Anda di halaman 1dari 28

ANALISA PEMBENTUKAN HARGA DALAM

PERSPEKTIF SYARIAH

OLEH :

1. JAMES S MASSORA B 1 A1 1 2 1 0 8
2. RAHMAT MANSYUR B 1 A1 1 2 0 9 5
3. ANNISA ZAVIERA B 1 A1 1 2 1 0 6
4. VALEN FARANSINA EA B 1 A1 1 2 1 0 7
5. SRI MINDA SARI B 1 A1 1 2 0 9 9

JURUSAN ILMU EKONOMI

FAKULTAS EKONOMI DAN BISNIS

UNIVERSITAS HALUOLEO 2015


KATA PENGANTAR

Puji dan syukur kami panjatkan kehadirat Tuhan Yang Maha Esa, karena atas ridhoNya dan

kuasaNya kami dapat merampungkan proses penyusunan makalah ini berdasarkan tempo waktu

yang telah ditetapkan.

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
Dalam proses penyusunan makalah ini, kami menganalisis mengenai proses pembentukan

harga dalam perspektif syariah, yang mana tujuan utama penyusunannya untuk memberikan

khazanah pengetahuan yang bermanfaat bagi masyarakat pada umumnya dan kami pada khususnya

untuk mengetahui secara Islami proses penetapan harga yang direstui dalam konsep syariah

berdasarkan pemikiran para filsuf Islam.

Terima kasih kami ucapakan atas bantuan berbagai pihak baik moral maupun moril dalam

terlaksananya penyusunan makalah ini, baik itu teman sesama mahasiswa yang memprogramkan

mata kuliah ekonomi mikro-makro syariah, para senior dan secara khusus Bapak/Ibu dosen dalam

lingkup jurusan Ilmu Ekonomi.

Kami menyadari secara positif, bahwa proses penyusunan makalah ini masih terdapat

banyak kekeliruan, baik dalam hal analisis ruang lingkupnya maupun dari segi kaidah bahasa yang

kami gunakan dalam penyusunannya. Untuk itu kami mengharapkan kritik dan saran yang

konstruktif terhadap kami selaku penyusun sebagai bahan evaluasi dalam penyusunan materi

makalah berprinsip syariah dikemudian hari. Terima Kasih

Kendari, 28 Oktober 2015

Penyusun

DAFTAR ISI

KATA PENGANTAR ...................................................................................... I

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
DAFTAR ISI .............................................................................................................. II

BAB I PENDAHULUAN

1.1 Latar Belakang .................................................................................................. 1-2


1.2 Rumusan Masalah.................................................................................................. 3
1.3 Tujuan dan Manfaat ...................................................................................... 3

BAB II PEMBAHASAN

2.1 Pengertian Harga ................................................................................................... 4

2.2 Ruang Lingkup Teori Harga ........................................................................... 5-8


2.3 Harga Pada Pasar Islami

....................................................................................... 8-9
2.4 Penetapan harga menurut Pemikiran Ilmuwan Muslim

....................................... 9-13
2.5 Penetapan Harga Menurut Pandangan Islam ................................................... 13-14
2.6 Urgensi Penetapan Harga ....................................................................................... 14-15
2.7 Penetapan Harga Pada Ketidaksempurnaan Pasar ....................................... 15
2.8 Musyawarah Untuk Menetapkan Harga

............................................................... 15-16
2.9 Penetapan Harga Dalam Sistem Perekonomian Modern ....................................... 16-18

BAB III PENUTUP

3.1 Kesimpulan ................................................................................................... 19-20

3.2 Saran ............................................................................................................... 20

DAFTAR PUSTAKA ....................................................................................... 21

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II
HALUOLEO 2015 |
ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II
HALUOLEO 2015 |
ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II
HALUOLEO 2015 |
BAB I

