Anda di halaman 1dari 45

KATA PENGANTAR

Alhamdulillah kami panjatkan puja dan puji syukur kepada Allah SWT Tuhan Yang
MahaEsa, yang telah melimpahkan kasih sayang dan karuniaNya, sehingga kami dapat
menyelesaikan laporan PBL modul 2 sistem kedokteran tropis sebagai salah satu syarat untuk
melengkapi nilai sistem tropis.
Terima Kasih kepada orang tua atas doa dan dukungannya, selalu mendampingi dan
penuh pengertian memberi semangat selama kami mengikuti pendidikan di Program Studi
Pendidikan Dokter, Universitas Muhammadiyah Jakarta.
Terima kasih kami sampaikan kepada semua pihak yang telah membantu kami dalam
menyelesaikan laporan PBL modul 2 sistem kedokteran tropis. Semoga kebaikan dan bantuan
yang diberikan kepada kami mendapat balasan dari Allah Yang Maha Pemurah. Semoga Allah
SWT Tuhan Yang Maha Esa, Maha Pengasih dan Maha Penyayang selalu melimpahkan rahmat
dan karuniaNya kepada kita semua. Amin.

Jakarta, 02 December 2014

Hormat Kami,
Kelompok VI

DAFTAR ISI
KATA PENGANTAR.1
DAFTAR ISI... 2
BAB I PENDAHULUAN........................................................................................................3
1.1 Latar Belakang...................................................................................................................3
1.2 Tujuan Instruksional Umum (TIU)....................................................................................3
1.3 Tujuan Instruksional Khusus (TIK)..................................................................................4
BAB II ANALIS MASALAH................................................................................................5
2.1 skenario.............................................................................................................................5
2.2 kata/kalimat sulit...............................................................................................................5
2.3 kata/kalimat kunci.............................................................................................................5
2.4 Mind Map..........................................................................................................................6
2.5 pertanyaan..6
BAB III PEMBAHASAN..7
1. Jelaskan fungsi kulit !...........................................................................................................7
2. Jelaskan Histologi Jaringan Kulit !.....................................................................................12
3. Jelaskan histopatologi dari efloresensi kulit!......................................................................18
4. Jelaskan Pathomekanisme bercak pada kandidiasis,eritrasma dan tinea kruris!.................25
5. Jelaskan Anamnesis Apa yang Ditanyakan Pada Penyakit dengan Gejala Bercak!...........26
6.
7.
8.
9.

Jelaskan pemeriksaan fisik apa yang ditemukan pada gejala bercak !................................27
Jelaskan Differential Diagnosis dan Working Diagnosis pada scenario !..........................30
Jelaskan pemeriksaan penunjang yang terkait pada scenario !...........................................31
Jelaskan penatalaksanaan pada scenario !..........................................................................32

10. Jelaskan penyakit penyakit yang berkaitan dengan gejala gatal !......................................33
11. Jelaskan pencegahan dari Working Diagnosis !................................................................46
BAB IV PENUTUP................................................................................................................46
3.1 Kesimpulan.......................................................................................................................46
DAFTAR PUSTAKA

BAB I
PENDAHULUAN
1.1 LATAR BELAKANG
Penyakit kulit pada masyarakat dengan standar hidup dan kebersihan yang rendah
cenderung meningkat dan endemis. Tingkat kejadian tinggi biasanya terjadi pada daerah yang
sedang mengalami musim kemarau yang panjang sehingga sulit untuk mendapat pasokan air
bersih. Selain itu juga lingkungan yang kotor dan memiliki sumber air bersih yang sangat
minim contohnya seperti pada daerah pemukiman kumuh dapat memicu tingginya tingkatan
penyakit kulit.
Sumber penularan penyakit kulit adalah berupa sentuhan langsung dengan penderita
melalui perantara seperti melalui pakaian, selimut, sabun mandi yang dipakai oleh penderita.
Penyakit kulit adalah penyakit yang menyerang kulit permukaan tubuh yang disebabkan oleh
berbagai macam penyebab. Penyakit kulit juga mempunyai karakteristik gatal-gatal pada saat
pagi, siang, sore atau sepanjang hari, timbul pula bintik-bintik, bentol-bentol, ataupun timbul
bula-bula yang berisi cairan bening atau nanah pada kulit permukaan tubuh.
Penyakit kulit secara umum disebabkan oleh kebersihan yang kurang dijaga, bakteri,
virus, reaksi alergi dan daya tahan tubuh rendah. Jika penyebab hanya berupa masalah
kebersihan yang kurang dijaga maka masih bisa dilakukan pencegahan dengan merubah gaya
hidup menjadi gaya hidup yang lebih bersih dan sehat.
Penyakit kulit masih menjadi masalah di Indonesia dikarenakan perubahan cuaca yang
tidak menentu dan gaya hidup bersih penduduk yang masih belum terjaga dengan baik
menyebabkan penerita penyakit kulit di Indonesia meningkat setiap tahunnya.
1.2 TUJUAN INSTRUKSIONAL UMUM (TIU)
Setelah selesai mempelajari modul ini mahasiswa diharapkan dapat menjelaskan tentang
penyakit-penyakit tropis yang menyebabkan gejala bercak dan gatal pada kulit, patomekanisme,
gejala klinik, kerusakan jaringan yang diakibatkan, cara diagnosis dan penatalaksanaan,
epidemiologi dari penyakit-penyakit tersebut.

1.3 TUJUAN INSTRUKSIONAL KHUSUS (TIK)


3

Setelah selesai mempelajari modul ini mahasiswa diharapkan dapat menjelaskan:


1.

Penyakit-penyakit tropis dengan gejala bercak dan gatal di kulit

2.

Patomekanisme penyakit-penyakit tropis dengan gejala bercak dan gatal pada kulit:
a) Menggambarkan histologi jaringan kulit
b) Menjelaskan fungsi kulit.
c) Menjelaskan penyebab penyakit infeksi tropis dengan gejala bercak dan gatal di
kulit.
d) Menjelaskan patogenesis penyakit infeksi tropis dengan gejala bercak dan gatal
di kulit
e) Menjelaskan berbagai faktor pencetus dan faktor resiko menderita penyakit
tersebut dikaitkan dengan gejala dan tanda yang ditemukan.

3.

Perubahan histopatologi jaringan kulit yang terjadi sebagai akibat penyakit-penyakit


tersebut.

4.

Gejala dan tanda yang ditemukan pada penyakit-penyakit tropis dengan gejala bercak
dan gatal pada kulit.

5.

Cara pemeriksaan fisik pada kulit dan anamnesis yang diperlukan untuk menegakkan
diagnosis dan diagnosis banding penyakit tropis dengan gejala bercak dan gatal di kulit.

6.

Penatalaksanaan penyakit infeksi

tropis dengan bercak dan gatal

pada kulit

(medikamentosa dan non-medikamentosa)


6.1.

Menjelaskan rencana / analisis penyebab dan faktor penyulit dihubungkan


dengan penatalaksanaan.

6.2.

Menentukan urutan pilihan pengobatan yang dapat diberikan pada penyakit


tersebut.

6.3.

Mengetahui indikasi dan kontraindikasi pengobatan serta cara pemberian


pengobatannya.

6.4.

Mengetahui efek samping dan reaksi tambahan yang mungkin timbul pada
pemakaian obat-obat tersebut.

7.

Penyulit (komplikasi) pada penyakit tropis dengan bercak dan gatal pada kulit.

8.

Epidemiologi (prevalensi, transmisi, pencegahan, cara pengendalian) penyakit tropis


dengan bercak dan gatal pada kulit.

