakarta.
Sinukaban,N.1994.MembangunPertanianMenjadiLestaridenganKonservasi.FapertaIPB.Bogor.
Subandi.2007.TeknologiProduksidanStrategiPengembangan.IptekTanamanPangan2(1):1225.
Sunaryo dan Suryono. 2000. Pengaruh dosis pupuk dolomit dan pupuk P terhadap jumlah bintil akar dan hasil
tanamankacangtanahditanahlatosol.Agrosains2(2):5458.
Subagyo, H., N. Suharta, dan A.B. Siswanto. 2000. Tanahtanah pertanian di Indonesia. Hal. 2166 dalam Sumber
DayaLahanIndonesiadanPengelolaannya.PusatPenelitianTanahdanAgroklimat,Bogor.
Sudirja,R.Solihin,MA dan Rosniawati,S. 2006. Respon beberapa sifat kimia fluventic eutrudepts melalui
pendayagunaanlimbahkakaodanberbagaijenispupukorganik.UniversitasPadjajaran.
Taufiq,A., H. Kuntyastuti, Sudaryono,A.G.Manshuri, Suryantini, Triwardani, dan C. Prahoro. 2003. Perbaikan dan
peningkatan efisiensi produksi kedelai di lahan keringmasam. Laporan teknis BalaiPenelitianTanaman Kacang
kacangandanUmbiumbian(tidakdipublikasi).
Tim Peneliti Pengembangan Sumberdaya Lahan Pertanian. 2008. Pemanfaatan Biota Tanah untuk keberlanjutan
produktivitaspertanianlahankeringmasam.PengembanganInovasiPertanian1(2):157163.
Wulandari,S.2001.EfektifitasbakteripelarutfosfatPseudomonassppadapertumbuhantanamankedelaipadatanah
podsolikmerahkuning.JurnalNatureIndonesia.4(1):15.
Widawati, S dan Suliasih . 2005. Augmentasi Bakteri Pelarut Fosfat (BPF) Potensial sebagai Pemacu Pertumbuhan
Caysin(BrasicacaventisOed.)diTanahMarginal.Biodiversitas.7(1):1014.
Wild,A.1950.Theretentionofphosphatebysoils.J.SoilSci.1:221238
Yuwono,NW.2006.PupukHayati.UGM.Yogyakarta.
YuwonoNWdanRosmarkamA.2008.IlmuKesuburanTanah.Edisi4.Yogyakarta.pp2332.

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

24/76

6/1/2016

DASARDASARILMUTANAH

Yulianti,N.2007.ReaksiTanah.JurnalHijau.2(5):2343.

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Pada

Lahan Gambut (Bagian 1) [http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah


padalahan_2664.html]

(Bagian1dari5Tulisan)

I.Pendahuluan
Lahan gambut dikenal dan ditemukan pertama kali oleh Kyooker, seorang pejabat Belanda pada tahun 1860an yang
menyatakan bahwa 1/6 areal wilayah Sumatera ditempati gambut (Notohadiprawiro, 1997). Istilah gambut sendiri
pertamakalimunculdankemudianumumdigunakanolehdikalanganilmiawandanmenjadikosakataIndonesiasejak
tahun1970an(Radjaguguk,2001).
Menurut Soekardi dan Hidayat (1988) penyebaran gambut di Indonesia meliputi areal seluas 18.480 ribu hektar,
tersebar pada pulaupulau besar Kalimantan, Sumatera, Papua serta beberapa pulau Kecil. Dengan penyebaran seluas
sekitar 18 juta ha maka luas lahan gambut Indonesia menempati urutan ke4 dari luas gambut dunia setelah Kanada
UniSovyetdanAmerikaSerikat.KalimantanBaratmerupakanpropinsiyangmemilikiluaslahangambutterbesardi
Indonesiayaituseluas4,61jutaha,diikutiolehKalimantanTengah,RiaudanKalimantanSelatandenganluasmasing
masing2,16jutahektar,1,70jutahektardan1,48jutahektar.
JenistanahOrganosolatautanahgambutatautanahorganikberasaldaribahanindukorganiksepertidarihutanrawa
atau rumput rawa, dengan ciri dan sifat: tidak terjadi deferensiasi horizon secara jelas, ketebalan lebih dari 0.5 m,
warnacoklathinggakehitaman,teksturdebulempung,tidakberstruktur,konsistensitidaklekatagaklekat,kandungan
organiklebihdari30%untuktanahteksturlempungdanlebihdari20%untuktanahteksturpasir,umumnyabersifat
sangatasam(pH4,0)kandunganunsurhararendah(PaungkasP,2006).
Soil Survey Staff (1990) menyatakan bahwa yang dimaksud dengan tanah organik (Histosol) adalah tanah yang
mempunyaiketebalansebagaiberikut:
(1)60cmataulebihdengankandunganserat(bahanorganikkasar)meliputi3/4volumeataulebihdankerapatan
jenisdalamkeadaanlembabkurangdari0.1gml1
(2)40cmataulebih:
(a)denganlapisanbahanorganikjenuhairlebihdari6bulanatautelahadaperbaikandrainase
(b)denganbahanorganikterdiriatasbahanorganikhalus(saprik)ataubahanorganiksedang(hemik)ataubahan
fibrik(kasar)kurangdari2/3volumedankerapatanjenisdalamkeadaanlembab0.1gml1ataulebih.
Tanah gambut merupakan tanah hidromorfik yang bahan asalnya sebagian besar atau seluruhnya terdiri atas bahan
organik sisasisa tumbuhan, dalam keadaan yang selalu tergenang, dimana proses dekomposisinya berlangsung tidak
sempurnasehinggaterjadipenumpukandanakumulasibahanorganikmembentuktanahgambutyangkedalamannyadi
beberpatempatdapatmencapai16meter.DidaerahtropiskhususnyaIndonesiamenurutDriesen(1978)terbentuknya
gambut pada umumnya terjadi dibawah kondisi dimana tanaman yang telah mati tergenang air secara terus menerus,
misalnyapadacekunganataudepresi,danauataudaerahpantaiyangselalutergenangdanproduksibahanorganikyang
melimpahdarivegetasihutanmangroveatauhutanpayau.
Tanah gambut dapat terbentuk di daerah rawa pasang surut dan di daerah rawarawa pedalaman yang tidak
dipengaruhi oleh air pasang surut (Hardjowigeno, 1996). Tanah gambut terbentuk karena laju akumulasi bahan
organik melebihi proses mineralisasi yang biasanya terjadi pada kondisi jenuh air yang hampir terus menerus
sehingga sirkulasi oksigen dalam tanah terhambat. Hal tersebut akan memperlambat proses dekomposisi bahan
organikdanakhirnyabahanorganikituakanmenumpuk.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

25/76

6/1/2016

DASARDASARILMUTANAH

Lahan gambut mempunyai penyebaran di lahan rawa, yaitu lahan yang menempati posisi peralihan diantara daratan
dan sistem perairan. Lahan ini sepanjang tahun/selama waktu yang panjang dalam setahun selalu jenuh air (water
logged) atau tergenang air. Tanah gambut terdapat di cekungan, depresi atau bagianbagian terendah di pelimbahan
dan menyebar di dataran rendah sampai tinggi. Yang paling dominan dan sangat luas adalah lahan gambut yang
terdapatdilahanrawadidataranrendahsepanjangpantai.Lahangambutsangatluasumumnyamenempatimenyebar
diantara aliran bawah sungai besar dekat muara, dimana gerakan naik turunnya air tanah dipengaruhi pasang surut
harianairlaut.
Di alam, gambut sering bercampur dengan tanah liat. Tanah disebut sebagai tanah gambut apabila memenuhi salah
satupersyaratanberikut(SoilSurveyStaff,1990):
1.ApabiladalamkeadaanjenuhairmempunyaikandunganCorganikpalingsedikit18%jikakandungliatnya>60%
atau mempunyai kandungan Corganik 2% jika tidak mempunyai liat (O %) atau mempunyai kandungan Corganik
lebihdari12%+%liatx0,1jikakandunganliatnyaantara060%.
2.ApabilatidakjenuhairmempunyaikandunganCorganikminimal2O%.
Menurut Suhardjo dan Soepraptohardjo (1981), tanah gambut mempunyai lapisan organik setebal 50 cm atau
lebih dari permukaan tanah. Kriteria penggolongan tanah gambut dengan tanah mineral secara kuantitatif
ditentukan oleh kandungan fraksi bahan tanah mineral dan Corganik. Menurut Everret (1983), suatu tanah
digolongkan pada tanah gambut jika (1) mempunyai 18 % atau lebih Corganik jika fraksi mineral terdiri atas
60% atau lebih kadar liat, (2) mempunyai 12% atau lebih kecil Corganik jika fraksi mineral tidak mengandung
liat, dan (3) mempunyai 12% sampai 18% Corganik jika fraksi mineral mengandung liat antara 0% sampai 60
%.
Gambut tropis umumnya berwarna coklat tua (gelap), bergantung pada tahapan dekomposisinya. Kandungan air
yangtinggidankapasitasmemegangair15sampai30kalidaribobotkering,bobotisirendah(0.050.4gcm3 ),
dan porositas total antara 75% sampai 95% menyebabkan terbatasnya penggunaan mesinmesin pertanian dan
pemilihan komoditas yang akan diusahakan (Ambak dan Melling, 2000). Sifat lain yang merugikan adalah jika
gambut mengalami pengeringan yang berlebihan sehingga koloid gambut menjadi rusak. Gejala kering tak balik
(irreversible drying) terjadi dan gambut berubah sifat seperti arang sehingga tidak mampu lagi menyerap hara
dan menahan air (Subagyo et al, 1996). Gambut akan kehilangan air tersedia setelah 4 sampai 5 minggu
pengeringandanhalitumengakibatkangambutmudahterbakar.
Dapat juga digolongkan pada tanah gambut bila kedalaman tanah tersebut besar dari 50 cm dan kandungan bahan
organiknyabesar65%.MenurutSoilTaxonomigambutdigolongkankedalamorderHistosolyangdibedakanmenjadi
4subordermasingmasingFolists,Fibreists,Hemists,Saprists.
Folist merupakan lapisan tanah yang tersusun oleh tumpukan daundaun, ranting dan cabang yang tertimbun diatas
batuan,kerikilataupasiryangruangantaranyatelahdiisiolehbahanorganik.
Fibrists merupakan tumpukan dari bahan organik yang berserat yang belum atau baru mengalami proses
dekomposisi.
Hemists adalah gambut yang tingkat dekomposis bahan organik tengah berlangsung, dimana separuh dari bahan
organiktersebuttelahterdekomposisi.
Sapristsadalahgambutyangtingkatdekomposisinyatelahlanjut,hampirtidakberserabut,beratjenisnyabesardari
0,2danbiasanyaberwarnahitamataucoklatkelam.
Berdasarkanpenyebarantopografinya,tanahgambutdibedakanmenjaditigayaitu:
a. gambut ombrogen: terletak di dataran pantai berawa, mempunyai ketebalan 0.5 16 meter, terbentuk dari sisa
tumbuhanhutandanrumputrawa,hampirselalutergenangair,bersifatsangatasam.Contohpenyebarannyadidaerah
dataranpantaiSumatra,KalimantandanIrianJaya(Papua)
b. gambut topogen: terbentuk di daerah cekungan (depresi) antara rawarawa di daerah dataran rendah dengan di
pegunungan, berasal dari sisa tumbuhan rawa, ketebalan 0.5 6 meter, bersifat agak asam, kandungan unsur hara
relatif lebih tinggi. Contoh penyebarannya di Rawa Pening (Jawa Tengah), Rawa Lakbok (Ciamis, Jawa Barat), dan
SegaraAnakan(Cilacap,JawaTengah)dan
c.gambutpegunungan:terbentukdidaerahtopografipegunungan,berasaldarisisatumbuhanyanghidupnyadidaerah
sedang(vegetasispagnum).ContohpenyebarannyadiDataranTinggiDieng.
Tanah gambut secara alami terdapat pada lapisan paling atas. Di bawahnya terdapat lapisan tanah alluvial pada ke
dalaman yang bervariasi. Lahan dengan ketebalan tanah gambut kurang dari 50 cm disebut sebagai lahan atau tanah
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

26/76

6/1/2016

DASARDASARILMUTANAH

bergambut disebut sebagai lahan gambut apabila ketebalan gambut lebih dari 50 cm. Dengan demikian,lahan gambut
adalahlahanrawadenganketebalangambutlebihdari50cm.
Berdasarkankedalamnya,lahangambutdibagimenjadiempattipe,yaitu:
1.Lahangambutdangkal,yaitulahandenganketebalangambut50100cm
2.Lahangambutsedang,yaitulahandenganketebalangambut100200cm
3.Lahangambutdalam,yaitulahandenganketebalangambut200300cm
4.Lahangambutsangatdalam,yaitulahandenganketebalangambutlebihdari300cm.
TanahgambutdidaerahtropikabasahsepertiIndonesiaberkembangdarivegetasihutantropis.Dalamkondisialami,
lapisantanahgambutterdiriatasbahanmaterialberseratdantanamanyangterdekomposisibelumsempurna,sehingga
menghasilkan tanah gambut yang variasi dan sebarannya heterogen. Menurut pengamatan di lapangan, material
berseratinitidakterdistribusisecarameratadalamlapisantanah.
DarisekianluaspenyebarandiIndonesiabeberapabagiandipengaruhiolehpasang.Diberbagaitempatdewasainitelah
dilakukan pemanfaatan tanah gambut itu terutama untuk lahan pasang surut dan pembukaan lahan lain baik untuk
perkebunanmaupununtuklahanpemukimantransmigrasi.
Wilayah lahanlahan gambut merupakan potensi karbon dan juga sebagai penyimpan air perlu didorong sehingga
pemanfaatannya bisa maksimal dan tidak keliru lagi. Pemanfaatan gambut yang tidak bijaksana justru membawa
bencana bagi kehidupan masyarakat setempat dan bangsa. Misalnya kasus kebakaran hutan yang menyebabkan protes
darinegaranegaratetangga.
Pasalnya, di kawasan hutan gambut tropika, vegetasi maupun gambut di bawahnya menyimpan kandungan karbon
yang besar. Terdapat hubungan sangat jelas antara cadangan karbon, emisi karbon, dan pengaruhnya terhadap proses
perubahaniklimdunia.Isuperubahaniklimduniasudahmenjadiisuglobalyangperludicarikansolusinya.
Berdasarsifatdaribahangambutdanhasilpembelajarandalampengelolaanlahangambut,makapengembanganlahan
gambut Indonesia ke depan dituntut menerapkan beberapa kunci pokok pengelolaan yang meliputi aspek legal yang
mendukung pengelolaan lahan gambut penataan ruang berdasarkan satuan sistem hidrologi gambut sebagai wilayah
fungsional ekosistem gambut pengelolaan air pendekatan pengembangan berdasarkan karakteristik bahan tanah
mineraldibawahlapisangambutpeningkatanstabilitasdanpenurunansifattoksikbahangambutdanpengembangan
tanamanyangsesuaidengankarakteristiklahan.
Komposisi bahan penyusun gambut berkaitan erat dengan asamasam organik yang dihasilkan selama proses
dekomposisi. Stevenson (1994) menjelaskan bahwa lignin akan mengalami proses degradasi menjadi senyawa humat
danselamaprosesdegradasitersebutakandihasilkanasamasamfenolat.
Berdasarkan tingkat kesuburan alami, gambut dibagi dalam 3 kelompok yakni eutrofik (kandungan mineral tinggi,
reaksi gambut netral atau alkalin), oligotrofik (kandungan mineral, terutama Ca rendah dan reaksi masam) dan
mesotrofik ( terletak diantara keduanya dengan pH sekitar 5, kandungan basa sedang). Ketebalan atau kedalaman
gambut juga menentukan tingkat kesuburan alami dan potensi kesesuaiannya untuk tanaman. Subagyo et al, (1996)
membagi gambut dalam 4 kelas, yaitu dangkal (50100 cm), agak dalam (100200 cm), dalam (200300 cm) dan
sangatdalam(lebihdari300cm).
MenurutSubagyoetal,(1996),tanahbawahgambutdapatterdiriatasliatendapanmarin,pasirkuarsa,atauendapan
liatnonmarin.Tanahgambutyangberkembangdiataspasirkuarsamiskinharaesensialdibandingkandengantanah
gambutyangberkembangdiatastanahlempungdanliat.
Tingkat dekomposisi bahan organik ditunjukkan oleh kandungan serat. Pengertian taraf dekomposisi bahan
organik tanah yang lebih jelas dikemukakan Widjaja dan Adhi (1988). Yang dimaksud dengan fibrik adalah
bahan organik tanah yang sangat sedikit terdekomposisi yang mengandung serat sebanyak 2/3 volume. Bobot
volume fibrik lebih kecil dari 0.075 g cm3 dan kandungan air tinggi jika tanah dalam keadaan jenuh air. Saprik
adalahbahanorganikyangterdekomposisipalinglanjutyangmengandungseratkurangdari1/3volumedanbobot
isi saprik adalah 0,195 g cm3 , sedangkan hemik adalah bahan organik yang mempunyai tingkat dekomposisi
antarafibrikdengansaprikdenganbobotisi0,075sampai0,195gcm3 .
Berdasarkan status hara, Fleisher (1965, dikutip Driessen dan Soepraptohardjo, 1974) memilah gambut menjadi
tiga golongan, yaitu (1) gambut eutropik yang subur, (2) gambut mesotropik dengan kesuburan sedang, dan (3)
gambut oligotropik sebagai gambut miskin. Penggolongan tersebut didasarkan pada kandungan nitrogen (N),
kalium(K),fosfor(P),kalsium(Ca),dankadarabunyasepertiyangdisajikanpadaTabel1.
Tabel1.Kriteriakimiagambuteutropik,mesotropik,danoligotropikmenurutFleischer
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

27/76

6/1/2016

Tingkat
Kesuburan

DASARDASARILMUTANAH

Kriteria
Penilaian(%)
N

K2O

P 2O5

CaO

Abu

Eutropik

2.50

0.10

0.25

4.00

10.00

Mesotropik

2.00

0.10

0.20

1.00

5.00

Oligotropik

0.80

0.03

0.05

0.25

2.00

Sumber:DriessendanSoepraptohardjo(1974).
Sebagai akibat akumulasi bahan organik dan tanah dalam lingkungan tergenang air, banyak terbentuk senyawa
senyawa asam organik sehingga derajat kemasaman tanah gambut tinggi. Menurut Halim dan Soepardi (1987),
kategorikemasamantanahgambutdibedakanatas:(1)tinggi,pHkurangdari4(2)sedang,pHberkisarantara4
sampai5(3)rendah,pHlebihdari5.
Bersambungkebagian2yangdapatdilihatpadapustakadibawahini:

Pengelolaan

Kesuburan

Tanah

Pada

Lahan

Gambut

(Bagian

2)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanahpadalahan_4838.html]

PemanfaatanLahanGambutuntukPertanian*
(Bagian2dari5Tulisan)

II.PermasalahanPadaTanahGambut
Pada pengelolaan tanah gambut untuk usaha pertanian, yang pertamatama harus diperhatikan adalah dinamika
sifatsifatfisikadankimiatanahgambut,antaralain(1)dinamikasifatkemasamantanahyangdikaitkandengan
pengendalian asam
asam organik meracun, dan (2) dinamika kesuburan tanah sehubungan dengan ketersediaan
unsur hara makro dan mikro yang dibutuhkan tanaman yang diusahakan (3) kebakaran lahan gambut dan (4)
pengaturantataairpadalahangambutsesuaikebutuhantanaman.
SifatsifatTanahGambut
Diantara sifat yang penting dari tanah gambut di daerah tropis adalah : bahan penyusun berasal dari kayukayuan,
dalam keadaan tergenang, sifat menyusut dan subsidence ( penurunan permukaan gambut) karena drainase, kering
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

28/76

6/1/2016

DASARDASARILMUTANAH

tidak balik, pH yang sangat rendah dan status kesuburan tanah yang rendah. Pengembangan usaha pertanian sangat
dibatasiolehbeberapahaldiatas(Andriesse,1988).
A.SifatFisik
Sifatsifat fisik gambut sangat erat kaitannya dengan pengelolaan air gambut. Bahan penyusun gambut terdiri dari
empat komponen yaitu bahan organik, bahan mineral, air dan udara. Perubahan kandungan air karena reklamasi
gambut akan ikut merubah sifat
sifat fisik lainnya (Andriesse, 1988). Mengingat sifatsifat fisik tanah gambut saling
berhubungan maka pembahasan sifat fisik dari tanah gambut tidak dapat dilakukan secara terpisah. Uraian tentang
sifatsifat fisik gambut ini akan dihubungankan dengan sifatsifat kimia tanah gambut. Pemahaman akan sifatsifat
fisikakansangatbermanfaatdalammenentukanstrategipemanfaatangambut.
MenurutHardjowigeno(1996)sifatsifatfisiktanahgambutyangpentingadalah:tingkatdekomposisitanahgambut
kerapatanlindak,irreversibledansubsiden.Noor(2001)menambahkanbahwaketebalangambut,lapisanbawah,dan
kadarlengasgambutmerupakansifatsifatfisikyangperlumendapatperhatiandalampemanfaatangambut.
Berdasarkanatastingkatpelapukan(dekomposisi)tanahgambutdibedakanmenjadi:(1)gambutkasar(Fibrist)yaitu
gambutyangmemilikilebihdari2/3bahanorgankkasar(2)gambutsedang(Hemist)memiliki1/32/3bahanorganik
kasar dan (3) gambut halus (Saprist) jika bahan organik kasar kurang dari 1/3. Gambut kasar mempunyai porositas
yang tinggi, daya memegang air tinggi, namun unsur hara masih dalam bentuk organik dan sulit tersedia bagi
tanaman. Gambut kasar mudah mengalami penyusutan yang besar jika tanah direklamasi. Gambut halus memiliki
ketersediaan unsur hara yang lebih tinggi memiliki kerapatan lindak yang lebih besar dari gambut kasar
(Hardjowigeno,1996).
Tanah gambut mempunyai kerapatan lindak (bulk density) yang sangat rendah yaitu kurang dari 0,1 gr/cc untuk
gambut kasar, dan sekitar 0,2 gr/cc pada gambut halus. Dibanding dengan tanah mineral yang memiliki kerapatan
lindak1,2gr/ccmakakerapatanlindakgambutadalahsangatrendah.Rendahnyakerapatanlindakmenyebabkandaya
dukunggambut(bearingcapasity)menjadisangatrendah,keadaaninimenyebabkanrebahnyatanamantahunanseperti
kelapadankelapasawitpadatanahgambut.
Tanah gambut jika di drainase secara berlebih akan menjadi kering dan kekeringan gambut ini disebut sebagai
irreversible artinya gambut yang telah mengering tidak akan dapat menyerap air kembali. Perubahan menjadi kering
tidak balik ini disebabkan gambut yang suka air (hidrofilik) berubah menjadi tidak suka air (hidrofobik) karena
kekeringan, akibatnya kemampuan menyerap air gambut menurun sehingga gambut sulit diusahakan bagi pertanian.
Berkurangnya kemampuan menyerap air menyebabkan volume gambut menjadi menyusut dan permukaan gambut
menurun (kempes). Perbaikan drainase akan menyebabkan air keluar dari gambut kemudian oksigen masuk kedalam
bahan organik dan meningkatkan aktifitas mikroorganisme, akibatnya terjadi dekomposisi bahan organik dan gambut
akanmengalamipenyusutan(subsidence)sehinggapermukaangambutmengalamipenurunan.
Kadar lengas gambut (peat moisture) ditentukan oleh kematangan gambut. Pada gambut alami kadar lengas gambut
sangattinggimencapai5001.000%bobot,sedangkanyangtelahmengalamidekomposisiberkisarantara200600%
bobot.Kadarlengasgambutfibriklebihbesardarigambuthemikdansaprik.Kemampuanmenyerapairgambutfibrik
lebih besar dari gambut sapris dan hemist, namun kemampuan fibris memegang air lebih lemah dari gambut hemik
dan saprist (Noor, 2001). Tingginya kemampuan gambut menyerap air menyebabkan tingginya volume poripori
gambut,mengakibatkanrendahnyakerapatanlindakdandayadukunggambut(Mutalibetal,1991).
Akumulasigambutakanmenyebabkanketebalangambutyangbervariasipadasuatukawasan.Umumnyagambutakan
membentuk kubah (dome), semakin dekat dengan sungai ketebalan gambut menipis, kearah kubah gambut akan
menebal,diKalimantanBaratkubahgambutdiSungaiSelamatdapatmencapai8m,demikianpulapadadaerahrasau
Jaya. Ketebalan gambut berkaitan erat dengan kesuburan tanah. Gambut ditepi kubah tipis dan memiliki kesuburan
yangrelatifbaik(gambuttopogen)sedangditengahkubahgambuttebal>3mmemilikikesuburanyangrelatiprendah
(gambutombrogen)(Andriesse,1988Harjowigeno,1996).
Lapisan bawah gambut dapat berupa lapisan lempung marine atau pasir. Gambut diatas pasir kuarsa memiliki
kesuburanyangrelatiprendah,jikalapisangambutterkikis,menyusutdanhilangmakaakanmuncultanahpasiryang
sangat miskin. Tanah lapisan lempung marin umumnya mengandung pirit (FeS2), pada kondisi tergenang (anaerob)
pirit tidak akan berbahaya namun jika didrainase secara berlebihan dan pirit teroksidasi maka akan terbentuk asam
sulfatdansenyawabesiyangberbahayabagitanaman.KemasamantanahakanmemningkatpHmenjadi23sehingga
tanamanpertanianakankeracunandanpertumbuhanterhambatsertahasilrendah.
Gambut tropis umumnya berwarna coklat kemerahan hingga coklat tua (gelap) tergantung tahapan dekomposisinya.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

29/76

6/1/2016

DASARDASARILMUTANAH

Kandunganairyangtinggidankapasitasmemegangair1530kalidariberatkering,rendahnyabulkdensity(0,050,4
g/cm3) dan porositas total diantara 7595% menyebabkan terbatasnya penggunaan mesinmesin pertanian dan
pemilihankomoditasyangakandiusahakan(AmbakdanMelling,2000)
Sebagai contoh di Malaysia, tiga komoditas utama yaitu kelapa sawit, karet dan kelapa cenderung pertumbuhannya
miring bahkan ambruk sebagai akibat akar tidak mempunyai tumpuan tanah yang kuat (Singh et al, 1986). Gambut
memilikidayadukungataudayatumpuyangrendahkarenakerapatantanahnyarendah.Sebagaiakibatnya,pohonyang
tumbuh menjadi mudah rebah, jalan sulit dilalui kendaraan, dan sulit disawahkan (kecuali gambut dengan kedalaman
kurangdari75cm).Gambuttebalsulitdantidakcocokdibuatsawahkarenadalamkondisibasah,akansulitdiinjakserta
sangatmiskinhara.Karenanya,gambuttebalsebaiknyatidakdigunakansebagailahanpertanian/sawah.
Penurunaan gambut terjadi setelah dilakukan drainase, permukaan tanah gambut akan mengalami penurunan karena
pematangan gambut dan berkurangnya kandungan air. Ratarata kecepatan penurunan adalah 0,30,8 cm/bulan, dan
umumnya terjadi selama 34 tahun setelah drainase dan pengolahan tanah. Semakin tebal gambut, penurunan tersebut
semakin cepat dan semakin lama. Sifat gambut seperti ini mengakibatkan terjadinya genangan, pohon rebah, dan
konstruksibangunan(jembatan,jalan,salurandrainase)tergangguatauambles.
Masalah penurunan gambut ditanggulangi dengan cara sebagai berikut: Penanaman tanaman tahunan didahului dengan
penanaman tanaman semusim minimal tiga kali musim tanam dan dilakukan pemadatan sebelum penanaman tanaman
tahunan.
Beberapakiatuntukmengatasidayatumpudandayadukunggambutyangrendahadalah:
1.Budidayatanamantahunanhanyapadalahandenganketebalangambut<>
2.Dilakukan pemadatan gambut sebelum penanaman. Pemadatan dapat dilakukan dengan menggunakan alat sederhana
yangdibuatsendiridari kayu gelondong yang dapadigelindingkan (Gambar 3), ata menggunakan alat pemadat mekanis
yangbiasadigunakanuntukmemadatkantanahdijalan
3.Gambutdenganketebalanlebihdari75cmditatadengansistemtegalan.
Untuk mengatasi masalah kandungan asamasam organik yang beracun biasanya dilakukan drainase dengan membuat
saluran drainase intensif atau saluran cacing. Bahan amelioran adalah bahan yang mampu memperbaiki atau
membenahi kondisi fisik dan kesuburan tanah. Beberapa contoh bahan amelioran yang sering digunakaadalah kapur ,
tanahmineral,pupukkandang,kompos,danabu.
B.SifatsifatKimia
Ketebalanhorisonorganik,sifatsubsoildanfrekuensiluapanairsungaimempengaruhikomposisikimiagambut.Pada
tanahgambutyangseringmendapatluapan,semakinbanyakkandunganmineraltanahsehinggarelatiflebihsubur.
Kesuburan gambut sangat bervariasi dari sangat subur sampai sangat miskin. Gambut tipis yang terbentuk diatas
endapan liat atau lempung marin umumnya lebih subur dari gambut dalam (Widjaya Adhi, 1988). Atas dasar
kesuburannya gambut dibedakan atas gambut subur (eutropik), gambut sedang (mesotropik) dan gambut miskin
(oligotropik).
Secara umum kemasaman tanah gambut berkisar antara 35 dan semakin tebal bahan organik maka kemasaman
gambutmeningkat.Gambutpantaimemilikikemasamanlebihrendahdarigambutpedalaman.Kondisitanahgambut
yang sangat masam akan menyebabkan kekahatan hara N, P, K, Ca, Mg, Bo dan Mo. Unsur hara Cu, Bo dan Zn
merupakanunsurmikroyangseringkalisangatkurang(Wongetal, 1986, dalam Mutalib etal,1991).KekahatanCu
acapkaliterjadipadatanamanjagung,ketelapohondankelapasawityangditanamditanahgambut.
Tanah gambut ombrogen dengan kubah gambut yang tebal umumnya memiliki kesuburan yang rendah dengan pH
sekitar 3,3 namun pada gambut tipis di kawasan dekat tepi sungai gambut semakin subur dan pH berkisar 4,3
(Andriesse, 1988). Kemasaman tanah gambut disebabkan oleh kandungan asam asam organik yang terdapat pada
koloid gambut. Dekomposisi bahan organik pada kondisi anaerob menyebabkan terbentuknya senyawa fenolat dan
karboksilatyangmenyebabkantingginyakemasamangambut.Selainituterbentuknyasenyawafenolatdankarboksilat
dapat meracuni tanaman pertanian (Sabiham, 1996). Jika tanah lapisan bawah mengandung pirit, pembuatan parit
drainasedengankedalamanmencapailapisanpiritakanmenyebabkanpiritteroksidasidanmenyebabkanmeningkatnya
kemasamangambutdanairdisalurandrainase.
Hubungan ketebalan gambut dengan sifat kimia dan kesuburan gambut disajikan pada Tabel 3. Tanah gambut
memiliki kapasitas tukar kation (KTK) yang sangat tinggi (90200 me/100 gr) namun kejenuhan basa (KB) sangat
rendah,halinimenyebabkanketersedianharaterutamaK,Ca,danMgmenjadisangatrendah.
KB gambut harus ditingkatkan mencapai 2530% agar basabasa tertukar dapat dimanfaatkan tanaman (Tim Fakultas
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