PENDAHULUAN

1.1 Latar Belakang

Dalam proses kehidupan bermasyarakat, kegiatan ekonomi sangat berpengaruh dalam

memenuhi kebutuhan manusia itu sendiri, dimana setiap orang akan diperhadapkan dengan berbagai

situasi dan kondisi tertentu untuk mengambil keputusan yang menyangkut ekonomi, termasuk

dalam hal pembentukan harga terutama yang dialami oleh para penjual atau pedagang dan

perusahaan baik mikro maupun makro. Pada dasarnya, suatu perusahaan menentukan harga suatu

barang untuk memperoleh keuntungan, dengan cara menjual kepada para konsumen

Berdasarkan pemaparan singkat tersebut dapat dianalisa secara ekonomi, bahwa

perekonomian merupakan salah satu soko guru kehidupan negara. Dimana kuat dan lemahnya

sistem perekonomian suatu negara itu salah satunya ditentukan melalui penetapan harga, sehingga

terjadi kestabilan harga. Namun tidak mudah untuk menciptakan perekonomian dengan harga yang

stabil karena adakalanya tingkat permintaan lebih tinggi dari penawaran begitu pun sebaliknya.

Interaksi antara pemerintah, produsen, dan konsumen sangat diperlukan guna mencapai

tujuan perekonomian yang kuat. Dengan kata lain, penentuan harga tidak dapat dimonopoli oleh

sepihak saja melainkan berdasarkan kesepakatan dalam penentuan harga. Hal tersebut guna

meminimalkan terjadinya kecurangan atau pun kerugian terhadap salah satu pihak. Pemerintah

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
mempunyai tanggung jawab dan ikut andil dalam penentuan harga, karena menjadi instrumen

utama penentu dari harga barang yang telah diatur dalam undang-undang seperti UU APBN.

Dalam Islam telah diatur mengenai cara bermuamalah bagi seorang muslim. Dalam

kaitannya dengan jual beli dan penentuan harga, Islam memperbolehkan jual beli dan melarang

konsep riba. Hal tersebut tertuang dalam surat Al-Baqarah : 275 yang artinya:

.......Keadaan mereka yang demikian itu, adalah disebabkan mereka berkata

berpendapat), sesungguhnya jual beli itu sama dengan riba, padahal Allah telah

menghalalkan jual beli dan mengharamkan riba.......

Yang mana dalam hal ini pedagang tidak boleh meraup keuntungan yang sebesar-besarnya

dengan menaikkan harga. Pedagang hanya boleh meraup untung yang sewajarnya sebagai pengganti

atas jasanya. Islam menolak sejumlah ideologi ekonomi yang terkait dengan

keagungan private property, kepentingan investor, asceticism (menghindari

kehidupan duniawi), authoritarianism (ekonomi terpimpin atau paham

mematuhi seseorang secara mutlak). Oleh sebab itu, sangat utama bagi umat

Islam untuk secara kumulatif mencurahkan semua dukungannya kepada ide

keberdayaan, kemajuan, dan kecerahan peradaban bisnis dan perdagangan.

Islam secara ketat memacu umatnya untuk bergiat dalam aktivitas keuangan

dan usaha-usaha yang meningkatkan kesejahteraan ekonomi dan sosial.

Pemerintah Islam pun, sejak Rasulullah SAW di Madinah fokus pada masalah

keseimbangan harga , terutama pada bagaimana peran negara dalam mewujudkan kestabilan harga

dan bagaimana mengatasi masalah ketidakstabilan harga. Para ulama berbeda pandapat mengenai

boleh tidaknya negara menetapkan harga. Masing Masing golongan ulama ini memiliki dasar

falsafah hukum dan interpretasi masing-masing.

Berdasarkan perbedaan pendapat para ulama tersebut, maka kami selaku penulis mencoba

menganalisa penetapan harga oleh negara dalam perspektif syariah dengan mempertimbangkan

realitas ekonomi yang berlangsung saat ini di negara kita.


ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II
HALUOLEO 2015 |
1.2 Rumusan Masalah

1. Apakah yang dimaksud dengan harga ?

2. Bagaimanakah ruang lingkup dalam teori harga?

3. Bagaimanakah konsep harga pada pasar Islami ?

4. Bagaimanakah penetapan harga menurut para ilmuwan Islam ?

5. Bagaimanakah penetapan harga menurut perspektif Islam dan

penerapannya di Indonesia?