BAB II
ANALISA MASALAH
5

2.1 SKENARIO
Skenario 1
Seorang perempuan, berusia 25 tahun dalam keadaan hamil 5 bulan datang ke Puskesmas
dengan keluhan lipat paha depan terasa sangat gatal sejak 3 hari yang lalu. Pemeriksaan
fisis: tampak adanya plakat kemerahan berbatas tegas dan tepinya dikelilingi vesikel di
daerah inguinal.
2.2 KATA/KALIMAT SULIT
- Plak adalah peninggian di atas permukaan kulit, permukaannya rata dan berisi zat padat
(biasanya infiltrat), diameternya 2 cm atau lebih.
2.3 KATA/KALIMAT KUNCI
-

perempuan, berusia 25 tahun


hamil 5 bulan
keluhan: lipat paha depan terasa sangat gatal sejak 3 hari yang lalu
Pemeriksaan fisis: tampak adanya plakat kemerahan berbatas tegas dan tepinya
dikelilingi vesikel di daerah inguinal.

2.4 MIND MAP


Perempuan 25 tahun
Hamil 5 bulan
Patomekanisme
Penyakit yang
berkaitan

Bercak

Anamnesis

DD

Pemfis

WD

Kulit

Faal

Histologi

Histopatologi

Pem.
Penunjang

Penatalaksana
an

2.5 PERTANYAAN
1. Jelaskan fungsi kulit !
2. Jelaskan histologi jaringan kulit!
3. Jelaskan histopatologi kulit !
4. Jelaskan patomekanisme bercak !
5. Jelaskan anamnesis apa yang ditanyakan pada penyakit dengan gejala bercak !
6. Jelaskan pemeriksaan fisik apa yang ditemukan pada gejala bercak !
7. Jelaskan DD dan WD pada scenario !
8. Jelaskan pemeriksaan penunjang yang terkait pada scenario !
9. Jelaskan penatalaksanaan pada scenario !
10. Penyakit yang berkaitan dengan gejala bercak !
11. Jelaskan pencegahan dari WD !

BAB III
PEMBAHASAN
1. Jelaskan fungsi kulit !
Jawab :
Kulit dapat dengan mudah dilihat dan diraba, hidup, dan menjamin kelangsungan hidup.
Kulit pun menyokong penampilan dan kepribadian seseorang. Dengan demikian kulit pada
manusia mempunyai peranan yang sangat penting, selain fungsi utama yang menjamin
kelangsugan hidup juga mempunyai arti lain yaitu estetik, ras, indicator sistemik, dan sarana
komunikasi non verbal antara individu satu dengan yang lain.
Fungsi utama kulit ialah proteksi, absorbs, ekskresi, persepsi, pengaturan suhu tubuh
(termoregulasi), pembentukan pigmen, pembentukan vitamin D, dan kreatinisasi.
FISIOLOGI
A. Fungsi Proteksi
Kulit menjaga bagian dalam tubuh terhadap gangguan fisis atau mekanis misalnya tekanan,
gesekan, tarikan, gangguan kimiawi, misalnya zat-zat kimia terutama yang bersifat iritan, contoh
nya lisol, karbol, asam dan alkali kuat lainnya. Gangguan yang bersifat panas, misalnya radiasi,
sengatan sinar ultraviolet. Gangguan infeksi luar terutama kuman, bakteri maupun jamur.
Hal diatas dimungkinkan karena adanyta bantalan lemak, tebalnya lapisan kulit dan serabutserabut jaringan penunjang yang berperanan sebagai pelindung terhadap gangguan fisis.
8

Melanosit turut berperan dalam melindungi kulit terhadap pajanan sinar matahari dengan
mengadakan tanning. Proteksi rangsangan kimia dapat terjadi karena sifat stratum korneum yang
impermeable terhadap berbagai zat kimia dan air, di samping itu terdapat lapisan kulit yang
melindungi kontak zat-zat kimia dengan kulit. Lapisan keasaman kulit ini mungkin terbentuk
dari hasil ekskresi deringat dan sebum, keasaman kulit menyebabkan pH kulit berkisar pada pH
5 6,5 sehingga merupakan perlindungan kimiawi terhadap infeksi bakteri maupun jamur.
Proses kreatinisasi juga berperanan sebagai sawar (barrier) mekanis karena sel-sel mati
meepaskan diri secara teratur.
B. Fungsi Absorbsi
Kulit yang sehat tidak mudah menyerap air, larutan dan benda padat, tetapi cairan yang
mudah menguap lebih mudah diserap, begitupun yang larut lemak. Permeabilitas kulit terhadap
oksigen, karbondioksida, dan uap air memungkinkan kulit untuk mengambil bagian pada fungsi
respirasi. Kemampuan absorbsi kulit dipengaruhi oleh tebal tipisnya, hidrasi, kelembapan,
metabolism dan jenis vehikulum. Penyerapan dapat berlangsung melalui celah antara sel,
menembus sel sel epidermis atau melalui u=muara saluran kelenjar. Tetapi lebih banyak yang
melalui sel sel epidermis daripada yang melalui muara kelenjar.
C. Fungsi Ekskresi
Kelenjar-kelenjar kulit mengeluarkan zat zat yang tidak berguna lagi atau sisa metabolism
dalam tubuh berupa NaCL, urea, asam urat, dan ammonia. Kelenjar lemak pada fetus atas
pengaruh hormone androgen dari ibunya memproduksi sebum untuk melindungi kulitnya
terhadap cairan amnion, pada waktu lahir dijumpai sebagai vernix caseosa. Sebum yang di
produksi melindungi kulit karena lapisan sebum ini sekaun meminyaki kulit juga menahan
evaporasi air yang berlebihan sehingga kulit tidak menjadi kering. Produk kelenjar lemak dan
keringat di kulit menyebabkan keasaman kulit pada ph 5 6,5.
D. Fungsi Presepsi
Kulit mengandung ujung ujung saraf sensorik di dermis dan subkutis. Terhadap rangsangan
panas diperankan oleh badan-badan ruffini di dermis dan subkutis. Terhadap dingin diperankan
oleh badan badan Krause yang terletak di dermis. Badan taktil meissner terletak di papilla dermis
berperan terhadap rabaan, demikian pula badan merkel ranvier yang terletak di epidermis.

Sedangkan terhadap tekanan diperankan oleh badan paccini di epidermis. Saraf saraf sensorik
tersebut lebih banyak jumlahnya di daerah yang erotic.
E. Fungsi pengaturan suhu tubuh
Termoregulasi, kulit melakukan peranan ini dengan cara mengeluarkan keringat dan
mengerutkan (kontraksi otot) pembuluh darah kulit. Kulit kaya akan pembuluh darah sehingga
memungkinkan kulit mendapat nutrisi yang cukup baik. Tonus vascular dipengaruhi oleh saraf
simpatis (asetilkolin). Pada bayi biasanya dinding pembuluh darah belum terbentuk sempurna,
sehingga terjadi ekstravasasi cairan, karena itu kulit bayi tampak lebih edematosa karena lebih
banyak mengandung air dan Na.
F. Fungsi pembentukan pigmen
Sel pembentuk pigmen (melanosit), terletak di lapisan basal dan sel ini berasal dari rigi saraf.
Perbandingan jumlah sel basal : melanosit adalah 10 : 1. Jumlah melanosit dan jumlah serta
besarnya butiran pihmen (melanosimes) menentukan warna kulit ras maupun individu. Pada
pulasan H.E. sel ini jernih berbentuk bulat dan merupakan sel dendrit, disebut pula sebagai clear
cell. Melanosome dibentuk oleh alat golgi dengan bantuan enzim tirosinase, ion Cu dan oksigen.
Pajanan terhadap sinar matahri mempengaruhi produksi

melanosom. Pigmen disebar ke

epidermis melalui tanga-tangan dendrit sedangkan ke lapisan kulit dibawah nya dibawa oleh sel
melanofag (melanofor). Warna kulit tidak sepenuhnya dipengaruhi oleh pigmen kulit. Melainkan
juga oleh tebal tipis nya kulit, reduksi Hb, oksi Hb dan karoten.
G. Fungsi kreatinisasi
Lapisanb epidermis dewasa mempunyai 3 jenis sel utama yaitu keratinosit, sel Langerhans,
melanosit. Kreatinosit dimulai dari sel basal mengadakan pembelahan, sel basal yang lain akan
berpindah ke atas dan berubah bentuknya menjadi sel spinosum, makin kea tas sel menjadi
makin gepeng dan bergranula menjadi sel granulosum. Makin lama inti menghilang dan
kreatinosit ini menjadi sel tanduk yang amorf. Proses ini berlangsung terus meneru seumur idup
dan sampai sekarang belum sepenuhnya dimengerti. Matoltsy berpendapat mungkin kreatinosit
melalui proses sintesis dan degradasi menjadi lapisan tanduk. Proses ini berlangsung normal
selama kira kira 14-21 hari, dan memberi perlindungan kulit terhadap infeksi secara mekanis
fisiologik.
10

