Anda di halaman 1dari 11

FRAKTUR MANDIBULA

Etiologi dan Insidensi


Fraktur mandibula dapat disebabkan oleh trauma maupun proses patologik.
1. Fraktur traumatik disebabkan oleh :
a. Kecelakaan kendaraan bermotor (50.8%)
b. Terjatuh (22.3%)
c. Kekerasan atau perkelahian (18.8%)
d. Kecelakaan kerja (2.8%)
e. Kecelakaan berolahraga (3.7%)
f. Kecelakaan lainnya (1.6%)
2. Fraktur patologik
Fraktur patologik dapat disebabkan oleh kista, tumor tulang, osteogenesis imperfekta,
osteomieleitis, osteoporosis, atropi atau nekrosis tulang.
Insidensiterjadinya fraktur mandibula berdasarkan lokasinya adalah sebagai berikut :

Klasifikasi
Klasifikasi Berdasarkan Lokasi Anatomi.

1. Dentoalveolar fracture
Setiap fraktur yang terbatas pada area bantalan gigi pada mandibula tanpa adanya gangguan yang
kontinu pada struktur tulang di bawahnya.
2. Symphisis fracture
Setiap fraktur pada area gigi incisive yang berjalan dari prosesus alveolar ke inferior border
mandibula dalam arah vertikal atau hampir vertical.

3. Parasymphisis fracture
Fraktur yang terjadi antara foramen mentalis dan aspek distal dari insicivus lateral mandibular
yang membentang dari prosesus alveolaris ke inferior border.
4. Body (Corpus) fracture
Setiap fraktur yang terjadi di antara foramen mentalis dan bagian distal gigi molar kedua dan
meluas dari prosesus alveolaris ke inferior border.
5. Angle fracture
Setiap fraktur distal ke molar kedua, membentang dari setiap titik pada lengkungan yang dibentuk
oleh persimpangan corpus dan ramus di daerah retromolar ke setiap titik pada lengukngan yang
dibentuk oleh inferior border corpus dan posterior border ramus mandibular.
6. Ascending ramus fracture
Fraktur dimana garis frakturnya meluas secara horizontal diantara batas anterior danbatas
posterior ramus atau yangberjalan secara vertikal dari sigmoid notch ke batas inferior mandibula.
7. Condylar process fracture
fraktur yang berjalan dari sigmoid notch ke batas posterior ramus mandibula sepanjang aspek
superior ramus. fraktur yang melibatkan daerah condylar dapat diklasifikasikan sebagai
ekstrakapsular atau intracapsular, tergantung pada hubungan antara frac-mendatang untuk
lampiran kapsuler.

8. Coronoid process fracture


Fraktur yang berjalan dari sigmoid notch ke batas anterior mandibular sepanjang aspek superior
ramus di area processus koronoid.
Klasifikasi Berdasarkan Pola Fraktur (Fracture Pattern).
1. Simple fracture
fraktur sederhana (simple) terdiri dari garis fraktur tunggal yang tidak tidak berhubungan dengan
eksterior.
2. Compound fracture
fraktur ini berhubungan dengan lingkungan eksternal, biasanya melalui ligamen periodontal gigi,
dan melibatkan semua fraktur soket gigi pada rahang.
3. Greenstick fracture
Jenis fraktur ini sering terjadi pada anak-anak dan melibatkan kehilangan kontinuitas tulang
secara tidak sempurna.
4. Comminuted fracture
Fraktur yang menunjukkan beberapa fragmentasi tulang pada satu area fraktur.
5. Complex/complicated fracture

Fraktur dimana terdapat cedera yang besar pada jaringan lunak yang berdekatan atau
bagian yang berdekatan
6. Telescoped/impacted fracture

7.
8.
9.
10.
11.

Jenis fraktur Ini jarang ditemukan pada mandibula, tetapi menunjukkan bahwa salah satu tulang
secara terpaksa terdorong ke arah yang berlawanan.
Indirect fracture
Direct fraktur muncul berbatasan langsung dengan titik kontak dari trauma, sedangkan indirect
fraktur (tidak langsung) muncul pada titik yang jauh dari area kontak trauma.
Pathologic fracture
fraktur patologis merupakan hasil dari fungsi normal atau trauma minimal pada tulang yang
diperlemah oleh kondisi patologis.
Displaced farcture
Fraktur dapat tidak berpindah (nondisplaced), menyimpang (deviated), atau berpindah
(displaced).
Dislocated fracture
Sebuah dislokasi terjadi ketika kepala kondilus bergerak sedemikian rupa sehingga tidak lagi
berartikulasi dengan fossa glenoid.
Special situation fracture
Jenis fraktur ini merupakan fraktur tidak sesuai dengan klasifikasi-klasifikasi di atas.