1.2 Tujuan dan Manfaat

1.2.1 Tujuan

Tujuan daripada penyusunan makalah ini secara komprehensif, yakni

untuk memberikan deskripsi mengenai proses pembentukan atau penetapan

harga berdasarkan perspektif syariah dari berbagai sudut pandang para

ilmuwan Islam agar dapat memberikan suatu khazanah pengetahuan dari segi

pemahaman agama Islam.

1.2.2 Manfaat

I. Bagi Penulis
Dapat menambah sumber rujukan referensi baru terhadap pemahaman

secara syariah, sehingga memiliki gambaran rasio pola pikir ekonomi

antara pemahaman secara konvensional dan secara syariah.


II. Bagi Masyarakat Luas
Dapat memberikan gambaran terhadap mekanisme penetapan harga

dari segi fiqih muamalahnya, sehingga masyarakat dapat lebih paham

dalam membandingkan proses penetapan harga dari basis syariah dan


ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II
HALUOLEO 2015 |
konvensional yang mampu membuka cakrawala pemikiran masyarakat

yang belum sepenuhnya paham mekanisme ekonomi syariah.

BAB II

PEMBAHASAN

2.1 Pengertian Harga

Ridwan Iskandar Sudayat menyatakan bahwa harga suatu barang adalah tingkat

pertukaran barang itu dengan barang lain. Sebagaimana telah kita ketahui, salah satu tugas pokok

ekonomi adalah menjelaskan alasan barang-barang mempunyai harga serta alasan barang yang

mahal dan murah. Sebagai contoh, gaji dan upah adalah harga jasa bagi seseorang yang bekerja.

Bunga adalah harga meminjam atau menggunakan uang di Bank. Pajak adalah harga jasa

pemerintah bagi warga negaranya. Bentuk atau sebutan harga lain adalah uang sewa, tiket, tol,

honorarium, SPP, dan sebagainya.

Harga terbentuk untuk memenuhi tujuan dua pihak, yaitu produsen dan konsumen. Produsen

memandang harga sebagai nilai barang yang mampu memberikan manfaat keuntungan di atas biaya

produksinya (atau tujuan lain, misalnya keuntungan). Konsumen memandang harga sebagai nilai

barang yang mampu memberikan manfaat atas pemenuhan kebutuhan dan keinginannya.

Dalam pasar persaingan sempurna, harga terbentuk dari kesepakatan produsen dan

konsumen. Akan tetapi, pada kenyataannya kondisi ini jarang terjadi. Salah satu pihak lain

(umumnya produsen) dapat mendominasi pembentukan harga atau pihak lain di luar produsen dan

konsumen. Tingkat harga dalam sebuah perekonomian secara keseluruhan dapat diketahui melalui

dua cara. Selama ini kita mengartikan tingkat harga sebagai hanya dari sekeranjang atau himpunan

barang dan jasa. Jika tingkat-tingkat harga mengalami kenaikan, masyarakat harus membayar lebih

untuk mendapatkan berbagai barang dan jasa yang mereka inginkan. Selain itu, kita dapat
ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II
HALUOLEO 2015 |
menggunakan tingkat harga untuk menentukan nilai uang. Naiknya tingkat harga berarti

menurunnya nilai uang karena setiap nilai rupiah yang Anda punya sekarang hanya dapat digunakan

untuk membeli barang dan jasa dalam jumlah yang lebih sedikit daripada sebelumnya.

2.2 Ruang Lingkup Teori Harga

Dalam teori harga ada beberapa hal yang harus dipelajari untuk memahami secara keseluruhan,

yaitu di antaranya:

1. Fungsi Harga

Secara umum, harga dapat berfungsi sebagai berikut:

a. Sumber pendapatan atau keuntungan perusahaan untuk mencapai tujuan produsen.

b. Pengendali tingkat permintaan dan penawaran.

c. Memengaruhi program pemasaran dan fungsi bisnis lainnya bagi perusahaan. Harga dapat

berperan sebagai pengaruh terhadap

2. Faktor Penentu Harga

Penentuan harga dipengaruhi oleh faktor internal dan eksternal. Faktor internal meliputi:

a. Tujuan pemasaran (biaya, penguasaan pasar, dan usaha)

b. Strategi marketing-mix (aspek harga dan non harga)

c. Organisasi (struktur, skala, dan tipe).