H. Fungsi pembentukan vitamin D


Dimungkinkan dengan mengubah 7 dihidroksi kolesterol dengan pertolongan sinar matahari.
Tetapi kebutuhan tubuh akan vitamin D tidak cukup hanya dari hal tersebut, sehingga
pemberian vitamin D sistemik masih tetap diperlukan.
Pada manusia kulit dapat pula mengekspresikan emosi karena adanya pembuluh darah,
kelenjar keringat, dan otot otot di bawah kulit.

2. Jelaskan Histologi Jaringan Kulit !


Jawab :
Berat kulit kira-kira 16% berat tubuh total. Kulit meliputi permukaan tubuh dan terdiri atas 2
lapisan utama : epidermis berasal dari ectoderem dan dermis berasal dari mesoderem.
Fungsi kulit :
o Sebagai barrier terhadap organisme penyakit
o Lapisan kulit luar relative impermeable terhadap air, akan mencegah kehilangan air
o
o
o
o
o

berlebihan secara penguapan


Proteksi organ terhadap cidera tubrukan atau gesekan
Pigmen melanin melindungi terhadap sinar ultraviolet
Mengatur suhu tubuh
Sebagai alat ekskresi (berkeringat)
Sebagai organ reseptor untuk melangsungkan komunikasi dengan lingkungan sekitarnya.

Struktur kulit
Berdasarkan tebal tipisnya epidermis :
o Kulit tebal terdapat pada telapak tangan dan telapak kaki yang tidak memiliki folikel
rambut, banyak terdapat glandula sudorifera
o Kulit tipis melapisi hampir seluruh tubuh

11

Epidermis
Dibentuk oleh epitel berlapis gepeng
Lapisan tanduk melindungi permukaan tubuh terhadap abrasi mekanik dan

membentuk sawar fisik terhadap pathogen atau mikroorganisme asing.


Lapisan glikolipid di antara sel-sel stratum granulosum, epidermis juga tidak

permeable terhadap air dan mencegah hilangnya cairan tubuh melalui dehidrasi.
Terdiri dari 4 jenis sel :
Keratinosit : bagian epidermis yang sel-selnya akan mengalami keratinisiasi,

terdiri dari stratum basalis dan stratum spinosum.


o Populasi sel-sel terbesar pada epidermis
o Terus menerus mengalami desquamasi
o Secara tetap diperbaharui dengan mitosis sel-sel basal
Melanocyt : berasal dari crista neuralis. Untuk mensintesa melanin. Terdapat
folikel rambut, glandula sebasea dan kelenjar keringat.
o Tersebar diantara sel-sel pada stratum basale
o Melanosit mensintesis pigmen melanin dari tirosin dengan bantuan enzim
tirosinase di dalam melanosom
o Pigmen melanin berfungsi untuk melindungi kulit dari radisi ultraviolet

menentukan warna kulit


o Sintesis melanin dapat dihambat oleh hidroquinon
Sel Langerhans : berperan dalam respon imun tubuh.
o 3-8% dari populasi sel epidermis
o Terletak pada lapisan atas stratum spinosum
o Merupakan antigen presenting cell
o Fungsi : respon imun tubuh
o Sel ini merupakan makrofag derivate sumsum tulang
Sel merkel : ditemukan banyak di ujung jari, sensitifitas perabaan.
o Ditemukan dalam lapisan basal kulit tebal
o Sel ini berasosiasi dengan terminal saraf sensoris
o Fungsi: mekanoreseptor sensoris

12

A. Stratum Basale :
Bentuk sel kuboid / selapis silindris. Disebut stratum germinativum karena ditemukan
mitosis pada lapisan ini. Disebut stratum pigmentosum karena pada sel-sel stratum
basale ditemukan butir-butir pigmen.
B. Stratum Spinosum
Merupakan lapisan paling tebal dari epidermis. Lapisan ini bersama dengan stratum
basale disebut juga stratum malpighi atau stratum germanitivum karena sel-selnya
menunjukkan adanya mitosis sel. Sel-sel dari stratum basale akan mendorong sel-sel
diatasnya dan berubah menjadi polyhedral.
C. Stratum Granulosum
Lapisan ini terdiri atas 2-4 lapis sel. Bentuk sel seperti ketupat yang memanjang
sejajar permukaan. Di dalam sitoplasma terdapat granula basofilik yaitu butir-butir
keratohyalin yang mengandung protein histidin berfosfor dan protein yang
mengandung sistin. Granula lamella melepaskan glikolipid yang berfungsi sebagai
barrier terhadap penetrasi benda asing
D. Stratum Lucidum
Tampak sebagai garis tipis bergelombang, homogen dan bening. Organela dan inti
tidak tampak lagi. Sitoplasma mengandung filament keratin padat dan eleidin yang
merupakan hasil antara dari keratohyalin.
E. Stratum Corneum
Disini eleidin berubah jadi keratin. Terdiri dari beberapa lapis sel mati dan terjadi
pengelupasan kulit yang akan diganti dengan sel-sel baru.
Pada epidermis terdapat 4 proses yang disebut cytomorphosis yaitu (1) mitosis dari
sel-sel bagian dalam, (2) sel-sel akan terdesak kerah permukaan, (3) sel-sel
dipermukaan berubah menjadi keratin, (4) sel-sel akan mati dan desquamasi dari
lapisan keratin. Proses ini selama 15-30 hari.

13

Dermis

Lapisan tebal, terdiri dari jaringan ikat yang epidermis


Folikel rambut, kelenjar keringat dan kelenjar sebasea
Lapisan superfisial di demis, Terbagi menjadi 2 lapisan :
a. Stratum Papilare
Kaya vaskularisasi yang memberi nutrisi pada epidermis. Pada lamina basalis terdapat
jaringan pengikat longgar yang mengandung serat kolagen halus, serabut elastin, mast
cell dan makrofag.
b. Stratum Retikulare
Terdiri atas serabut kolagen kasar, banyak anastomosis arterivenosus yang akan
membantu pengaturan suhu tubuh.

Hipodermis

Lapisan subkutis (sel subcutanea)


Terdiri dari jaringan ikat dan jaringan adipose yang membentuk fasia superfisial yang
tampak secara anatomis

TURUNAN DERIVAT SPESIFIK.


1. Rambut

14

Struktur tipis dan bertanduk berasal dari invaginasi epidermis kulit yang membentuk akar
rambut atau folikel rambut yang berlikasi pada dermis
2. Kuku

Lempeng yang mengalami penandukan dan terdapat pada permukaan dorsal ujung-ujung
jari.
3. Kelenjar Sudorifera

Kelenjar ini berfungsi mengeluarkan keringat melalui saluran keringat yang

bermuara di pori-pori kulit.