Klasifikasi Berdasarkan Ada Tidaknya Gigi. (Menurut Kazanjian Dan Converse)

Kelas I : Gigi terdapat di 2 sisi fraktur, penanganan pada fraktur kelas 1 ini dapat melalui
interdental wiring (memasang kawat pada gigi)
Kelas II : Gigi hanya terdapat di salah satu sisi fraktur.
Kelas III : Tidak terdapat gigi di kedua sisi fraktur, pada keadaan ini dilakukan melalui open
reduction, kemudian dipasangkan plate and screw, atau bisa juga dengan cara intermaxillary

Klasifikasi Berdasarkan Posisi Fraktur.


1. Fraktur Unilateral
Fraktur ini biasanya hanya tunggal.
2. Fraktur Bilateral
Fraktur bilateral sering terjadi dari suatu kombinasi antara kecelakaan langsung dan tidak
langsung.

3. Fraktur Multipel
Gabungan yang sempurna dari kecelakaan langsung dan tidak langsung dapat menimbulkan
terjadinya fraktur multipel.Pada umumnya fraktur ini terjadi karena trauma tepat mengenai titik
tengah dagu yang mengakibatkan fraktur pada simpisis dan kedua kondilus.

Klasifikasi Internasional

Patofisiologi
Ketika patah tulang, akan terjadi kerusakan di korteks, pembuluh darah, sumsum tulang dan
jaringan lunak. Akibat dari hal tersebut adalah terjadi perdarahan, kerusakan tulang dan
jaringan sekitarnya. Keadaan ini menimbulkan hematom pada kanal medulla antara tepi
tulang dibawah periostium dengan jaringan tulang yang mengatasi fraktur. Terjadinya respon
inflamasi akibat sirkulasi jaringan nekrotik adalah ditandai dengan vasodilatasi dari plasma
dan leukosit. Hematom menyebabkan dilatasi kapiler di otot, sehingga meningkatkan tekanan
kapiler, kemudian menstimulasi histamin pada otot yang iskhemik dan menyebabkan protein
plasma hilang dan masuk ke interstitial. Hal ini menyebabkan terjadinya edema, sehingga
mengakibatkan pembuluh darah menyempit dan terjadi penurunan perfusi jaringan

Tandaklinis
1.Perubahan oklusi
Frakturpadagigi, tulang alveolar, trauma TMJ
sertaototpengunyahanbisamenyebabkankelainanoklusiini(Fonseca. 200)
Kelainan Oklusi

Daerah yang diduga mengalami fraktur

Kontakprematurgigi post.

Kondilus atau sudut mandibula (bilateral)

Openbite anterior
Openbite posterior

Prosesus alveolar anterior atau daerah


parasymphyseal

Posterior crossbite

Kondilus dan midline symphyseal dengan


miringnya segmen posterior dari mandibula

Retrognatik

Kondilus dan sudut mandibula

Unilateral openbite

Sudut ipsilateral dan parasymphyseal

Prognatik

Efusi TMJ

2. Anestesia, ParestesiaatauDisestesiaBibirBawah
Hal iniberkaitandengangangguanpadanervus alveolar inferior dimananervusinimelewati
foramen mandibula.Jikabibirbawahmati rasa, mungkinsajaterjadifrakturpadadaerah distal
foramen mandibula(Fonseca. 200)
3. PergerakanMandibula yang Abnormal
Frakturpadadaerahmandibulabisamenimbulkankeabnormalandaripergerakanmandibulasecaras
ignifikan.Keterbatasanpembukaanmulutdantrismusbisamenjaditandadarifrakturmandibula.Hal
inijugaberkaitandengankerjaotot-ototpengunyahan.
Kelainan Pergerakan Mandibula