Sedangkan Faktor eksternal meliputi:

a. Elastisitas permintaan dan kondisi persaingan pasar.

b. Harga pesaing dan reaksi pesaing terhadap perubahan harga;

c. Lingkungan eksternal lain, yaitu lingkungan mikro (pemasok, penyalur, asosiasi, dan masyarakat)

dan lingkungan makro (pemerintah, cadangan sumber daya, keadaan sosial).

3. Batas Penentu Harga

Perubahan harga buka tanpa batas, melainkan terbatasi oleh permintaan (customer demand), biaya

(cost), dan persaingan (competition). Posisi atau tingkat harga akan bergerak berfluktuasi dalam

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
ruang gerak persaingan mengikuti kekuatan pesaing yang lebih besar. Akan tetapi, perubahannya

tidak melebihi batas harga tertinggi dari permintaan pasar (batas atas) ataupun tidak lebih rendah

dari biaya yang ditanggung produsen (batas bawah)

4. Tahap Penentuan Harga

Khusus untuk produk baru, penentuan harga melalui prosedur berikut:

a. Memilih tujuan dan orientasi harga.

b. Memperkirakan permintaan produk dan perilakunya.

c. Memperkirakan biaya dan perilakunya.

d. Melakukan analisis perilaku pesaing;

e. Menetukan strategi harga;

f. Menyesuaikan harga akhir.

5. Tujuan Harga

Secara umum, penentuan harga mempertimbangkan batasan-batasan berikut:

a. Biaya bertujuan untuk mengendalikan keuntungan atau hanya untuk menutup menutup biaya;

b. Permintaan pasar bertujuan untuk mengendalikan (memperluas ataupun mempertahankan)

penjualan atau market-share.

c. Persaingan harga akan bertujuan untuk mengendalikan (mengatasi atau menghindari) persaingan.

6. Strategi Harga

a. Strategi Harga Berorientasi Pada Biaya

Strategi harga yang berorientasi pada biaya didasarkan pada perhitungan biaya (tetap atau variabel)

dan penentuan target keuntungan yang diinginkan (target pengembalian investasi) untuk dapat

menetapkan harga. Penentuan harga dilakukan berdasarkan hal-hal berikut.

1. Tingkat keuntungan tertentu, yaitu:


Harga ditentukan menurut perhitungan biaya target keuntungan yang diharapkan.
2. Besarnya keuntungan merupakan persentase dari biaya (cost-plus), harga Perolehan (mark-

up), atau harga jualnya.

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
3. Melalui perilaku biaya (tetap ataupun variabel) dapat diperhitungkan tingkat atau volume

penjualan impas (break-even point).

b. Strategi Harga Berorientasi Pada Permintaan

Penetapan harga yang berorientasi pada permintaan akan mempertimbangkan kondisi permintaan

pasar. Harga akan diserap apabila ada permintaan. Dengan kata lain, harga dapat ditetapkan sesuai

menurut tingkat permintaannya. Dengan demikian, perusahaan perlu memahami tingkat permintaan

terhadap barang yang terbentuk. Dengan mempertimbangkan permintaan pasar, strategi harga dapat

diarahkan untuk mencapai tingkat atau penumbuhan penjualan (market-share), mencakup:

Diskriminasi harga
Perceived value pricing

c. Strategi Harga Berorientasi Pada Persaingan

Harga dapat bertahan di pasar persaingan apabila produsen memerhatikan harga-harga pesaingnya

(price competition), terutama price leadernya. Produsen dapat menentukan harga yang sama, di atas

atau dibawah harga pesaingnya (going rate pricing). Adapun pada penawaran pekerjaan secara

lelang, harga ditetapkan dengan memperkirakan harga pesaingnya.

d. Kebijakan Harga Akhir

Harga yang sudah ditetapkan adakalanya perlu disesuaikan karena perubahan yang terjadi di

lingkungan pasar. Untuk melakukan antisipasi perubahan tersebut, perlu dilakukan kebijakan harga.