Kelenjar tubeler simpleks bergelung.
Pars sekresi dan ekskresi

4. Kelenjar Sebacea

15

Kelenjar minyak berfungsi menghasilkan minyak (sebum). Minyak yang

dikeluarkan berfungsi untuk melumasi kulit dan membuat rambut tidak kering.
Bermuara pada bagian atas dari folikel rambut

3. Jelaskan histopatologi dari efloresensi kulit!


Jawab :
Ada 2 jenis ruam kulit:
1. Ruam kulit primer
Makula: lesi kulit datar, fokal dan berwarna. Efloresensi yang hanya berupa
perubahan warna kulit tanpa perubahan bentuk, eperti pada tinea versikolor,
morbus Hansen

16

Eritema: macula yang berwarna merah, seperti pada dermatitis, lupus


eritematosus

Papula: lesi yang sedikit meninggi. Penonjolan padat diatas permukaan kulit,
bebatas tegas, berukuran <1cm

Nodula: sama seperti papula tetapi diameternya >1cm, misalnya pada prurigo
nodularis

Vesikula: gelembung yang berisis cairan serosa dengan diameter <1cm, misalnya
pada varisela, herpes zozter
17

Bula: vesikel dengan diameter >1cm, missal pada pemfigus, luka bakae. Jika
vesikel/ bula berisi darah disebu vesikel/bula hemoregik. Jika bula berisis nanah
disebut bula purulent

Pustula: vesikel berisi nanah, seperti pada variola, varisela, psoriasis, pustulosa

Urtika: penonjolan diatas permukaan kuliat akibat edema setempat dan dapat
hilang perlahan-lahan, misalnya pada dermatitis medikamentosa, da gigitan
serangga

18

Tumor: penonjolan diatas permukaan kuliat berdasarkan pertumbuhan sel


maupun jaringan tumbuh

Kista: penonjolan diatas permukaan kuliat berupa kantong yang berisis cairan
serosa atau padat atau setengah padat, seperti pada kista epidermoid

2. Ruam kulit sekunder


Skuama: pelepasan lapisan tanduk dari permukaan kulit. Dapat berupa sisik halus
(TV), sedang (dermatitis), atau kasar (psoriasis). Skuama dapat berwarna putih
(psoriasis), coklat (TV), atau seperti sisik ikan (iktiosis)

Krusta: onggokan cairan darah, kotoran, nanah dan obat yang sudah mongering
diatas permukaan kulit, misalnya impetigo krustosa, dermantitis kontak. Krusta
dapat berwarna hitam (pada jaringan nekrosis), merah (asal darah) atau coklat
(asal darah, nanh, serum)

19

Erosi: kerusakan kulit sampai stratum spinosum. Kulit tampak menjadi merah dan
keluar cairan serosa, misalnya paa dermatitis kontak

Ekskoriasi: kerusakan kulit sampai ujung stratum papilarisehingga kulit tampak


merah disertai bintik-bintik perdarahan. Ditemukan pada dermatitis kontak dan

ektima
Ulkus: kerusakan kulit (epidermis dan dermis) yang memiliki dasar, dinding, tepi
dan isi. Missal ulkus tropikum, ulkus dorum

Rhagaden: belahan-belahan kulit dengan dasar yang sangat kecil/dalam missal

pada keratoskisis, keratodermia


Parut (sikatriks): jaringan ikat yang menggantikan epidermis dan dermis yang
sudah hilang. Jaringan ikat ini dapat lebih cekung dari kulit sekitarnya (sikatriks
atrofi), dapat lebih menonjol (sikatriks hipertrofi) dan dapat normal (eutrofi/luka
sayat). Sikatriks tampak licin, garis kulit dan adneksa hilang

Keloid: hipertrofi yang pertumbuhannya melampaui batas

20

Abses: efloresensi sekunder berupa kantong berisi nanah dalam jaringan.

Misalnya abses Bartholini dan abses banal


Likenifikasi: penebalan kulit sehingga garis-garis lipatan/rilef kulit tampak lebih

jelas, seperti pada prurigo, neorodermatitis


Guma: kerusakan kulit yang dekstrutif, kronik dengan penyebaran serpiginosa.

Missal pada sifilis gumosa


Hiperpigmentasi: penimbunan pigmen berlebihan sehingga kulit tampak lebih

hitam dari sekitarnya. Misal pada melasma dan pascainflamasi


Hipopigmentasi: penimbunan pigmen berlebihan sehingga kulit tampak lebih
putih dari sekitarnya. Missal pada skeloderma dan vitiligo

Ada beberapa efloresensi khusus yaitu:


Kanalikuli: ruam kulit berupa saluran-saluran pada stratum korneum yang timbul

sejajar dengan permukaan kulit, seperti yang terdapat pada scabies


Milia (=white head): penonjolan diatas permukaan kulit yang berwarna putih
yang ditimbulkan oleh penyumbatan saluran kelenjar sebasea, seperti pada akne

sitiska
Komedo (=blak head): ruam kulit berupa bintik-bintik hitam yang timbul akibat
proses oksidasi udara terhadap sekresi kelenjar sebasea dipermukaan kulit, seperti

pada akne
Eksantema: ruam permukaan kulit yang timbul serentak dalam waktu singkat dan

tidak berlangsung lama, biasanya didahului demam, seperti pada demam berdarah
Roseola: eksantema lentikuler berwarna merah tembaga seperti pada sifilis dan

frambusia
Purpura: perdarahan didalam/dibawah kulit yang tampak kemerahan dan tidak
hilang pada penekanan kulit, seperti pada dermatitis medikamentosa

Sifat-sifat Efloresensi:
21

1. Ukuran: Miliar (sebesar kepala jarum pentul); lenticular (sebesar kacang hijau-jagung);
nummular (sebesar uang logam seratus rupiah); dan plakat (>dari uang logam 100 rupiah)
2. Gambaran: linear seperti garis lurus; sirsinar/anular jika melingkar; arsinar menyerupai
bulan sabit; polisiklis, menyerupai bunga; korimbiformis, jika efloresensi besar
efloresensi kecil (hen and chickenconfiguration)
3. Bentuk: bundar (impetigo); lonjong (pitiriasis rosea); serpiginosa (sifilis stadium III);
herpetiformis, menyerupai dermatitis herpetiformis; dan konfluen, jika beberapa
efloresensi bergabung menjadi satu efloresensi besar (variola); iris formis, menyerupai
iris (bentuk bulat/lonjong, pada bagian tengah tampak putih/hitam), pada eritema
multiforme
4. Lokalisasi/penyebaran:
- Solitar, jika hanya satu lesi (ulkus durum)
- Multiple, jika lesi banyak (varisela)
- Regional, menyerang satu region; pada prurigo, urtikaria
- Diskrit, lesi-lesi terpisah satu dengan yang lain; pada ektima
- Simetris, mengenai kedua belahan badan yang sama; pada dermatitis medikamentosa
- Bilateral, menyerang kedua belahan badan seperti varisela, variola
- Unilateral, menyeranh separuh badan seperti pada herpes zoester
- Generalisata, jika seluruh/hampir seluruh tubuh terkena seperti pada eritroderma

4.Jelaskan Pathomekanisme bercak pada kandidiasis,eritrasma dan tinea kruris!


22

Jawab :
kandidiasis
Infeksi diawali dengan inhalasi sel ragi, yang di alam bersifat kering, terkapsulisasi minimal,
dan menjadi aeroso. Infeksi paru primer dapat asimtomatis atau menyerupai infeksi pernafasan
mirip influenza dan sering kali sembuh spontan.pada pasien imunnya menurun ragi ini dapat
memperbanyak diri menyebar kebagian tubuh lain biasa menyebar ke kulit yang menyebabkan
bercak merah .
Eritrasma
Awalnyakulit terpapar jamur, lesi kulit yang dilanjutkan kulit berwarna merah muda ditutupi
dengan sisik halus dan kerutan. Kemudian pink untuk warna memudar merah dan daerah yang
terkena menjadi coklat dan bersisik.
Tinea krunis
Kulit terkena paparan jamur,akan terjadi adhesi pada kulit di lanjutakan dengan adanya
germinasi dan penetrasi stratum korneum lalu terjadi sekresi keratinase,proteinase,mucinolitik
dan terjadi bercak kemeran pada pangkal paha.