30/76

6/1/2016

DASARDASARILMUTANAH

Pertanian IPB,1986 Hardjowigeno, 1996 dan Sagiman, 2001). C/N gambut umumnya sangat tinggi melibihi 30 ini
berartiharanitrogen kurang tersedia untuk tanaman sekalipun hasil analisis N total menunjukkan angka yang tinggi.
Unsur P dalam tanah gambut terdapat dalam bentuk P organik dan kurang tersedia bagi tanaman. Pemupukan P
denganpupukyangcepattersediaakanmenyebabkanionphosphatmudahtercucidanmengurangiketersediaanharaP
bagi tanaman. Penambahan besi dapat mengurangi pencucian P (Soewono, 1997) dilapangan pencucian P dapat
diperkecildenganmenambahkantanahmineralkayabesidanAl(Salampak,1999).
Everret(1983)mengemukakanbahwaKapasitasTukarKation(KTK)tanahgambutpadaumumnyasangattinggi,
biasanya lebih dari 100 cmol kg1 tanah. KTK tanah gambut di dataran Anai termasuk tinggi dan sangat tinggi,
yaitu antara 35,1 sampai 65,6 cmol kg1 tanah. Data KTK tanah gambut di dataran Anai yang diambil dari
beberapasampelprofil.
Nilai Kejenuhan Basa (KB) adalah persentase dari total kapasitas tukar kation yang ditempati oleh kationkation
basa seperti kalsium, magnesium, kalium, dan natrium. Nilai KB berhubungan erat dengan pH dan tingkat
kesuburantanah.
KemasamanakanmenurundankesuburantanahakanmeningkatdenganmeningkatnyaKB.Lajupelepasankation
terjerap bagi tanaman bergantung pada tingkat KB suatu tanah. Suatu tanah dikatakan sangat subur jika KBnya
lebihbesardari80%,kesuburansedangjikaKBnyaberkisarantara50%sampai80%,dandikatakantidaksubur
jikaKBnyakurangdari50%(Tan,1993).
Tindaklanjutmasalahtanahgambutyangsudahdipecahkanadalahusahamemperbaikikesuburantanahdigunakan
pupuk (makro dan mikro) dan bahan amelioran. Pupuk mikro digunakan pada tanah gambut dengan kedalaman lebih
dari1m.(Prasetyo, 1996), pengapuran untuk menaikkan pH tanah (Mawardi et al,1997), dan aplikasi mikrobia
pelapukbahanorganik(Poeloenganet al, 1995).
Hasil penelitian Mawardi et al, (1997) memperlihatkan bahwa bahanbahan amelioran dapat menetralkan asam
asamorganikyangbersifatmeracuni,meningkatkanpH,danmemperbaikipertumbuhandanproduksitanaman.
Menurut Sastrosupadi et al, (1992) pengapuran dapat meningkatkan pH tanah, menetralkan Al, dan
meningkatkan ketersediaan P untuk tanaman. Rendahnya pH dan besarnya kapasitas sangga tanah gambut
menyebabkanbanyakdiperlukankapuruntukmeningkatkansetiapsatuanpH.
Dari hasilhasil penelitian disimpulkan bahwa salah satu kegiatan pertanian yang memberikan kontribusi yang nyata
bagi rusaknya ekosistem gambut adalah kegiatan pembukaan lahan gambut dengan cara bakar. Pembukaan lahan
gambutdengancarabakar,menjadifaktorpenyebabkerusakanlahangambutyangcukupsignifikan.
Selain itu, pemakaian pupuk kimia dengan dosis tinggi secara terus menerus dapat merusak struktur tanah dan
menimbulkan pencemaran, baik terhadap lahan pertanian maupun lingkungan, sehingga menyebabkan produktivitas
lahansemakinmerosot.
Pertanian yang hanya bertumpu pada pemakaian pupuk kimia, selain memberikan dampak positif terhadap
peningkatan produksi, juga memberikan dampak negatif berupa penurunan kualitas tanah serta pemborosan energi.
Dalam era lingkungan dan globalisasi, orientasi pengembangan pertanian diarahkan untuk meningkatkan produksi
secara berkelanjutan (mempertahankan kualitas lahan dan lingkungan) denga cara memperbaiki kesuburan tanah
menggunakan sumberdaya alami seperti mendaur ulang limbah pertanian sehingga pemakaian pupuk kimia dapat
dikurangi.
Alternatif mempertahankan dan meningkatkan kesuburan lahan gambut serta menghindarkan dampak negatif
penggunaan abu bakaran gambut dan pupuk kimia antara lain dengan memadukan penggunaan limbahlimbah
pertaniansebagaiameliorandanpenanamanvarietasvarietasadaftifsertapemanfaatanpupukorganik.Pembuatanabu
sebagai bahan amelioran dilakukan petani bersamaan dengan musim kemarau, yaitu dengan cara membakar gambut
padawaktumembersihkanlahandarigulmadansemakbelukar.Mahalnyahargapupukmenyebabkanketergantungan
petanipadaabubakardarigambutsemakintinggi.
Kendala utama yang dihadapi dalam pengembangan pertanian di lahan pasang surut (gambut) adalah adanya lapisan
gambuttebaldanlapisanpirit(FeS02).Gambutmempunyaisifatkhas,yaitusifatkeringtakbalik(irreversible drying)
dandayaretensiairyangbesar(DriessendanSoepraptohardjo,1974).Sedangkanpiritadalahsuatumineralendapan
marinyangterbentukpadatanahyangjenuhair,kayabahanorganikdandiperkayaolehsulfatlarutyangberasaldari
laut.Piritmempunyaisifatyangunikdantergantungpadakeadaanair(VanBreemendanPons,1978).Padakeadaan
jenuhairpiritstabildantidakberbahaya,tetapipadakeadaankeringataudrainaseberlebihanmakapiritmenjadilabil
danmudahteroksidasi.Oksidasipiritakanmenyebabkanpemasamantanahkarenadiikutiolehpelepasanionionsulfat
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

31/76

6/1/2016

DASARDASARILMUTANAH

dan besi, selanjutnya akan menghancurkan struktur mineral liat tanah sehingga meningkatkan kadar asam, besi,
aluminumdalamlaruttanah.
Dalam konteks konservasi lahan gambut maka upaya untuk menghindarkan terjadinya degradasi lahan adalah
bagaimana mempertahankan lapisan gambut pada batas antara 25 50 cm bergantung sistem usahatani yang
dikembangkandanmencegahterjadinyaoksidasipiritberlebihan.Hasilpemetaanpadasebagianbesarkawasangambut
diKalimantan,termasukkawasanpengembanganlahangambut(PLG)sejutahektarberadapadaendapanmarinyang
kayapiritpadakedalamanyangberagamantara25100cmlebih.Olehkarenaitupenyusutanataukehilanganlapisan
atas (gambut) dapat menyebabkan terjadinya pemasaman tanah dan pencemaran terhadap lingkungan. Selain itu juga
dengan semakin meningkatnya penyusutan kawasan gambut dapat mengakibatkan terganggunya tatanan tata air di
kawasangambutkarenasifatgambutyangbesardalammenyimpanairyaituantara200800%bobot(Nugrohoet
al. , 1997).
Lahangambutmerupakanlahanyangberasaldaribentukangambutbesertavegetasiyangterdapatdiatasnyaterbentuk
di daerah yang topografinya rendah, dan bercurah hujan tinggi atau di daerah yang suhunya sangat rendah. Tanah
gambutmempunyaikandunganbahanorganikyangtinggi(>12%C.karbon)dankedalamangambutminimum50cm.
TanahgambutdiklasifikasikansebagaiHistosoldalamsistem
Klasifikasi FAO
UNESCO (1994) yaitu yang mengandung bahan organik lebih tinggi daripada 30 persen, dalam
lapisan setebal 40 cm atau lebih, dibagian 80 cm teratas profil tanah. Gambut merupakan sumberdaya alam yang
banyak memiliki kegunaan antara lain untuk budidaya tanaman pertanian maupun kehutanan, dan akuakultur, selain
juga dapat digunakan untuk bahan bakar, media pembibitan, ameliorasi tanah dan untuk menyerap zat pencemar
lingkungan.
C.SifatBiologi
Menurut Waksman dalam Andriesse (1988) perombakan bahan organik saat pembentukan gambut dilakukan oleh
mikroorganismeanaerobdalamperombakaninidihasilkangasmethanedansulfida.Setelahgambutdidrainaseuntuk
tujuan pertanian maka kondisi gambut bagian permukaan tanah menjadi aerob, sehingga memungkinkan fungi dan
bakteri berkembang untuk merombak senyawa sellulosa, hemisellulosa, dan protein. Gambut tropika umumnya
tersusun dari bahan kayu sehingga banyak mengandung lignin, bakteri yang banyak ditemukan pada gambut tropika
adalahPseudomonasselainfungiwhitemolddanPenecilium(Suryanto,1991).Pseudomonasmerupakanbakteriyang
mampu merombak lignin(Alexander, 1977). Penelitian tentang dekomposisi gambut di Palangkaraya menunjukkan
bahwa dekomposisi permukaan gambut terutama disebabkan oleh dekomposisi aerob yang dilaksanakan oleh fungi
(MooreandShearer,1997).
Pada berapa penelitian di lahan gambut Jawai (Kab Sambas) dan Jangkang (Kab Pontianak) dapat diisolasi bakteri
Bradyrhizobium japonicum yang dapat dipergunakan untuk meningkatkan hasil kedelai di lahan gambut. Kedelai
adalah tanaman yang sangat banyak memerlukan nitrogen, 40 80 persen kebutuhan nitrogen kedelai dapat disuplai
melalui simbiosis kedelai dan bakteri bintil akar (B. japonicum ). Gambut memiliki ketersediaan N yang rendah.
Inokulasi B japonicum asal Jawai dan Jangkang yang efektif dapat meningkatkan kandungan N dan hasil tanaman
kedelai(SagimandanAnas.2005).
D.PengaturanTataAirPadaTanahGambut
Lahan marginal seperti lahan gambut dapat ditingkatkan menjadi lahan produktif dengan menerapkanteknologiyang
tepat guna. Lahan gambut dicirikan dengan kandungan bahan organik yang tinggi, kemasaman tanah tinggi, namun
mempunyai ketersedian hara makro dan mikro yang sangat rendah. Selain itu path musim penghujan akan terjadi
penggenangan air dan path musim kemarau akan terjadi kekeringan, sehingga tata air menjadi kebutuhan mutlak
(Yardha,eta1,1998Yusuf,eta1,1999).
SumberAirdiLahanGambut
Sebagaisalahsatujenislahanrawa,keberadaanairdilahangambutsangatdipengaruhiolehadanyahujandanpasang
surut/luapanairsungai.Tingkahlakudarikeduanyaakanberpengaruhterhadaptinggidanlamagenanganairdilahan
gambutdanpadaakhirnyaakanberpengaruhterhadaptingkatkesuburanlahansertapolabudidayatanamanyangakan
diterapkan di atasnya. Lahan gambut yang sering menerima luapan air sungai relatif lebih subur dibandingkan lahan
gambut yang sematamata hanya menerima limpasan/curahan air hujan. Sifat luapan/pasang surut air sungai yang
jangkauannya dapat mencapai lahan gambut dapat disiasati untuk mengatasi berbagai kendala pertanian di lahan
gambut, misalnya untuk mencuci zatzat beracun atau asam kuat yang berasal dari teroksidasinya pirit dan mengatur
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

32/76

6/1/2016

DASARDASARILMUTANAH

keberadaanairsehinggatanamandapattumbuhdenganbaik.
TeknologiPengelolaanAirdiLahanGambut
Pengelolaan air di lahan gambut bertujuan untuk mengatur pemanfaatan sumber daya air secara optimal sehingga
didapatkan hasil/produktivitas lahan yang maksimal, serta sekaligus mempertahankan kelestarian sumber daya lahan
tersebut. Salah satu teknik pengelolaan air di lahan gambut dapat dilakukan dengan membuat parit/saluran, dengan
tujuan:
1.Mengendalikankeberadaanairtanahdilahangambutsesuaidengankebutuhantanamanyangakandibudidayakan.
Artinya: gambut tidak menjadi kering di musim kemarau, tapi juga tidak tergenang di musim hujan. Hal demikian
dapat dicapai dengan membuat pintu air (flapgate) yang dapat mengatur tinggi muka air tanah gambut sekaligus
menahanairyangkeluardarilahan
2. Mencuci asamasam organik dan anorganik serta senyawa lainnya yang bersifat racun terhadap tanaman dan
memasukan(suplai)airsegaruntukmemberikanoksigen
3. Memanfaatkan keberadaan air di dalam saluran sebagai media budidaya ikan, baik budidaya aktif (dimana benih
ikan ditebarkan di dalam saluran) maupun budidaya pasif (dimana parit/saluran digunaan sebagai perangkap ikan
ketikasungaidisekitarnyameluap).
Selainitukeberadaanairdidalamparitakanberfungsisebagaisekatbakaryangdapatmencegahterjadinyakebakaran
di lahan gambut sebagai sarana transportasi hasil panen.Lahan gambut merupakan salah satu jenis lahan rawa yang
selalu jenuh air atau tergenang, kondisi demikian menjadikan lahan gambut sulit untuk dikembangkan sebagai lahan
pertanian. Salah satu faktor kunci keberhasilan pengembangan pertanian di lahan gambut, selain meningkatkan
kesuburannya adalah mengendalikan tinggi muka air di dalamnya sehingga gambut tetap basah tapi tidak tergenang
dimusim hujan dan tidak kering di musim kemarau. Pengaturan tinggi muka air yang tepat juga dimaksudkan agar
prosespencucianbahanberacunberjalandenganlancarsehinggaterciptamediatumbuhyangbaikbagitanaman.
Beberapateknikpengelolaanairyangtelahlamadikembangkandilahanrawa(termasukgambut)antaralain:
(1)Sistemparit/handilditepisungaidan
(2)Sistemsaluranmodelgarpudilahanpasangsurut
(dikembangkanolehUniversitasGajahMada).
Keduasisteminimempunyaikelemahanyaitualiranairyangmasukataukeluardaripetakanlahangambut(padasaat
pasangsurut/luapanberlangsung)terjadipadasatusaluranyangsama,danpadasaluraniniseringterjadipendangkalan
yangdiakibatkanolehendapanlumpursungai.Kondisidemikianmenyebabkanpenyumbatansaluransehinggaproses
pergantianairdidalampetakanlahantidakberlangsungsempurna,akibatnyabahanbahanberacundanjugasenyawa
asammenumpuk/terakumulasididalamsalurandanmenyebabkanmutuairmenjadijelek.Kondisidiatasdapatdiatasi
denganmengangkat/membuangendapandaridalamsaluranataumemisahkansaluranairmasuk/irigasi(inlet) dengan
airkeluar/drainase(outlet).
1.Sistemparit/handilditepisungai
Pengelolaanlahanpertaniandengansistemparit/handilini,telahdikembangkansejakdahulukalaolehpetanidilahan
gambutpedalamanKalimantan.Paritdibuatdaripinggirsungaiyangmengarahtegakluruskearahdaratan,dikiridan
kanan parit dibuat pematangpematang yang umumnya digunakan sebagai jalan sekaligus sebagai batas kepemilikan
lahan. Parit dapat dipandang sebagai saluran sekunder bila sungai dipandang sebagai saluran primer. Parit dibuat
secara bertahap dan diselaraskan dengan kondisi perubahan lahan, pengaruh pasang surut (kedalaman muka air) dan
ketebalan gambut. Penerapan sistem parit biasanya diawali dengan usaha pembukaan lahan (reklamasi) dengan
merintisdanmemotong/menebangpohonpohonbesar.
Pekerjaaninidilakukansecaraberkelompokdanbertahapsertadimulaidaritepisungaitegakluruskearahpedalaman.
Sistemparit/handildicirikanoleh:
1. Lahan usahatani umumnya berjarak 0,5 4 km dari tepi sungai ke arah pedalaman, atau sampai ke ketebalan
gambutmaksimum1meter
2. Di bagian tepi sungai biasanya tidak dibuatkan pematang, karena sudah ada tanggul sungai yang terbentuk secara
alami sehingga bila sungai pasang atau banjir, luapan air akan tertahan dan genangan pada lahan usaha yang
ditimbulkanterbatas
3.Paritdibuatbiasanyaberfungsiganda,pertamasebagaisalurandrainase(pembuangan)apabilaairsurutdankedua
sebagaisaluranirigasi(mengairi)apabilaairpasang.Aliranairdalamparitadalahduaarahataubolakbalik
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

33/76

6/1/2016

DASARDASARILMUTANAH

4.Untukmempertahankankeberadaanairdilahan/petakan,makapadaparitdipasangtabatuntukmencegahkeluarnya
airsewaktusuruttetapisewaktupasangairdapatmudahmasukdalampetakan
5.Untukmencegahagarparittidaktersumbatolehendapanlumpur,makaperludilakukanpengangkatan/pembuangan
lumpursecararutinsetiapbulansekali
6.Lebarparit/handilberukuran5meterdansemakinmenyempitkearahhuluparit.Padakanandankiriparitdibuat
tanggul/pematang untuk ditanami buahbuah yang berfungsi sebagai penguat tanggul agar tidak longsor. Di atas
pematangini,jugadapatdibuatpondokpondok
7. Pada setiap jarak 500 meter dibuat parit cacing yang berfungsi untuk memasukan dan mengeluarkan air pada
petakanpertanaman.
2.Sistemsaluranmodelgarpudilahanpasangsurut
Pengaturan tata air dengan sistem garpu (Gambar 2) telah dikembangkan oleh Universitas Gajah Mada (UGM) pada
lahanpasangsurut,yaitulahanlahanyangterletakdidataranpantaiataudatarandekatsungaibaikterpengaruhsecara
langsung maupun tidak langsung oleh pasang surut. Untuk mengatur air pasang surut, maka dibuat pintupintu air
yangdikenaldengansebutanflapgateyaitupintuotomatisyangketikapasang,airakanmendorongpintusehinggaair
dapat masuk ke dalam paritparit petakan lahan tetapi sewaktu surut, air akan tertahan di dalam paritparit petakan
lahan. Struktur tinggi/operasional pintupintu air tersebut disesuaikan dengan penggunaan lahannya, apakah untuk
sawah, surjan atau lahan kering. Kelemahan sistem garpu: Biaya pembuatan sistem garpu terlalu mahal, karena
dirancanguntukarealpertanianyangcukupluasdanmenggunakanalatalatberat
E.KebakaranLahanGambut
Kendala lain pada tanah gambut adalah kebakaran gambut hal ini dapat merugikan, apabila gambut mengalami
pengeringan yang berlebihan sehingga koloid gambut menjadi rusak dan kering. Terjadi gejala kering tak balik
(irreversible drying) dan gambut berubah sifat seperti arang sehingga tidak mampu lagi menyerap hara dan menahan
air (Subagyo et al, 1996). Gambut akan kehilangan air tersedia setelah 4 5 minggu pengeringan dan ini
mengakibatkangambutmudahterbakar.
Kebakaran hutan dan lahan gambut di wilayah tropika terutama di Asia Tenggara sudah terjadi selama 20 tahun
terakhir ini. Kebakaran tersebut terjadi umumnya selama musim kering yang terimbas oleh periode iklim panas atau
dikenal sebagai El NinoSouthern Oscilation (ENSO). Periode panas ini dapat terjadi setiap 37 tahun, dan lama
kejadiannyadari14bulanhingga22bulan(Singaravelu,2002).PemanasaninibiasanyabermulapadabulanOktober,
terusmeningkatkeakhirtahundanberpuncakpadapertengahantahunberikutnya.
Kebakaran hutan tropika basah di Indonesia diketahui terjadi sejak abad ke19, yakni di kawasan antara Sungai
KalimantandanCempaka(sekarangSungaiSampitdanKatingan)diKalimantanTengah,yangrusakakibatkebakaran
hutan tahun 1877. Statistik Kehutanan Indonesia telah mencatat adanya kebakaran hutan sejak tahun 1978, meskipun
kebakaran besar yang diketahui oleh umum terjadi pada tahun 1982/1983 telah menghabiskan 3,6 juta ha hutan
termasuk sekitar 500.000 ha lahan gambut di Kalimantan Timur (Page et al., 2000 Parish, 2002). Selanjutnya pada
tahun1987kebakaranhutandalamskalabesarterjadilagidi21propinsiterutamadiKalimantanTimur,yangterjadi
bersamaan dengan munculnya periode iklim panas ENSO, sehingga sejak saat itu timbul anggapan bahwa kebakaran
hutan adalah bencana alam akibat kemarau panjang dan kering karena ENSO. Begitulah kebakaran besar terjadi lagi
padatahun1991,1994dan1997di24propinsidiIndonesia.
Kebakaran selama musim kering pada tahun 1997, telah membakar sekitar 1,5 juta ha lahan gambut di Indonesia
(BAPPENAS, 1998), termasuk 750.000 ha di Kalimantan. Kebakaran hutan dan lahan pada tahun 1997 dinyatakan
sebagaiyangterburukdalam20tahunterakhir.Atasdasarrekamansejarahtersebutdiatas,kebakaranhutandanlahan
diIndonesiaberulangsetiaplimatahun,yangnampaknyacocokbenardenganperiodeiklimpanasENSOratarata5
tahun.
PenyebabKebakaran
Kebakaran hutan dan lahan gambut selama musim kering dapat disebabkan atau dipicu oleh kejadian alamiah dan
kegiatan atau kecerobohan manusia. Kejadian alamiah seperti terbakarnya ranting dan daun kering secara sertamerta
(spontan) akibat panas yang ditimbulkan oleh batu dan benda lainnya yang dapat menyimpan dan menghantar panas,
danpelepasangasmetana(CH4)telahdiketahuidapatmemicuterjadinyakebakaran(Abdullahetal.,2002).Meskipun
demikian, pemicu utama terjadinya kebakaran adalah adanya kegiatan dan atau kecerobohan manusia, yang 9095%
kejadiankebakarandipicuolehfaktorini.
Faktor manusia yang dapat memicu terjadinya kebakaran meliputi pembukaan lahan dalam rangka pengembangan
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

34/76

6/1/2016

DASARDASARILMUTANAH

pertanian berskala besar, persiapan lahan oleh petani, dan kegiatankegiatan rekreasi seperti perkemahan, piknik dan
perburuan.MenurutpengalamandiMalaysia(Abdullahetal.,2002Musa&Parlan,2002)dandiSumatra(Sanders,
2005),kegiatanpembukaandanpersiapanlahanbaikolehperusahaanmaupunmasyarakatmerupakanpenyebabutama
terjadinya kebakaran hutan dan lahan gambut. Pembukaan dan persiapan lahan oleh petani dengan cara membakar
merupakan cara yang murah dan cepat terutama bagi tanah yang berkesuburan rendah. Banyak penelitian telah
menunjukkanbahwacarainicukupmembantumemperbaikikesuburantanahdenganmeningkatkankandunganunsur
haradanmengurangikemasaman(Diemontetal.,2002).Hanyasajajikatidakterkendali,kegiataninidapatmemicu
terjadinyakebakaran.
Dalam skala besar, ancaman kebakaran terutama terjadi dalam kawasan hutan dan lahan gambut yang telah
direklamasi. Kasus kebakaran hutan dan lahan gambut pada tahun 1997 menunjukkan bahwa sekitar 80% dari luas
lahanProyekPengembangan
Lahan Gambut (PPLG) 1,4 juta hektar di Kalimantan Tengah diliputi oleh titik titik panas (hot spots), yang
sebarannya semakin banyak ke arah saluran pengatusan (drainase) yang telah dibangun (Jaya et al, 2000 Page et al,
2000). Ancaman itu memang akhirnya terjadi bahwa sekitar 500.000 ha kawasan PPLG di Kalimantan Tengah telah
terbakarselamakebakarantahun1997(Pageetal,2000Siegertetal,2002).
SifatKebakaran
Sifat kebakaran yang terjadi di kawasan hutan dan lahan gambut berbeda dengan yang terjadi di kawasan hutan dan
lahan tanah mineral (bukan gambut). Di kawasan bergambut, kebakaran tidak hanya menghanguskan tanaman dan
vegetasihutansertalantaihutan(forest floor) termasuk lapisan serasah, dedaunan dan bekas kayu yang gugur, tetapi
jugamembakarlapisangambutbaikdipermukaanmaupundibawahpermukaan.
Berdasarkan pengamatan lapangan (Usup et al, 2003) ada dua tipe kebakaran lapisan gambut, yaitu tipe lapisan
permukaan dan tipe bawah permukaan. Tipe yang pertama dapat menghanguskan lapisan gambut hingga 1015 cm,
yangbiasanyaterjadipadagambutdangkalataupadahutandanlahanberketinggianmukaairtanahtidaklebihdari30
cmdaripermukaan.Padatipeyangpertamaini,ujungapibergeraksecarazigzagdancepat,denganpanjangproyeksi
sekitar1050cmdankecepatanmenyebarratarata3,83cmjam1(atau92cmhari1).
Tipe yang kedua adalah terbakarnya gambut di kedalaman 3050 cm di bawah permukaan. Ujung api bergerak dan
menyebarkearahkubahgambut(peatdome)danperakaranpohondengankecepatanratarata1,29cmjam1(atau29
cm hari1). Kebakaran tipe kedua ini paling berbahaya karena menimbulkan kabut asap gelap dan pekat, dan
melepaskangaspencemarlainnyakeatmosfer.Disampingitu,kebakarantipeke2inisangatsulituntukdipadamkan,
bahkanolehhujanlebatsekalipun.
Dari uraian di atas jelas bahwa kebakaran hutan dan lahan gambut dapat meninmbulkan dampak/akibat buruk yang
lebihbesardibandingkandengankebakaranyangterjadidikawasantidakbergambut(tanahmineral).Selainitu,cara
penanganannyapunberbeda,karenakarakteristikkebakarandikawasanbergambutyangkhasdaripadadikawasantidak
bergambut.
AkibatKebakaran
Kebakaran hutan dan lahan gambut dapat berakibat langsung dan tidak langsung atas lingkungan di dalam tapak
kejadian(onsiteefect)ataudiluartapakkejadian(ofsiteefect).Akibatkebakaranhutandanlahangambutantaralain
adalahkehilanganlapisanserasahdanlapisangambut,stabilitaslingkungan,gangguanatasdinamikafloradanfauna,
gangguan atas kualitas udara dan kesehatan manusia, kehilangan potensi ekonomi, dan gangguan atas sistem
transportasidankomunikasi.
KasuskebakaranhutandanlahangambutdiKalimantanTengahpadatahun1997telahmenghilangkanlapisangambut
3570cm(Jayaetal.,2000).Kehilanganlapisangambutiniberakibatataskestabilanlingkungan,karenakehilangan
lapisangambut.Ketebalanitusetaradenganpelepasankarbon(C)sebanyak0,20,6GtC.PelepasanCiniberdampak
luarbiasaatasemisigaskarbondioksida(CO2)keatmosfer,yangturutberperandalampemanasanglobal(Siegertet
al.,2002).Selainitu,kebakarantahun1997telahmerusakvegetasihutansehinggakerapatanpohonberkuranghingga
75%(DArcy&Page,2002).
Dampakutamakebakaranhutandanlahangambutadalahasapyangmempengaruhijarakpandangdankualitasudara.
Asapbertahancukuplamadilapisanatmosferpermukaan,akibatrendahnyakecepatananginpermukaan.Lapisanasap
iniberdampakseriuspadasistemtransportasiudara,danpadakesehatanmanusiasertafloradanfauna.Padakebakaran
tahun 1997 berkurangnya jarak pandang di beberapa kota di Kalimantan dan Sumatra antara bulan Mei dan Oktober
telahmengakibatkanpenundaanjamterbangdanbahkanpenutupanbeberapabandarudara.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