Daerah yang Kemungkinan Mengalami


Fraktur

Ketidakmampuan membuka rahang

Prosesus koroniod, ramus dan lengkung


zigomatikum

Ketidak mampuan menutup rahang

Prosesus alveolaris, ramus, sudut atau


symphysis

Pergerakan lateral

Kondilus (bilateral), ramus dengan


displacement tulang

4. PerubahanKonturWajahdanLengkungMandibula
Perubahan pada wajah

Daerah yang Kemungkinan Mengalami

Fraktur
Bagian lateral yang lebih datar

Korpus, ramus, sudut mandibula

Retruded chin

Parasymphyseal (bilateral)

Pemanjangan wajah

Subkondilar (bilateral), sudut, korpus


menyebabkan posisi mandibula lebih ke bawah

5. Laserasi, Hematoma, danEchymosis


Arahdantipefrakturbisakitalihatdanperkirakanmelaluilaserasi yang
terjadinamununtuklebihtepatnyabisadenganbantuanpemeriksaanradiografik.Ekimosispadadas
armulutbisamengindikasikanterjadinya trauma
padakorpusmandibuladansymphyseal(Fonseca. 200)
6. Hilangnya Gigi danKrepitasiatauPalpasi
Tenaga yang
kuatbisamenyebabkankehilangangigidantidakmenutupkemungkinanterjadinyafrakturpadatula
ngdibawahnya.Sebagaidoktergigi,
kitaharusmelakukanpalpasipadabagianmandibuladenganmenggunakankeduatangandenganpos
isiibujaripadagigidanjari yang lain berada di batasbawahmandibula,
namundibutuhkanpemeriksaanradiofrafisuntukmemastikanfrakturtersebut.
7. Dolor, Tumor, Rubor, dan Color
Adanyakeempattandaini, merupakantandautamadaritrauma
,padadaerahmandibulameningkatkankemungkinanadanyafrakturpadadaerahtersebut.
8. Kesulitanatauketidakmampuanuntukmengunyah
Pemeriksaanradiologisjugadiperlukanuntukmemperkuatdiagnosa, beberapateknikfoto yang
bisadigunakanpadakasusfrakturmandibulainiantaralain, panoramik, lateral oblique,
posteroanterior, occlusal view,periapikal view, reverse townesdanCT scan (Fonseca. 200)
PemeriksaanRadiologis
Berikutinimacam-macampemeriksaanradiologis yang
dapatmembantudalammendiagnosisfrakturpadamandibular(Fonseca. 200):
a

Panoramic radiograph

Lateral oblique radiograph

Posteroanterior radiograph

Occlusal view

Periapical view

Reverse Townes view

TMJ, termasuk tomograms

CT-high resolution spiral or helical CT

Pemeriksaanradiologis
yang
paling
seringdigunakanuntukmendiagnosisfrakturpada
mandibular
adalahpanoramic
radiograph.Tetapisemuateknikinimempunyaikelebihandankekurangannyamasingmasing.Sehinggadalampenggunaanuntuksetiaptekniknyaharusdisesuaikandengankebutuhan
diagnosis, sertakondisi anamnesis daripasienitusendiri.
Perawatam
Ada dua cara penatalaksanaan fraktur mandibula, yaitu cara tertutup atau konservatif dan
terbuka atau pembedahan.
P
E
D
F
I
R
e
i
m
r
e
f
d
k
o
h
a
r
i
u
s
b
w
g
n
k
a
i
b
a
e
i
s
l
n
t
i
l
a
c
i
s
n
y
f
a
t
a
s
i
t
i
f

1. Reduksitertutup
Reduksitertutupsangatsesuaiuntukpenatalaksanaankebanyakanfraktur
mandibular
dansecaraspesifikdiindikasikanuntukkasusdimanagigiterdapatpadasemuaseg
menatausegmenedentulus di sebelahproksimaldenganpergeseran yang
hanyasedikit.Indikasimetodereduksitertutupadalahsebagaiberikut:
a. Frakturmenguntungkantanpaadanyapergeserantempat
(nondisplace
favorable
fracture)
b. Frakturcomunitted yang luas
c. Frakturpadamandibula yang edentulous
d. Frakturmandibulapadaanak
e. Frakturprocessuscoronoidalis
f. Frakturkondilus

Reduksi tertutup dilakukan dengan teknik-teknik berikut :


1.1Fiksasi
Fiksasimaksilomandibulardilakukandenganmenggunakan
elastic
ataukawatuntukmenghubungkan loop (lug) arch bar ataualatmaksilardan
mandibular
yang
lain.
Apabilasuatusegmenmengalamipergeserancukupbanyak,
makadianjurkanuntukmelakukanimobilisasisegmen
yang
pergeserannyasedikitdahulu,
kemudianmelakukanreduksidanimobilisasisegmen yang lain secara digital
atau manual.