5. Jelaskan Anamnesis Apa yang Ditanyakan Pada Penyakit dengan Gejala Bercak!
23

Jawab :
1) Tanyakanlah kapan kelainan kulit tersebut mulai muncul, apakah hilang timbul, menetap,
dimana lokasi awalnya dan kemudian muncul dimana.
2) Tanyakanlah apakah disertai demam atau tidak.
3) Tanyakanlah apakah disertai gatal atau tidak.
4) Tanyakanlah apakah bercak kulit ini ada hubungannya dengan gigitan serangga atau luka
(trauma).
5) Tanyakanlah apakah bercak kulit ini disertai kram atau nyeri. Jika ada tanyakan lah:
a. Kapan mulai terjadi hal tersebut, apakah terjadi mendadak atau tidak.
b. Sifat nyeri atau kram: ringan, sedang, berat; intermitten atau terus-menerus; lebih
tinggi pada pagi, sore atau malam hari; serangan dengan interval tertentu; hanya
pada satu tempay atau terasa seperti semut bergerak.
c. Apakah ada sakit tulang-tulang, artalgia, myalgia, anoreksia dan malaise.
d. Nyeri tekan pada lengan dan atau kaki.
e. Luka di telapak tangan atau kaki.
6) Tanyakanlah apakah pernah pasien pernah mengalami keluhan yang sama pada masa lalu.
7) Tanyakanlah riwayat penyakit yang sama dalam lingkup keluarga atau lingkungan sekitar
tempat tinggal.
8) Tanyakanlah riwayat kontak dengan penderita penyakit dengan gejala yang sama.
9) Tanyakanlah riwayat pengobatan yang pernah diterima dari dokter dan obat yangj dibeli
sendiri oleh pasien tanpa resep dokter.

6. Jelaskan pemeriksaan fisik apa yang ditemukan pada gejala bercak !


Jawab :
Penilaian status pasien secara umum dan tanda vital

Lihat dan catatlah keadaan umum pasien: sakit ringan, sakit sedang atau sakit berat.
Tentukanlah status gizi : ukur tinggi dan berat badan (sesuai panduan penentuan status

gizi).
Ukur dan menilailah tanda vital pasien: tekanan darah, denyut nadi, pernapasan dan suhu.
24

Perhatikanlah seluruh tubuh penderita dari ubun-ubun sampai kaki:


-

apakah ada penipisan rambut kepala dan alis.

apakah ada lagophthalmia pada kelopak mata.

apakah hidung pasien merosot (saddle nose).

didaerah mana bercak yang dimaksud berada

Periksa ada tidaknya pembesaran hati, edema kaki, luka pada kaki

Pemeriksaan bercak kulit

Dimana letak bercak tersebut


Bila seluruh permukaan lesi rata, perhatikan apakah permukaan

dan ada tidaknya rambut halus.


Perhatikanlah jenis effloresensi: eritema, hipopigmentasi, hiperpigmentasi,nodul vesikel,

bulla, makula papula, skuama, urtika, ulkus, krusta


Tekstur : kulit kasar atau halus
Mobilisasi dan turgor : kulit mudah diangkat atau sulit, kecepatan kulit untuk kembali ke

kulit kering atau basah,

keadaan semula atau tidak.


Uji sensitivitas

Dengan ujung kapas


Minta pasien melihat kearah lain dan lakukan sentuhan dengan kapas mula-mula pada
daerah normal, lalu di daerah bercak secara berganti-ganti. Tanyakan apakah pasien
merasakan sentuhan tersebut

Dengan ujung jarum


Lakukanlah tes yang sama dengan menggunakan tusukan ringan jarum steril. Tutuplah
mata pasien dan lakukan tusukan ringan mula-mula pada daerah normal, lalu di daerah
bercak secara berganti-ganti.

Dengan tabung panas dan dingin


Lakukanlah tes yang sama dengan menggunakan dua tabung yang masing-masing
berisi air dingin dan air hangat. Tutuplah mata pasien dan tempelkanlah berganti-ganti
kedua tabung tadi mula-mula pada daerah normal, lalu di daerah bercak secara bergantiganti.
25

Pemeriksaan saraf tepi

N. Auricularis magnum
N. Radialis
N.Medianus
N. Ulnaris
N. Peroneus Communis (N. Poplitea lateralis)

Pemeriksaan gangguan fungsi saraf


-

Periksalah kelopak mata pasien untuk melihat adanya gangguan motorik dari N. Fasialis

Periksalah kaki untuk melihat adanya gangguan motorik dan sensoris.

26

7. Jelaskan Differential Diagnosis dan Working Diagnosis pada scenario !


Jawab :
GEJALA

TINEA KRURIS

ERITRASMA

KANDIDIASIS
INTERTRIGINOSA

Gatal

hebat

pada +

lipatan paha
Adanya plakat merah

Berbatas tegas

Vesikel

Berdasarkan pada tabel diatas kelompok kami menyimpulkan bahwa working diagnosis pada
skenario adalah Tinea Kruris,karena pada Tinea Kruris terdapat rasa gatal yang hebat khususnya
di lipatan paha, adanya plakat merah yang berbatas tegas dan terdapat vesikel di tepi derah
inguinal.

27

8. Jelaskan pemeriksaan penunjang yang terkait pada scenario !


Jawab :
Pemeriksaanpenunjang
1.

Pemeriksaan Langsung
Sediaan dari bahan kerokan (kulit, rambut dan kuku) dengan larutan KOH 10-30% atau
pewamaan Gram. Dengan pemeriksaan mikroskopis akan terlihat elemen jamur dalam bentuk
hipa panjang, spora dan artrospora.

2.

Pembiakan
Tujuan pemeriksaan cara ini untuk mengetahui spesies jamur penyebab, dilakukan bila
perlu. Bahan sediaan kerokan ditanam dalam agar Sabouroud dekstrose; untuk mencegah
pertumbuhan bakteri dapat ditambahkan antibiotika (misalnya khloramfenikol) ke dalam
media tersebut. Perbenihan dieramkan pads suhu 24 - 30C. Pembacaan dilakukan dalam waktu
1 - 3 minggu. Koloni yang tumbuhdiperhatikan mengenai wama, bentuk, permukaan dan ada
atautidaknya hifa.

3.

Darah dan Urin


Kira-kira 70 % hingga 80% pasien dermatitis atopik mempunyai serum IgE yang meningkat.
Kondisi ini beruhubung dengan sensitisasi alergen makanan atau alergen hirup dan/atau yang
disebabkan oleh rhinitis alergi dan asma. Kadar eosinofildalamdarahperifernyameningkat.
Limfosit T dang sel mast meningkatkarena dermatitis atopic melibatkan perangsangan berlebihan
limfosit T dansel mast.

28

9. Jelaskan penatalaksanaan pada scenario !


Jawab :
Pada infeksi tinea cruris tanpa komplikasi biasanya dapat dipakai anti jamur topikal saja dari
golongan imidazole dan allynamin yang tersedia dalam beberapa formulasi. Semuanya
memberikan keberhasilan terapi yang tinggi 70-100% dan jarang ditemukan efek samping. Obat
ini digunakan pagi dan sore hari kira-kira 2-4 minggu. Terapi dioleskan sampai 3 cm diluar batas
lesi, dan diteruskan sekurang-kurangnya 2 minggu setelah lesi menyembuh. Terapi sistemik
dapat diberikan jika terdapat kegagalan dengan terapi topikal, intoleransi dengan terapi topikal.
Sebelum memilih obat sistemik hendaknya cek terlebih dahulu interaksi obat-obatan tersebut.
Diperlukan juga monitoring terhadap fungsi hepar apabila terapi sistemik diberikan lebih dari 4
mingggu.
Pengobatan anti jamur untuk Tinea cruris dapat digolongkan dalam empat golongan yaitu:
golongan azole, golongan alynamin, benzilamin dan golongan lainnya seperti siklopiros,
tolnaftan, haloprogin. Golongan azole ini akan menghambat enzim lanosterol 14 alpha
demetylase (sebuah enzim yang berfungsi mengubah lanosterol ke ergosterol), dimana struktur
tersebut merupakan komponen penting dalam dinding sel jamur. Golongan Alynamin
menghambat kerja dari squalen epokside yang merupakan enzim yang mengubah squalene ke
ergosterol yang berakibat akumulasi toksik squalene didalam sel dan menyebabkan kematian sel.
Dengan penghambatan enzim-enzim tersebut mengakibatkan kerusakan membran sel sehingga
ergosterol tidak terbentuk. Golongan benzilamin mekanisme kerjanya diperkirakan sama dengan
golongan alynamin sedangkan golongan lainnya sama dengan golongan azole.