35/76

6/1/2016

DASARDASARILMUTANAH

DibeberapadaerahdiKalimantandanSumatra,terutamadidaerahdaerahyangbanyakdijumpaikebakaranhutandan
lahangambut,asapyangdihasilkantelahmengakibatkangangguankesehatanterutamamasyarakatmiskin,lanjutusia,
ibuhamildananakbalita.JumlahkasusselamabulanSeptemberNovember1997didelapanpropinsidiKalimantan
danSumatratercatat527kematian,298.125asma,58.095bronkitis,dan1.446.120ISPA(infeksisaluranpernafasan
akut),termasukdiKalimantanSelatanyangdijumpai69kasuskematian,41.800asma,8.145bronkitis,dan202.761
kasusISPA.
Kebakaran hutan dan lahan gambut juga berdampak atas hilangnya beberapa potensi ekonomi terutama di sektor
kehutanan dan pertanian. Kerugian ekonomi pada sektor kehutanan akibat kebakaran tahun 1997 mencapai Rp 2,4
trilyun untuk delapan propinsi kawasan bergambut di Kalimantan dan Sumatra. Sedangkan di sektor pertanian
kerugiannyamencapaiRp718milyar.
Akibat tidak langsung dari kebakaran lahan gambut merupakan akibat lanjutan (post
e fect) yang dihasilkan ketika
proses pemulihan hutan dan lahan gambut baik secara alamiah maupun buatan manusia belum mencapai titik pulih.
Akibat ini bisa terjadi selama bertahuntahun tergantung kemampuan untuk memulihkan. Akibat utamanya adalah
terganggunya fungsi hidrologis dan pengaturan iklim. Hilangnya vegetasi dan terbukanya hutan dan lahan gambut
menyebabkan debit aliran permukaan dan erosi akan meningkat dalam musim hujan sehingga dapat menyebabkan
banjir.Selainitu,hilangnyavegetasiakanmengurangipenyerapanCO2sehinggameningkatkanefekrumahkacadan
hutanjugakehilanganfungsipengaturaniklimnya.
Pengelolaanataskebakaranhutanlahangambutmeliputiupayapencegahandanpengendalian.Keduaupayaituharus
dilakukan secara sistematis, serbacakup (comprehensive), dan terpadu, dengan melibatkan semua pihak yang
berkepentingan(stakeholder).
Pencegahankebakaran
Tindakan pencegahan merupakan komponen terpenting dari seluruh sistem penanggulangan bencana termasuk
kebakaran. Bila pencegahan dilaksanakan dengan baik, seluruh bencana kebakaran dapat diminimalkan atau bahkan
dihindarkan. Pencegahan kebakaran diarahkan untuk meminimalkan atau menghilangkan sumber api di lapangan.
Upaya ini pada dasarnya harus dimulai sejak awal proses pembangunan sebuah wilayah, yaitu sejak penetapan fungsi
wilayah,perencanaantatagunahutan/lahan,pemberianijinbagikegiatan,hinggapemantauandanevaluasi.
Beberapakegiatanyangdapatdilakukanuntukmencegahtimbulnyaapidiantaranya:
1. Penatagunaan lahan sesuai dengan peruntukan dan fungsinya masingmasing, dengan mempertimbangkan
kelayakannyasecaraekologisdisampingsecaraekonomis.
2. Pengembangan sistem budidaya pertanian dan perkebunan, serta sistem produksi kayu yang tidak rentan terhadap
kebakaran, seperti pembukaan dan persiapan lahan tanpa bakar (zero burningbased land clearing), atau dengan
pembakaranyangterkendali(controlledburningbasedlandclearing).
3. Pengembangan sistem kepemilikan lahan secara jelas dan tepat sasaran. Kegiatan ini dimaksudkan untuk
menghindaripengelolaanlahanyangtidaktepatsesuaidengenperuntukandanfungsinya.
4. Pencegahan perubahan ekologi secara besarbesaran diantaranya dengan membuat dan mengembangkan pedoman
pemanfaatanhutandanlahangambutsecarabijaksana(wiseuseofpeatland),danmemulihkanhutandanlahangambut
yangtelahrusak.
5. Pengembangan program penyadaran masyarakat terutama yang terkait dengan tindakan pencegahan dan
pengendalian kebakaran. Program ini diharapkan dapat mendorong dikembangkannya strategi pencegahan dan
pengendaliankebakaranberbasismasyarakat(communitybasedfiremanagement).
6. Pengembangan sistem penegakan hukum. Hal ini mencakup penyelidikan terhadap penyebab kebakaran serta
mengajukanpihakpihakyangdidugamenyebabkankebakarankepengadilan.
7. Pengembangan sistem informasi kebakaran yang berorientasi kepada penyelesaian masalah. Hal ini mencakup
pengembangan sistem pemeringkatan bahaya kebakaran (Fire Danger Rating System) dengan memadukan data iklim
(curah hujan dan kelembaban udara), data hidrologis (kedalaman muka ir tanah dan kadar lengas tanah), dan data
bahan yang dapat memicu timbulnya api. Kegiatan ini akan memberikan gambaran secara kartografik terhadap
kerawanankebakaran.Gambarannyadapatberupapetabahayakebakaranyangberhubungandengankondisimudahnya
terjadikebakaran,petaresikokebakaranyangberkaitandengansebabmusababterjadinyakebakaran,danpetasejarah
kebakaranyangpentinguntukevaluasipenanggulangankebakaran.
Pengendaliankebakaran
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

36/76

6/1/2016

DASARDASARILMUTANAH

Kegiatan pengendalian kebakaran meliputi kegiatan mitigasi, kesiagaan, dan pemadaman api. Kegiatan mitigasi
bertujuan untuk mengurangi dampak kebakaran seperti pada kesehatan dan sektor transportasi yang disebabkan oleh
asap.Beberapakegiatanmitigasiyangdapatdilakukanantaralain:
(1)menyediakanperalatankesehatanterutamadidaerahrawankebakaran,
(2)menyediakandanmengaktifkansemuaalatpengukurdebudidaerahrawankebakaran,
(3)memperingatkanpihakpihakyangterkaittentangbahayakebakarandanasap,
(4)mengembangkanwadukwadukairdidaerahrawankebakaran,dan
(5)membuatparitparitapiuntukmencegahmeluasnyakebakaranbesertadampaknya.
Kesiagaandalampengendaliankebakaranbertujuanagarperangkatpenanggulangankebakarandandampaknyaberada
dalamkeadaansiapdigerakkan.Halyangpalingpentingdalamtahapiniadalahmembangunpartisipasimasyarakatdi
kawasanrawankebakaran,danketaatanparapengusahaterhadapketentuanpenanggulangankebakaran.
Tahapan ketiga adalah kegiatan pemadaman api. Pada tahap ini usaha lokal untuk memadamkan api menjadi sangat
penting karena upaya di tingkat lebih tinggi memerlukan persiapan lebih lama sehingga dikhawatirkan api sudah
menyebar lebih luas. Pemadaman api di kawasan bergambut jauh lebih sulit daripada di kawasan yang tidak
bergambut.Haliniterkaitdengankecepatanpenyebaranapiyangsangatcepatdantipeapidibawahpermukaan.
Strategi pemadaman api secara konvensional seperti pada kawasan hutan dan lahan tidak bergambut harus
dikombinasikan dengan caracara khas untuk kawasan bergambut, terutama untuk memadamkan api di bawah
permukaan. Pemadaman api di bawah permukaan dengan menyemprotkan air ke atas permukaan lahan tidaklah
efektif, karena tanah gambut mempunyai daya hantar air cacak (vertikal) yang sangat randah, tetapi daya hantar air
menyamping(lateral)nyatinggi.Olehkarenanyapemadamanapibertipeinihanyadapatdilakukandenganmembuat
parit yang diairi, seperti sekat bakar diairi (KATIR) yang telah dikembangkan oleh Tim Serbu Api Universitas
Palangkaraya. Cara lainnya adalah penyemprotan air melalui lubang yang telah digali hingga batas api di bawah
permukaan,sepertiyangdilakukandiMalaysia(Musa&Parlan,2002).
Pengelolaanlahangambutharusdilakukansecaraterencanadanpenuhkehatihatianagarmutudankelestariansumber
daya lahan dan lingkungannya dapat dipertahankan secara berkesinambungan. Kegiatan pengelolaan lahan rawa
gambut untuk pertanian harus diprioritaskan pada kawasan lahan gambut yang telah mengalami kerusakan tetapi
memilikipotensipemanfaatanyangtinggidenganbataskedalamantidaklebihdari1meter.Kegiatanpertaniandengan
membukalahanbaru,apalagiyangmasih
berhutan,harusdihindari/dilarang.

Bersambungkebagian3yangdapatdilihatpadapustakadibawahini:

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Pada

Lahan Gambut (Bagian 3) [http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah


padalahan_3252.html]

(Bagian3dari5Tulisan)
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

37/76

6/1/2016

DASARDASARILMUTANAH

III.HasilHasilPenelitianTentangTanahGambut
Dariluasantotallahangambutdiduniasebesar423.825.000ha,sebanyak38.317.000 ha terdapat di wilayah tropika.
Sekitar 50% dari luasan lahan gambut tropika tersebut terdapat di Indonesia yang tersebar di pulaupulau Sumatra,
Kalimantan,danPapua,sehinggaIndonesiamenempatiurutanke4dalamhalluastotallahangambutsedunia,setelah
Kanada,UniSoviet,danAmerikaSerikat.
Diperkirakan sedikitnya 20% dari luasan lahan gambut di Indonesia telah dimanfaatkan dalam berbagai sektor
pembangunan meliputi pertanian, kehutanan, dan penambangan (Rieley et al, 1996). Karena wataknya yang sangat
rapuh,luasanlahangambutdiIndonesiacenderungmengalamipenurunan,diperkirakanyangmasihtersisatidaklebih
dari 17 juta hektar (Kurnain, 2005). Bahkan dari data yang telah dipublikasikan oleh Pusat Penelitian Tanah dan
Agroklimat tahun 2002, luasan lahan gambut di Indonesia hanya tersisa 13,203 juta hektar dari 16,266 juta hektar
tahun1997.
Dari itu semua dan dari banyak publikasi yang telah dirilis baik melalui pertemuan ilmiah maupun laporan ilmiah,
penelitian tentang pemanfaatan tanah gambut untuk lahan pertanian dan perkebunan telah banyak dilakukan
diantaranya:
Jagungmerupakankomoditaspangankeduasetelahpadi.Kendalayangdihadapiuntukmeningkatkanproduksijagung
diantaranyapersainganlahandantanamanpadisebagaimakananpokoksebagianbesarmasyarakatIndonesia.Untuk
itu perlu lahan altematif yang potensial seperti lahan gambut untuk budidaya tanaman jagung. Tanah gambut
merupakantanahmarjinalyangmemilikikesuburanrendahyangdicirikanolehpHrendah(3.05.0),kandungandan
ketersediaanunsurN,P,K,Mg,Zn,B,Ca,ModanMnrendahdankandunganairyangtinggi.Namurdemikianlahan
gambutmasihmemberikanharapanuntukdijadikanlahanproduktifdenganmenerapkanteknologiyangsesuaiseperti
paket teknologi tampurin. Penerapan paket teknologi Tampurin yang merupakan singkatan dari Tata Air, Mikroba,
Pupuk yang seimbang dan kapur serta proses inkubasi bahan amelioran (IPPTP, 1997 Widarjanto, 1997). Dengan
penelitian mampu meningkatkan produksi tanaman jagung hingga mampu meningkatkan pendapatan petani
(Gonggoetal,2004).
Penelitian Widodo ( 2004), tentang budidaya tanaman padi gogo di lahan gambut telah dilakukan. Kendala utama
dalammeningkatkanproduksipadigogoadalahrendahnyakesuburantanahdanjugakandunganbahanorganikdalam
tanah.Altematifuntukmengatasikendalapadatanahgambutuntuktanamanpadigogodilakukandenganmemberikan
pupuk urea dan kombinasi media tanam. Ukuran urea tidak memberikan perbedaan yang nyata pada peubah yang
diamati, demikian juga interaksi antara ukuran urea dan media tanam tidak terjadi. Pada perlakuan media tanam
memberikan beda nyata pada peubah jumlah dawn, bobot pupus, jumlah malai, bobot bulir bemas dan indeks panen
dannilaitertinggiuntukpeubah:jumlahdawn:45,19,bobotpupus10,53,jumlahmalai7,59,bobotbulirberms12,62
g,danindekspanen1,12.
Pengembangan budidaya tanaman melon pada lahan gambut melalui penerapan sistem pertanian berwawasan
lingkungan maka sistem budidaya inovatif, yaitu sistem budidaya yang menggunakan tanah gambut hanya sebagai
saranapendukungatausebagaiwadahberpengaruhpositifbagipertumbuhandanhasiltanamanmelonvarietasAction
434.Halitudidukungolehberbagaihalsebagaimanatercantumdalambutirbutirdibawahini.1.Abuserbukgergaji
danpupukorganikpadatPowernasasecarasinergisdapatmeningkatkanpanjangtanamandanbobotbuahpertanaman.
Panjangtanamanterpanjangdanbobotbuahterberatdiperolehpadapemberianabuserbukgergajidengandosis22,5
tonha1danpemberianpupukorganikpadatSupernasadengandosis15kgha1,masingmasing149,0cmdan1166,7
gpertanaman.2.DosispupukkaliumdanpupukorganikpadatPowernasayangmemberikanpertumbuhandanhasil
yangbaikmasingmasingadalah250kgha1dan15kgha1menghasilkanpanjangtanaman135,3cmdanbobotbuah
1530,0gpertanaman(AsieER,2003).
Penelitiantentangtanamanperkebunanjugadilakukanpadatanahgambut.DalamPeraturanMenteriPertanianNomor
14/Permentan/PL.110/2/2009 Tahun 2009 tentang Pedoman Pemanfaatan Lahan Gambut Untuk Budidaya Kelapa
Sawit,lahangambutyangdapatdigunakanuntukbudidayakelapasawitharusmemenuhikriteria:
1.Beradapadakawasanbudidaya
Kawasan budidaya dimaksud dapat berasal dari kawasan hutan yang telah dilepas dan/atau areal penggunaan lain
(APL)untukusahabudidayakelapasawit.
2.Ketebalanlapisangambutkurangdari3(tiga)meter
Lahangambutyangdapatdigunakanuntukbudidayakelapasawit:
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

38/76

6/1/2016

DASARDASARILMUTANAH

(2.1)dalambentukhamparanyangmempunyaiketebalangambutkurangdari3(tiga)meterdan
(2.2) proporsi lahan dengan ketebalan gambutnya kurang dari 3 (tiga) meter minimal 70% (tujuh puluh prosen) dari
luasarealyangdiusahakan.
3.Lapisantanahmineraldibawahgambut
Substratum menentukan kemampuan lahan gambut sebagai media tumbuh tanaman. Lapisan tersebut tidak boleh
terdiriataspasirkuarsadantanahsulfatmasam.
4.Tingkatkematangangambut
Arealgambutyangbolehdigunakanadalahgambutmatang(saprik)dangambutsetengahmatang(hemik)sedangkan
gambutmentahdilaranguntukpengembanganbudidayakelapasawit.
5.Tingkatkesuburantanah
Tingkat kesuburan tanah dalam kategori eutropik, yaitu tingkat kesuburan gambut dengan kandungan unsur hara
makro dan mikro yang cukup untuk budidaya kelapa sawit sebagai pengaruh luapan air sungai dan/atau pasang surut
airlaut.(hukmasdjbun).
Dari pembukaan lahan yang telah dilakukan pada tanah gambut untuk tanaman kepada sawit mampu memproduksi
kelapasawitsebesar1224ton/hadalamsatutahunnya.
AnalisisUsahataniKomoditasDiLahanGambut
Padi
Produksi ratarata padi unggul 2,3 ton/ha dengan kisaran 2 2,5 ton/ha dan padi lokal ratarata 1,8 ton/ha dengan
kisaran1,52,4ton/ha.Secaraekonomipengusahaanpadidilahangambutcukupmenguntungkan.
Nilai keuntungan dari padi lokal sebesar Rp 1.270.000/ha sementara pada padi unggul sebesar Rp 1.144.743/ha. Hal
ini diikuti pula dengan nilai R/C yaitu pada usahatani padi lokal sebesar 1,38 dan padi unggul 1,32. Pengembalian
tenaga kerja pada usahatani padi unggul lebih tinggi sebesar 28,7% dibanding padi lokal, hal ini karena tenaga kerja
yang digunakan pada padi unggul lebih sedikit atau pada kegiatan pengolahan tanah menggunakan handtraktor,
sementarapadausahatanipadilokalumumnyapetanimelakukansecaramanualyaitutebasangkut(RizaAR,2006)
Sistem usahatani berbasis padi dapat dilihat dari besarnya kontribusi usahatani tani dalam menyumbang pendapatan
rumah tangga petani. Dari sistem usahatani berbasis padi di Desa Petak Batuah Kecamatan Kapuas Murung wilayah
UPT Dadahup A 2 Proyek Lahan Gambut Sejuta hektar menunjukkan bahwa kontribusi pendapatan usahatani padi
sebesar47%terhadappendapatanrumahtanggapetanisebesarRp9.516.314,pertahun(RizaAR,2006).
Sayuran
Sayuran yang diusahakan petani adalah kacang panjang, gambas, pare dan cabai Rawit (varietas Tiung). Sayuran
umumnyauntukkonsumsirumahtangga,namuntidaksedikitpetaniyangmenjualkepasardesa.Berdasarkananalisis
biaya dan pendapatan menunjukkan bahwa sayuran cabai rawit, pare dan gambas cukup efisien diusahakan di lahan
gambut.
HasildaripelaksanaandemplotolehBalaiPenelitianPertanianLahanRawa(Balittra)padatahun2006menunjukkan
bahwa sayuran tomat dan bawang daun cukup menguntungkan untuk diusahakan di lahan gambut dengan nilai R/C
masingmasing 3,37 dan 2,22. (Riza AR, 2006) Demikian juga dengan tanaman sayuran yang diusahakan di lahan
gambut Desa Siantan Hulu Kalimantan Barat menunjukkan bahwa komoditas bawang daun memiliki R/C tertinggi
(3,36) dibanding sayuran lainnya, namun demikian semua jenis sayuran yang diusahakan cukup layak untuk
dikembangkankarenaR/C>1.(Noorginayuwatietal,2006)
Sistem usahatani berbasis sayuran di lahan gambut menunjukkan bahwa kontribusi sayuran cukup besar terhadap
pendapatantotalrumahtanggapetani.HasilpenelitianNoorginayuwatiet al, (2006) menunjukkan bahwa kontribusi
sayuransebesar39%terhadappendapatantotalrumahtanggapetanisebesarRp8.214.674pertahun.
Dalamistilahyangtepat,konseppertanianberkelanjutanpadalahangambutsebenarnyabukanmerupakanistilahyang
tepat dikarenakan adanya daya menyusut dan adanya subsidence selama penggunaannya untuk usaha pertanian. Akan
tetapi, hal tersebut bisa dikurangi dalam arti memperpanjang life span dengan meminimalkan tingkat subsidence
dengancaramengadopsibeberapastrategipengelolaanyangbenarmengenaiair,tanahdantanaman.
Penggunaansistemsurjanmerupakansuatucarapengelolaantanahdanairyangdisesuaikandenkondisigambut<>dapat
dilakukan pada lahan gambut dangkal yang marginal . Namun yang perlu diperhatikan dalam menggunakan sistem ini
adalah penerapan pola tanam tumpang (multicroping) yang berkelanjutan dan produktif dalam waktu lama. Hal ini
misalnyaterlihatdariadanyapolasuksesidaripertanamanpadimenjaditanamanperkebunakelapaataukebunkaretatau
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

39/76

6/1/2016

DASARDASARILMUTANAH

pohonbuahbuahandanperikanan.
Denganpenerapansistemsurjan,makalahanakanmenjadilebihproduktif,karenapadalahantersebutakantersediadua
tatanan lahan, yaitu: ( 1) Lahan tabukan yang tergenang (digunakan untuk menanam padi atau digabungkan dengan
budidaya ikan/minapadi) da (2) Lahan guludan/tembokan/baluran sebagai lahan kering (digunakan untuk budidaya
palawija,buahbuahan,tanamantahunan/perkebunan).
KeuntungandanKerugianSistemSurjan
Keuntungan
Dapat menanam aneka ragam jenis tanaman dengan umur panen yang berbeda
sehingga pendapatan petani dapat
berlanjut
Pengolahantanahdanpemeliharaantanamanlebihmudah
Memperkecilresikokegagalanpanenkarenajenistanamanyangditanambermamacam
Dapatditanamipadisawahsebanyak2kalimusimtanam.
Kerugian
Biayapembuatansurjanmahadanmembutuhkanlebihbanyakwaktudantenagaker
Diperlukanpengaturan/pengawasanairyanglebihba
Lapisangambutakanlebihcepatdangkalkarenaseringdiolah,sehinggamenimbulkanlapisanpirityangdapatmeracuni
tanaman. Untuk mengatasi hal demikian, maka perlu dilakukan pemilihan jen tanaman yang tepat (misal jen tanaman
tahunanatauhortikulturatertentuyangtidakmemerlukanpengolahatanahsecaraintensif).

TahapantahapanPembuatanSurjan
Pemilihanlokas
Identifikasiterlebihdahululokadankarakteristiklahanyangakdigunakanmenjadilahanpertaniandengansistemsurjan
apakah layak secara fisik dan memenuhi nilainilai sosial ekonomi. Dalam kegiatan ini, beberapa hal yang harus
diperhatikan yaitu kondisi permukaan lahan/tutupan vegetasi, kedalaman dan kematangan gambut, serta kedalaman
permukaanairtanah.
Kondisipermukaanlahan/tutupanvegetasi
Lahanberhutanakanlebihsulituntukdiolahdibandingkandengalahanyangsudahterbukaatausemakbelukar.Hutan
setelahdibukaharusdibiarkanselamadu tahun untuk proses pencucian, pengeringan dan pematangan tanah. Sedangkan
semakbelukadanrerumputanakanlebihmudahdanrelatifdapatdigunakan.
Kedalamandankematangangambut
Tanahgambutyangbaikuntukusahapertanianadalahlahanbergambut(<0,5>
Kedalamanpermukaanairtanah
Kegiatan budidaya tanaman di laha gambut sangat ditentukan oleh kedalaman muka/paras air tanah d lamanya periode
genangan. Jenisjeni tanaman yang berbeda memiliki toleransi yang berbeda pula terhadap tinggi muka air tanah dan
genangan(lihatTabel1),sehinggapolasurjanyaakandibangunharuspulamemperhatikanaspekmukaairtanahuntuk
kelangsunganhidupjenisjenistanamanyangakanditanamdiatasnya.
Pembuatansurjan
Menata/mengolahlahandengansistemsurjan,terutamapadalahanyangtelahlamaditinggalkan(sepertisemakbelukar)
memerlukan waktu pengolahan lebih lama dan tenaga memerlukan waktu pengolahan lebih lama dan tenaga ke lebih
banyakdaripadalahanyangseridikerjakansebagailahanusaha.
Bersambungkebagian4yangdapatdilihatpadapustakadibawahini:

Pengelolaan

Kesuburan

Tanah

Pada

Lahan

Gambut

(Bagian

4)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanahpadalahan_13.html]

PemanfaatanLahanGambutuntukPertanian*
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

40/76

6/1/2016

DASARDASARILMUTANAH

(Bagian4dari5Tulisan)
IV.PengelolaanKesuburanPadaTanahGambut
Bertani di lahan gambut harus dilakukan secara hatihati karena menghadapi banyak kendala antara lain kematangan
dan ketebalan gambut yang bervariasi, penurunan permukaan gambut, rendahnya daya tumpu, rendahnya kesuburan
tanah, dan pH yang sangat masam. Selama ini, untuk mengatasi kendala kesuburan lahan gambut pada umumnya
dilakukan pemberian abu bakaran gambut, kapur dan pemberian pupuk kimia. Penggunaan abu bakaran gambut
sebagai amelioran sangat tidak dianjurkan karena jika dilakukan terus menerus gambut akan menipis sehingga fungsi
gambut sebagai pengatur air/hidrologi, sarana konservasi keanekaragaman hayati serta sebagai penyerap dan
penyimpankarbonyangmampumeredamperubahaniklimglobalakanberkurang.
Kesuburan tanah dalam pandangan masyarakat petani lokal melayu di lahan rawa atau lahan gambut adalah
kemampuan tanah untuk memberikan hasil yang memadai umumnya dilihat dari aspek fisik dan lingkungannya.
Kriteria lahan yang cocok untuk pertanian bagi para petani pioner sebagaimana dituturkan ditentukan oleh jeluk
mempan (kedalaman effective) dan bau dari tanah lapisan atas yang diistilahkan dengan bau harum (Idak, 1985).
Bolehjadiyangdimaksuddenganbauharumadalahlawandaribaubusukyangmunculdariasamsulfida(H2S).
Asam sulfida ini bersifat meracun tanaman pada kondisi tergenang atau lahanlahan yang setelah kekeringan (musim
kemarau)menjadibasahkembalisetelahhujanmenyisakankadarsulfidayangtinggihasilprosesreduksisulfat.
Berkenaan dengan dinamika tanah ini pada petani umumnya pada awalawal minggu pertama musim hujan
membiarkan tanahnya kosong karena air bacam dapat meracuni tanaman, khususnya padi. Petani baru melakukan
tanamsetelah34minggumemasukimusimhujansaatairbacamsudahterencerkandantergelontor.
Selain hal di atas, petani juga sering menilai kesuburan lahan dari vegetasi yang tumbuh pada lahan tersebut. Jenis
jenisgulmaatauvegetasitertentuseringdijadikanpenciriatautanamanindikatorbagistatuskesuburanlahantersebut.
Misalnyatanamanpuruntikus(Eleocharisdulcis)mencirikankeadaantumpatair(waterlogging)dankemasamanakut,
galam (Meleleuca leucadendron) mencirikan tanah mengalami pengatusan dan berubah matang dengan tingkat
kemasaman pH <>(Melastoma malabatharicum) dengan bunga merah jambu menarik, yang disebut juga
Rhododendron Singapura menunjukkan tanah paling miskin. Tumbuhan lain seperti Commelina dan Emilia
menunjukkan pH rendah (Noor, 1996 Mackinnon et al., 2000). Indikasi tumbuhan yang dilihat di atas berkorelasi
dengantipeluapanlahanrawasehinggaumumnyadipilihyangmendapatkanluapanyaitutipeAdanB.
Penilaian kesuburan tanah juga terkait dengan keadaan air di sekitar wilayah tersebut antara lain apabila air tersebut
tampak bening dan terang ini menunjukkan bahwa kualitas air tersebut sangat masam. Sebaliknya apabila keruh dan
berwarna cokelat seperti air teh menunjukkan bahwa kondisi lahan di sekitar wilayah tersebut adalah gambut dalam
atautebal.MenurutMaas(2003)warnaairyangkeruhtersebutmenunjukkankandunganasamasamhumatdanfulvat
yangtinggi.
MenurutRadjagukguk(2003)lahangambuttropikayangterdapatdiIndonesiadicirikanolehantaralain:
1.Biodiversitas(keragamanhayati)yangkhasdengankekayaankeragamanfloradanfauna
2. Fungsi hidrologisnya, yakni dapat menyimpan air tawar dalam jumlah yang sangat besar. Satu juta lahan gambut
tropikasetebal2mditaksirdapatmenyimpan1,2jutam3.
3. Sifatnya yang rapuh (fragile) karena dengan pembukaan lahan dan drainase (reklamasi) akan mengalami
pengamblesan(subsidence),percepatanperuraiandanresikopengerutantakbalik(irreversible)sertarentanterhadap
bahayaerosi
4. Sifatnya yang praktis tidak terbarukan karena membutuhkan waktu 500010.000 tahun untuk pembentukannya
sampai mencapai ketebalan maksimum sekitar 20 m, sehingga taksiran laju pelenggokannya adalah 1cm/ 5 tahun, di
bawahvegetasihutan
5. Bentuk lahan dan sifatsifat tanahnya yang khas, yakni lahannya berbentuk kubah keadaannya yang jenuh atau
tergenang pada kondisi alamiah serta tanahnya mempunyai sifatsifat fisika dan kimia yang sangat berbeda dengan
tanahtanahmineral.
Pengelolaanairharusdisesuaikandengankebutuhanperakarantanaman.Kedalamanpermukaanairtanahpadaparit
kebun diusahakan agar tidak terlalu jauh dari akar tanaman, jika permukaan air terlalu dalam maka oksidasi
berlebih akan mempercepat perombakan gambut, sehingga gambut cepat mengalami subsiden. Sebagai acuan
kedalamanpermukaanairtanahuntuktanamanpertanianmenurutMaasetaldalamAndriesse(1988).
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

41/76

6/1/2016

DASARDASARILMUTANAH

Bertitiktolakdariuraiantersebut,makaperludilakukanpenelitiantentangbudidayatanamanmelondilahangambut
dengan teknik budidaya inovatif, yaitu memadukan beberapa teknik budidaya ramah lingkungan seperti pembukaan
lahan tanpa bakar, pengolahan tanah minimum (minimum tillage), pemanfaatan gambut hanya sebagai sarana
pendukungatausebagaiwadah/potbagitanaman,pemanfaatanlimbahpertaniansepertiabuserbukgergajidanpupuk
kandang sebagai amelioran sehingga dapat mengurangi penggunaan kapur, pemberian amelioran hanya pada lubang
tanam untuk efisiensi dan penggunaan pupuk organik padat (POP) untuk mengurangi pemakaian pupuk anorganik
sertamenananamvarietasadaptif.
Pengelolaanlahangambutyangberwawasanlingkungansangatperludipraktekanmengingatlahangambutmerupakan
salah satu lahan untuk masa depan apabila diperhatikan cara pengelolaan yang tepat. Menurut Sabiham (2007)
melaporkan bahwa beberapa kunci pokok penggunaan gambut berkelanjutan : (1) Legal aspek yang mendukung
pengelolaanlahangambut,(2)Penataanruangberdasarkansatuansistemhidrologi,(3)Pengelolaanairyangmemadai
sesuai tipe luapan dan hidro topografi, (4) Pendekatan pengembangan berdasarkan karakteristik tanah mineral di
bawah lapisan gambut, (5) Peningkatan stabilitas dan penurunan sifat toksik bahan gambut. Selain itu dalam
pengelolaan lahan gambut haruslah didukung dengan teknologi budidaya spesifik lokasi dan ketersediaan lembaga
pendukung.
Salah satu upaya dapat dilaksanakan untuk memanfaatkan lahan gambut dan mengurangi resiko terjadinya kebakaran
di lahan gambut/bergambut adalah memperpendek masa bera. Pengaturan pola tanam dan pola usahatani merupakan
alternatifyangdapatditerapkanuntukmeningkatkanintensitaspertanamandanmemperpendekmasabera.
Pola usahatani yang diterapkan petani dapat berupa monokultur seperti padi bera, padi + palawija/sayuran,
sayuran+palawija,sayur
sayuran,sangattergantungpadatipologigambut.
Sistem usahatani lahan gambut hendaknya didasarkan kepada sistem usahatani terpadu yang bertitik tolak kepada
pemanfaatan hubungan sinergik antar subsistemnya agar pengembangannya tetap menjamin kelestarian sumberdaya
alamnya.Secaragarisbesaradaduasistemusahataniterpaduyangcocokdikembangkandilahangambut,yaitusistem
usahatani berbasis tanaman pangan dan sistem usahatani berbasis komoditas andalan (Alihamsyah dan Ananto 1998
Suprihatno et al., 1999 Alihamsyah et al.,2000). Sistem usahatani berbasis tanaman pangan ditujukan untuk
menjaminkeamananpanganpetanisedangkansistemusahataniberbasiskomoditasandalandapatdikembangkandalam
skalaluasdalamperspektifpengembangansistemdanusahaagribisnis.
Sitem pertanian Leisa menggunakan Tanah selalu tertutupi tanaman dimana dedaunan yang jatuh atau serasah
membusukmenutupipermukaantanah.Pelepasanunsurharaolehmikrobatanahsejalandengankebutuhantanaman.
Sebagianbesarharadisimpandalambentuktumbuhandanternak.Darisegiperakarandiupayakanmenanamtanaman
yang menyebar merata di tanah pada berbagai kedalaman. Konsep agroforestry dan penggunaan mulsa merupakan
sebagiancontohkonsepmenirualam.
Konsep LEISA berupaya memanfaatkan sinergi berbagai komoditi seperti pemilihan tumpang sari yang saling
mendukung dalam memanfaatkan ruang, hara, air dan enerji surya. Integrasi ternak tanaman selalu diusahakan
sepanjanghalitumemungkinkan.
Tanamanataulimbahtanamandijadikanpakanternakdanlimbahternakdalambentukurine,sisapakandankotoran
ternak dijadikan bahan untuk pupuk organik sebagai upaya untuk mengembalikan kesuburan tanah baik secara fisik
maupunkimiawi.Budidayacampuranberbagaivarietasataujenisdiupayakanselainuntuktujuantersebutdiatasjuga
untuk mengurangi resiko kegagalan. Budidaya padi dengan ikan secara terintegrasi (Mina padi) merupakan praktek
yang mendukung keberlanjutan. Penganekaragaman sumber hara terutama yang berasal dari bahan organik yang
tersediasecaralokalmenjadisalahsatuciriupayamempertahankankeberlanjutan.