Penyesuaian harga (administered pricing) mempertimbangkan fleksibilitas, siklus produk, potongan

harga (diskon), jarak geografis antara penjual dan pembeli, product mix, dan harga psikologis

konsumen.

e. Metode Penetapan Harga

Menurut Ridwan Iskandar Sudayat, ada beberapa metode yang dapat digunakan sebagai

rancangan dan variasi dalam penetapan harga, yaitu sebagai berikut.

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
Harga didasarkan pada biaya total ditambah laba yang diinginkan (cost plus pricing

method). Metode harga ini adalah metode yang paling sederhana, yaitu penjualan atau

produsen menetapkan harga jual untuk satu barang yang besarnya sama dengan jumlah

biaya per unit ditambah jumlah untuk laba yang diinginkan (margin) pada tiap-tiap unit

tersebut. Formulanya menjadi:


Cost Plus Pricing Method = Biaya Total + Laba = Harga Jual
Harga yang berdasarkan keseimbangan antara permintaan dan suplai. Metode penetapan

harga yang lain adalah metode menentukan harga terbaik untuk mencabai laba optimal

melalui keseimbangan antara biaya dan permintaan pasar. Metode ini paling cocok bagi

perusahaan yang tujuan penetapan hargannya adalah memperoleh keuntungan maksimal.


2.3 Harga Pada Pasar Islami

Konsep Islam memahami bahwa pasar dapat berperan efektif dalam

kehidupan ekonomi bila prinsip persaingan bebas dapat berlaku secara efektif.

Pasar tidak mengharapkan adanya intervensi dari pihak manapun, tak

terkecuali negara dengan otoritas penentuan harga atau private sector dengan

kegiatan monopolistik ataupun lainnya. Karena pada dasarnya pasar tidak

membutuhkan kekuasaan yang besar untuk menentukan apa yang harus

dikonsumsi dan di produksi. Sebaliknya biarkan tiap invidu dibebaskan untuk

memilih sendiri apa yang dibutuhkan dan bagaimana memenuhinya. Inilah pola

normal dari pasar atau keteraturan alami dalam istilah Al-Ghazali berkait

dengan ilustrasi dari evolusi pasar. Selanjutnya Adam Smith menyatakan

serahkan saja pada invisible hand, dan dunia akan teratur dengan sendirinya.

Dari pemahaman itu, harga sebuah komoditas (barang dan jasa)

ditentukan oleh permintaan dan penawaran, perubahan yang terjadi pada

harga berlaku juga ditentukan oleh terjadinya perubahan permintaan dan

perubahan penawaran. Hal ini sesuai dengan hadits yang diriwayatkan oleh

Anas Ra bahwasanya suatu hari terjadi kenaikan harga yang luar biasa dimasa

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
Rasulullah Saw, maka sahabat meminta Nabi untuk menentukan harga pada

saat itu, lalu beliau bersabda yang artinya:

Bahwasanya Allah adalah Zat yang mencabut dan memberi

sesuatu, Zat yang memberi rezeki dan penentu harga.

Dengan demikian pemerintah tidak memiliki wewenang untuk melakukan

intervensi terhadap harga pasar dalam kondisi normal. Ibnu Taimiyah

menyatakan jika masyarakat melakukan tranasaksi jual beli dalam kondisi

normal tanpa ada bentuk distorsi atau penganiayaan apa pun dan terjadi

perubahan harga, maka ini merupakan kehendak Allah dan harus diyakini,

bahwa nilai konsep Islam tidak memberikan ruang intervensi dari pihak

manapun untuk menentukan harga.