29

10. Jelaskan penyakit penyakit yang berkaitan dengan gejala gatal !


Jawab :

I.

A. Tinea Kruris
Definisi

Tinea kruris adalah penyakit dermatofitosis (penyakit pada jaringan yang mengandung zat
tanduk) yang disebabkan infeksi golongan jamur dermatofita pada daerah kruris (sela paha,
perineum, perianal, gluteus, pubis) dan dapat meluas ke daerah sekitarnya.
Berikut ini adalah gambar predileksi terjadinya Tinea kruris :

Gambar 1. Predileksi Tinea Kruris


II.

Epidemiologi

pria lebih sering terkena Tinea kruris daripada wanita dengan perbandingan 3 berbanding 1, dan
kebanyakan terjadi pada golongan umur dewasa daripada golongan umur anak-anak.
III.

Etiologi dan Patogenesis

Tinea kruris disebabkan oleh infeksi jamur golongan dermatofita. Dermatofita adalah golongan
jamur yang menyebabkan dermatofitosis. Golongan jamur ini mempunyai sifat mencernakan
30

keratin
sifat keratofilik masih banyak sifat yang sama di antara dermatofita, misalnya sifat faali,
taksonomis, antigenik, kebutuhan zat makanan untuk pertumbuhannya, dan penyebab penyakit.
Jamur ini mudah hidup pada medium dengan variasi pH yang luas. Jamur ini dapat hidup sebagai
saprofit tanpa menyebabkan suatu kelainan apapun di dalam berbagai organ manusia atau hewan.
Pada keadaan tertentu sifat jamur dapat berubah menjadi patogen dan menyebabkan penyakit
bahkan ada yang berakhir fatal.
Beberapa jamur hanya menyerang manusia (antropofilik), dan yang lainnya terutama menyerang
hewan (zoofilik) walau kadang-kadang bisa menyerang manusia. Apabila jamur hewan
menimbulkan lesi kulit pada manusia, keberadaan jamur tersebut sering menyebabkan terjadinya
suatu reaksi inflamasi yang hebat. Penularan biasanya terjadi karena adanya kontak dengan
debris keratin yang mengandung hifa jamur
IV.

Gejala Klinis

gambaran klinis Tinea kruris khas, penderita merasa gatal hebat pada daerah kruris. Ruam kulit
berbatas tegas, eritematosa, dan bersisik. Bila penyakit ini menjadi menahun, dapat berupa
bercak hitam disertai sedikit sisik. Erosi dan keluarnya cairan biasanya akibat garukan.
Berikut ini gambaran klinis dari Tinea kruris :

31

Gambar2. Regio Inguinal Meluas ke Pubis


V.

Komplikasi

Pada penderita Tinea kruris dapat terjadi komplikasi infeksi sekunder oleh organisme candida
atau bakteri. Pemberian obat steroid topikal dapat mengakibatkan eksaserbasi jamur sehingga
menyebabkan penyakit menyebar
VI.

Prognosis

Prognosis Tinea kruris akan baik, asalkan kelembaban dan kebersihan kulit selalu dijaga.

I.

B. Kandidiasis
Definisi

Kandidiasis adalah penyait jamur yang bersifat akut atau subakut disebabkan oleh spesies
Candida, biasanya oleh spesies Candida albicans dan dapat mengenai mulut, vagina, kulit, kuku,
bronki, atau paru, kadang kadang dapat menyebabkan septikemia, endokarditis, atau meningitis
II.

Etiologi

Sebagian besar dari spesies C. albicans tidak bersifat menguntungkan maupun merugikan.
Kolonisasi C. albicans dapat diisolasi dari kulit, mulut, selaput mukosa vagina dan feses orang
normal.
III.

Epidemiologi

Penyakit ini terdapat di seluruh dunia, dapat menyerang semua umur, baik laki-laki maupun
perempuan. Jamur penyebabnya terdapat pada orang sehat sebagai saprofit. Faktor resiko yang
pemicu hal ini adalah kondisi imunocompromise, diabetes militus, obesitas, hyperhidrosis,
demam, polyendocrinophaties, terapi steroid topikal maupun sistemik, dan penyakit kronik.
Gambaran klinisnya bermacam-macam sehingga tidak diketahui data-data penyebarannya
dengan tepat.
IV.

Pathogenesis
32

Infeksi kandida dapat terjadi, apabila ada faktor predisposisi baik endogen maupun eksogen:
Fator endogen:
1. Perubahan fisiologik
a. Kehamilan
b. Obesitas
c. Debilitas
d. Iatrogenik
e. Endokrinopati
f. Penyakit kronik dengan keadaan umum yang buruk.
2. Umur: usia tua dan bayi lebih mudah terkena infeksi ini karena status imunologi yang
tidak sempurna.
3. Imunologik: penyakit genetik.
Faktor eksogen:
1. Iklim, panas, dan kelembaban.
2. Kebersihan kulit.
3. Kebiasaan merendam kaki dalam air yang lama.
Kontak langsung dengan penderita, misalnya pada thrush, balanopostitis.
V.

Klasifikasi
Berdasarkan tempat yang terkena CONANT dkk.(1971), membaginya sebagai berikut:

1. Kandidiasis selaput lendir:


- Kandidosis oral (thrush)
- Perleche
- Vulvovaginitis
- Balanitis atau balanopostitis
- Kandidosis mukokutan kronik
- Kandidosis bronkopulmonar dan paru
2. Kandidiasis kutis:
- Lokalisata: daerah intertriginosa dan daerah perianal
- Generalisata
- Paronikia dan onikomikosis
- Kandidosis kutis granulomatosa
3. Kandidiasis sistemik:
- Endokarditis
- Meningitis
- Pielonefritis
- Septikemia
4. Reaksi id

33

VI.

Gejala Klinis

Kandidiasis Kutis Intertriginosa

Gambar 3 Kandidiasis Intertriginosa


Lesi mengenai daerah pelipatan-pelipatan badan, umbilikus, pannikulus (lipatan lemak badan).
Lesi berupa bercak yang berbatas tegas, bersisik, basah, dan eritematosa dikelilingi oleh vesikelvesikel dan pustul-pustul kecil atau bula yang bila pecah meninggalkan daerah erosi, dengan
pinggir yang kasar dan berkembang seperti lesi primer. Kandidiasis mengenai sela jari tangan
(tersering) pada sela jari ketiga dan keempat, yang sering kena air.

VII.

Diagnosis
1. Anamnesis dan gejala klinik yang khas.
Kandidiasis kutis biasanya terja di pada lipatan kulit yang lembab dan
termaserasi. Keluhan yang sering terjadi adalah gatal, kemerahan, dan daerah
yang termaserasi.(6) Kulit nyeri, inflamasi, eritematous, dan ada satelit
vesikel/pustula, bula atau papulopustular yang pecah meninggalkan permukaan
yang kasar dengan tepi yang erosi.
2. Pemeriksaan penunjang dengan pemeriksaan dengan KOH 10-20% dan pengecatan
gram.
Pada pemeriksaan dengna KOH 10% menunjukan adanya spora dan
pseudohifa, namun pada kandidiasis kutis tidak selalu tampak. Pada pengecetan
gram, yeast akan menjadi dense, gram positif, oviod bodies, diameter 2-5m.
Kombinasi antara Gomori Methanemine Silver (GMS) dan Congo Red dapat
bermanfaat untuk mendiagnosa banding infeksi fungi. Pada Blastomyces dan

34

Pityrosporum memberikan hasil positif pada hasil pengecetan, sedangkan pada


Candida dan Hitoplasma negatif.