SistemusahataniberbasisPadi
Sistem usahatani yang berkembang di tingkat petani lahan gambut adalah di lahan pekarangan ditanami dengan
tanamanhortikulturasepertirambutan,mangga,ternakayamburasatauitikdipeliharadenganskalarumahtangga5
20 ekor per KK atau ternak sapi, atau kambing. Sedangkan lahan usaha ditata dengan sistem surjan. Bagian tabukan
(bawah)ditanamipadiberaataupadipadi,sedangkandiguludanditanamitanamanhortikultura.
Dengansistemtataairmikroyangtelahdikembangkandilahanpasangsurutdanpembuatanpintuairflapgateyang
dikembangkan Balittra, peluang untuk meningkatkan intensitas pertanaman sangat besar. Pola Sawit Dupa (sekali
mawiwit dua kali panen), yaitu pola padi unggul padi lokal sudah berkembang. Sebenarnya menurut petani
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

42/76

6/1/2016

DASARDASARILMUTANAH

khususnya petani transmigrasi, penanaman padi unggul dapat dilaksanakan. Tetapi karena petani tidak semuanya
mengusahakanpadiunggulmakamunculbeberapamasalahdilapangan.Masalahhamatanamansepertitikus,walang
sangit menjadi penyebab kegagalan panen padi unggul oleh petani. Hama tikus umumnya bersarang di lahanlahan
tiduryangtidakdigarappetani.
Selama pola tanam di lahan petani tidak bisa disepakati, maka pola sawit dupa akan sulit terlaksana. Hal ini akan
berdampak masa bera yang diperpanjang. Hasilhasil penelitian yang telah dilaksanakan oleh Balittra menunjukkan
bahwa pola tanam padi unggul palawija dapat berhasil baik. Pola tanam digunakan petani di Desa Kantan Atas dan
PinangHabangadalahpadi
kedelai,padikacangtanah,kedelaikacangtanah.
SistemUsahataniberbasiskomoditasHortikultura
Di lahan pekarangan ditanam tanaman keras/hortikultura dan ternak ayam, kambing dan sapi, sedangkan di lahan
usahadiusahakantanamanpalawija/sayuran.Penataanlahanpadalahanbergambutcukupberagamantarlokasi,namun
sistemusahataninyarelatifserupa.LahanbergambutdengandengantipeluapanB/C(RasauJayaII)umumnyaditata
sebagaisurjan,hanyasebagiankecilditatasebagaisawah/tegalan.
Pembuatan surjan dan pengolahan tanah harus hatihati sesuai dengan kaedah konservasi gambut dengan
mempertahankan lapisan gambut tetap dalam keadaan lembab serta tidak melakukan pembakaran. Pola tanam yang
umum dijumpai adalah padipalawija pada lahan sawah dan palawija
palawija pada surjan dengan periode tanam
Agustus/SeptemberJanuari/PebruariMei/Juni. Sebagian petani menanam palawija dan sayuran pada periode Juni
Agustus. Lahan bergambut dengan tipe luapan C ditata sebagai lahan tadah hujan, surjan dan tegalan dengan pola
tanamPadiPalawijadanPalawijaPalawija.
Noorginayuwati et al, (2006) melaporkan bahwa sistem usahatani berbasis sayuran dapat diusahakan pada lahan
gambutdangkalsepertidiDesaKelampangankecamatanSebangauKalimantanTengah.Polatanamyangdiusahakan
petani SawiSawi, Kangkung, bawang daun, demikian pula di desa Siantan Hulu Kalimantan Barat dilakukan pola
tanampalawija/sayuran,lidahbuaya,pepayadanobatobatan.
PengalamanpetanisayuranyangmengusahakanlahangambuttebaldidaerahSungaiSlamet(Pontianak)menunjukkan
produksi mantap dicapai setelah 15 tahun. Gambut tebal sampai dengan 350 cm ternyata cocok untuk budidaya
sayuran, terutama bawang daun, kubis dan bayam. Pemupukan yang diperlukan sangat berat dengan abu kayu dan
kotoranternaksebagaipupukutamadandenganabubakarangambutsertaserasahan.
Bertanam di lahan gambut sama dengan bertanam sistem hidroponik (Notohadiprawiro, 1994). Demikian juga
menurut Maas (1999) bahwa pertanian di lahan gambut dengan ketebalan 20 50 cm di Pangkoh 10 (Kalimantan
Tengah)denganpengaturanmukaairpadatingkattersieryangberupapenandonanairdimusimhujandanpembukaan
tabat di musim kemarau, dapat bertanam 2 kali setahun dengan hasil 2 3 ton/ha gabah kering, dan pada demfarm
dapatmenghasilkan4,4ton/hapadiIR66.
Pemanfaatan lahan gambut oleh sebagian besar telah dilakukan petani untuk pertanaman palawija dan hortikultura.
Pengembangan pertanian sayuran yang tergolong berhasil telah dilakukan petani di Siantan Hulu dan Rasau Jaya
(Kalimantan Barat), Kalampangan (Kalimantan Tengah), Mamuju Utara (Sulawesi Barat). Sistem usahatani di lahan
gambut Mamuju Utara terdiri dari lahan pekarangan tanaman cacao dan jeruk sedangkan di lahan usaha diusahakan
tanaman jeruk secara monokultur maupun tumpang sari dengan tanaman sayuran atau palawija. Perbaikan tingkat
kesuburan dan kemasaman tanah gambut dilakukan petani dengan memberikan bahan amelioran, seperti abu serbuk
gergajian,abusisatanaman,dangulma,pupukkandang,tepungkepalausangdantepungikan.
Pengelolaanair
1.Drainase
Drainase merupakan prasyarat untuk usaha pertanian, walaupun hal tersebut bukanlah suatu yang mudah untuk
dilakukan mengingat sifat dari gambut yang bisa mengalami penyusutan dan kering tidak balik akibat drainase,
sehingga sebelum mereklamasi lahan gambut perlu diketahui sifat spesifik gambut, peranan dan fungsinya bagi
lingkungan.
Drainase yang baik untuk pertanian gambut adalah drainase yang tetap mempertahankan batas air kritis gambut akan
tetapitetaptidakmengakibatkankerugianpadatanamanyangakanberakibatpadahasil.Intensitasdrainasebervariasi
tergantung kondisi alami tanah dan curah hujan. Curah hujan yang tinggi (40005000 mm per tahun)(Ambak dan
Melling,2000)membutuhkansistemdrainaseuntukmeminimalkanpengaruhbanjir.
Setelah drainase dan pembukaan lahan gambut, umumnya terjadi subsidence yang relatif cepat yang akan berakibat
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

43/76

6/1/2016

DASARDASARILMUTANAH

menurunya permukaan tanah. Subsidence dan dekomposisi bahan organik dapat menimbulkan masalah apabila bahan
mineral di bawah lapis gambut terdiri dari lempeng pirit atau pasir kuarsa. Kerapatan lindak yang rendah berakibat
kemampuanmenahan(bearingcapacity)tanahgambutjugarendah,sehinggapengolahantanahsulitdilakukansecara
mekanis atau dengan ternak. Kemampuan menahan yang rendah juga juga merupakan masalah bagi untuk tanaman
pohonpohonanatautanamansemusimyangrentanterhadapkerebahan(lodging)(Radjagukguk,1990).
Bagi tanaman perkebunan, usaha perbaikan drainase dilakukan dengan pembuatan kanal primer, kanal sekunder dan
kanaltersier.HasilpenelitiansementaradiPT.RSUPmenunjukkanbahwakelapahybridaPB121padaumur4tahun
(45 tahun setelah tanam adalah 1,5 ton kopra/ha). Angka ini sementara 5 kali lebih besar dari hasil yang dicapai di
negara asalnya Afrika dimana PB 121 pada umur 4 tahun menghasilkan 0,26 ton kopral/ha (Thampan, 1981 dalam
SudradjatdanQusairi,1992).
2.Irigasi
Ketika batas kritis air dapat dikontrol pada level optimum untuk pertumbuhan tanaman, pengelolan air bukan
merupakan suatu masalah kecuali pada tahap awal pertumbuhan tanaman. Jika batas kritis air tidak dapat terkontrol
danlebihrendahdarikebutuhanairsemestinya,irigasiperludilakukanterutamabagitanamantertentu.Halinipenting
untuk memasok kebutuhan air tanaman dan menghindari sifat kering tidak balik. Sayuran berdaun banyak,
menunjukkanlayupadakeadaanudarapanas.Kondisiinimungkinmerupakanpengaruhdaridangkalnyaprofiltanah
yang dapat dicapai oleh akar tanaman dan kehilangan air akibat transpirasi yang lebih cepat daripada tanah mineral
(AmbakdanMelling,2000).
Tanaman mempunyai tahapan pertumbuhan yang sensitif terhadap stress air yang berbeda. Pengetahuan tentang
tahapan tersebut akan mempermudah irigasi pada saat yang tepat sehingga mengurangi terjadinya stress air dan
penggunaanairyangoptimum.Untukpenanamantanamansemusim,pengaturanirigasiharusmempertimbangkansaat
dankebutuhantanaman dan disesuaikan dengan ketersediaan airtanah diataswater table, jumlah air hujan, distribusi
danjumlahevapotranspirasi(Lucas,1982)..
3.Penggenangan
Untuk meminimalkan terjadinya subsidence, langkah yang bisa dilakukan adalah tetap mempertahankan kondisi
tergenangtersebutdenganmengadopsitanamantanamansejenishidrofilikatautanamantoleranairyangmemberikan
nilai ekonomi seperti halnya Eleocharis tuberosa, bayam cina (Amaranthus hybridus), kangkung (Ipomoea aquatica)
dan seledri air. Di Florida ketika tanaman tertentu tidak bisa dibudidayakan karena perubahan musim, penggenangan
dilakukandandigunakanuntukbudidayatanamanairtersebut(AmbakdanMelling,2000).
PengelolaanTanah
Tanahgambutsebenarnyamerupakantanahyangbaikuntukpertumbuhantanamanbiladitinjaudarijumlahporipori
yang berkaitan dengan pertukaran oksigen untuk pertumbuhan akar tanaman. Kapasitas memegang air yang tinggi
daripada tanah mineral menyebabkan tanaman bisa berkembang lebih cepat. Akan tetapi dengan keberadaan sifat
inheren yang lain seperti kemasaman yang tinggi, kejenuhan basa yang rendah dan miskin unsur hara baik mikro
maupun makro menyebabkan tanah gambut digolongkan sebagai tanah marginal (Limin et al, 2000). Untuk itulah
perlunyausahauntukmengelolatanahtersebutdengansemestinya.
1.Pembakaran
Pembakaran merupakan cara tradisional yang sering dilakukan petani untuk menurunkan tingkat kemasaman tanah
gambut. Terjadinya pembakaran bahan organik menjadi abu berakibat penghancuran tanah serta menurunkan
permukaan tanah. Pembakaran berpengaruh nyata terhadap pertumbuhan tanaman pada tahun pertama dan
meningkatkanserapanPtanaman,namunakanmenurunkanserapanCadanMg(Mawardietal,2001).
2.Bahanpembenahtanah
Pemberian pupuk dan amandemen dalam komposisi dan takaran yang tepat dapat mengatasi masalah keharaan dan
kemasamantanahgambut.UnsurharayangumumnyaperluditambahkandalambentukpupukadalahN,P,K,Ca,Mg
serta sejumlah unsur hara mikro terutama Cu, Zn dan Mo. Pemberian Cu diduga lebih efektif melalui daun (foliar
spray) karena sifat sematannya yang sangat kuat pada gambut, kurang mobil dalam tanaman dan kelarutan yang
menurun ketika terjadi peningkatan pH akibat penggenangan. Sebagai amandemen, abu hasil pembakaran gambut itu
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

44/76

6/1/2016

DASARDASARILMUTANAH

sendiri akan berpengaruh menurunkan kemasaman tanah, memasok unsur hara dan mempercepat pembentukan lapis
olahyanglebihbaiksifatfisikanya(Radjagukguk,1990).
DiSumateraBaratditemukanbahanamelioranbaruHarzburgiteyangdefositnyacukupbesardankandunganMgyang
tinggi(27,2132,07%MgO)yangmerupakanbahanpotensialuntukameliorasilahangambut(Mawardietal,2001).
Pupuk kandang khususnya kotoran ayam dibandingkan dengan kotoran ternak yang lainnya mengandung beberapa
unsur hara makro dan mikro tertentu dalam jumlah yang banyak. Kejenuhan basanya tinggi, tetapi kapasitas tukar
kation rendah. Kotoran ayam, dalam melepaskan haranya berlangsung secara bertahap dan lama. Tampaknya,
pemberiankotoranayammemungkinkanuntukmemperbaikisifatfisikadankimiatanahgambut.Padajagungmanis,
pemberiankotoranayamsampai14ton/hapadatanahgambutpedalamanberengbengkeldapatmeningkatkanjumlah
tongkol(Limin,1992dalamDarungetal,2001).
Potensipengembanganpertanianpadalahangambut,disampingfaktorkesuburanalamigambutjugasangatditentukan
olehtingkatmanajemenusahataniyangakanditerapkan.Padapengelolaanlahangambutpadatingkatpetani,dengan
pengelolaan usaha tani termasuk tingkat rendah (low inputs) sampai sedang (medium inputs), akan berbeda dengan
produktivitas lahan dengan tingkat manajemen tinggi yang dikerjakan oleh swasta atau perusahaan besar (Subagyo et
al,1996)
Denganmanajementingkatsedang(AbdurachmandanSuriadikarta,2000),yaituperbaikantanahdenganpenggunaan
input yang terjangkau oleh petani seperti pengolahan tanah, tata air mikro, pemupukan, pengapuran dan
pemberantasanhamadanpenyakit,potensipengembanganlahangambutuntukpertanianadalahsebagaiberikut:
Pemilihanjenistanaman
1.Padisawah
Budidaya padi sawah selalu diupayakan oleh petani transmigrasi untuk memenuhi kebutuhan pangannya. Akan tetapi
budidayapadisawahdilahangambutdihadapkanpadaberbagaimasalahterutamamenyangkutkendalakendalafisika,
kesuburan serta pengelolaan tanah dan air. Khususnya gambut tebal (> 1 m ) belum berhasil dimanfaatkan untuk
budidaya padi sawah, karena mengandung sejumlah kendala yang belum dapat diatasi. Kunci keberhasilan budidaya
padi sawah pada lahan gambut terletak pada keberhasilan dalam pengelolaan dan pengendalian air, penanganan
sejumlah kendala fisik yang merupakan faktor pembatas, penanganan substansi toksik dan pemupukan unsur makro
danmikro(Radjagukguk,1990).
Lahan gambut yang sesuai untuk padi sawah adalah gambut dengan (2050 cm gambut) dan gambut dangkal (0,51
m). Padi kurang sesuai pada gambut sedang (12 m) dan tidak sesuai pada gambut tebal (23 m) dan sangat tebal
(lebihdari3m).Padagambuttebaldansangattebal,tanamanpaditidakdapatmembentukgabahkarenakahatunsur
haramikroSubagyoetal,1996).
Pada tanah sawah dengan kandungan bahan organik tinggi, asamasam organik menghambat pertumbuhan, terutama
akar, mengakibatkan rendahnya produktivitas bahkan kegagalan panen. Leiwakabessy dan Wahjudin (1979) dalam
Radjagukguk (1990) menunjukkan hubungan erat antara ketebalan gambut dan produksi gabah padi sawah. Pada
percobaanpotdengantanahyangdiambildarilapis020cm,diperolehhasilgabahpadi(ditanamsecarasawah)yang
sangat rendah apabila tebal gambut > 80 cm, dan yang paling tinggi apabila ketebalan gambut 50 cm. Ditunjukkan
pula bahwa ada kesamaan antara pola perubahan kejenuhan Ca, kejenuhan Mg, pH dan kandungan abu bersama
ketebalangambutdenganperubahantingkathasilgabah.
Sehingga kemungkinan tingkat kemasaman dan suplai Ca yang rendah serta kandungan abu yang rendah merupakan
faktor pembatas utama pertumbuhan padi sawah pada gambut tebal. Tidak terbentuknya gabah menurut Andriesse
(1988) dan Driessen (1978) berkaitan dengan defisiensi Cu yang akan menyebabkan meningkatnya aktivitas racun
fenolikdanmenyebabkanmalesterilitypadatanamanpadi.
2.Tanamanperkebunandanindustri
Budidaya tanamantanaman perkebunan berskala besar banyak dikembangkan di lahan gambut terutama oleh
perusahaanperusahaanswasta.PengusahaantanamantanamaninikebanyakandikembangkandipropinsiRiaudengan
memanfaatkan gambut tebal. Sebelum penanaman, dilakukan pemadatan tanah dengan menggunakan alatalat berat.
Sistem drainase yang tepat sangat menentukan keberhasilan budidaya tanaman perkebunan di lahan tersebut.
Pengelolaan kesuburan tanah yang utama adalah pemberian pupuk makro dan mikro (Radjagukguk, 1990). Tanaman
perkebunansesuaiditanampadaketebalangambut12mdansangattebal(23m)(Subagyoetal,1996).
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

45/76

6/1/2016

DASARDASARILMUTANAH

DiMalaysia,diantaratanamanperkebunanyanglainsepertikelapasawit,sagu,karet,kopidankelapa,nanas(Ananas
cumosus) merupakan tanaman yang menunjukkan adaptasi yang tinggi pada gambut berdrainase. Nanas bisa
beradaptasi dengan baik pada keadaan kemasaman yang tinggi dan tingkat kesuburan yang rendah. Kelapa sawit
merupakan salah satu tanaman tahunan yang cukup sesuai pada lahan gambut dengan ketebalan sedang hingga tipis
dengan hasil sekitar 13 ton/ha pada tahun ketiga penanaman (Ambak dan Melling, 2000). Percobaanpercobaan yang
dilakukan oleh PT. RSUP di Indragiri Hilir, menunjukkan bahwa tanaman nenas tumbuh dengan baik dan mulai
berbuah14bulansetelahtanam.Darihasilsementaramenunjukkanbahwa,penanamannanasdengankerapatan20.000
pohon/ha yang ditanam diantara jalur kelapa, tumpangsari kelapa nenas memberikan prospek yang sangat cerah
(SudradjatdanQusairi,1992).
Sagubisaberadaptasidenganbaikdanmemberikanhasilbagustanpapemberianinputpupuk(AhmaddanSim,1976)
pada gambut dengan minimum drainase, walaupun umur tanaman sampai menghasilkan buah sangat lama (1520
tahun).
Untuk jenisjenis pohon buah banyak ditemukan di Sumatra dan Kalimantan seperti jambu air (Eugenia) Mangga
(Mangosteen), rambutan (Ambak dan Melling, 2000) sedangkan di daerah pantai Ivory dengan gambut termasuk
oligotropik, pisang dapat tumbuh dengan drainase 80100 cm dan menghasilkan 2540 ton/ha walaupun dengan
pengelolaanyangagaksulit(Andriesse,1988).
Komoditas lain yang berpotensi ekonomi untuk dikembangkan guna memenuhi kebutuhan domestik adalah tanaman
industri/kerassepertikelapa,kopi,ladadantanamanobat(AbdurachmandanSuriadikarta,2000).Tanamanramidan
obatobatan tumbuh dan berproduksi baik pada gambut sedang dan kurang baik pada gambut sangat dalam (35 m)
(Subagyoetal,1996).
3.Tanamanpangan(palawija)dantanamansemusimlainnya
Tanahgambutyangsesuaiuntuktanamansemusimadalahgambutdangkaldangambutsedang.Pengelolaanairperlu
diperhatikanagarairtanahtidakturunterlaludalamataudrastisuntukmencegahterjadinyagejalakeringtidakbalik
(Subagyoetal,1996).
Tanamanpanganmemerlukankondisidrainaseyangbaikuntukmencegahpenyakitbusukpadabagianbawahtanaman
dan meminimalkan pemakaian pupuk. Cassava (Manihot esculenta) atau tapioka menghasilkan lebih dari 50 ton/ha
dengan pengelolaan yang baik dan merupakan tanaman pangan yang penting pada gambut oligotropik tropis dengan
drainaseyangbaik(Andriesse,1988).
DiBengkulu,penanamanjagungdenganpenerapanteknologiyangspesifikuntuklahangambut(teknologiTampurin)
diperolehhasil3,29ton/hapadavarietasPioneer12(Mantietal,2001).
Sementara untuk tanaman sayuran, Satsiyati (1992) dalam Abdurachman dan Suriadikarta (2000) menyebutkan
beberapa tanaman hortikultura yang berpotensi ekonomi untuk dikembangkan di lahan gambut eks PLG yaitu cabai,
semangkadannenas.
Di daerah Kalampangan yang merupakan penghasil sayuran untuk Palangkaraya Kalimantan Tengah, petani setempat
mengembangkan sayuran diantaranya sawi, kangkung, mentimun yang diusahakan secara monokultur dalam skala
kecildalamlahankuranglebih0,25hektar(Liminetal,2000).Disampingitubeberapalahangambutyangtermasuk
lahanbongkorbisadiusahakanuntukberbagaitanamanseperticabaibesar/keriting/kecil,terong,tomat,sawi,seledri,
bawang daun, kacang panjang, paria, mentimun, jagung sayur, jagung manis, dan buahbuahan (mangga, rambutan,
melinjo, sukun, nangka, pepaya, nanas dan pisang) karena lahan gambut tersebut termasuk tipe luapan C/D (tidak
dipengaruhi air pasang surut, hanya melalui rembesan air tanah >50 cm di bawah permukaan tanah pada musim
kemaraudan<>etal,2001).
TeknisBertanam
Untuk menghindari penurunan permukaan tanah (subsidence) tanah gambut melalui oksidasi biokimia, permukaan
tanah harus dipertahankan agar tidak gundul. Beberapa vegetasi seperti halnya rumputrumputan atau leguminose
dapatdibiarkanuntuktumbuhdisekelilingtanamankecualipadalubangtanampokoksepertihalnyapadaperkebunan
kelapa sawit dan kopi. Beberapa jenis legume menjalar seperti Canavalia maritima dapat tumbuh dengan unsur hara
minimum(Singh,1986)danmenunjukkantoleransiyangtinggiterhadapkemasaman.
Pembakaransepertiyangdilakukanpadaperkebunannanasharusmempertimbangkanpengaruhnyaterhadapkebakaran
lingkungansekitarnya.Akanlebihbaikbilapenyianganterhadapguladikembalikanlagikedalamtanah(dibenamkan)
yang akan berfungsi sebagai kompos sehingga selain bisa memberikan tambahan hara juga dapat membantu
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

46/76

6/1/2016

DASARDASARILMUTANAH

mempertahankanpenurunanpermukaantanahmelaluisubsidence(AmbakdanMelling,2000).
Untuk tanaman hortikultura, pembakaran seresah bisa dilakukan pada tempat yang khusus dengan ukuran 3 X 4 m.
Dasar tempat pembakaran diberi lapisan tanah mineral/liat setebal 20 cm dan sekelilingnya dibuat saluran selebar 30
cm. Kedalaman saluran disesuaikan dengan kedalaman air tanah dan ketinggian air dipertahankan 20 cm dari
permukaantanahagargambuttetapcukupbasah.Inidimaksudkanagarpadawaktupembakaran,apitidakmenyebar
Ardjakusumaetal(2001).
EkosistemLahanGambut
Pada saat mengembangkan hutan rawa gambut harus memerhatikan ekosistem lahan gambut yang sangat unik dan
rapuh/rentan.HaltersebutdapatdicermatisecaramudahdariPetaTataGunaHutanKesepakatan(TGHK)padalahan
gambut.
Di dalam peta tersebut, ada alokasi hutan tanaman industri (HTI) yang berada pada ekosistem kubah gambut.
Seharusnya pada bagian kubah gambut ini dijadikan daerah konservasi sebagai tempat cadangan/resapan air untuk
daerahyangberadadisekitarnya.
Akibat yang ditimbulkan oleh kesalahan alokasi ini adalah kawasan hutan tanaman industri pada kubah gambut
tersebut mempunyai produktivitas yang rendah. Demikian pula lingkungan di sekitar kubah gambut menjadi
terganggu,yangpadamusimhujankebanjirandanpadamusimkemaraukekeringan.
Pembukaan lahan gambut besarbesaran untuk pengembangan lahan pertanian yang dikombinasikan dengan
pengembanganwilayahmelaluiproyektransmigrasibanyakdilakukanpadagambuttebal(ketebalangambut>2,0m).
Pembukaan lahan gambut ini dimulai dengan pembuatan saluran berukuran sangat besar, tanpa memperhatikan sifat
gambutyangmudahrusak.
Akibatnya, terjadi berbagai fenomena perubahan sifat gambut yang sangat drastis. Di beberapa tempat, terutama di
daerahdengangambutlebihtipis(ketebalan<>
Perubahan sifat yang drastis ini mengakibatkan lahan gambut tidak dapat dipakai sebagai lahan budi daya sehingga
banyak yang ditinggalkan begitu saja oleh para pemiliknya. Dampak lebih jauh dari pembukaan lahan gambut yang
dilakukan secara besarbesaran dengan membuat saluran drainase berukuran besar adalah bahwa saluransaluran
tersebut menjadi jalan untuk masuknya kegiatan pembalakan ke dalam hutan. Akibatnya, penebangan hutan menjadi
sangatintensif,yangdisusulfenomenakebakaranhutandanlahangambutyangasapnyatelahmenyebabkanpersoalan
lingkunganyangseriushinggamemancingprotesnegaranegaratetangga.
Potensipengembanganpertanianpadalahangambut,disampingfaktorkesuburanalamigambutjugasangatditentukan
oleh tingkat manajemen usahatani yang akan diterapkan. Pada pengelolaan lahan gambut pada tingkat petani, dengan
pengelolaan usaha tani termasuk tingkat rendah (low inputs) sampai sedang (medium inputs), akan berbeda dengan
produktivitas lahan dengan tingkat manajemen tinggi yang dikerjakan oleh swasta atau perusahaan besar (Subagyo et
al,1996)
Denganmanajementingkatsedang(AbdurachmandanSuriadikarta,2000),yaituperbaikantanahdenganpenggunaan
input yang terjangkau oleh petani seperti pengolahan tanah, tata air mikro, pemupukan, pengapuran dan
pemberantasanhamadanpenyakit,potensipengembanganlahangambutdapatdilakukandenganbaik.