1.2 System Eyelet


Pengawatan langsung yang paling sering digunakan adalah tekni eleyet (Ivy loop).
Pada sistem ini kawat dipilinkan satu sama lain untuk membentuk loop. Kedua ujung
kawat dilewatkan ruang interproksimal, dengan loop tetap disebelah bukal. Satu ujung
dari kawat dilewatkan di sebelah distal dari gigi distal dan kembalinya di bawah atau
melalui loop, sedangakan ujung yang lain ditelusupkan pada celah interproksimal mesial
dari gigi mesial. Akhirnya loopnya dikencangkan dengan jalan memilinnya. Beberapa

eyelet bisa ditempatkan pada gigi posterior untuk mendapatkan tempat perlekatan kawat
atau elastik yang digunakan untuk fiksasi maksilomandibular
1.3Splint
Arch
bar
memberikan
daerah
perlekatan
untuk
fiksasi
maksilomandibular, tetapi secara teknik tidak berfungsi sebagai splint,
karenajarangmemeberikanimobilisasidanstabilisasisegmenfrakturdenganbaik
.
Suatu
splint
merupakanalat
individual
yang
ditujukanuntukimobilisasiataumembantuimobilisasisegmen-segmenfraktur.
Pembuatansuatu
splint
memerlukanbahancetak,
fasilitaslabolatoriumdanwaktu
yang
relatif
lama.Splint
inibiasanyamerupakanlogamtuang (cor), atauterbuatdariakrilik.
1.4Arch Bar
Ada
berbagailengkungan
bar
tersediauntukmencapaifiksasimaksilomandibula.Peralatan
yang
dibutuhkanadalahanestesilokal, Arch bar, 24- 26 gauge wire, dan driver
needle.Langkah yang dilakukan :
1. Pengukuranlengkung
bar.
Bar
biasanyaditempatkanduagigiproksimaldarifraktur
2. Bar ditempatkandarititik distal molar pertamaketitik distal molar pertama di
sisiberlawanan.
3. Kawatadalahpertimbanganberikutnya;
Kawat
24-gauge
dianjurkanuntukkabelcircumdental,
dankawat
26-gauge
digunakanuntukkabelkotak yang menyediakanfiksasimaksilomandibula.
4. Kabelcircumdentalpertamaditempatkanbiasanyapada
premolar
kedua.
Lengkungan bar diukurkemudianditempatkan di loop darikabel.
5. Kabelkemudianmenempatidaerahdarigaristengahke
posterior
untukmenghindarikelebihanlengkungan bar di anterior lengkungan.
6. Adaptasidarilengkungan
bar
untukspasi
interdental
membantumemaksimalkangigikelengkungan
bar
kontakdanmembantumencegahmelonggarnyalengkungan bar.

1.5 Gunning Splint


Frakturedentulusmembawaproblematersendiridalamimobilisasi.Apabilame
mpunyaiprotesagigimakabisadigunakanuntukfiksasimaksilomandibular. Salah
satucaraadalahdenganmembuatlubangpada
basis
akrilik
di
regiointerproksimalgigigigidarigeligitiruandankemudiandilakukanpengawatan arch bar terhadap
basis
protesa.
Apabilapasientidakmemakaigeligitiruan,
makadilakukanpencetakandankemudiandibuatgunning splint yang mirip
basis protesadengan bite plane. Splint dibuatoverclosed, karenadimensi
vertical yang berlebihanseringtidakdapatditolelirdenganbaik. Geligitiruan
yang
digunakansebagai
splint,
atauGunning
splint
seringdilapisidengankondisionerjaringan.