Gambar 1.4 Species Candida pada pemeriksaan KOH 10%


3. Kultur.

Gambar 1.5 Hasil kultur Species Candida


Pada kultur C. albicans harus dibedakan dengan jenis kandida yanng lain,
yang biasanya jarang menjadi patogen. Seperti C. krusei, C. stellatoidea, C.
tropicalis, C. pseudotropicans, dan C. guilliermondii. Kultur pada Sabouraud
glucose agar yang dibubuhi antibiotik (kloramfenikol) menunjukan hasil biakan
yang seperti krim, keabu-abuan, dan koloni basah dalam waktu 4 hari.
4. Histo PA bila diagnosis meragukan.
Dengan pengecetan PAS (Periodic Acid-Schiff) atau GMS . pilihan untuk
kandida leukoplakia dan bila diperlukan pada kandidiasis kutis.
5. Glukosa darah dan reduksi urine untuk melihat diabetes mellitus.
VII.

Penatalaksanaan

Perbaiki keadaaan umum, dan atasi faktor faktor predisposisi:

Pemakaian antibiotik secara berhati hati


Hindari obesitas
Hindari bekerja /beraktivitas di temat yang banyak air / lembab

Sistemik:

Amfoterisin B 0,5-1 mg/kg BB IV


35

Tablet nistatin 3 x 100.000 U selama 1-4 minggu


Ketokonazol 400 mg / hari selama 5 hari atau flikonazol 150 mg/ hari selama 7 hari

Topikal:

VIII.

Larutan gentian violet 1-2%


Nistatin 100.000 U / ml terutama pada kandidiasis mukosa
Ekonazol 1-2% (krim atau larutan)
Mikokonazol 1-2% (krim, solusio, atau bedak); toksiklat 1-2% (bedak, larutan, atau krim)
Prognosis

Umumnya baik. Tergantung berat ringannya faktor predisposisi.

C. Eritrasma

I.

Definisi

Eritrasma adalah penyakit bakteri kronik pada stratum korneum yang disebabkan oleh
Corynebacterium minitussismum, ditandai dengan adanya lesi berupa eritema dan skuama halus
terutama di daerah ketiak dan lipat paha.
36

II.

Etiologi

Seperti yang telah disebutkan di atas etiologi dari penyakit ini adalah Corynebacterium
minitussismum. Bakteri ini adalah bakteri gram positif (difteroid). Bakteri ini tidak membentuk
spora dan merupakan basil yang bersifat aerob atau anaerob yang fakultatif. Corynebacterium
minitussismum merupakan flora normal di kulit yang dapat menyebabkan infeksi epidermal
superfisial pada keadaan-keadaan tertentu.
III.

Gejala Klinis

Lesi kulit dapat berukuran sebesar miliar sampai plakat. Lesi eritoskuamosa, berskuama halus
kadang-kadang dapat terlihat merah kecoklat-coklatan. Variasi ini rupanya bergantung pada area
lesi dan warna kulit penderita.
Tempat predileksi dimulai dari tempat yang paling sering, yakni toe webspaces (di antara jari
kaki), lipat paha, aksila. Selain itu, juga bisa ditemukan di daerah intertriginosa lain (terutama
pada penderita gemuk), intergluteal, inframamary (submammary). Lesi di daerah lipat paha
dapat menunjukkan gejala berupa gatal dan terasa terbakar. Sedangkan lesi pada tempat lain
asimtomatik.
Perluasan lesi terlihat pada pinggir yang eritematosa dan serpiginosa. Lesi tidak menimbulkan
dan tidak terlihat vesikulasi. Skuama kering yang halus menutupi lesi dan pada perabaan terasa
berlemak.
Beberapa penulis beranggapan ada hubungan erat antara eritrasma dan diabetes melitus. Penyakit
ini terutama menyerang pria dewasa dan dianggap tidak begitu menular, berdasarkan observasi
pada pasangan suami-isteri yang biasanya tidak terserang penyakit tersebut secara bersamasama. Eritrasma tidak menimbulkan keluhan subyektif, kecuali bila terjadi ekzematisasi oleh
karena penderita berkeringat banyak atau terjadi maserasi pada kulit.
IV.

Pemeriksaan Penunjang

Pemeriksaan pembantu terdiri atas pemeriksaan dengan lampu Wood dan sediaan langsung.

37

Pada pemeriksaan dengan lampu Wood, lesi terlihat berfluoresensi merah membara (coral-red).
Fluoresensi ini terlihat karena adanya porfirin. Pencucian atau pembersihan daerah lesi sebelum
diperiksa akan mengakibatkan hilangnya fluoresensi.
Bahan untuk sediaan langsung dengan cara mengerok. Lesi dikerok dengan skalpel tumpul atau
pinggir gelas obyek. Bahan kerokan kulit ditambah satu tetes eter, dibiarkan menguap. Bahan
tersebut yang lemaknya sudah dilarutkan dan kering ditambah biru metilen atau biru laktofenol,
ditutup dnegan gelas penutup dan dilihat di bawah mikroskop dengan pembesaran 10x100. Bila
sudah ditambah biru laktofenol, susunan benang halus belum terlihat nyata, sediaan dapat
dipanaskan sebentar di atas api kecil dan gelas penutup ditekan, sehingga preparat menjadi tipis.
Organisme terlihat sebagai batang pendek halus, bercabang, berdiameter 1u atau kurang, yang
muda putus sebagai bentuk basil kecil atau difteroid. Pemeriksaan harus teliti untuk melihat
bentuk terakhir ini.
Kultur biasanya tidak diperlukan.
V.

Penatalaksanaan

Mencegah agar jangan banyak keringat, serta menghilangkan faktor faktor pencetus (Panas,
lembab dan hygiene yang buruk)
Eritromisin merupakan obat pilihan. Satu gram sehari (4x250mg) untuk 2-3minggu. Obat
topikal, misalnya salap tetrasiklin 3% juga bermanfaat. Demikian pula obat antijamur yang baru
yang berspektrum luas. Hanya pengobatan topikal
memerlukan lebih ketekunan dan kepatuhan penderita.
VI.

Prognosis

Biasanya baik

D. Skabies
38

I.

Definisi

Skabies merupakan penyakit kulit yang disebabkan oleh infestasi dan sensitasi terhadap
Sarcoptes scabei var, hominis dan produknya (DERBER 1971).
Pengetahuan dasar tentang penyakit ini diletakkan oleh VON HEBRA, bapak dermatologi
modern. Penyebabnya ditemukan pertama kali oleh BENOMO pada tahun 1687, kemudian oleh
MELLANBY dilakukan percobaan induksi pada sukarelawan selama perang dunia II.
II.