Bersambungkebagian5yangdapatdilihatpadapustakadibawahini:

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Pada

Lahan Gambut (Bagian 5) [http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah


padalahan.html]

PemanfaatanLahanGambutuntukPertanian*
(Bagian5dari5Tulisan)
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

47/76

6/1/2016

DASARDASARILMUTANAH

III.Kesimpulan
(1)Tanahgambutatautanahorganikadalahtanahyangberasaldaribahanindukorganiksepertidarihutanrawaatau
rumput rawa, dengan ciri dan sifat: tidak terjadi deferensiasi horizon secara jelas, ketebalan lebih dari 0.5 m, warna
coklat hingga kehitaman, tekstur debu lempung, tidak berstruktur, konsistensi tidak lekatagak lekat, kandungan
organiklebihdari30%untuktanahteksturlempungdanlebihdari20%untuktanahteksturpasir,umumnyabersifat
sangatasam(pH4,0)kandunganunsurhararendah.
(2) Ada beberapa hal yang dapat menghambat perkembangan lahan gambut sebagai lahan pertanian diantaranya : 1)
Sifatfisik,2)SifatKimia,3)SifatBiologi,4)Keadaanairtanahdan5)Kebakaranlahangambut.
(3) Untuk pengembangan lahan gambut yang berkelanjutan perlu dilakukan pengolahan tanah, tata air mikro,
pemupukan, pengapuran dan pemberantasan hama dan penyakit, serta memilih tanaman yang sesuai dengan kondisi
lahangambutyangada.
DAFTARPUSTAKA
Abdurachman dan Suriadikarta, 2000. Pemanfaatan Lahan Rawa eks PLG Kalimantan Tengah untuk Pengembangan
PertanianBerwawasanLingkungan.JurnalLitbangPertanian19(3).
Ambak, K., dan Melling, L., 2000. Management Practices for Sustainable Cultivation of Crop Plants on Tropical
Peatlands.Proc.OfTheInternationalSymposiumonTropicalPeatlands2223November1999.BogorIndonesia,hal
119.
Andriesse, J.P. 1989. Constrainsts and opportunities for alternative use options of tropical peat land. In B.Y.
Aminuddin (Ed.). Tropical Peat Proceedings of International Symposium on Tropical Peatland, 610 May 1991,
Kuching,Sarawak,Malaysia.BBLitbangSDLP(BalaiBesarPenelitiandanPengembanganSumberdayaLahan
Andriesse,J.P.1988.NatureandManagementofTropicalPeatSoils.FAOSoilsBulletin59.
Asie E R. 2004. Pengembangan Tanaman Melonn di Lahan Gambut Dengan Budidaya Inovatif. Palangkaraya.
Kalimantan.
Driessen, P.M., dan H. Suhardjo. 1976. On the Defective Grain Formation of Sawah Rice on Peat. Soil Res. Inst.
Bull.3:2044.Bogor.
Driessen,P.M.1978.Peatsoils.pp:763779.In:IRRI.Soilandrice.IRRI.LosBanos.Philippines.
FakultasPertanianIPB.1986.Gambutpedalamanuntuklahanpertanian.KerjasamaDinasPertanianTanamanPangan
PropinsiDatiI,KalimantanTengahdenganFakultasPertanianIPB,Bogor.
FAOUnesco.1994.SoilMapoftheworld.FAORomePublishedByISRIC.Wageninagan140hal.
Gonggo B M, Purwanto, Bilan W S dan J. Arto. 2004. Pertumbuhan dan Hasil Jagung Pada Lahan Gambut dengan
PenerapanTeknologiTampurn.ISSN1411006761421.
Hardjowigeno,S.1986.Sumberdayafisikwilayahdantatagunalahan:Histosol.FakultasPertanianInstitutPertanian
Bogor.Hal.8694.
Jaya, A., Inoue, T., Rielley, J.O, dan Limin, S. 2004. Enviromental change caused by development of peatland
landscapesinCentralKalimantan,Indonesia.Dalam Proc.ofthe12thInt.PeatCongress:Wise Use of Peatland.
Finlad.pp.660667.
Limin,S.,Layuniati.,Jamal,Y.,2000.UtilizationofInlandPeatforFoodCropCommodityDevelopmentRequires
High Input and is Detrimental to Peat Swamp Forest Ecosystem. Proc. International Symposium on Tropical
Peatlands2223November1999.BogorIndonesia.
Maas A,Tukijo, Dwijono, Darmanto. 1999. Karakterisasi dan Identifikasi Masalah Lahan bongkor Untuk Perluasan
ArealTanamdiWilayahKerjaCPLBTKalimantanTengah.MakalahTemuPakardanLokakaryaNasionalOptimasi
pemanfaatanSumberdayaLahanRawa.Jakarta2326November1999.
Mawardi,E,AzwardanTambidjo,A.2001.PotensidanPeluangPemanfaatanHarzeburgitesebagaiAmelioranLahan
Gambut. Prosiding Seminar Nasional Memantapkan Rekayasa Paket Teknologi Pertanian dan Ketahanan Pangan
dalamEraOtonomiDaerah,31Oktober1November2001.Bengkulu.
Mutalib,A.Aa,J.S.Lim,M.H.WongandL.Koonvai.1991.Characterization,distributionandutilizationofpeatin
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

48/76

6/1/2016

DASARDASARILMUTANAH

Malaysia.Proc.InternationalSymposiumontropicalpeatland.610May1991,Kuching,Serawak,Malaysia.
Notohadiprawiro,T.1994.PengembanganLahanPasangSurutUntukTujuanPertanian.PertemuanTeknisKegiatan
PengajianTahapanPengembanganLahanRawaPasangSurut,BadanLitbangPU,Bandung,20Oktober1994.
Noor,M.2001.PertanianLahanGambutPotensidanKendala.Kanisius,Yogyakarta.
Noorginayuwati, A.Rafiq, Yanti R., M. Alwi, A.Jumberi, 2006. Penggalian Kearifan Lokal Petani untuk
PengembanganLahanGambutdiKalimantan.LaporanHasilPenelitianBalittra2006.
Nugroho, K., G. Gianinazzi and IPG. WidjajaAdhi. 1997. Soil hydraulic properties of Indonesian peat. In: Rieley
andPage(Eds.).pp.147156InBiodiversityandsustainabilityoftropicalpeatandpeatland.SamaraPublishingLtd.
Radjagukguk, B. 1997. Peat soil of Indonesia: Location, Classification, And Problems For Sustainability. In: Rieley
and Page (Eds.). pp. 4554. Biodiversity and Sustainability of Tropical Peat and Peatland. Samara Publishing Ltd.
Cardigan.UK.
Radjagukguk,B.2001.PerubahanSifatSifatFisikdanKimiatanahGambutAkibatReklamasiLahanGambutuntuk
Pertanian.JurnalIlmuTanahdanLingkungan(2):115.
Riza,AR.2006.KarakteristikWilayahdanPerancanganModelPenataanLahandanKomoditasdiLahanRawaPasang
Surut.LaporanHasilPenelitianBalittra.BalaiBesarPenelitiandanPengembanganSumberdayaLahanPertanian.
Rieley,J.O.,R.A.J.Wst,J.Jauhiainen,S.E.Page,H.Wsten,A.Hooijer,F.Siegert,S.H.Limin,H.Vasanderand
M. Stahlhut. 2008. Tropical Peatlands: Carbon Stores, Carbon Gas Emissions and Contribution to Climate Change
Processes.pp.148182InM.
Sabiham, S. 2007. Pengembangan Lahan Secara berkelanjutan Sebagai Dasar dalam Pengelolaan Gambut di
Indonesia.MakalahUtamadisimpulkanpadaSeminarNasionalPertanianLahanRawadikapuas,34juli,2007.
Sagiman,S.2005.PertaniandiLahanGambutBerbasisPasardanLingkungan,SebuahPengalamanPertanianGambut
dariKalbar.WorkshopgambutHGI.Palangkaraya2021Sept2005.
Soekardi M., dan A. Hidayat. 1988. Extent and distribution of peatsoils of Indonesia. Third meeting cooperative
resarchonproblemsoils.CRIFC.Bogor.
Soewono,S.1997.FertilityManagementForSustainableAgricultureOnTropicalOmbrogenousPeat.I n Biodiversity
And Sustainability Of Tropical Peatlands. E ds J.O. Rieley. And S.E. Page. Proceedings Of The International
Symposium On Biodiversity, Environmental Importance and sustainability of Tropical Peat and Peatlands, held in
Palangkaraya,CentralKalimantan,Indonesia,48sept.1995.
SoilSurveyStaff.1990.KeytoSoilTaxonomy.7thedition.USDAWashingtonDC.
Singh, G., Tan, Y.P., Padman, C.V., Rajah dan Lee. F.W. 1986. Experinces on the Cultivation and Management of
Oil Palm on Deep Peat in United Plantation Berhard. In. Proc. 2nd InternSoils Management Workshop
Thailand/Malaysia718April1986.
Suhardjo, H. and I P.G. WidjajaAdhi. 1976. Chemical Characteristics Of The Upper 30 Cm Of Peat Soils From
Riau.ATA106.Bull.3:7492.SoilRes.Inst.Bogor.Tie,Y.L.AndJ.S.Esterle.1991.Formationoflowlandpeat
domes in Serawak, Malaysia. Proc. International Symposium on Tropical Peatland. 610 May 1991, Kuching,
Serawak,Malaysia.
Suryanto, S. 1991. Prospek Gambut Sebagai Sumberdaya Alam Dalam Pengembangan Bioteknologi Di Indonesia.
Makalah Seminar Bioteknologi PPI Perancis, 30 Juni1 Juli, 1990 Di Institute Agronomique Meditererranee (IAM)
Montpellier.
Sudradjat daan Qusairi, L., 1992. Diversifikasi Usaha Perkebunan Pada Lahan Gambut Dengan Kelapa Sebagai
TanamanUtama(SuatuPandanganterhadappemanfaatanLahanGambut).SeminarPengembanganTerpadukawasan
RawaPasangSurutdiIndonesia5September1992.FakultasPertanianInstitutPertanianBogor.
Subagyo, Marsoedi dan Karama, S., 1996. Prospek Pengembangan Lahan Gambut untuk Pertanian dalam Seminar
PengembanganTeknologiBerwawasanLingkunganuntukPertanianpadaLahanGambut,26September1996.Bogor.
Soewono,S.1997.Fertilitymanagementforsustainableagricultureontropicalombrogenouspeat.I nBiodiversityand
SustainabilityofTropicalPeatlands.E ds J.O.Rieley.andS.E.Page.ProceedingsoftheinternationalSymposiumon
Biodiversity, Environmental importance and sustainability of Tropical Peat and Peatlands, held in Palangkaraya,
CentralKalimantan,Indonesia,48sept.1995.
Stevenson,F.J.1994.HumusChemistry.Genesis,Composition,andReactions.JohnWileyandSons.Inc.NewYork.
443p.
Tim Institut Pertanian Bogor. 1974. Laporan Survai Produktivitas Tanah Dan Pengembangan Pertanian Daerah
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

49/76

6/1/2016

DASARDASARILMUTANAH

PalangkaRaya,KalimantanTengah.IPB.Bogor.
WidjajaAdhi,IP.G.1988.PhysicalAndChemicalCharacteristicOfPeatSoilOfIndonesia.Ind.Agric.Res.Dev.J.
10:5964.
WidjajaAdhi, I P.G. 1997. Developing tropical peatlands for agriculture. In: J.O. Rieley and S.E. Page (Eds.). pp.
4554.BiodiversityandSustainabilityOfTropicalPeatAndPeatland.ProceedingsoftheInternationalSymposiumon
Biodiversity, environmental importance and sustainability of tropical peat and peatlands, Palangka Raya, Central
Kalimantan48September1999.SamaraPublishingLtd.Cardigan.UK.
Widodo.2004.PertumbuhandanHasilPadiGogoCV.Cirataterhadap3JenisMediaTanamdanUkuranPupukUrea.
AktaGrasia7.1710
Yardha A, Yusuf dan Hifnalisa. 1998. Penilaian sifat fisis tanah dan kimia gambut Teunom Aceh Barat. Jurnal
Agrista(2):2228.

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Sulfat


http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

50/76

6/1/2016

Masam

DASARDASARILMUTANAH

(Bagian

1)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah

sulfat_2264.html]

PengelolaanKesuburanTanahSulfatMasam
(Bagian1dari5Tulisan)

DAFTARISI

BABI.PENDAHULUAN...............................................................................1
BABII.PERMASALAHANPADATANAHSULFATMASAM............3
BABIII.RINGKASANHASILHASILPENELITIANTANAHSULFAT
MASAM.......................................................................................19
BABIV.PENGELOLAANKESUBURANPADATANAHSULFAT
MASAM..................................................................................25
BABV.KESIMPULAN...............................................................................54
DAFTARPUSTAKA....................................................................................55

I.PENDAHULUAN
Lahan rawa di Indonesia cukup luas dan tersebar di tiga pulau besar, yaitu di Sumatera, Kalimantan, dan Irian Jaya
(Papua). Menurut WidjajaAdhi et al. (1992) luas lahan rawa Indonesia 33,4 juta ha, yang terdiri atas lahan rawa
pasangsurutsekitar20jutahadanlahanlebak13,4jutaha.Pembukaanlahanrawapasangsurutdilakukanberkaitan
denganprogrampemukimantransmigrasiyangdimulaisejakPelitaI(ordebaru)sekitartahun1969melaluiprogram
Proyek Pembukaan Persawahan Pasang Surut (P4S). Pemanfaatan lahan pasang surut untuk pertanian merupakan
pilihan yang strategis dalam mengimbangi penciutan lahan produktif di pulau Jawa yang dialihfungsikan untuk
pembangunansektornonpertanianseperti,perumahan,jalanraya,industridanpembangunanlainnya.
MenurutSudiadikartaetal.,(1999)sampaisaatinilahanrawayangtelahdibuka2,4jutaha,1,5jutahadiKalimantan
dan 0,9 ha di Sumatera. Lahan rawa di Irian Jaya (Papua) sampai saat ini masih belum dibuka untuk pertanian.
Pengembangan lahan rawa memerlukan perencanaan pengelolaan dan pemanfaatan yang baik dan memerlukan
penerapan teknologi yang sesuai, terutama pengelolaan tanah dan air yang tepat. Pemanfaatan yang bijak,
pengembangan yang seimbang dan pengelolaan yang sesuai dengan karakteristik, sifat dan kelakuannya, diharapkan
dapatmengembalikanlahanrawamenjadilahanpertanianyangberproduktivitastinggi,berkelanjutandanberwawasan
lingkungan(WidjajaAdhi,1995adan1995b).SejakproyekP4Stahuntujuhpuluhandandilanjutkandenganproyek
penelitian Badan Litbang Pertanian Swamp I, Swamp II, dan kerjasama dengan Belanda (LAWOO) tahun delapan
puluhan, Proyek Penelitian Pengembangan Lahan Rawa Terpadu (ISDP) dan Proyek Pertanian PLG tahun sembilan
puluhan telah banyak teknologi pengelolaan lahan rawa yang dihasilkan (Suriadikarta dan A.Abdurachman, 1999).
Teknologi itu antara lain adalah teknologi pengelolaan tanah, tata air mikro, teknologi ameliorasi tanah dan
pemupukan,penggunaanvarietasyangadaptif,teknologimengatasihamadanpenyakit,danmodelusahatani.Namun
penerapan teknologi pertanian lahan rawa umumnya tidak dapat diterapkan secara berkelanjutan disebabkan ada
beberapa kendala yaitu : modal petani yang rendah, infrastruktur yang terbatas, kelembagaan pedesaan yang minim,
dankurangnyaperhatianpemerintahdalampemeliharaanjaringantataairmakrosecarakonsisten.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

51/76

6/1/2016

DASARDASARILMUTANAH

Berbagai kegagalan telah didokumentasikan namun keberhasilan juga telah dicapai sepanjang pengembangan lahan
rawa. Terjadinya lahan bongkor akibat reklamasi yang kurang tepat merupakan pengalaman kegagalan yang tidak
perlu terulang lagi dalam pengembangan lahan rawa yang masih memungkinkan untuk pengembangan pertanian.
Potensi lahan rawa yang masih besar ini sebaiknya dapat dimanfaatkan untuk menunjang persiapan pengembangan
sistemketahananpangandanagribisnisyangmenjadiprogramutamasektorpertanian.Sebagaimanadisampaikanoleh
Menteri Pertanian (1999). Lahan rawa, baik rawa pasang surut maupun bukan pasang surut (lebak) dapat dijadikan
basis pengembangan sistem ketahanan pangan, untuk kepentingan jangka pendek, menengah maupun jangka panjang.
Sehingga perhatian berupa investasi, terutama swasta dalam pemanfaatan lahan rawa seyogyanya dapat lebih
ditingkatkan. Berdasarkan macam dan tingkat kendala dalam pengembangan dan pengelolaan, khususnya untuk
pertanian, lahan rawa dibagi menjadi lima tipologi lahan, yaitu 1) lahan potensial, 2) lahan sulfat masam, 3) lahan
gambut,4)lahansalinataupantai,5)lahanrawalebak.

Bersambungkebagian2yangdapatdilihatpadapustakadibawahini:

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Sulfat

Masam

(Bagian

2)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah

sulfat_154.html]

PengelolaanKesuburanTanahSulfatMasam
(Bagian2dari5Tulisan)

II.PERMASALAHANPADATANAHSULFATMASAM
Pertama kali tanah sulfat masam dikenal dengan sebutan cat clay yang diambil dari asal kata katteklei (bahasa
Belanda),yangdiartikansebagailempungyangberwarnasepertiwarnapadabulukucing,yaituwarnakelabudengan
bercak kuning pucat (jerami). Bercak kuning pucat ini merupakan senyawa hasil (produk) oksidasi pirit yang sering
disebut dengan jarosit. Istilah tanah sulfat masam sendiri digunakan karena berkaitan dengan adanya bahan sulfida
(pirit)dalamtanahiniyangapabilateroksidasimenghasilkanasamsulfatsehinggamenyebabkantanahmenjadimasam
sampai sangat masam (pH 23). Tanah sulfat masam merupakan tanah liat rawa dan seringkali memiliki lapisan
gambut tipis < 20 cm memiliki lapisan pirit yang belum teroksidasi (bahan sulfidik) atau sudah teroksidasi (horison
sulfurik) pada kedalaman 050 cm. Tanah sulfat masam terbagi menjadi sulfat masam potensial dan sulfat masam
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

52/76

6/1/2016

DASARDASARILMUTANAH

aktual. Sulfat masam potensial dapat berubah menjadi sulfat masam aktual bila tanah mengalami drainase yang
berlebihan akibat reklamasi. Pirit yang semula stabil dan tidak berbahaya pada kondisi anaerob atau tergenang, akan
teroksidasi bila kondisi berubah menjadi aerob. Menurunnya permukaan air tanah akibat pembuatan saluran drainase
primersekundertersier menyebabkan oksigen masuk ke dalam pori tanah dan akan mengoksidasi pirit membentuk
asam sulfat, ion hidrogen dan Fe3+. Apabila oksidasi pirit berlangsung cepat maka akan terbentuk mineral jarosit
berupabercakbercakkaratanberwarnakuningjerami(Dent,1986Langenhoff,1986).
Pada kondisi tergenang, kemasaman tanah dapat dikurangi namun disisi lain muncul masalah keracunan besi fero
(Fe2+), Al, Mn, Hidrogen sulfida, CO2, dan asam organik. Masalah fisik yang sering dijumpai adalah terhambatnya
perkembanganakartanamanpadahorisonsulfurikkarenatanamankekuranganair,pematangantanahterhambatserta
salurandrainasetertutupolehdepositoksidabesi.Padakondisisepertiini,pertumbuhandanaktivitasmikroorganisme
tanahterhambat.Jenistanamanyangdapattumbuhdanberkembangakansangatterbatasdenganhasilrendah.

Proseskimiapadatanahsulfatmasam:
Proseskimiapadatanahsulfatmasamdapatdikelompokkanmenjadiduabagianpenting.Pertama,proseskimiayang
terjadi dalam keadaan reduktif, antara lain pembentukan pirit, reduksi besi feri menjadi fero, serta reduksi senyawa
beracun.

Kedua,proseskimiapadakondisioksidatif,yangterpentingadalahoksidasipirit.
a.Prosesreduksi
Padakondisiaerob,sumberelektronutamabagiaktivitasmikroorganisme
pendekomposisibahanorganikadalahoksigen.Bilakeadaanberubahmenjadianaerob,oksigendidalamtanahsecara
perlahan menghilang. Namun demikian, dekomposisi bahan organik oleh bakteri anaerob tetap berlangsung dengan
memanfaatkan elektron yang dilepaskan dalam proses reduksi nitrat, oksida mangan, oksida besi, dan sulfat. Dalam
proses reduksi selalu memanfaatkan proton, sehingga pH tanah akan meningkat. Proses kimia penting yang terjadi
adalah:
Pembentukan pirit. Pirit (FeS2) adalah mineral berkristal kubus dari senyawa besisulfida yang terkumpul di dalam
endapan marin kaya bahan organik dan diluapi air mengandung senyawa sulfat (SO4) dari air laut. Bentuk kristal
pirit sangat halus bervariasi dari <> 2 mikron hingga > 100 mikron (Van Dam dan Pons, 1972). Kandungan pirit
dalam endapan marin mencapai 5%, tetapi umumnya 14% (Van Breemen, 1972). Pembentukan pirit memerlukan
persyaratantertentu:
(1) Lingkungan anaerob : Reduksi sulfat hanya dapat terjadi pada kondisi yang sangat anaerob seperti pada sedimen
tergenang dan kaya bahan organik. Dekomposisi bahan organik oleh bakteri anaerob menghasilkan senyawasenyawa
yangbersifatmasamsehinggamenyebabkanlingkunganbertambahmasam(Ponsetal.,1982)
(2)Sulfatterlarut:Sumberutamasulfatadalahairlautatauairpayaupasang
(3)Bahanorganik:Oksidasibahanorganikmenghasilkanenergiyangsangatdiperlukanolehbakteripereduksisulfat.
Ionsulfatbertindaksebagaisumberelektronbagirespirasibakterikemudiandireduksimenjadisulfida.Jumlahsulfida
yangterbentukberkaitanlangsungdenganjumlahbahanorganikyangdimetabolismeolehbakteri
(4)Jumlahbesi:Tanahdansedimenmengandungbesioksidadanhidroksidadalamjumlahyangbanyak,yangakan
tereduksimenjadiFe2+,yangsangatlarutpadapHsekitarnormalataudijerapolehsenyawaorganikyanglarut
(5) Waktu : Waktu yang diperlukan untuk pembentukan pirit pada kondisi alami masih belum banyak diketahui.
Reaksi antara padatan FeS dan S berjalan sangat lambat, memerlukan waktu bulanan bahkan tahunan untuk
menghasilkan sejumlah pirit. Namun demikian, pada kondisi yang sesuai, Fe2+ larut dan ion polisulfida dapat
membentukpiritdalambeberapahari(Howarth,1979dalamDent,1986).Reaksikeseluruhanpembentukanpiritdari
besioksida(Fe2O3)sebagaisumberFedigambarkansebagaiberikut:
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

53/76

6/1/2016

DASARDASARILMUTANAH

Pada kondisi tergenang atau anaerob, selain terbentuk ion monokarbonat, di dalam tanah atau sedimen juga
mengandung karbonat yang berasal dari koral atau binatang laut. Karbonat akan menetralisir kemasaman tanah dan
mempertahankanpHsekitarnetral.
Pirit adalah zat yang hanya ditemukan di tanah di daerah pasang surut saja. Zat ini dibentuk pada waktu lahan
digenangi oleh air laut yang masuk pada musim kemarau. Pada saat kondisi lahan basah atau tergenang, pirit tidak
berbahaya bagi tanaman. Akan tetapi, bila terkena udara (teroksidasi), pirit berubah bentuk menjadi zat besi dan zat
asambelerangyangdapatmeracunitanaman.Piritdapatterkenaudaraapabila:
=>Tanah pirit diangkat ke permukaan tanah (misalnya pada waktu mengolah tanah, membuat saluran, atau membuat
surjan).
=>Permukaanairtanahturun(misalnyapadamusimkemarau).
Gejalakeracunanzatbesipadatanaman:
Dauntanamanmenguningjingga
Pucukdaunmengering
Tanamannyakerdil
Hasiltanamanrendah.
Ciriciritingginyakadarbesidalamtanah:
Tampakgejalakeracunanbesipadatanaman
Adalapisansepertiminyakdipermukaanair
Adalapisanmerahdipinggiransaluran.
Belerangmenyebabkanairtanahmenjadiasam,bahkanlebihasamdaripadacuka.Akibatyangditimbulkanadalah:
Tanamanmudahterserangpenyakit
Hasilpanenrendah
Tanamanlebihmudahkenakeracunanbesi.
TingkatkemasamantanahdiukurdenganangkapH.MakinrendahangkapH,makinasamairatautanahnya.Tanaman
padimenyukaipHantara56danpaditidakdapathidupjikaberadapadapHdibawah3.
Piritdidalamtanahdapatditandaidengan:
Adanya rumput purun atau rumput bulu babi, menunjukkan ada pirit di dalam tanah yang telah mengalami
kekeringandanmenimbulkanzatbesidanasambelerang.
Bongkahtanahberbecakkuningjeramiditanggulsaluranataujalan,menunjukkanadanyapirityangberubahwarna
menjadikuningsetelahterkenaudara.
=> Adanya sisasisa kulit atau ranting kayu yang hitam seperti arang dalam tanah. Biasanya di sekitamya ada becak
kuningjerami.
=> Tanah berbau busuk (seperti telur yang busuk), maka zat asam belerangnya banyak. Air di tanah tersebut harus
dibuangdenganmembuatsalurancacingdandigantidenganairbarudariairhujanatausaluran.
Kedalamanpiritdiukurdengancaraberikutini:
Galilubangsedalam75cmataulebih.
Ambillahgumpalantanahmulaidarikedalaman10cm,20cm,30cm,danseterusnyasampaikebagianbawah.
Gumpalantanahtersebutditandaidandicatatsesuaidenganasalkedalaman.
Setiapgumpalantanahditetesiairperoksida.Bilakeluarbuihmeledakledakmenunjukkanadanyapiritdalamtanah
tersebut.
Caralaindenganmenyimpangumpalantanahtadiditempatteduh.Diamatisetelah3minggu,jikaadabecakwarna
kuningjerami,makatanahtersebutmengandungpirit.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

54/76

6/1/2016

DASARDASARILMUTANAH

Cara ini diulang sedikitnya di 20 tempat untuk setiap hektar lahan, guna memastikan kedalaman piritnya. Sehingga
sewaktumengolahtanah,pirittidakteroksidasi,karenadapatmeracunitanaman.
ReduksiFe3+menjadiFe2+.Padasebagiantanahmasam,penggenanganakanmengakibatkanpHmeningkathingga6
7 setelah beberapa minggu. Pada kondisi seperti ini, proses terpenting adalah reduksi Fe3+ menjadi Fe2+
(Ponnamperuma, 1972 Patrick dan Reddy, 1978). Pada tanah sulfat masam muda, peningkatan pH dari 3,03,5
menjadi5,56,0berkaitandengantingkatpelarutanFe2+yangdicapai.Padatanahsulfatmasamyangtelahlanjut,pH
meningkat sangat lambat setelah penggenangan bahkan kadangkadang tidak mencapai 5,56,0. Kemungkinan hal ini
disebabkan oleh : (1) lambatnya proses reduksi dan (2) tidak adanya bahan yang akan direduksi seperti misalnya
oksidabesiferi.Padakondisipertama,makasetelahpenggenangantidakakanterjadiperubahannilaiEhataupHyang
drastis.Padakasuskedua,nilaiEhakanmenuruntanpameningkatkanpH.MenurutDent(1986),tanahsulfatmasam
yang sudah tua mengandung besi dalam bentuk kristal goetit dan hematit yang stabil sehingga sulit tereduksi.
Sebaliknyatanahsulfatmasamyangmasihmudakayaakankoloidbesi,sehinggadiperkirakanmempunyaikadarbesi
terlarut yang tinggi setelah penggenangan. Reduksi oksida Fe3+ dengan bahan organik sebagai donor elektron akan
mengkonsumsi4proton:
Konstenetal.,(1990)melaporkanbahwatanahsulfatmasamdiKalimantanadayangtidakmenunjukkanpeningkatan
pH setelah penggenangan. Hal ini disebabkan tanah tersebut mempunyai kandungan oksida Fe3+ yang rendah
dibandingkankapasitasnetralisasiolehtanah.
Reduksi sulfat. Proses reduksi sulfat menjadi sulfida dapat terjadi pada kondisi pH di atas 4 hingga 5, pada pH di
bawahitureaksiterjadisangatlambatdanbahkantidakada.Reduksisulfatseringkaliterjadipadatanahsulfatmasam
yang masih muda dan sulfat masam lanjut yang lama tergenang. Reduksi sulfat ini sangat berkaitan dengan adanya
hasildekomposisibahanorganikyangmasihbaru.H2Syangterbentuksangatberacunbagitanaman,padakonsentrasi
0,1 mg l1 H2S sudah dapat meracuni tanaman padi dalam larutan hara (Mitsui, 1964 dalam van Breemen, 1993).
Reaksiyangterjadidigambarkansebagaiberikut:

b.Prosesoksidasi
Proses utama yang terjadi bila tanah sulfat masam teroksidasi adalah oksidasi pirit. Reklamasi lahan rawa melalui
pembuatan saluran drainase mengakibatkan perubahan kimia di dalam tanah sulfat masam. Pirit yang semula tidak
berbahayapadakondisitergenang,secaraperlahanberubahmenjadiunsurberacundanmerupakansumberkemasaman
tanahbilakondisitanahberubahmenjadioksidatif.Perbedaanyangbesarantarapasangsurutnyaairlautsertamusim
kemarau yang panjang menyebabkan pirit teroksidasi secara alami. Reaksi oksidasi pirit dengan oksigen pada tanah
sulfatmasamberlangsungdalambeberapatahapan,meliputireaksireaksikimiadanbiologis(Dent,1986).Padatahap
awal, oksigen terlarut secara lambat bereaksi dengan pirit menghasilkan 4 molekul H+ per molekul pirit yang
dioksidasi:
Pada nilai pH kurang dari 3,5 reaksi oksidasi kimia ini berjalan sangat lambat dengan waktu paruh 1.000 hari.
KecepatanoksidasipiritolehFe3+sangatdipengaruhiolehpH,karenaFe3+hanyalarutpadanilaipHdibawah4dan
Thiobacillus ferrooxidans tidak tumbuh pada pH yang tinggi. Besi oksida dan pirit di dalam tanah mungkin secara
fisik berada pada tempat yang berdekatan, namun ada tidaknya reaksi di antara mereka sangat dipengaruhi oleh
kelarutanFe3+.
Kecepatan oksidasi pirit cenderung bertambah dengan menurunnya pH tanah. Pada pH di bawah 4, proses oksidasi
terhambat oleh suplai O2. Kecepatan penurunan pH akibat oksidasi pirit tergantung pada : (1) jumlah pirit (2)
kecepatanoksidasi(3)kecepatanperubahanbahanhasiloksidasidan(4)kapasitasnetralisasi.Kalsiumkarbonatdan
basa dapat ditukar merupakan bahan penetralisir kemasaman dimana reaksinya dengan asam sulfat berjalan cepat(van
Breemen,1993).