1.6 Pengawatan Sirkummandibular


Geligi tiruan atau splint mandibular sering distabilisasi dengan menggunakan tiga
pengawatan sirkummandibular, satu melingkari mandibula pada regio parasimfis dan dua
pada daerah posterior dari foramen mentale. Kawat-kawat ini diinsersikan dengan jarum
penusuk (awl) atau metode jarum lurus ganda (double straight needle). Awl adalah
sebuah jarum yang dilengkapi dengan pegangan. Pada teknik awl, jarum tersebut

ditusukkan pada kulit (yang sudah dipersiapkan) di bawah mandibula dan muncul pada
dasar mulut. Pada teknik jarum lurus ganda, suatu jarum dilewatkan sebelah lingual dari
mandibula, masuk ke dalam dasar mulut dan kawat ditarik.
1.7 Stabilisasi pada geligi tiruan atas
Geligi tiruan atau splint maksila distabilisasi dengan pengawatan sirkumzigomatik,
dan apabila diperlukan, insersi kawat pada apertura piriformis atau spina nasalis. Kawat
sirkumzigomatik diinsersikan dengan teknik yang serupa dengan pengawatan
sirkummandibular, satu ujung kawat dilewatkan di bawah (medial) arcus zygomaticus
dan satu di atas (lateral). Untuk ini digunakan awl atau teknik double straight needle.
1.8 Fiksasi tulang eksternal
Fiksasi tulang eksternal yang sering dipakai adalah alat fiksasi Bi-phase. Dengan alat
ini, pin-pinnya diinsersikan melalui insisi kutan ke dalam tulang yang sebelumnya
dilubangi dengan bur. Pin dimasukkan melalui korteks bukal dan tulang kanselus dan
sedikit tertanam pada tulang kortikal lingual. Paling tidak dua pin untuk tiap-tiap segmen
fraktur. Kemudian pin-pin tersebut dijembatani dengan bar (dengan menggunakan klem),
dan reduksi diamati dengan sinar-X. Kemudian bar digantikan dengan konektor akrilik,
yang bentuknya disesuaikan, dengan menggunakan peralatan khusus.
1.9 Risdon wiring
Penggunaankawat
Risdon
sangatbermanfaatketikamerawatgigicampuran.Seringkali,
karenaanatomigigipadatahappengembangan,desainlengkungan
bar
konvensionaltidakmemungkinkanuntukfiksasimaksilomandibuladenganbenar.

2. Reduksi Terbuka
Untukmelakukanreduksiterbukapadafrakturmandibulabisamelaluikulitatau
oral.Antibiotikdanperalatan
intraoral
yang
baikmemberikandukungantambahanpadapendekatanperoral.Secarateknis,
setiapdaerahpadamandibuladapatdicapaidandirawatsecaraefektifsecara oral
kecualipadadaerahsubkondilar.
Sebelummelakukanpembedahanpadafrakturmandibula,
tindakpembedahanharusmencakupsudutmulut
di
area
operasiuntukmemantauaktivitassarafwajah.Faktor
yang
digunakanuntukmenetapkanlokasisayatantermasuklokasifraktur,
gariskulit,danposisisaraf.Adapuncakupansudutmuluttersebutyaitu :
1. Submandibular approach
2. Retromandibular approach
3. Preauricular approach
4. Endaural approach
5. Intraoral approach (Simphysis and Parasimphysis)
6. Wire Osteosynthesis

Indikasi metode ini adalah sebagai berikut:


a. Fraktur
yang
tidakmenguntungkan
padasudutmandibula.

(displaced

unfavorable)

b. Fraktur
yang
tidakmenguntungkan
(displaced
padabadanmandibulaataudaerahparasimfisismandibula
c. Terjadinyakegagalanpadametodetertutup
d. Fraktur yang membutuhkantindakan osteotomy (malunion)
e. Fraktur yang membutuhkanbone graft
f. Multiple fraktur

unfavorable)

Reduksi terbuka dilakukan dengan teknik-teknik berikut :