Etiologi
Sarcoptes scabiei termasuk filum Arthropoda, kelas Arachnida, ordo Ackarima, super

family Sarcoptes. Pada manusia disebut Sarcoptes scabieivar. Hominis. Selain itu terdapat
S.scabiei yang lain, misalnya pada kambing dan babi.
Secara morfologik merupupakan tungau kecil, berbentuk oval, punggungnya cembung
dan bagian perutnya rata. Tungau ini translusen, berwarna putih kotor, dan tidak bermata.
Ukurannya yang betina berkisar antara 330-450 mikron x 250-350 mikron, sedangkan yang
jantan lebih kecil, yakni 200-240 mikron x 150-200 mikron. Bentuk dewasa mempunyai 4
pasang kaki di depan sebagai alat untuk melekat dan 2 pasang kaki kedua pada betina berakhir
dengan rambut, sedangkan pada yang jantan pasangan kaki ketiga berakhir dengan rambut dan
keempat berakhir dengan alat perekat..
Siklus hidup tungau ini sebagai berikut. Setelah kopulasi ( perkawinan) yang terjadi di
atas kulit, yang jantan akan mati, kadang-kadang masih dapat hidup beberapa hari dalam
terowongan yang digali oleh yang betina. Tungau betina yang telah dibuahi menggali
terowongan dalam stratum korneum, dengan kecepatan 2-3 milimeter sehari dan sambil
meletakkan telurnya 2 atau 4 butir sehari sampai mencapai jumlah 40 atau 50. Bentuk betina
yang dibuahi ini dapat hidup sebulan lamanya. Telurnya akan menetas, biasanya dalam waktu 35 hari, dan menjadi larva yang mempunyai 3 pasang kaki. Larva ini dapat tinggal dalam
terowongan, tetapi dapat juga keluar. Setelah 2-3 hari larva akan menjadi nimfa yang mempunyai
2 bentuk, jantan dan betina, dengan 4 pasang kaki. Seluruh siklus hidupnya mulai dari telur
sampai bentuk dewasa memerlukan waktu antara 8-12 hari.

39

III.
Epidemiologi
Skabies adalah infestasi kulit manusia disebabkan oleh penetrasi parasit tungau Sarcoptes scabiei
var. hominis ke dalam epidermis. Tungau skabies adalah arthropoda kelas Acarina pertama kali
diidentifikasi pada tahun 1600-an, tetapi belum dikenal sebagai penyebab erupsi kulit sampai
pada tahun 1700-an. Ada yang memperkirakan bahwa lebih dari 300 juta orang di seluruh dunia
terinfeksi dengan tungau skabies.
Skabies adalah masalah seluruh dunia dan segala usia, ras dan kelompok sosial ekonomi yang
rentan. Faktor lingkungan mempercepat penyebaran meliputi kepadatan penduduk, pengobatan
yang terlambat kasus primer, dan kurangnya kesadaran masyarakat terhadap kondisi tersebut.
Ada variasi yang cukup besar dalam prevalensi, dengan tingkat di beberapa negara berkembang
berkisar antara 4% sampai 100% . Insiden yang lebih tinggi terjadi pada daerah dengan
kepadatan penduduk, sering berhubungan dengan bencana alam, perang, depresi ekonomi dan
tempat pengungsian. Skabies dapat ditularkan langsung melalui kontak pribadi yang dekat,
seksual atau lainnya, atau tidak langsung melalui transmisi melalui benda-benda. Prevalensi
lebih tinggi pada anak dan pada orang yang aktif secara seksual. Pada umumnya infestasi
penyebarannya terjadi antara anggota keluarga dan orang yang dekat.
IV.

Gejala Klinis
Setelah paparan awal terhadap tungau skabies akan timbul pruritus dan ruam yang dapat

terjadi selama 6 sampai 8 minggu untuk berkembang. Setelah terpapar, paparan hasil tungau
menyebabkan rasa gatal dan ruam berkembang dalam beberapa hari, mungkin karena sensitisasi
sebelumnya dengan tungau skabies. Rasa gatal tersebut terasa parah dan biasanya memburuk
pada malam hari. Lesi muncul berupa kemerahan, bersisik, kadang-kadang krusta (ekskoriasi),
papula dan nodul pada sela-sela jari, pergelangan tangan, permukaan ekstensor siku dan lutut,
sisi tangan dan kaki, daerah ketiak, pantat, pinggang daerah, dan pergelangan kaki. Pada pria,
penis dan skrotum biasanya terlibat; pada wanita, payudara, termasuk areola dan putting. Lesi,
sering vesikular dan distribusinya mungkin paling banyak di telapak tangan dan telapak bayi.
Kulit kepala dan wajah, jarang terlibat pada orang dewasa, kadang-kadang adalah penuh pada
bayi.
V.

Penatalaksanaan
40

Umum:

Meningkatkan kebersihan perorangan dan lingkungan


Menghindari orang orang yang terkena
Mencuci / menjemur alat alat tidur
Jangan memakai pakaian / handuk bersama sama

Khusus:

Sulfur prespitatum 2-5% dalam bentuk salep atau krim. Obat ini lebih efektif jika
dicampur dengan asam salisilat 2%. Dioleskan di seluruh tubuh setelah mandi dan

24 jam
Krotamiton 10% dalam bentuk salep atau krim dipakai selama 24 jam.
Krim permetrin 5% dapat memberi hasil yang baik.

VI.

dipakai 3-4 hari berturut turut


Emulsi benzyl benzoate 20-25% selama 24 jam
Gama benzene heksaklorida (gameksan) 0,5-1% dalam salep atau krim, dioleskan selama

Prognosis

Dengan memperhatikan pemilihan dan cara pemakaian obat, serta syarat pengobatan dan
menghilangkan factor predisposisi (antara lain hygiene), maka penyakit ini dapat diberantas dan
member prognosis yang baik.

41

11. Jelaskan pencegahan dari Working Diagnosis !


Jawab :
Pencegahan Tinea Cruris
Pencegahan dilakukan dengan menjaga kelembaban tubuh tetap seimbang, ini dilakukan
dengan menjaga kebersihan pribadi, tidak menggunakan pakaian yang ketat atau berbahan panas,
gunakan pakaian yang menyerap keringat dan rajinlah berganti pakaian, biarkan sirkulasi udara
pada area selangkangan tetap baik dengan tidak memakai celana yang berlapis-lapis. Angin dan
cahaya matahari pagi dapat membantu mengeringkan luka dan mengusir jamur, gunakan sabun
antiseptik sebagai perlindungan tambahan.

42

BAB IV
PENUTUP
4.1 KESIMPULAN
Berdasarkan gejala pada skenario dengan keluhan lipat paha depan terasa sangat
gatal sejak 3 hari yang lalu. Pemeriksaan

fisis: tampak

adanya plakat kemerahan

berbatas tegas dan tepinya dikelilingi vesikel di daerah inguinal, maka kelompok kami
menengakkan diagnosis pada skenario tersebut adalah tinea cruris.

43

DAFTAR PUSTAKA
Atlas Histologi diFore Edisi 11 hal. 223-226
Budimulja U. Mikosis. Dalam: Djuanda, A. dkk, editor. Ilmu Penyakit Kulit Dan Kelamin. Edisi
Kelima. 2007. Jakarta: Fakultas Kedokteran Indonesia.
Chosidow, Oliver. 2006. Scabies. The new england journal of medicine. Massachusetts
Medical Society. pp 1718-1722
Djuanda A, Hamzah M, Aisah S, editor. 2007. Ilmu Penyakit Kulit dan Kelamin, ed. Ke-6.
Jakarta: BP FKUI.
Djuanda, Prof. Dr. dr. Adhi. 2010. Ilmu Penyakit Kulit Dan Kelamin, Edisi Keenam.
Jakarta ; Badan Penerbit Fakultas Kedokteran Universitas Indonesia.
Dorland, W. A. Newman. 2012. Kamus Saku Kedokteran Dorland, Ed. 28.
Jakarta ; Penerbit Buku Kedokteran EGC.
44

http://repository.usu.ac.id/bitstream/123456789/35227/4/Chapter%20II.pdf
Jawetz,menick dan adelberg.2002.mikrobiologi kedokteran. Jakarta: EGC
Siregar, R. S.. 2002. Atlas berwarna Saripati Penyakit Kulit. Jakarta: Penerbit Buku Kedokteran
EGC.
Siregar, R.S. 2004. Atlas Berwarna Saripati Penyakit Kulit. Jakarta: EGC
W Klaus, Johnson RA. Fitzpatricks Color Atlas & Synopsis of Clinical Dermatology, ed. Ke-6.
United States: The McGraw-Hill Companies, 2009.

45