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

55/76

6/1/2016

DASARDASARILMUTANAH

Didalamtanah,berbagaitingkatanoksidasiyangberlangsungtidakterjadi
pada titik yang sama. Pengujian secara mikromorfologi menunjukkan bahwa ada perbedaan/batas yang nyata antara
lokasi beradanya pirit dan bahan hasil oksidasinya seperti jarosit, besi oksida, dan gipsum. Pirit biasanya terdapat di
dalam inti dari ped, sedangkan jarosit, besi oksida, dan gipsum terdapat pada permukaan ped dan ruang pori. van
Breemen (1976) menduga bahwa oksigen bereaksi dengan Fe2+ terlarut membentuk Fe3+ terlebih dahulu sebelum
bertemudenganpirit.

c.Hasiloksidasipirit
Oksidasi pirit oleh Fe3+ menghasilkan ion (H+) yang kemudian sebagian digunakan lagi untuk mengoksidasi Fe2+
menjadiFe3+.HasilakhirdarioksidasipiritadalahhidroksidaFe3+.PadapH>4,oksidadanhidroksidaFe3+akan
mengendap,misalnyadalambentukgoetityanglambatlaunakanberubahmenjadihematit(Dent,1986).
Jarosit [KFe3(SO4)2(OH)6] merupakan endapan berwarna kuning pucat hasil oksidasi pirit pada kondisi yang sangat
masam,yaitupadaEhdiatas400mVdanpHkurangdari3,7.Reaksipembentukannyasebagaiberikut:
Pada pH di atas 4, jarosit tidak stabil dan mudah berubah menjadi goetit dan terhidrolisa menjadi oksida besi. Hasil
pengujian mikroskopi terhadap irisan tipis dan difraksi sinar X menunjukkan bahwa bercak kuning yang merupakan
karakteristiktanahsulfatmasamdidominasiolehjarositdangoetit.Bercakmerahdancoklatpadasulfatmasamadalah
goetit yang kadangkadang berasosiasi dengan jarosit dan hematit (van Breemen, 1976). Sulfat merupakan salah satu
hasiloksidasipirityangsangatsedikitdijerapolehprofiltanah.Sebagianbesardarisulfurterlaruthilangbersamaair
drainaseatauberdifusikelapisandibawahnyayangkemudianakandireduksikembalimenjadisulfida.Sebagiankecil
tertahan dalam bentuk jarosit atau gipsum. Gipsum terbentuk pada tanah sulfat masam melalui reaksi netralisasi
kemasamanolehkalsiumkarbonat:
Ion hidrogen (proton) yang dihasilkan dari oksidasi pirit menyebabkan kondisi tanah yang sangat masam. pH yang
sangatrendahmenyebabkanpenghancurankisikisimineralliatsehinggasilikatdanAl3+terlepas.Dilapangan,nilai
pHtanahsulfatmasamberkisarantara3,2hingga3,8(Dent,1986).MeningkatnyakandungansilikadanAl3+terlarut
mempengaruhi karakteristik tanah dan air tanah. Aktivitas Al3+ terlarut berkorelasi secara langsung dengan pH, bila
pHmeningkatmakaaluminiumakanmengendapsebagaihidroksidaataubasicsulfate(vanBreemen,1973).
BeberapaunsurmikrosepertiNidanCoikutterakumulasididalamsedimenkarenamensubstitusiFedalampiritatau
unsurCu,Zn,Pbyangmenggantikansulfida(Deeretal.,1965dalamvanBreemen,1993).Unsurunsurtersebutakan
terlepas kembali saat pirit teroksidasi. Satawathananont (1986 dalam van Breemen, 1993) menunjukkan bahwa
konsentrasiunsurCu,Zn,Mo,Cd,Pb,Ni,danAsterdapatdalamjumlahyanglebihtinggipadatanahberpirityang
aerasinyabaik(pH2,9)dibandingkanpadatanahsulfatmasamyangsudahberkembang(pH3,94,5)dantanahmarin
yangtidakmasam(pH4,9)diBangkok.Lebihlanjutiamengamatitanahyangdiinkubasipadanilaipotensialredoks
dan pH yang terkontrol dalam suasana masam yang oksidatif selama dua minggu, logam berat yang larut air lebih
tinggipadatanahberpiritdibandingkantanahlanjut/tua.
Selain unsur mikro, masih banyak unsur lain seperti gas SO2, Fe2+, H2S, Al3+ dan asamasam organik yang
dilepaskansebagaiakibatteroksidasinyapirit.Keluarnyaunsurunsurberacuntersebutdaritanahmelaluiairdrainase
keperairanumumdapatmenyebabkanpolusidanmengancamkehidupanbiotasungai/laut.
Kandunganpiritditanahsulfatmasamtemyatadikemudianharimenjadipermasalahanutamayangberat,atausangat
sulit diatasi, apabila tanah sulfat masam dibuka untuk pertanian. Masalahnya dimulai pada saat direklamasi, yaitu
dengan penggalian saluransaluran drainase besar, seperti saluran primer, sekunder, dan tersier, dengan tujuan untuk
mengeringkan wilayah agar tanah sulfat masam yang semula basah atau tergenang menjadi tanah yang relatif lebih
kering yang siap digunakan sebagai lahan pertanian. Akibat adanya saluransaluran drainase tersebut, permukaan air
tanahmenjaditurun,dantanahbagianatasmenjadikeringdanterbuka.Akibatadanyaoksigendiudara,makatanah
bagian atas ini mengalami oksidasi, sementara tanah bagian bawah masih tetap berada di lingkungan air tanah, yaitu
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

56/76

6/1/2016

DASARDASARILMUTANAH

tetapdalamkondisitereduksi.Pirityangterbentukdalamsuasanareduksidalamendapanlautdidekatpantaidengan
kandunganbahanorganiktinggi,berasaldarivegetasipantaisepertiapiapidanbakau/mangrove.
Dalam kondisi reduksi, pirit bersifat stabil sesuai dengan suasana lingkungan pembentukannya. Akibat penurunan air
tanah, pirit yang berada di tanah bagian atas ikut terbuka (exposed) di lingkungan yang aerob, dan mengalami
oksidasi,menghasilkanasamsulfatdansenyawabesibebasbervalensi3(FeIII).Hasilakhirnyamerupakantanahber
reaksimasamekstrim(pH<3,5),>4,0),teksturliatberdebusampailiat,danumumnyaberwarnakelabukelabugelap.
Profiltanahsulfatmasampotensial,tanahbagianatasteroksidasirelatiflebihtipissekitar2575cm,setengahmatang
sampai hampir matang, reaksi tanah sangat masamagak masam (pH >4,0), tekstur umumnya liat berdebu, dan
warnanya kelabu tua sampai coklat kekelabuan. Lapisan bawah tereduksi, hampir mentah (practically unripe) sampai
mentah,reaksitanahmasamagakmasam(pH>4,0),teksturliatberdebusampailiat,danwarnanyakelabutuasampai
kelabugelap.Tanahsulfatmasamaktual,karenamemilikireaksimasamekstrim,danbanyakkandunganionionyang
bersifat racun/toksik, sehingga tidak sesuai untuk tanaman pertanian. Tanaman padi yang ditanam di tanah ini tidak
menghasilkangabahyangberarti.Lahaninibanyakditinggalkanpetanitransmigran,sehinggamenjadilahanbongkor
danditutupisemaksemaklebat.Vegetasialamiyangmamputumbuhadalahyangtoleranterhadapkemasamantinggi,
terdapat di Delta pulau Petak biasanya berupa purun (Lepironia mucronata), atau purun tikus (Fimbristylis sp.), dan
gelam(Melaleucaleucadendron).
Sulfatmasampotensial
Dataprofilsulfatmasampotensial(SMP)menunjukkanadanyalapisangambutpermukaanyangtipis,sekitar012/16
cm.Teksturseluruhlapisantanahmenunjukkanhalus,yaituteksturtanahSMPdariSumateramempunyaikandungan
liatantara4075%,dengandebu2560%.SementarakandunganliatSMPdariKalimantan,bervariasiantara4085%,
dandebu2050%.Dengandemikian,teksturtanahlapisanatastermasukliatberdebu,sedangkanlapisanbawahnyaliat
berdebuatauliat.
Reaksi tanah di seluruh lapisan bervariasi dari masam ekstrim (extremely acid) (pH 3,5 atau kurang) sampai sangat
masam(verystronglyacid)(pH4,54,8),dancenderungmakinmasamdilapisanIapisanbawah.Reaksitanahlapisan
atasrataratasangatmasamsekali(pH4,04,3),dandilapisanbawahmasamekstrimsampaisangatmasamsekali(pH
3,53,8). Kandungan garam, dengan data terbatas yang hanya berasal dari SMP Kalimantan, ditunjukkan oleh daya
hantar listrik yang bervariasi dari 7.00021.000 dS/m, dengan ratarata termasuk sangat tinggi sekali (7.2537.320
dS/m),baikdilapisanatasmaupunlapisanbawah.
Kandungan bahan organik, tidak termasuk lapisan gambut tipis di permukaan tanah bervariasi sedang sampai sangat
tinggi,baikpadaSMPdariSumateramaupunSMPdariKalimantan.Rataratakandunganbahanorganiksangattinggi
sampai sangat tinggi sekali (9,1620,54%) di lapisan atas, dan sangat tinggi (6,316,61%) di lapisan bawah.
Kandungan N tinggi (0,590,70%) di lapisan atas, dan menurun menjadi rendah sampai sedang (0,170,28%) di
lapisan bawah. Rasio C/N di seluruh lapisan tanah bervariasi dari tinggi sampai sangat tinggi, dan cenderung
meningkat di lapisan bawah. Ratarata C/N tergolong tinggi (1624) di lapisan atas, dan sangat tinggi (3031) di
lapisanbawah.
Kandungan fosfat potensial (P2O5HCI) pada SMP dari Sumatera bervariasi dari rendah sampai sangat tinggi di
lapisanatas,danmenurunmenjadirendahsampaisedangdilapisanbawah.Rataratanyatinggi(58mg/100gtanah)di
lapisan atas, dan rendah (20 mg/100 g tanah) di lapisan bawah. Sementara kandungan P2O5 di seluruh lapisan pada
SMP dari Kalimantan, bervariasi dari rendah sampai sangat tinggi. Oleh karena itu, ratarata kandungan P2O5
potensial di lapisan atas termasuk sangat tinggi (115 mg/100 g tanah), dan di lapisan bawah sedang (33 mg/100 g
tanah). Kandungan K2O tergolong sedang (3235 mg/100 g tanah) di lapisan atas, dan sedang sampai tinggi (2960
mg/100gtanah)dilapisanbawah.
Kandunganfosfattersedia(P2O5BrayI)tergolongsedangsampaitinggi(17,732,3ppm)dilapisanatas,dansedang
(15,217,0 ppm) di lapisan bawah. Jumlah basa, baik di lapisan atas maupun lapisan bawah, tergolong tinggi (18,0
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

57/76

6/1/2016

DASARDASARILMUTANAH

28,3cmol(+)/kgtanah).
BasadapattukaryangdominandiseluruhlapisantanahadalahMgdanNamasingmasinguntukMgtermasuksangat
tinggi (10,89 14,19 cmol(+)/kg tanah, pada SMP dari Sumatera, dan termasuk tinggi (7,058,02 cmol(+)/kg tanah)
pada SMP dari Kalimantan. Kandungan Na tergolong sangat tinggi sampai sangat tinggi sekali, baik di lapisan atas
(2,346,01 cmol(+)/kg tanah) maupun di lapisan bawah (4,915,61 cmol(+)/kg tanah). Sebaliknya kandungan Ca
dapat tukar rendah sampai sedang, baik di lapisan atas (5,117,84 cmol(+)/kg tanah), maupun lapisan bawah (4,61
7,95 cmol(+)/kg tanah). Sementara kandungan Kdapat tukar, tergolong sedang (0,430,64 cmol(+)/kg tanah) di
seluruh lapisan. Kapasitar tukar kation tanah, menunjukkan nilai tinggi sampai sangat tinggi (31,562,5 cmol(+)/kg
tanah) di lapisan atas, dan tinggi (28,932,7 cmol(+)/kg tanah) di lapisan bawah karena pengaruh kandungan bahan
organikyangsangattinggi.
Kejenuhanbasatergolongrendahsampaisedang(3549%)dilapisanatas,dansedangsampaisangattinggi(5584%)
dilapisanbawah.KejenuhanAIdisemualapisanumumnyasangatbervariasidarisangatrendahsampaisangattinggi,
dan rataratanya rendah (3235%) di lapisan atas, dan rendah sampai sedang (3047%) di lapisan bawah. Kandungan
pirit(FeS2)sangatrendah(0,441,12%)dilapisanatas,danrendah(1,352,31%)dilapisanbawah.

Sulfatmasamaktual
DataSulfatMasamAktual(SMA)yangtersedia,hanyaberasaldarilahanrawadiKalimantan.Sementaradataanalisis
yang berasal dari Sumatera, tidak menyebutkan adanya SMA karena data relatif berumur tua, 19741978. Tanah
mempunyai lapisan gambut permukaan yang tipis, sekitar 012 cm. Seluruh lapisan tanah memiliki tekstur halus,
dengan kandungan fraksi liat 3570%, dan debu 2560%, sehingga tekstur tanah lapisan atas tergolong liat berdebu,
dan di lapisan bawah liat. Lapisan atas berreaksi sangat masam sekali (pH 3,6), sementara lapisan bawah antara
kedalaman20120cmmenunjukkanpHantara1,83,5,denganpHratarata2,8,sehinggatergolongberreaksimasam
ekstrim.
Kandungan bahan organik di seluruh lapisan bervariasi tinggi sampai sangat tinggi, sehingga rataratanya tergolong
sangattinggi(7,5110,93%).KandunganNrataratatergolongsedang(0,220,49%)diseluruhlapisan,dancenderung
menurun di lapisanIapisan bawah. Rasio C/N bervariasi dari tinggi sampai sangat tinggi, dan bertambah besar di
lapisan bawah. Karena itu rasio C/N ratarata tergolong tinggi (25) di lapisan atas, dan sangat tinggi (39) di lapisan
bawah.
Kandungan fosfat potensial (P2O5HCI 25%) di lapisan atas bervariasi dari rendah sampai sangat tinggi, dan rata
ratanya termasuk tinggi (45 mg/100 g tanah). Kandungan P2O5 lapisan bawah, sebagian besar sangat rendah sampai
sedang,sehinggarataratanyarendah(17mg/100gtanah).SebaliknyakandunganK2Opotensial(HCl25%),sebagian
besar tinggi sampai sangat tinggi di semua lapisan, sehingga rataratanya tergolong sangat tinggi (7381 mg/100 g
tanah).
Kandunganfosfattersedia(PBrayI)diseluruhlapisansangatrendahsampaisedang,dancenderungsemakinrendah
kelapisanbawah.Olehkarenaitu,rataratanyatermasuksedang(19,3ppm)dilapisanatas,danrendah(12,6ppm)di
lapisanbawah.
Jumlah basabasa di semua lapisan sampai sedalam 180 cm sangat bervariasi dari rendah sampai sangat tinggi sekali,
dan cenderung menurun di lapisan bawah. Karena itu, ratarata jumlah basa, baik di lapisan atas maupun lapisan
bawahtergolongtinggi(21,929,1cmol(+)/kgtanah).Sepertipadatipetipelahansebelumnya,basadapatttukaryang
dominandiseluruhlapisanadalahMgdanNa.Mgterdapatdalamjumlahtinggisampaisangattinggisekali,danrata
ratanyasangattinggi(8,309,25cmol(+)/kgtanah)disemuatapisan.DemikianjugaNaterdapatdalamjumlahtinggi
sampai sangat tinggi sekali di seluruh lapisan, sehingga rataratanya termasuk sangat tinggi sekali (9,7014,87
cmol(+)/kgtanah).SebaliknyakandunganCadapattukarumumnyabervariasidarisangatrendahsampaisedang,dan
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

58/76

6/1/2016

DASARDASARILMUTANAH

rataratanya tergolong rendah (3,494,12 cmol(+)/kg tanah) di lapisan atas dan lapisan bawah. Sedangkan Kdapat
tukartergolongtinggi(0,89cmol(+)/kgtanah)dilapisanatas,danrendah(0,37cmol(+)/kgtanah)dilapisanbawah.
Kapasitas tukar kation tanah bervariasi dari tinggi sampai sangat tinggi, dan rataratanya tergolong tinggi (33,537,2
cmol(+)/kgtanah)diseluruhlapisankarenakontribusidaribahanorganik.
Kejenuhanbasadiseluruhlapisantanahsangatbervariasi,sebagiansangatrendah,sebagianrendahsampaisedang,dan
sebagianlagisangattinggi,denganrataratasedang(4042%),baikdilapisanatasmaupunlapisanbawah.Kejenuhan
AIdisemualapisanumumnyabervariasidarisedangsampaisangattinggi,sehinggarataratanyatinggi(6771%)baik
dilapisanatasmaupunlapisanbawah.Kandunganpirit(FeS2)menunjukkanrataratasangatrendah(0,851,07%)di
kedualapisantanah.

Bersambungkebagian3yangdapatdilihatpadapustakadibawahini:

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Sulfat

Masam

(Bagian

3)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah

sulfat_2139.html]

PengelolaanKesuburanTanahSulfatMasam
(Bagian3dari5Tulisan)

III.RINGKASANHASILHASILPENELITIANTANAHSULFATMASAM
Salah satu tipologi lahan yang dijumpai di lahan rawa pasang surut, adalah lahan sulfat masam. Dicirikan dengan
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

59/76

6/1/2016

DASARDASARILMUTANAH

terdapatnya lapisan sulfida (piritFeS2) yang kadarnya >2% di dalam tanah dengan kedalaman bervariasi, sifat
kimiatanahnyakurangmenguntungkanbagiusahapertanian,diantaranyakemasamantanahsangattinggi(pHtanah
<4,0),>Ada tiga komponen teknologi yang harus diterapakan secara bersamasama, yakni penataan lahan,
pengelolaantanahdanair,danpenanamantanamanvarietastoleran(Simatupang,2006).
Lahansulfatmasamdimanakandunganbesinyacukuptinggidanditemukanpadalapisantanahtidakterlaludalam
(<50>Pirittidakberbahayaapabilatidaktereksposkepermukaantanahdantidakmemgalamioksidasi,olehkarena
itupiritdidalamtanahdiupayakantetapstabildengancarapenerapanteknologiolahlahankonservasi.Terjadinya
oksidasi pirit akan memasamkan tanah sehingga pH tanah turun sampai di bawah 3,0 dan menghasilkan besi ferro
(Fe2+)yangbersifatracunbagitanamanpadi.Penyiapanlahansistemolahtanahkonservasimerupakanteknologi
yang dapat mengendalikan dan mengkonservasi pirit yang terdapat pada lapisan tanah. Olah tanah konservasi
merupakan salah satu teknologi yang dapat menjawab atau mengatasi masalah yang berpeluang muncul dalam
pengembangankawasanlahaneksPLGdiKaltengsebagailahanproduksipangan(Simatupang,2006).
Olah tanah konservasi merupakan teknologi penyiapan lahan yang menganut kepada prinsip konservasi tanah dan
air.Bertujuanuntukmengatasidanmengendalikanterjadinyadegradasikesuburantanahterutamapadalahanlahan
marginal seperti lahan rawa pasang surut sehingga produktivitas lahan dapat dipertahankan dan berkelanjutan
(Simatupang,2006).
Sistem olah tanah konservasi dapat diterapkan sebagai pengganti sistem olah tanah yang mengguanakan banyak
tenaga kerja, dilain pihak tenaga kerja sulit diperoleh (langka) dan upahnya relatif mahal. Di kawasan lahan rawa
pasangsurut,tenagakerjamerupakansalahsatukendaladalamsistemusahatanisehinggauntukkmengatasimasalah
tersebutsistempenyiapanlahantanpaolahtanahmerupakancarayanglebihtepat(Simatupang,2006).
Sistem olah tanah konservasi di lahan sulfat masam sangat erat hubungnannya dengan terdapatnya lapisan sulfidik
(pirit) di dalam tanah hendaknya dipertahankan tetap dalam keadaan stabil, tadak terekspos (terangkat ke
permukaantanah)sehinggapirittidakmengalamioksidasi(Simatupang,2006).
Teknologi olah tanah konservasi erat kaitannya dengan pengelolaan gulma, dilain pihak gulma tumbuh cepat dan
subur di lahan pasang surut, oleh karenannya dalam penerapannya berkaitan dengan penggunaan herbisida sebagai
komponen utama untuk untuk mengendalikan gulma sehingga lahan menjadi siap untuk ditanami. Herbisida
digunakan bertujuan untuk lahan menjadi siap untuk ditanam dan sekaligus untuk mengendalikan pertumbuhan
gulmadiarealpertanamansebagailahanditanami(Simatupang,2006).
Tahapan kegiatan dalam penerapan sistem penyiapan tanpa olah tanah: vegetasi (gulma dan sisa tanaman
sebelumnya) disemprot dengan herbisida (glyfostat, paraquat, dan sulfo sat). Selanjutnya, setelah gulma mati
kemudian direbabkan menggunakan alat bantu (seperti drum, batang pisang atau kelapa, digilas dengan roda
traktortanagn) sampai rata dengan permukaan tanah untuk memudahkan pelaksanaan tanam padi (Simatupang,
2006).
Berdasarkan penelitian berlokasi SPI Palingkau di kawasan lahan eksPLG, ternyata penerapan teknologi tanpa
olahtanahmenggunakanherbisidadapatmeningkatkanhasilpadi3047%dibandinghasilpadiyangdidapatdengan
teknologi yang diterapkan oleh petani umumnya. R/Cratio 1,241,28, meningkat pendapatan petani, mengurangi
penggunaan tenaga kerja sampai 28% dan teknologi tanpa olah tanah mampu mengendalikan keracunan besi pada
tanaman padi. Selain itu, teknologi TOT ini juga dapat mendukung sistem usahatani yang berkelanjutan
(Simatupang,2006).
Maka untuk memacu usaha peningkatan produksi dan untuk mengendalikan kegagalan usahatani padi karena
timbulnya keracunan besi, penerapan teknologi tanpa olah tanah merupakan langkah yang strategis. Melalui
penerapan teknologi ini revitalisasi pembangunan pertanian di kawasan lahan eksPLG diharapkan memberikan
hasil yang optimal, dan memberikan kontribusi yang besar dalam usaha peningkatan produksi dan penyediaan
pangannasional(Simatupang,2006).
Sistem mekanisasi pada pengolahan tanah akan menyebabkan pengusikan tanah yang juga akan memperlancar difusi
oksigenkedalamtanah.Difusioksigenakanmemperbaikiaerasitanahyangberdampakpadaperubahansuasanatanah.
Tataairyangberfungsisebagaisaluranpengatustanpakeberadaansistempengaturmukaairtanahdapatmenyebabkan
tanah rawa menjadi over drain sehingga status tanah yang semula reduktif berubah menjadi oksidatif. Proses
perubahansuasanainiselalumenyebabkanpemasamanpadatanah,terlebihlagibiladalamtanahtersebutterkandung
bahan sulfidik. Untuk itu perlu dilakukanlah penelitian hubungan antara potensi kemasaman dengan laju pengeluaran
asampadaberbagaiayunankondisiairolehSutanto(2001),gunamengurangikontakantaraasamyangtimbuldengan
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

60/76

6/1/2016

DASARDASARILMUTANAH

tanah, maka pembilasan perlu segera dilaksanakan. Pembilasan dapat dikerjakan dengan air biasa ataupun air yang
mengandungion.
Tujuanpenelitianiniadalah:(a)mengetahuiperangambutdalammemperbaikisifatfisiktanah,(b)melihatpengaruh
air laut, kapur, atau pupuk kandang sebagai bahan amelioran pada tanah sulfat masam, (c) melihat pengaruh
pengolahantanahsecaramekanisasiterhadapevolusikejenuhanaluminiumditanahsulfatmasampotensialpadasistem
sawahdanpalawija.
Hasilpenelitianmenunjukkanbahwa:
(a)Tanahsulfatmasampalingcocokdigunakanuntukpadisawah,akanlestaribilakadarpiritawal<1%>
(b) Perbaikan sifat fisika tanah dapat dikerjakan dengan pemberian bahan gambut hingga takaran yang mampu
mencegah tanah bersifat kohesif bila kering. Takaran gambut sampai 10% belum mampu melonggarkan tanah atau
memperbaikilajuperembihannya,
(c) Air laut dapat berfungsi sebagai amelioran dengan jalan menukarkan sumber kemasaman dalam kompleks
pertukaran dengan kation basa (Ca dan Mg serta K) yang ada dalam air laut tersebut. Pembilasan sisa air laut sangat
dibutuhkanuntukmenghindariplasmolisisakartanaman,
(d) Pembilasan garam terlarutkan, hasil oksidasi pirit yang bersifat masam sangat diperlukan sebelum tanah sulfat
masamdiberiameliorandanpupuk,
(e) Kejituan pemberian amelioran sangat ditentukan oleh tingkat reaktifitas tanah, tanah tidak reaktif lebih tanggap
daripada tanah reaktif, bahan penukar atau penetral sangat efisien bila hanya untuk sumber kemasaman yang berada
dalamkomplekspertukaran.
Tahana(status)harapadatanahsulfatmasamtergolongrendahbahkansangatrendah.GejalakahatharaN,P,K,
dan terutama P dan B sering dialami tanaman budidaya (lahan kering) merana dan kerdil akibat kemasaman dan
keracunan ion Al3+ dan Fe3+ yang tinggi. Pada kondisi tergenang tanaman (seperti padi) mengalami keracunan
Fe2+ ,H2 S,CO2 ,danasamasamorganik.
Hasilhasil pertanian di tanah sulfat masam menunjukkan pemberian pupuk berpengaruh positif terhadap hasil
tanaman. Keragaan tanaman yang diberi pupuk lengkap (N, P, dan K) menunjukkan lebih baik. Pengaruh ppuk
lebih sangkil apabila kombinasi dengan pemberian bahan amelioran seperti kapur, dolomit, batuan fosfat alam,
atausejenislainnya.
Prinsipdasarpemberiankapurpadatanahsulfatmasamadalahuntukmenekankemasamantanahterutamaakibat
kelarutanAl3+ yangtinggidanjugauntukkemepananpemupukan.Pemberiankapur,dolomit,ataubatuanfosfat
alam banyak disarankan untuk menetralisir kondisi kemasaman dan keracunan oleh H+ , Al3+ , dan atau Fe3+ .
PemberiandolomitataukapurtidakmestiuntukmencapaipH5,5,karenaapabiladitujukanuntukmenaikkanpH
mencapai 5,5 diperlukan jumlah kapur yang besar sekali antara 1520 ton kapur/ha. Berdasarkan kadar pirit,
untuk menetralkan 1 % pirit yang apabila terdegradasi menghasilkan potensi kemasaman setara dengan 35 cmol
(+)/kg, diperlukan sekitar 50 ton kapur/ha. Padahal kadar pirit tertinggi di tanah sulfat masam antara 57 %
sehingga untuk menetralkannya diperlukan 200400 ton kapur (Sutrisno, 1990 Maas, 2000). Hasil Simposium
internasionaltanahsulfatmasamkeduadibangkok,Thailand(1982)merekomendasikanbahwapemberiankapur
cukuphanyabeberapatonsajauntukperbaiaknkondisikemasamandantahananharatanahyangrendah.
Laporanlaporan penelitian tentang pengaruh kapur menunjukkan hasil beragam. Pemberian kapur pada lahan
budidaya yang telah mantap pada Kebun Percobaan Unit Tatas, Kapuas sampai dengan 1,5 ton kapur/ha
memberikanresponyangliniermengikutipersamaan:
Y=1,336+1,862X,
Dimana:
Y=hasilpadi(dalamtongabah/ha)dan
X=takarankapur(dalamtonkapur/ha)
Rangkaian penelitian di alhan sulfat masam tipe luapan B, Unit Tatas, kalimantan tengah menunjukkan
pemberian kapur 1,5 ton CaO/ha dapat meningkatkan hasil padi sebesar 30 % berturutturut hasil pada MH
89/90,MK90,MK90/91mencapai3,142,00dan3,28tonGKG/ha).Penelitianlaindilahansulfatmasamtipe
C,Barambai,kalimantanSelatandenganpemberiankapur2tonCaCO3 /hadapatmeningkatkanhasilpadisebesar
20 % (4,65 ton GKG/ha) yang apabila dipadukan dengan pelumpuran hasil padi meningkat 52 % (5,83 ton
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

61/76

6/1/2016

DASARDASARILMUTANAH

GKG/ha).Dalamrangkaianpenelitianinijugaditunjukkanbahwapengaruhresidukapurdapatdiperolehsampai
masatanamketiga.
Dengankatalain,pemberiankapurtidakdiperlukansetiapmusimtanam(Noor,1996NoordanSaragih,1997).
Penelitian di lahan sulfat masam, Vietnam menunjukkan pemberian kapur hingga sebesar 3 ton kapur/ha tidak
berpengaruh terhadap pH tanah, Al dapat ditukar, serapan N, P dan Ca pada tanam ke 1, tetapi sebaliknya pada
tanam ke 2 terjadi peningkatan pH, penurunan Al, peningkatan serapan serapan N, P, dan Ca dan penurunan
serapan Fe. Pengaruh pemberian kapur hingga takaran 3 ton/ha berhasil meningkatkan hasil padi sampai tanam
ke empat, tetapi pada takaran 610 ton/ha hanya dapat meningkatkan hasil sampai pada tanam kedua selanjutnya
menurun untuk tanam ketiga dan keempat. Tambahan kapur susulan/ulangan sampai takaran 10 ton/ha setiap
musim tanam secara terusmenerus berhasil meningkatkan hasil padi hingga mencapai 4,8 ton gabah/ha.
Pemberian kapur susulan/ulangan lebih sangkil dibandingkan secara tunggal dalam jumlah kapur yang sama,
tetapiperbedaanhasilsangatkecil.
Banyak laporan yang menyatakan munculnya gejala kahat P pada tanaman yang dibudidayakan di lahan sulfat
masam. Hal ini sebagaimana dikemukakan diatas, terkait dengan sifat kimia tanah sulfat masam yang tinggi
dalam menyemat (fixation) P, terutama oleh Al3+ , Fe3+ . Hasil penelitian di lahan sulfat masam pada sistem
reklamasi garpu Unit Tatas, Kalimantan Tengah menunjukkan tanggapan P muncul secara jelas pada pemberian
bersaam dengan kapur, teapi pada takaran >2 ton kapur/ha pengaruh pemberian P tidak muncul secara jelas.
Pemberian90kgP 2 O5 /hayangdikombinasikandengan1,50tonkapur/hadapatmeningkatkanhasilpadisebesar
90 % (2,38 ton GKG/ha) dibandingkan dengan kontrol (1,22 ton GKG/ha). Pemberian P saja hanya
meningkatkanhasilpadisebesar25%(1,50tonGKG/ha)dankapursajahanyameningkatkanhasilpadisebesar
60%(2,06tonKG/ha).HasilpenelitiamenunjukkanjugabahwapengaruhresiduPmasihtampaksampaidengan
tanam ketiga (Noor, 1996). Hasil penelitian di lahan sulfat masam pada sistem jaringan tat air Samuda Kedah,
SemenanjungMalaysiamenunjukkanpemberianfosfatalamsetara100kgP 2 O5 /ha yang dikombinasikan dengan
kapur 2 ton/ha dapat meningkatkan hasil padi sebesar 15 % (4,09 GKG/ha) dan tanpa kapur meningkatkan hasil
padihanyasebesar5%(3,76tonGKG/ha)(ArulandodanPheng,1982).
PemberianPdalambentukfosfatalammenunjukkanlebihungguldibandingkandenganbentuksuperfosfat (TSP
atau SP36). Pupuk fosfat alam adalah bahan galian yang sebagian besar mengandung kalsium fosfat yang
disebutapatit(Ca10 (PO4 ) 6 F 2 ) berbentuk serbuk (prill) yang dapat digunakan langsung. Selain kandungan unsur
ikutanyangtinggisepertiCa,Mg,dansebagainya,fosfatalambersifatpelepasPlambat(slowrelease) sehingga
cocok untuk tanahtanah masam. Pengaruh fosfat alam selain tergantung pada mutu dan kadar Pnya, juga sifat
reaksi yang ditimbulkannya. Berdasarkan kuat lemahnya reaksi, fosfat alam dapat dipilah antara yang bereaksi
lemah(soft),sedangdankuat(strong).DalamsimposiuminternasionaltanahsulfatmasamdiBangkok,Thailand
(1982)banyakdikemukakantentangpengaruhpemberianfosfatalamterhadapperubahankimiadanhasilpadidi
lahansulfatmasam.