2.1 Reduksi tulang peroral
Reduksi tulang peroral dari fraktur mandibula sering dilakukan untuk mengendalikan
fragmen edentulus proksimal yang bergeser. Situasi ini umumnya berupa fraktur yang
melalui alveolus gigi molar ketiga yang impaksi/ erupsi sebagian. Tindakandilakukan
pada pasiendiberianestesi local atausedasiatauanestesiumum. Arch bar ataualatfiksasi
yang lainpertama-tamadiikatkan pada tempatnya dan suatuflapenvelopemukoperiosteal
yang dimodifikasi (lebih besar dan terletaklebihkearahbukal) dibuatuntuk jalan
masukkedaerah
molar
ketiga.
Molar
ketigadikeluarkan,
biasanya
bisa
dilakukansangatmudahdenganmenggunakanelevator dan distraksi anterior darisegmen
distal. Lubangunikortikaldibuat pada dinding alveolar sebelahbukaldarikeduafrakmen,
dan sebuahkawat baja tahankarat (0,018 atau 0,020 inch, 0,45 atau 0,5 mm)
ditelusupkankedalamnya. Reduksidiakhiridenganmanipulasi manual.
2.2 Reduksi terbuka pada simfisis
Fraktur parasimfisis ini dirawat dengan pengawatan transalveolar pada tepi atas,
apabila gigi di dekat garis fraktur tidak ada. Pada situasi tipikal yang lain, fraktur
parasimfisis yang bergeser distabilisasi pada tepi bawah melalui jalan masuk yang
diperoleh dengan membuka simfisis. Flap dibuat dengan menempatkan insisi 3-4 mm di
bawah pertemuan mukosa bergerak dan tak bergerak. Inisisi submukosal dibuat miring
sedemikian rupa sehingga periosteum diiris di bawah origo m. mentalis. Pemisahan
periosteum dimulai dengan elevator periosteal, dan pengelupasan dilakukan dengan
tekanan digital ke arah inferior.
2.3 Reduksi Terbuka Perkutan
Reduksi terbuka perkutan pada fraktur mandibula diindikasikan apabila reduksi
tertutup atau peroral tidak berhasil, terjadi luka-luka terbuka, atau apabila akan dilakukan
graft tulang seketika. Fraktur subkondilar tertentu dan fraktur yang sudah lama atau yang
mengalami penggabungan yang keliru atau tidak bergabung juga merupakan indikasi
untuk reduksi perkutan terbuka. Pendekatan terbuka biasanya dikombinasikan dengan
fiksasi maksilomandibular untuk mendapatkan stabilisasi maksimum dari segmen
fraktur. Apabila terjadi luka-luka terbuka, jalan masuk langsung ke daerah fraktur bisa
didapatkan hanya dengan sedikit modifikasi.
2.4 Pemasangan pelat tulang
Jika pasien mengalami gangguan mental/ inkompeten, memiliki gangguan konvulsif
yang kurang terkontrol, atau seorang pemabuk atau pecandu obat bius; jika mobilisasi
awal dari mandibula diinginkan agar dapat mengurangi kemungkinan terjadinya
ankilosis (beberapa fraktur subkondilar); dan untuk fraktur edentulous mandibular
tertentu, reduksi dan imobilisasi kaku dengan pelat tulang (Vitalium, titanium) akan
sangat bermanfaat. Teknik ini tidak dipilih untuk kasus kontaminasi yang luas, atau

fraktur kominusi yang lebar, dan jika penutupan primer baik mucosal atau dermal, tidak
bisa dicapai.
2.5 Reduksi Terbuka pada Fraktur Subkondilar
Banyak fraktur subkondilar mandibula bilateral dan kebanyakan fraktur kondilar pada
orang dewasa memerlukan reduksi terbuka. Pada kasus fraktur subkondilar bilateral, baik
segmen yang pergeserannya paling besar, maupun fragmen yang lebih besar bisa
direduksi sendiri-sendiri atau bersama-sama. Fraktur dislokasi yang parah dan tidak
direduksi sering mengakibatkan cacat permanen
2.6 Perawatan yang tertunda
Penatalaksanaan fraktur yang sudah lama, baik yang umurnya sudah lebih dari 14 hari
atau sudah tahunan, membawa masalah tersendiri. Fraktur yang sudah berumur 14 hari
menunjukkan tahap awal penyembuhan, yakni organisasi beku darah dan proliferasi
jaringan granulasi/jaringan ikat. Beberapa fraktur yang sudah lama, menunjukkan adanya
pseudartrosis, yang meliputi perkembangan kapsula fibrus dan tepi fraktur kortikal yang
tidak tervaskularisasi dengan baik serta tereburnasi. Fraktur-fraktur jenis ini, paling baik
dirawat dengan jalan masuk melalui kutan dan reduksi terbuka
2.7 Tindak Lanjut
Perawatan pendukung pasca bedah terdiri atas analgesik, dan bila diindikasikan
ditambah antibiotik, aplikasi dingin dan petunjuk diet. Rontgen pasca reduksi dan pascaimobilisasi perlu dilakukan. Reduksi terbuka bisa memperpendek masa fiksasi
maksilomandibular, dan pembukaan percobaan yang dilakukan pada minggu keempat
atau kelima kadang-kadang dilakukan untuk mengetahui derajat kesembuhan klinis,
terutama pada anak yang masih muda