Bersambungkebagian4yangdapatdilihatpadapustakadibawahini:

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Sulfat


http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

62/76

6/1/2016

Masam

DASARDASARILMUTANAH

(Bagian

4.A)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah

sulfat_4757.html]

PengelolaanKesuburanTanahSulfatMasam
IV.PENGELOLAANKESUBURANPADATANAHSULFATMASAM
A.PengelolaanBahanOrganik
Pengelolaan bahan organik di lahan sulfat masam memegang peranan penting. Walaupun pada umumnya kadar
bahanorganikdilahansulfatmasamcukuptinggi,khususnyayangberasosiasidnegangambut,tetapidibeberapa
tempat kadar bahan organik tanah mengalami kemerosotan karena pembakaran atau terbakar, perombakan
alamiah, terangkut melalui tanaman, dan tererosi/terlindi. Penyiapan lahan dengan membakar umum, tidak saja
dilakukan oleh petani atau peladangyang miskin, tetapi juga oleh perusahaan perkebunan yang bermodal besar
karenadianggapmudahdanlebihmurah.
Bahan organik tidak hanya berperanan dalam memperbaiki fisik tanah, tetapi sekaligus berperan dalam menekan
oksidasi pirit. Dalam konteks tanah sulfat masam, kompos humus (bahan organik) mempunyai fungsi untuk
menurunkan atau mempertahankan suasana reduksi karena dapat mempertahankan kebasahan tanah sehingga
oksidasi pirit dapat ditekan. Penekanan terhadap oksidasi pirit ini penting artinya bagi pertumbuhan tanaman
yang peka terhadap peningkatan kemasaman dan kadar meracun kationkation seperti Al3+ , Fe2+ , Mn2+ , dan
anionanionsepertisulfidadansisasisaasamorganik.
Penyiapan lahan secara konvensional oleh petani petani tradisional dengan sistem tajakpuntalhambur
sebagaimana dkemukakan di atas merupakan kearifan lokal (indigenous knowledge) dalam pengelolaan bahan
organik yang patut dikembangkan. Proses pengomposan praktis diserahkan kepada kebesaran alam dengan
memanfaatkan mikroorganisme perombak anaerob. Hasil analisis kompos dari purun (Eleocharissp.),burabura
(Panicum repens), kerisan (Rhynchospora corymbosa) menunjukkan mengandung ratarata 31,74 % organik
karbon,1,96%N,0,68%P,dan0,64%K(Balittra,2001).
Kadar bahan organik tanah di sulfat masam perlu dipertahankan pada taraf 5 %, terutama pada tipe luapan c
untuk mempertahankan kebasahan tanah dan potensial redoks. Pada lahan sulfat masam yang lapisan atasnya
berupagambutataulahanlahangambutyangdibawahnyaterdapatlapisanpiritkeberadaanlapisanpiritnyaperlu
dipertahankan setebal antara 1525 cm (Noor, 2001). Lahanlahan gambut yang mempunyai lapisan pirit di
bawahnya(sepertijenistanahSulfihemist,danSulfohemist)merupakanlahanyangsangatberbahayadanberesiko
sertasukarpenulihankembaliapabilaterdegradasibiladibandingkanjenislahansulfatmasamsepertiSulfaquent.
Produktivitas dan kesuburan tanah rawa pasang surut berkaitan erat dengan ketebalan lapisan gambut atau kadar
bahanorganiktanah(Notohadiprawiro,1998b).
Bersambungkebagian4.Byangdapatdilihatpadapustakadibawahini:

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

63/76

6/1/2016

DASARDASARILMUTANAH

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Sulfat

Masam

(Bagian

4.B)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah

sulfat_647.html]

PengelolaanKesuburanTanahSulfatMasam*
(Bagian4.Bdari5Tulisan)
B.TeknologiAmeliorasidanPemupukanpadaLahanSulfatMasam
Ameliorasitanahsulfatmasamuntukmemperbaikisifatkimiadanfisiktanahharusdilakukanterlebihdahulusebelum
pemupukan dilaksanakan. Pemupukan tanpa perbaikan tanah tidak akan efisien bahkan tidak respon. Produktivitas
tanah sulfat masam biasanya rendah, disebabkan oleh tingginya kemasaman (pH rendah), kelarutan Fe, Al, dan Mn
serta rendahnya ketersediaan unsur hara terutama P dan K dan kejenuhan basa yang dapat mengganggu pertumbuhan
tanaman (Dent, 1986). Oleh karena itu tanah seperti ini memerlukan bahan pembenah tanah (amelioran) untuk
memperbaikikesuburantanahnyasehinggaproduktivitaslahannyameningkat.Bahanamelioranyangdapatdigunakan
adalahkaptandanRockPhosphate.KaptandigunakanuntukmeningkatkanpHtanahsedangkanRockPhosphateuntuk
memenuhikebutuhanharaPnya.
Beberapafaktoryangperludipertimbangkandalammenetapkankebutuhankapurmenurut(McLean,1982,dalam Al
Jabri, 2002) adalah 1) derajat pelapukan dari tipe bahan induk, 2) kandungan liat, 3) kandungan bahan organik, 4)
bentuk kemasaman, 5) pH tanah awal, 6) penggunaan metode kebutuhan kapur, dan 7) waktu. Penetapan kebutuhan
kapur untuk tanah sulfat masam dapat dilakukan melalui beberapa metode, yaitu : 1) kebutuhan kapur berdasarkan
metode inkubasi, 2) metode titrasi, dan 3) berdasarkan Aldd. Penetapan kebutuhan kapur dengan metode inkubasi
dilakukan dengan mencampurkan kapur dan tanah serta air dalam beberapa dosis kapur selama beberapa waktu
tertentu,biasanyadarisatuminggusampaibeberapaminggu.LalukebutuhankapurditentukanpadanilaipHtertentu.
Menurut Mc. Lean (1982 dalam AlJabri 2002), kelemahan metode ini adalah terjadinya akumulasi garam (Ca, Mg,
dan K) sehubungan dengan aktivitas mikroba sehingga takaran kapurnya lebih tinggi. Penetapan kebutuhan kapur
berdasarkan metode titrasi dengan NaOH 0,05 N untuk mencapai pH tertentu lebih rendah jika dibandingkan dengan
metode inkubasi dan Aldd KCl 1 N, tetapi cara ini lambat tidak sesuai untuk analisis rutin (AlJabri, 2002).
Walaupun kebutuhan kapur dengan metode titrasi lebih rendah, tetapi sebagian besar dari kemasaman tanah tidak
dinetralisir oleh basa. Hal ini disebabkan reaksi antara kationkation asam yang dapat dititrasi berlangsung sangat
lambat. Penetapan kebutuhan kapur berdasarkan Aldd KCl 1,0 N banyak dipertanyakan, sebab tingkat keracunan Al
bervariasi dengan tanaman dan tanah. Karena tingkat keracunan untuk suatu jenis tanaman mempunyai variasi lebar
dalam tanah yang berbeda maka Aldd tidak digunakan sebagai parameter yang menentukan keracunan tetapi
persentasekejenuhannya.
Hasil penelitian di rumah kaca dan lapangan ternyata pemberian dosis kapur berdasarkan titrasi dan inkubasi dapat
diaplikasikanpadatanahsulfatmasampotensialbergambutdiLamuntiex.PLGKalimantanTengah(Suriadikartadan
Sjamsidi,2001),tanahsulfatmasamumumnyaketersediaanharaPdanKrendahnamunbilabahanorganiknyatinggi
makaPdanKbiasanya
tinggipula.PadatanahsulfatmasamaktualkadarPdanKdalamtanahsangatrendahsehinggapemupukanPdanK
sangat diperlukan. Pemupukan P diberikan 100 kg TSP/ha atau 125 kg SP36/ha yang setara dengan 200 kg RP/ha
(Hartatik,1999danSupardietal.,2000).RockPhosphateyangbaikmutunyauntuktanahiniadalahRock Phosphate
Maroko Ground karena mempunyai kandungan Ca yang tinggi yaitu 27,65% dan kadar P2O5 total 28,8%
(SuriadikartadanSjamsidi,2001).Hasilpenelitiandilahanrawamenunjukkanpupukkaliumcukupdiberikan100kg
KCl/hauntuktanamanpadisawah.
Tanah sulfat masam di Pulau Petak sangat respon terhadap pemupukan P baik yang berasal dari TSP maupun dari
Rock Phosphate. Hasil penelitian Manuelpillei et al. (1986) di kebun percobaan Unitatas BARIF pemberian 135 kg
P2O5/ha,1.000kgkaptan/ha,50kgK2O/ha,dan120kgN/hadapatmeningkatkanhasiltanamanpadimenjadi2,45
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

64/76

6/1/2016

DASARDASARILMUTANAH

t/haGKGterjadidelapankalilipatpeningkatanbiladibandingkandengankontrol(tanpaPdanKaptan).Pemberian90
kgP2O5/hadankaptan500kg/hamenghasilkan2,21t/haGKG,hasilinitidakberbedanyatadenganpemberian135
kgP2O5/hadankaptan1.000kg/ha.
Pemberian Rock Phosphate pada tanah sulfat masam juga menunjukkan tidak ada perbedaan yang nyata dengan
penggunaanTSP,halinidisebabkanterjadinyaprosespenyanggaanRockPhophate dalam media yang sangat masam,
menghasilkan bentuk P yang metastabil seperti Dicalsium phophate yang tersedia untuk tanaman. Subiksa et al.
(1999),menunjukkanpemberiandolomit2t/hadanSP36200300kg/hadapatmenghasilkanratarata4,0t/haGKG
padatanahsulfatmasampotensialdiKecamatanTelang,KabupatenMuba,SumateraSelatan.
DalampenelitianpadatanahsulfatmasampotensialdiTabungAnenKalimantanSelatanpemberianpupukP+kalium
+ bahan organik dan kapur masingmasing sebesar 43 kg P/ha, 52 kg K/ha, kapur 1 t/ha dan pupuk kandang 5 t/ha
memberikan hasil 3,24 t/ha GKG, pemberian kapur didasarkan kepada metode inkubasi untuk mencapai pH 5
(Hartatiketal.,1999).SedangkanpemupukanPberdasarkankepadakebutuhanPuntukmencapai0,02ppmPdalam
larutantanah.DiBelawangkebutuhankapurnyalebihtinggiyaitusebesar4t/ha,responpemupukanPdanKtertinggi
dicapaipadaperlakuanPoptimum(100kgP/ha),K78kg/ha,dan4tkapur/ha.Hasilitudapatdipahamikarenatanah
sulfatmasamaktualdiBelawangpiritnyatelahmengalamioksidasisehinggaAlddtinggidanPtersediarendah.Hasil
penelitianpemupukanPdankapurpadatanahsulfatmasampadabeberapalokasipenelitiandisajikanpadaTabel4.3.
PalamyangtelahdicobauntuktanahsulfatmasamdanmemberikanhasilyangsamabaiknyaadalahPalamTunisia,
Ciamis,Christmas,danAljazair.
DiLamunti,exPLGKalimantanTengahPalamsetaradengan150kgP2O5/harataratadapatmemberikanhasil4,5
t/haGKG,tetapikalaudiberikan75kgP2O5/hahasilyangdiperolehhanya3,79t/haGKG,sedangkandiPalingkau
KalimantanTengahdengandosisyangsamadapatmemberikanmasingmasing3,7t/hadan3,4t/haGKG(Supardiet
al., 2000). Pemupukan Palam hingga 60% erapan maksimum P dalam tanah sulfat masam Sumber Agung dan
Sumber Rejo di Pulau Rimau, Sumatera Selatan dapat meningkatkan kadar P tersedia, namun belum dapat
menurunkan kadar unsur beracun Fe2+, FeAl oksida, dan amorf serta sulfat dalam tanah. Unsur beracun diatas
ditemukan dalam jumlah yang lebih tinggi pada tanah sulfat masam potensial yang baru teroksidasi dibandingkan
tanah sulfat masam aktual (Setyorini, 2001). Oleh karena itu diperlukan kehatihatian dalam mereklamasi atau
melakukan pencucian/drainase di tanah sulfat masam potensial, apalagi jika kandungan liat tinggi. Lebih lanjut ia
menyatakanbahwaerapanPmaksimumpadatanahsulfatmasamaktualmencapai2,000gP/gsedangkanpadasulfat
masam potensial sedikit lebih rendah yaitu sekitar 1,666 g P/g. Nilai erapan maksimum yang tinggi pada sulfat
masamaktualdaripadasulfatmasampotensialdiakibatkanperbedaankadardanjenisliat,kadarpirit,pH,AldanFe,
sertabahanorganik.DitinjaudaridistribusibentukPanorganikpadatanahsulfatmasamdiatas,terlihatbahwafraksi
FeP dan AlP mendominasi jumlah P anorganik pada tanah sulfat masam potensial sedangkan fraksi AlP dan CaP
dominanpadasulfatmasamaktual.FaktorfaktoryangmempengaruhiketersediaanPpadatanahsulfatmasamantara
lain pH, Alo, Feo, Ald, Fed, dan pirit. Tingginya kadar Fe dan Al bentuk amorf pada tanah sulfat masam
mempengaruhidistribusifraksiPanorganik(Setyorini,2001).
DarihasilpenelitianKonstendanSarwani(1990),diPulauPetakKalimantanSelatan,diperolehbahwaoksidasipirit
setelahreklamasimembuattanahdidaerahtersebutsangatmasam,dijenuhiolehAldanmempunyaipHantara3dan
4. Adanya garamgaram besi bebas dan Al menyebabkan keracunan tanaman dan defisiensi K dan Ca sangat sering
terjadi. Kemasaman tanah aktual dari tanah sulfat masam di Pulau Petak diduga dengan titrasi cepat pada pH 5,5,
jumlahAlddsampai60mmol/g.KemasamantanahaktualuntuktanahpHkurangdari4adalah20mmol/100gyang
setaradengankeperluankapur15t/ha.Potensikemasamansangattinggidengankandunganpiritmencapai8%.
SelanjutnyaKonstendanSarwani(1990)mengemukakanbahwauntukmengatasikemasamanaktualyangtinggidapat
dilakukan dengan drainase dangkal, pencucian intensif tanah lapisan atas, yang dikombinasikan dengan pemberian
kapurdanpupukkalium.
Bersambungkebagian4.Cyangdapatdilihatpadapustakadibawahini:

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

65/76

6/1/2016

DASARDASARILMUTANAH

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Sulfat

Masam

(Bagian

4.C)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah

sulfat_1517.html]

PengelolaanKesuburanTanahSulfatMasam*
(Bagian4.Cdari5Tulisan)
C.PenggunaanVarietasyangAdaptif
Tanaman yang dapat diusahakan dilahan sulfat masam antara lain tanaman padi, palawija (jagung, kedelai, kacang
tanah, dan kacang hijau), sayuran (cabe, kacang panjang, kubis, tomat, dan terong), buahbuahan (rambutan, nanas,
pisang, jeruk, nangka, dan semangka), dan tanaman industri (kelapa dan lada) (Suwarno et al., 2000). Tanaman
tersebutdapattumbuhbaikbilatanahnyamasihSMPdansistemtataairmikrosepertisalurandrainasedanameliorasi
tanah dilakukan dengan baik sesuai kondisi lahannya. Namun walaupun banyak tanaman pangan, buahbuahan,
sayuran,dantanamanindustridapattumbuhdilahanrawasulfatmasamfaktorpemasamanperludipertimbangkan.
a.Padidanpalawija
Penelitian adaptabilitas tanaman padi sawah telah lama dilakukan di lahan pasang surut khususnya pada tanah sulfat
masam dan pertumbuhan tanaman padi lebih baik pada tanah sulfat masam dibandingkan pada tanah gambut dalam.
Penelitian dimulai sejak sebelum Proyek Swamps sampai berakhir pada Proyek ISDP tahun 2000. Menurut Suwarno
etal.(2000)sampaisaatinitelahdilepassecararesmi11varietasyangcocokdilahanpasangsurut(Tabel4.4).Dari
11varietasdiatasnampaknyayangakancocokuntukdilahansulfatmasamadalahMahakam,Kapuas,Lematang,Sei
Lilin,Banyuasin,Lalan,Batanghari,danDendang.
NamununtuktanahsulfatmasamaktualdimanakadarAldanFesangattinggilebihbaikditanamivarietaslokalyang
telah adaptif seperti varietas Ceko, Jalawara, Talang, Gelombang, dan Bayur. Mengingat kondisi kesuburan tanah
sulfatmasamsangatberagammakapemupukanperludisesuaikandenganhasilanalisistanahnya.
Tanamanpalawijaumumnyaditanamdilahanpekarangansebagaikebuncampurandengantanamanbuahbuahandan
sayuran. Varietas kedelai yang cocok untuk tanah sulfat masam adalah varietas Wilis, Rinjani, Lokon, dan Dempo.
Varietaskedelaitersebutmampumemberikanhasil1,52,4t/ha,kacangtanah3,5t/ha,dankacanghijau1,2t/habiji
kering,danjagungyangsesuaiadalahvarietasArjunadenganhasil34t/habijipipilankering.
b.Sayurandanbuahbuahan
Teknik penggunaan amelioran dan pengelolaan hara terpadu serta penggunaan benih bermutu dengan waktu tanam
yang tepat merupakan persyaratan utama keberhasilan sayuran di lahan rawa (Satsiyati et al., 1999). Namun
keberadaan lokasi pengembangan yang terletak jauh dipedalaman dan tidak didukung oleh infrastruktur dan sarana
menjadihambatanuntukpemasaranhasilsayuran.
Tanaman buahbuahan ditanam di pekarangan pada guludan adalah pisang, nangka, dan rambutan atau jeruk. Tanam
sayuran dan pisang cepat memberikan kontribusi terhadap pendapatan petani terutama pada tahun pertama mereka
tinggal di tempat pemukiman baru. Hasil penelitian Proyek Swamps di lahan pekarangan lahan sulfat masam di
Karang Agung Ulu (1987/1988), komoditas hortikultura mampu memberikan pendapatan lebih besar dari pada
tanamanpangandenganrincian65,4%untuktanamansayurandan34,6%untuktanamanpangan(SubiksadanBasa,
1990).
Jenis sayuran yang telah diteliti pada tanah sulfat masam adalah tomat varietas Ratna dan Intan dengan potensi hasil
masingmasing 18,54 t/ha dan 13,4 t/ha. Petsai yang sesuai hanya ada satu varietas yaitu No. 82157 dengan potensi
hasil15,6t/ha.SelanjutnyabawangmerahvarietasAmpenandanBimadapatberadaptasicukupbaikpadatanahsulfat
masamdenganpotensihasil6,4dan6,15tonumbikering/ha(Sutateretal.,1990).Dosispemupukantanamansayuran
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

66/76

6/1/2016

DASARDASARILMUTANAH

danbuahbuahandisajikanpadaTabel4.6.
c.Tanamanindustri/perkebunan
Hasil penelitian di Sumatera Selatan dan Kalimantan Tengah ex PLG tanaman industri/perkebunan yang dapat
beradaptasidilahansulfatmasamadalahkopi,kelapa,danlada.
a.Kelapa
Tanamankelapamerupakankomoditastanamandilahanpasangsurut,sebagaisentraproduksikelapasebarantanaman
kelapa di Provinsi Riau diperkirakan > 60% (Mahmud, 1990). Jenis kelapa yang sesuai adalah kelapa lokal, yang
dikenalmemilikidayaadaptasidantoleransiterhadaplingkungantumbuhsangatluas.
Tanaman kelapa dapat ditanam tumpangsari dengan tanaman kopi, palawija, dan hortikultura. Namun ada juga yang
ditanam secara monokultur di guludan seperti di Riau. Di Karang Agung Ulu dan Karang Agung Tengah produksi
kelaparatarataberkisar718butir/pohon/periodepetikdan1017butir/pohon/periodepetik.
Pupuk yang diberikan untuk tanaman kelapa masing masing diberikan per pohon, tergantung kepada umur tanaman
(Tabel4.7).PemberianpupukN,P,danKpalingtinggipadaumurtanamankelapa3tahun.
b.Temutemuan
Jenistanamantemutemuandiantaranyajahe,kencur,kunyit,temulawak,lengkuas,danbangledilokasipasangsurut
cukup baik pertumbuhannya dan dapat dikembangkan secara monokultur dan tumpangsari dengan tanaman palawija
atau tanaman tahunan yang tidak terlalu tinggi tingkat naungannya (Anonimous, 1993 dan Anonimous, 1999).
Persyaratan tumbuh tanaman temutemuan menghendaki tanah yang gembur dan subur, pH tanah normal dan tidak
tahan genangan air, sehingga upaya perbaikan tanah meliputi pemberian kaptan, pemupukan, pembuatan saluran
cacing yang intensif, dan penambahan lapisan gambut akan memberikan pertumbuhan dan produksi rimpang yang
optimum.
Temutemuan diharapkan dapat menunjang sistem usahatani di lahan pasang surut yang mempunyai fungsi ganda
dapatdimanfaatkansebagaibumbudandapatdigunakansebagaiobatalternatifbaikuntukmanusiamaupunternak,di
antaranyakunyit,temulawak,jahe,kencur(obatreumatikpegellinu),lempuyang(pegellinu)temuirengdanbangle
(obatcacing),temugiring(obatpanasdanbatuk).
Sebagaicontohuntukternak,jahedapatmencegahgejalatetelo(ND),dantemulawakdapatmenekanberkembangnya
bakteridikotorannya,sehinggabaulimbahdapatditekan.Produksitemutemuancukupbagus,jahemerahdiKarang
Agung Ulu (Anonimous, 1993) dengan pemupukan 45 kg N + 36 kg P2O5 + 50 kg K2O + 200 kg kapur + 1,5 ton
gambut/hektar memberikan hasil 15,523,6 t/ha. Sedangkan untuk jahe putih kecil atau emprit produksi 4,98,5 t/ha
danjaheputihbesarvarietasgajahproduksi4,55,9t/ha.DemikianjugadariKalimantanTengahproduksijaheputih
kecilcukupbaik0,71,0kg/rumpun.ProduksitanamankencurjugacukupbaikdiKarangAgungUludapatmencapai
11,220,1 t/ha, dan dari uji produksi di Kalimantan Tengah juga menunjukkan produksi yang baik yaitu mencapai
200300g/rumpun.
c.Lada
Tanaman lada varietas Petaling I, Petaling II, dan LDK dapat tumbuh dan beradaptasi baik di lahan pasang surut
potensial maupun sulfat masam aktual Karang Agung Ulu. Pada lahan potensial pengapuran dengan takaran 23
kg/tanaman dapat mempengaruhi produksi buah lada sampai panen ke3 (panen pertama 28 bulan). Sedangkan pada
lahansulfatmasam,pembuatansalurancacingdikanandandikiritanamanmemberikanhasiltertinggiyaitu140,300,
dan230gramperpohonmasingmasingpadapanenpertama,kedua,danketiga.
Salurancacinginiditujukanuntukmenjamindrainaseyangbaikagarkelembabantanahtidakberlebihanbagitanaman
lada.Karenaladamemerlukanbahanorganiktinggimakapengembangandilahanbergambuttipislebihsesuaiuntuk
tanamanladaproduktif,pemupukantigakalisetahundenganintervalempatbulansekalidengantakaran512gurea+
880gTSP+600gKCl+60gkiseritperpohonmemberikanhasiltertinggiyaitu1,22kg/pohon(Anonimous,1993).
Tiang panjat seperti lamtoro gung (Leucaena sp.) dan waruwaruan dengan pemangkasan empat kali setahun
memberikanpertumbuhanyangbaikterhadapladadiKarangAgungUluini.

Bersambungkebagian4.Dyangdapatdilihatpadapustakadibawahini:

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

67/76

6/1/2016

Pengelolaan

DASARDASARILMUTANAH

Kesuburan

Tanah

Sulfat

Masam

(Bagian

4.D)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanahsulfat_461.html]

PengelolaanKesuburanTanahSulfatMasam*
(Bagian4.Ddari5Tulisan)

D.PengelolaanTanahdanAir
Pengelolaan tanah dan air (soil and water management) merupakan kunci utama untuk keberhasilan pengembangan
pertanian di lahan rawa pasang surut, termasuk tanah sulfat masam. Pengelolaan tanah dan air ini meliputi jaringan
tataairmakromaupunmikro,penataanlahan,ameliorasi,danpemupukan.
a.Jaringantataairmakro
Pengembanganlahanrawameliputikegiatanreklamasidanpengelolaan.Kegiatanreklamasidimulaidariperencanaan,
penelitiandanpelaksanaandilapangan.Penelitianyangmendukungperencanaanreklamasisangatdiperlukanterutama
penelitian sumberdaya lahan meliputi tanah, air, iklim, dan hidrologi serta aspek lingkungan. Dalam pelaksanaannya
reklamasi mencakup pekerjaan penebangan hutan dan pembakaran, konstruksi jalan, dan pembuatan saluran drainase
(WidjajaAdhi,1995).
SistemreklamasilahanrawadiIndonesiatelahdilakukansejakproyekP4SyangdimulaiawalPelitaIdilahanrawa
pasang surut pantai timur Sumatera, Kalimantan Tengah, dan Kalimantan Selatan serta Kalimantan Barat. Menurut
SubagjodanWidjajaAdhi(1998)selamaPJPItelahditetapkanlimasistemjaringantataairmakro,yaitu:1)sistem
garpu,2)tangga,3)sisirtunggal,4)sisirberpasangan,dan5)kombinasigarpudengansisir.
SelainkelimasistemtersebutUGMtelahmengkombinasikandenganpembuatankolampadaujungsaluranprimeratau
sekunder (Gambar 1) yang disebut dengan sistem kolam. Keuntungan dari sistem kolam ini adalah asamasam atau
racundapatdiendapkandalamkolamtersebuttidakmasukkedalamlahanpertaniandanmemeliharaaliransewaktuair
surut.SistemkolaminitelahdilaksanakandiPulauPetakdanBarabaiKalimantanSelatan.
Sistem jaringan tata air tersebut sebenarnya tidak berlaku umum tetapi tergantung kepada tipologi lahan dan tipe
luapan di daerah itu. Sistem jaringan tata air selain dibedakan menurut bentuknya dapat pula dibedakan menurut
hubungantataair,yaitusistemterbukadansistemtertutup.Sistemreklamasijaringantertutupadalahcarapembukaan
lahan yang jaringan tata airnya tidak berhubungan satu sama lain (zonasi). Sistem ini seperti yang dilakukan oleh
petani Suku Banjar di Kalimantan Selatan dan Kalimantan Tengah dan Suku Bugis di Pulau Sumatera. Pada sistem
tertutupinipembuatansaluranatauhandilsangathatihatidenganmemperhatikankarakteristiktanahdantipeluapan
airsungai.Handilitudibuattegaklurussungaikearahhutanmengikutigariskontursehinggahandilitutidakselalu
lurus dan panjangnya tergantung air pasang masuk (410 km). Cara reklamasi seperti ini umumnya berhasil dalam
meningkatkanproduktivitaslahanrawa,terutamapadi,palawija,dantanamanbuahbuahan.
Berdasarkan hasil penelitian Badan Litbang Pertanian bahwa lahan pasang surut memiliki prospek yang besar untuk
dikembangkan menjadi lahan pertanian terutama dalam kaitannya dalam mendukung program ketahanan pangan dan
agribisnis melalui peningkatan dan diversifikasi produksi, peningkatan pendapatan dan lapangan kerja. Namun untuk
mendukung kearah pengembangan pertanian yang berhasil dan berkesinambungan dilahan pasang surut ada dua hal
pentingyangharusdiperhatikandalamreklamasilahan,yaitupemanfaatanjaringantataairberikutsalurannyadantata
ruanguntukpenataanlahannya(WidjajaAdhidanAlihamsyah,1998).
Selanjutnya dalam pembuatan saluran baik primer, sekunder dan tersier perlu memperhatikan tata letak, dimensi dan
cara pembuatan salurannya disesuaikan dengan fisiografi dan kondisi lahan sehingga menunjang kelestarian dan
produktivitas lahan. Pembuatan saluran harus mengikuti atau memperhatikan garis kontur dan tipologi lahannya.
Salurandenganmempertimbangkangariskonturmakaaliranairdapatmengalirdenganbaik,tinggiairdisaluranrata.
Haliniakansangatberpengaruhdalamprosespencucianbahanbahanberacundarilahankesalurandanseterusnyake
sungai berjalan lancar. Dimensi dan kedalaman saluran perlu dipertimbangkan sehubungan dengan keadaan hidrologi
didaerahtersebut,sebabpenurunanmukaairyangdrastisakanmengakibatkanteroksidasilapisanpirit,besi,Al,dan
sulfatakanmunculkepermukaandandenganadanyaairhujanakanmeningkatkankemasaman(pH)airdisaluran.
Selainitupenurunanpermukaanairyangdrastisjugaakanmenyebabkangambutkeringtakbalik(irrevisible drying)
sehingga akan mempercepat penurunan permukaan gambut (subsidence) dan atau cepat hilangnya lapisan gambut.
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

68/76

6/1/2016

DASARDASARILMUTANAH

Pembuatan tata ruang sebelum saluran dibuat perlu memperhatikan dan mempertimbangkan pola penggunaan lahan
hipotetik yang dikemukakan oleh WidjajaAdhi, (1992). Menurut Harjono, (1995) sedikitnya terbuka lima peluang
fungsidarijaringanpengairanrawa,yaitu1)berfungsisebagaisalurandrainase,2)sebagaipemasukanair,3)sebagai
alattrasportasi,4)berfungsisebagaikonservasisumberdayaairrawa,dan5)sebagaipendukungbagiprosesreklamasi.
Untuk mencapai jaringan tata air ini hendaknya berpegang kepada pola penggunaan lahan dan pola pemanfaatan
sekaligus diharapkan dapat berfungsi sebagai saluran drainase, pemasok air, mendukung proses reklamasi, dan
konservasisumberair.Fungsijaringantataairsebagaialattransportasiperludipertimbangkanpadatahapanmanaini
dapat diberlakukan. Pada tahap saluran primer dan sekunder mungkin fungsi ini dapat diberlakukan, tetapi untuk
tersier sebaiknya tidak dianjurkan. Pembuatan pintu air pada saluran primer atau sekunder seperti dilahan exPLG
sangat tidak efisien karena mengganggu fungsi transportasi masyarakat sekitar sehingga akhirnya dijebol, pengaturan
pintuairsebaiknyamulaidilakukanditingkattersierkebawah.
Dalamrancanganinfrastrukturhidrologi,pengelolaanairdilahanpasangsurutdibedakankedalam:(1)Pengelolaan
airmakro,(2)pengelolaanairmikro,dan(3)pengelolaanairtingkattersieryaitumengkaitkanantarapengelolaanair
makrodanpengelolaanairmikro(WidjajaAdhidanAlihamsyah,1998).Pengelolaanairmakroyaitupenguasaanair
di tingkat kawasan reklamasi yang bertujuan mengelola berfungsinya jaringan drainase/irigasi (navigasi
sekundertersier), kawasan retarder dan sepadan sungai/laut dan saluran intersepsi bila diperlukan serta kawasan
tampunghujan.
Kawasan retarder dimaksudkan untuk mengurangi terjadinya banjir di daerah hulu sungai termasuk mengurangi
kedalamandanlamagenanganairdilahanlebakdangkaldantengahan.Dalamhalini,seyogyanyalebakdalamdapat
dimanfaatkansebagaikawasanretarderdenganjalandiperdalamdanalirannyadiarahkankesungaidibagianhilirnya.
Saluran itersepsi dimaksudkan untuk menampung aliran permukaan dan sebagai tempat memproses air yang
mengandungbahanberacunagartidakmemasukiarealpertanian.Saluraninidibuatdidaerahperbatasanlahankering
danrawamenyerupaiwadukpanjangsertadiarahkanuntukmenyalurkankelebihanairkesungaidibagianhilirnya.
Kawasan tampung hujan dimaksudkan sebagai daerah sumber air untuk irigasi. Kawasan tampung hujan sebaiknya
dialokasikanpadalahangambutdibagianhulusungaikarenagambutmemilikidayamenahandanmelepasairtinggi,
yaituantara300800%bobotnya.
b.TataAirMikro
Sistempengelolaantataairmikroberfungsiuntuk:(1)mencukupikebutuhanevapotranspirasitanaman,(2)mencegah
pertumbuhan tanaman liar pada padi sawah, (3) mencegah terjadinya bahan beracun bagi tanaman melalui
penggelontoran dan pencucian, (4) mengatur tinggi muka air, dan (5) menjaga kualitas air di petakan lahan dan di
saluran. Untuk lebih memperlancar keluar masuknya air pada petakan lahan yang sekaligus memperlancar pencucian
bahan racun, WidjajaAdhi (1995) menganjurkan pembuatan saluran cacing pada petakan lahan dan di sekeliling
petakan lahan. Oleh karena itu, sistem pengelolaan tata air mikro mencakup pengaturan dan pengelolaan tata air di
saluran kuarter dan petakan lahan yang sesuai dengan kebutuhan tanaman dan sekaligus memperlancar pencucian
bahanberacun.
HasilpenelitianSuriadikartaetal.(1999),salurankuarterbiasanyadibuatdisetiapbataspemilikanlahan,sedangkan
didalampetakanlahandibuatsalurancacingdenganinterval312mdandisekelilingpetakanlahantergantungpada
kondisi lahannya. Semakin tinggi tingkat keracunan, semakin rapat pula jarak antar saluran cacing tersebut. Hasil
penelitianSubagyonoetal.(1999)pencucianbahanberacundaripetakanlahandilakukandenganmemasukkanairke
petakan lahan sebelum tanah dibajak, kemudian air tersebut dikeluarkan setelah pengolahan tanah selesai. Usaha
pencucianiniakanberjalanbaikapabilaterdapatcukupairsegar,baikdarihujanmaupundariairpasang.Olehkarena
itu,airdipetakanlahanperludigantisetiapduaminggupadasaatpasangbesar.
Pengelolaanairtingkattersierditujukanuntukmengatursalurantersieragarberfungsi:(1)memasukkanairirigasi,(2)
mengaturtinggimukaairdisalurandansecaratidaklangsungdipetakanlahan,dan(3)mengaturkualitasairdengan
membuangbahanberacunyangterbentukdipetakanlahansertamencegahmasuknyaairasinkepetakanlahan.Sistem
pengelolaanairditingkattersierdanmikrotergantungkepadatipeluapanairpasangdankeracunandipetakanlahan.
Penataan air di lahan petani dapat dilakukan dengan sistem aliran satu arah (oneway flow system) dan sistem aliran
yang sifatnya bolakbalik (twoway flow system). Hal yang perlu mendapat perhatian khusus dalam sistem tata air
adalahsinkronisasiantaratataairmakrodanmikro(Subagyonoetal., 1999). Misalnya, penerapan aliran sistem satu
arah untuk pencucian hanya akan berjalan efektif jika kondisi saluran tersier, sekunder, dan primer semuanya dalam
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

69/76

6/1/2016

DASARDASARILMUTANAH

kondisibaikdanarahalirantidakbolakbalik.
Pada sistem aliran satu arah dirancang saluran irigasi dan saluran drainase secara terpisah. Pintu klep (flapgate)
dipasangberlawananarah.Padasaluranirigasipintuklepmembukakearahdalamsedangpadasalurandrainasepintu
klepmembukakearahluar,sehinggapencucianlahandapatberlangsungdenganefektif.Pencucianlahandimaksudkan
agar unsur yang bersifat racun bagi tanaman seperti Fe2+ , sulfat, dan Al3+ keluar dari lahan usaha dan pH tanah
menjadilebihbaik.
Tata air pada lahan yang bertipe luapan A dan B perlu diatur dalam sistem aliran satu arah (one way flow system),
sedangkan untuk lahan bertipe luapan C dan D, saluran air perlu ditabat/disekat dengan stoplog untuk menjaga
permukaanairtanahagarsesuaidengankebutuhantanamansertamemungkinkanairhujantertampungdalamsaluran
tersebut.Untukkeperluanpengaturantataairiniperludibangunpintupintuyangsesuaisebagaipengendaliair.Pintu
airtersebutdapatberupastoplogmaupunpintuayunataupintuengsel(flapgate).Skestakeduasistemtataairtersebut
dapatdilihatpadaGambar2dan3.
Hasil penelitian pengelolaan tata air mikro dengan cara tersebut pada lahan sulfat masam dengan berbagai sistem
penataan lahan di Karang Agung Ulu oleh Djayusman et al. (1995) menunjukkan adanya peningkatan kualitas lahan
danhasiltanamandarimusimkemusim.Aliransatuarahdikombinasikandenganpengolahantanahmemakaitraktor
tangandanpemberiandolomitpadalahansulfatmasamdalamsatuunittataairsaluransekunder(50ha)olehProyek
ISDP(1997),dapatsecaracepatmeningkatkankualitaslahandanmemberikanhasilyangbaikbagitanamanpadidan
palawija. Nilai pH air tanah meningkat dari ratarata 4,2 pada saat sebelum pengolahan tanah menjadi ratarata 4,8
pada saat penanaman dan 5,4 pada pada saat panen (WidjajaAdhi dan Alihamsyah, 1998). Sedangkan kandungan
Fe++ 160 ppm pada saat tanam dan 72 ppm pada saat panen. Hasil ratarata ubinan padi varietas Cisadane mencapai
6,26t/haGKPsedangkanvarietasCisangarungdapatmencapai9,44t/haGKP.
c.Penataanlahan
Penataan lahan perlu dilakukan untuk membuat lahan tersebut sesuai dengan kebutuhan tanaman yang akan
dikembangkan.Dalammelakukanpenataanlahanperludiperhatikanhubunganantaratipologilahan,tipeluapan,dan
pola pemanfaatannya seperti pada tipologi sulfat masam potensial dengan tipe luapan A, maka penataan lahan
sebaiknyauntuksawah,karenapiritakanlebihstabiltidakmengalamioksidasidantanamanpadidapattumbuhdengan
baik.TetapibilatipeluapanB,makapolapemanfaatanlahandapatdilaksanakandengansistemsurjan.
Sistem surjan dapat digunakan untuk tanaman padi, palawija, sayuran atau buahbuahan. Untuk tanah sulfat masam
potensialpengolahantanahdanpembuatanguludansebaiknyadilakukansecarahatihatidanbertahap.Guludandibuat
secarabertahapdantanahnyadiambildarilapisanatas.Halinidilakukanuntukmenghindarioksidasipirit.
Sistem surjan adalah salah satu contoh usaha penataan lahan untuk melakukan diversifikasi tanaman dilahan rawa.
Lebar guludan 35 m, dan tinggi 0,50,6 m, sedangkan tabukan dibuat dengan lebar 15 m. Setiap ha lahan dapat
dibuat 610 guludan, dan 59 tabukan. Tabukan surjan ditanami padi sawah, sedangkan guludan ditanami dengan
palawija, sayuran, dan tanaman industri (kencur, kopi, dan kelapa). Dari Tabel diatas ditunjukkan bagaimana pola
pemanfaatan lahan dalam kaitannya tipologi lahan dan tipe luapan. Sistem surjan baik dilakukan pada tipe luapan B
dan C sedangkan tipe luapan D lebih baik untuk sistem pertanian lahan kering. Untuk tanah gambut tekstur lapisan
tanahdibawahnyasangatmenentukandalampolapemanfaatanlahannya.

Bersambungkebagian4.Eyangdapatdilihatpadapustakadibawahini:

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

70/76

6/1/2016

DASARDASARILMUTANAH

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Sulfat

Masam

(Bagian

4.E)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah

sulfat_2282.html]

PengelolaanKesuburanTanahSulfatMasam*
(Bagian4.Edari5Posting)

E.PengelolaanLahanSulfatMasamMelaluiAktivitasMikroorganisme
Tanah sulfat masam merupakan tanah yang mengandung senyawa pirit (FeS2), banyak terdapat di daerah rawa, baik
pada pasang surut maupun lebak. Mikroorganisme sangat berperan dalam pembentukan tanah tersebut. Pada kondisi
tergenangsenyawatersebutbersifatstabil,namunbilatelahteroksidasimakaakanmemunculkanproblem,bagitanah,
kualitas kimia perairan dan biotabiota yang berada baik di dalam tanah itu sendiri maupun yang berada di badan
badanair,dimanahasiloksidasitersebuttercucikeperairantersebut.MensvoortdanDent(1998)menyebutkanbahwa
senyawapirittersebutmerupakansumbermasalahpadatanahtersebut.
Dilihat luasan, topografi dan ketersediaan air, lahan tersebut sebenarnya mempunyai potensi untuk pengembangan
tanamanpangandantahunan.DiIndonesia,diperkirakanterdapatsekitar6,7halahanberpirittersebut,yangtersebar
dipulauKalimantan,Sumatera,danIrian(Nugrohoetal.,1992).Topografitermasukkategoridatar(<3%)style="">
air yang bervariasi tergantung tipe luapan air. Sebagian lahan tersebut telah dibuka untuk pemukiman transmigrasi,
dan ditanami padi, palawija dan buahbuahan dengan hasil yang bervariasi, dan umumnya dibawah potensi produksi
tanaman.
Pembukaan lahan pada tanah tersebut selalu dibarengi dengan pembuatan saluran air untuk kepentingan transportasi
dan dranase/irigasi kawasan tersebut. Tapi dalam kenyataannya, pengelolaan air tak terkendali dengan baik.
Permukaan air tanah turun di bawah permukaan lapisan pirit, terutama pada musim kemarau. Akibatnya terjadi
oksidasi senyawa pirit, yang menghasilkan asam sulfat, membuat pH tanah sangat masam. Kemasaman yang rendah
tersebutberdampaknegatifterhadapsifatkimiatanahdanaktivitasmikrobatanah.
Tanahtanahyangsudahteroksidasiini,bilatergenangpadamusimhujan,akanterjadiprosesreduksi.Prosestersebut
meningkatkanpembentukanbesiferrodansulfida,yangdapatmeracunitanamanpadi.
Dilihat dari potensi dan dampaknya, maka tanah tersebut membutuhkan pengelolaan yang tepat dan terintregasi dari
berbagaiaspek.Untukituperludipelajariprosesprosesoksidasidanreduksidarisenyawapirittersebutagardiketahui
caracarapengelolaannyayangsesuai.
Reaksioksidasidanreduksipadatanahtersebutdipengaruhiberbagaiaspek,baikkimia,biologimaupunfisikatanah.
Ditinjau dari aspek biologi, maka kecepatan oksidasi senyawa pirit sangat ditentukan oleh peran dari bakteri
pengoksidasipirityangdisebutThiobacillussp..Sedangkandalamkondisireduksi,pembentukanpiritatauH2S sangat
ditentukan olek aktivtas bakteri pereduksi sulfat Desulfovibro sp. Karena itu dalam pengelolaan tanah sulfat masam
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

71/76

6/1/2016

DASARDASARILMUTANAH

dapat didekati melalui pemanfaatan peranan kedua bakteri tersebut. Namun aktivitas kedua bakteri tersebut
dipengaruhi oleh lingkungannya, karena adanya saling ketergantungan satu sama lain antara bakteri dan
lingkungannya.
Adanya proses oksidasi senyawa pirit dan proses reduksi dari hasil oksidasi tersebut membawa berbagai dampak
negatifbagipertumbuhantanamandanlingkungansekitarnya.Karenaituperludilakukanupayapenanggulanganagar
dampaknegatiftersebutdapatditekanseminimalmungkintanpabanyakmengurangitingkatproduksipadi.
Dalam proses oksidasireduksi pada tanah sulfat masam, terlihat betapa besarnya peran dari mikroorganisma, karena
itupendekatanpengelolaantanahsulfatmasammelaluimikroorganismadapatdidekatimelalui:
1. Mencegah atau memperlambat terjadi proses oksidasi, yaitu mencegah kerja dari bakteri pengoksidasi tersebut,
melalui:
Pemberian bakterisida. Aktivitas bakteri pengoksidasi dapat ditekan melalui pemberian bakterisida yang spesifik.
Hasil pengujian Polford et al. (1988) mendapatkan bahwa bakterisida seperti Panasida (2,2 dyhydrpxy 5,5
dichlorophenylmethane) dan deterjen efektif mencegah kerja bakteri pengoksidasi Thiobacillus ferrooxidans. Selain
itu, berdasarkan hasil penelitian Arkesteyn (1980), pemberian NaN3 dan Nethylmaleimide (NEM) mampu
menghambatoksidasiFe2+danSo.
Mengurangisuplaioksigenmelaluipenggenangan,sehinggakerjabakteripengoksidasiterhambat.MenurutAnonim
(2002b), adanya udara mempercepat oksidasi S yang menyebabkan pH turun kurang dari 1. Kemasaman ini
menyebabkanmasalahpadaorganismelaindanmelarutkanlogamlogamberat,sehinggalahantidaklayakdigunakan
untukpertanian,tetapibergunauntukmenghambatStreptomycesscabiespenyebabpenyakitpadakentang.Wakoet al.
(1984) dan Jaynes et al. (1984 diacu dalam Mensvoort dan Dent 1998) menyebutkan bahwa kondisi optimum untuk
oksidasi pirit sama dengan kondisi optimum untuk oksidasi besi oleh Thiobacillus ferrooxidans yaitu konsentrasi
oksigen > 0,01 Mole fraksi (1%), temperatur 555oC (optimal 30oC), pH 1.55.0 (optimal 3.3). Menurut Anonim
(2002b),bakteritersebutadaptifpadapHrendah(optimumuntukpertumbuhannya23)dengankonsentrasibesiferro
yangtinggi,besitersebutdigunakansebagaidonorelektron,dimanapengaruhpHpadakonsentrasibesidirepleksikan
denganenergiyangdihasilkan.
Pemberian kapur, sehingga pH meningkat diatas 5,0 akibatnya aktivitas bakteri pengoksidasi terhambat, karena
meningkatnyapopulasibakterilainnyayangdapatmenyaingidalampengambilanberbagaikebutuhanhidupnyaseperti
oksigendanlainnya.MenurutMills(2002),terjadisuksesibakteridenganperubahanpHtanah.pHyangcocokuntuk
habitat Thiobacillus ferrooxidans adalah 1,53,5, dengan suhu optimal 3035oC. Pada pH 3,54,5 didominasi oleh
bakteri metalogenium, sedangkan pada pH netral didominasi oleh bakteri Thiobacillus thioparus. Selain itu, adanya
ion Ca yang berasal dari kapur akan menetralkan ion sulfat membentuk gipsum (CaSO4) sehingga menurunkan
aktivitas ion sulfat. Hasil penelitian Arkesteyn (1980) menunjukkan bahwa adanya penambahan kapur mencegah
pemasaman, dimana pada pH dibawah 4,0, oksidasi kimia (tanpa bakteri) lebih rendah dibanding tanah yang diberi
bakteriThiobacillusferrooxidans(oksidasibiologi).IniartinyapadapHdiatas4,0,kemampuanoksidasisecarabiologi
tidak berbeda dengan secara kimia, yaitu berjalan sangat lambat. Pada percobaan tersebut, bakteri pengoksidasi pirit
lainnyasepertiLeptospirillumferrooxidansataugenusMetallogeniumgagaldiisolat.
2.Mempercepat proses reduksi sulfat dan besi, dengan menciptakan kondisi lingkungan yang diperlukan oleh bakteri
tersebut. Hasil reduksi tersebut dikeluarkan dari lahan melalui air drainase saat air surut. Menurut Anonim (2002b),
reduksisulfattersebutdimediaolehorganismeyangdiketahuisecarakolektifsebagaibakteripereduksisulfur(SRB).
SRB merupakan bakteri obligat anaerob yang menggunakan H2 atau organik sebagai donor elektron
(chemolithotrophic). Kelompok organisme pereduksi sulfat ini secara generik diberi nama awal dengan desulfo,
dimana SO42 sebagai aseptor elektron. Menurut Mills (2002) bakteri tersebut berasal dari genus Desulfovibrio dan
Desulfotomaculum yang merupakan organisme heterotrophic, yang menggunakan sulfate, thiosulphate (S2O3) dan
sulfide (SO3) atau ion yang mengandung sulfur tereduksi sebagai terminal aseptor elektron dalam proses
metabolisme. Bakteri tersebut memerlukan subtrat organik yang berasal dari asam organik berantai pendek seperti
asamlaktatatauasampiruvat.Dalamkondisialamiah,asamtersebutdihasilkanolehaktivitasfermentasidaribakteri
anaerob lainnya. Laktat digunakan oleh SRB selama respirasi anaerobik untuk menghasilkan acetat dengan reaksi
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

72/76

6/1/2016

DASARDASARILMUTANAH

berikut:
2CH3CHOHCOO+SO4>2CH3COO+2HCO3+H2S
StersebutbergunauntukmengendapkanCu,Zn,Cdsebagaimetalsulfide.MenurutAnonim(2002a)danGadd(1999),
bakteripereduksisulfatdapatmereduksisulfatpadakondisianaerobmenjadisulfida,selanjutnyadapatmengendapkan
logamlogam toksik sebagai logam sulfida. Menurut Saida (2002), pada percobaan lab dengan media agar, bakteri
tersebut dapat tumbuh sampai pH 2 dan meningkatkan pH media menjadi 6,4. Menurut Beckett et. al. (diacu dalam
Sullivanetal.2002),reduksisulfatkesulfidedalamlingkungananarobikdilakukanolehbakteridanfungi.Beberapa
gas dihasilkan dalam oksidasireduksi sulfur tersebut dan tervolatilisasi ke atmosfer dengan jumlah kurang dari 5%
daritotalresidusulfur.DuagasterpentingadalahSO2danH2S.SO2darilahanbasahbergabungdenganyangberasal
dariindustridapatmembentukformasihujanasam.Padakondisiaerobik,H2Smungkindikonsumsiolehpengoksidasi
S,dimanaSO2diserapsecarakimia.
1.Adanyasenyawapiritmerupakansalahsatupenciritanahsulfatmasamdanmerupakansumbermasalahpadatanah
tersebut.
2. Adanya oksidasi senyawa pirit menyebabkan tanah menjadi masam, basabasa tercuci, kelarutan logamlogam
meningkat,aktivitasmikroorganismatanahdankehidupanbiotaperairanmenjaditerganggu.
3.Prosesoksidasisenyawapiritdanreduksidariionatausenyawayangdihasilkannyaterjadisecarakimiadanbiologi.
4. Kecepatan oksidasi dan reduksi secara kimia berjalan lambat. Adanya bantuan bakteri pengoksidasi atau pereduksi
sebagaikatalisatormempercepatreaksitersebutbeberaparatussampaijutakali.
5.Pengelolaantanahsulfatmasamdapatdilakukanmelaluipengendalianaktivitasmikroorganismayaitumenghambat
aktivitas bakteri pengoksidasi melalaui pemberian bakterisida, pemutusan suplai oksigen melalui penggenangan dan
pemberian kapur agar terjadi suksesi bakteri. Sedangkan pada proses reduksi, perlu dirangsang dengan pemberian
bahanorganiksebagaisumberelektrondanenergisertapenggenanganuntukmemutussuplaioksigensebagaiaseptor
elektron.
Bersambungkebagian5.Fyangdapatdilihatpadapustakadibawahini:

[http://www.blogger.com/blogger.g?blogID=4183298213618451918] Pengelolaan Kesuburan Tanah Sulfat

Masam

(Bagian

4.F)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanah

sulfat_6673.html]

PengelolaanKesuburanTanahSulfatMasam*
(Bagian4.Fdari5Posting)

F.PenyiapandanPengelolaanSurjan
Sistembudidayasurjan(surjan=bahasajawayangartinyaberjajar/berbarisberselangselingsepertilurik)disarankan
khususnya hanya untuk lahan pasang surut tipe B (wilayah yang hanya terluapi pada saat pasang tunggal) dan tipe c
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

73/76

6/1/2016

DASARDASARILMUTANAH

atau D (wilayah yang tidak terluapi pasang sama sekali) yang mempunyai muka air tanah tinggi. Budidaya tanaman
lahan kering (palawija) di lahan pasang surut di aats sering mengalami cekaman kelebihan air, dengan sistem surjan
makakebasahanataugenanganairyangtidakdisukaitanamanlahankeringdapatterhindarkan.
Tujuanpokokdarisistemsurjandilahanpasangsurutiniadalahuntukmembagirisikokegagalanusahatanisehingga
dapat bertahan apabila tanaman padinya gagal (Tim FTP UGM, 1986). Sistem surjan ini banyak diterapkan oleh
petanidiKalimantandanSumatera,terutamapetanitransmigrasidariJawadanBali.Masyarakattanisetempatseperti
di kalimantan tidak banyak mengenal sistem budidaya surjan ini, tetapi mereka menggunakan istilah tembokan yang
falsafahnya sedikit berbeda (Sarwani et al., 1993: 1994). Budidaya surjan ini juga abnyak dilakukan petani rawa
Malaysia(Mensvoort,1996Tri,1996).
Surjan mengandung pengertian meninggikan sebagian tanah dengan menggali atau mengeruk tanah di sekitarnya.
Dalam praktiknya sebagian tanah lapisan atas diambil atau digali dan digunakan untuk meninggikan bidang tanah
disampingnyasecaramemanjangsehinggaterbentuksurjan.Wilayahbagianlahanyangditinggikandisebuttembokan
(raisebeds),sedangwilayahyangdigaliataudibawahdisebuttabukanatauledokan(sunkensbeds).Lahanbagianatas
di tanami tanaman palawija (jagung, kedelai, kacangkacangan, dan umbiumbian), hortikultura, buahbuahan, dan
jugatanamanperkebunan,sedanglahanbagianbawah(ledokan/tabukan)ditanamipadisawah.
Pertanian dengana sistem surjan banyak berkembang di lahan rawa. Berdasarkan cara pengambilan dan penyusunan
lapisan tanah yang dibentuk surjan, surjan dapat dibagi menjadi dua model atau tipe : 1) model tradisional dan 2)
model inovatif dan kreatif. Pada model tradisional lapisan surjan dibuat dengan meletakkan bagian yang digali ke
lapisan atas secara runtut sehingga kemungkinan besar lapisan atas surjan terdiri dari lapisan bawah (subsoil). Pada
modelinovatifdankreatiflapisansurjandisusunsesuaidenganurutanasal.Modeltradisionalsangatberbahayaapabila
lapisanbawahyangdiletakkansebagailapisanatassurjanmerupakanlapisanberkadarpirittinggi.Berdasarkansistem
pembuatan,surjandapatdibagimenjadiduacarapembuatanyaitu:1)dibuatsekaligus,dan2)dibuatsecarabertahap.
Pembuatansurjanbanyakmemerlukantenagakerjayaitusekitar500HOKperhektar.

Bersambungkebagian4.gyangdapatdilihatpadapustakadibawahini:

Pengelolaan

Kesuburan

Tanah

Sulfat

Masam

(Bagian

4.G)

[http://dasar2ilmutanah.blogspot.com/2009/06/pengelolaankesuburantanahsulfat_13.html]

PengelolaanKesuburanTanahSulfatMasam*
http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

74/76

6/1/2016

DASARDASARILMUTANAH

(Bagian4.Gdari5Posting)

G.Perikanan
Penelitiankomponenperikanandalamsistemusahatanidilahanpasangsurutdanrawatelahdilakukansejak1985/86
di Kertamulia Patratani mewakili lahan rawa, Sungai Lempung di Lubuk Lampan mewakili rawa banjiran, lahan
pasang surut di tepi Sungai Musi Mariana, lahan potensial di Karang Agung Ulu, lahan Salin di Delta Upang, dan
lahan lebak di Kayu Agung Sumatera Selatan. Sedangkan di wilayah Kalimantan yang mewakili lahan pasang surut
dan sulfat masam di daerah Parit Keladi dan Palingkau. Sistem usahatani perikanan diartikan sebagai penelitian di
lahan petani (Kasrino et al., 1989 dan Partohardjo, 1989) yang bertujuan untuk meningkatkan produksi, pendapatan,
dan pemanfaatan sumberdaya secara optimal guna meningkatkan kesejahteraan petani. Tujuan tersebut dapat dicapai
melalui penerapan teknologi atau paket teknologi usahatani yang sesuai dengan kondisi biofisik dan sosioekonomi
yangadadidaerah(ManwandanOka,1988).
Penelitian perikanan menunjang program usahatani dibagi atas dua jenis kegiatan yaitu (1) penelitian perikanan yang
bersifat komponen dan (2) penelitian dalam usahatani terpadu. Dalam kegiatan komponen dititik beratkan kepada
perekayasaantataairdanmanajemenkolam,produksibenihikan,kesesuaiankomoditas,dansistembudidaya.Dalam
usahataniterpadu,titikberatdiberikankepadaoptimasipemanfaatanlahandenganberbagaikomoditas.

Penelitianikantelahdilakukandilahanpotensial,lahanlebak,lahanpasangsurutmempunyaipHairyangrelatiflebih
baik 45 dibandingkan dengan lahan sulfat masam dengan hasil produksi yang bervariasi. Jumlah kapur yang
ditambahkanpadalahanpotensial5t/ha,sedangkanpadalahansulfatmasamdosispengapuransekitar10t/ha.Kendala
yang sering dijumpai pada kolamkolam yang dibangun di lahan pasang surut yang berpH air 4 adalah rembesan air
daripematangdanmasuknyaairhujanyangjatuhdaritepipematangkedalamkolam.AirtersebutmenyebabkanpH
air kolam turun mendadak sampai <3 sehingga menyebabkan ikan mati. Jenis ikan yang dipelihara antara lain ikan
patin,tembakang,lele,gurame,dannilamerah.IkantersebutdapatberadaptasidenganperubahanpHairkolamyang
padaumumnyaturundiwaktuhujan.UntukmengatasipenurunanpHdiwaktuhujan,makapembuatankolamharus
dilakukansebagaiberikut:1)lapisanatastanah010cmdikupaskemudianhasiltanahkupasantersebutditempatkan
padalokasiyangaman,2)penggaliankolamdilakukansampaikedalamantertentubiasanyaantara11,2m,3)setelah
penggaliankolamselesailalupembuatangalengankolamdisusunsepertitangga(23tangga)laluguludanituditutup
dengan tanah lapisan atas yang kita simpan itu, 4) pengapuran kolam baru dilaksanakan dengan dosis 510 ton
kaptan/ha. Pada pemeliharaan yang dilakukan polikultur diharapkan ikan dapat memanfaatkan organisme plankton
seperti ikan nila sedangkan organisme yang hidup di dasar kolam diharapkan dapat menjadi makanan ikan patin.
Sedangkanuntukmonokultur,ikandiberitambahanpakanpeletdansisamakanan.

Bersambungkebagian5yangdapatdilihatpadapustakadibawahini:

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

75/76

6/1/2016

DASARDASARILMUTANAH

Diposkan12thDecember2011olehmuhammadbrajarumambe
Label:IlmuTanah
0 Tambahkankomentar

MasukkankomentarAnda...

Berikomentarsebagai:

Publikasikan

GoogleAccount

Pratinjau

http://muhammadbraja.blogspot.co.id/2011/12/dasardasarilmutanah.html

76/76