2.4 Penetapan harga menurut Pemikiran Ilmuwan Muslim

Pada masa kenabian dalam dunia perdagangan Arab menjadi kesepakatan

bersama bahwa tingginya rendahnya permintaan terhadap komoditas

ditentukan oleh harga yang bersangkutan yang mana jika tersedia sedikit

barang maka harga akan mahal dan bila tersedia banyak barang maka harga

akan menjadi murah. Dalam pembahasan harga serta hal-hal yang terkait

mengungkapkan pendapat para ekonom Muslim yaitu Abu Yusuf, Al-Ghazali,

Ibnu Taimiyah beserta Ibnu Khaldun.

a. Abu Yusuf

Seperti ahli ekonomi Islam yakni Abu Yusuf ulama pertama yang

menyinggung mekanisme pasar, ia meneliti peningkatan dan penurunan

produksi dalam kaitannya dengan perubahan harga. Fenomena umum inilah

yang kemudian dikritisi oleh Abu Yusuf. Pemahamannya tentang hubungan

antara harga dan kuantitas hanya memperhatikan kurva demand. Ia

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
membantah fenomena tersebut karena tidak selalu terjadi bahwa bila

persediaan barang sedikit harga akan mahal dan bila persediaan melimpah

harga akan menjadi murah. Fenomena yang berlaku pada amasa Abu Yusuf

dapat dijelaskan dalam teori permintaan yang mana teori ini menjelaskan

hubungan antara harga dengan banyaknya kuantitas yang diminta dapat

diformulasikan sebagai berikut:

D = Q = f (P)

Yang menunjukkan bahwa pengaruh harga terhadap jumlah permintaan

suatu komoditi adalah negatif, apabila terjadi kelangkaan barang maka harga

cenderung akan tinggi dan juga sebaliknya apabila barang tersebut melimpah

maka harga akan cenderung turun atau lebih rendah. Sehingga hukum

permintaan mengatakan bila harga komoditi naik akan menyebabkan

penurunan jumlah komoditi yamg dibeli dan juga jika harga turun maka

konsumen akan meningkatkan jumlah komoditi yang akan dibeli.

Karena pada kenyataannya tidak selalu terjadi bila persediaan sedikit

harga akan mahal dan jika persediaan melimpah harga akan murah. Dari

pernyataan tersebut Abu Yusuf menyangkal pendapat umum mengenai

hubungan terbalik antara persediaan barang (supply) dan harga karena pada

kenyataannya harga tidak bergantung pada permintaan saja tetapi juga pada

kekuatan penawaran. Dalam sebuah formulasi sederhana, hubungan antara

harga dengan jumlah komoditi dapat dilihat:

S = Q = f (p)

Bahwa pengaruh harga terhadap jumlah permintaan suatu komoditi

adalah positif, apabila harga naik maka permintaan juga akan naik begitu

sebaliknya jika harga turun maka permintaan akan turun. Sehingga dapat kita

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
simpulkan bahwa hukum penawaran mengatakan bila harga komoditi naik

makan akan direspon oleh penambahan jumlah komoditi yang ditawarkan.

Begitu juga bila harga komoditi turun akan direspon oleh penurunan jumlah

komoditi yang akan ditawarkan. Menurut Siddiqi ucapan Abu Yusuf hatus

diterima sebagai pernyataan hasil pemgamatannya pada saat itu, yakni

keberadaan yang bersamaan antara melimpahnya barang dan tingginya harga

serta kelangkaan barang dan harga rendah.

b. Al-Ghazali

Al-Ghazali telah menjabarkan secara rinci akan peranan aktivitas

perdagangan dan timbulnya pasar yang harganya bergerak sesuai dengan

kekuatan permintaan dan penawaran. Menurut Al-Ghazali pasar merupakan

bagian dari keteraturan alami secara rinci ia juga menerangkan bagaimana

evolusi terciptanya pasar.

Al-Ghazali tidak menolak kenyataan bahwa keuntunganlah yang

menjadi motif perdagangan. Dan pada saat lain ia menjabarkan pentingnya

peran pemerintah dalam menjamin keamanan jalur perdagangan demi

kelancaran perdagangan dan pertumbuhan ekonomi. Al-Ghazali tidak

menjelaskan permintaan dan penawaran dalam terminologi modern, beberapa

paragraf dalam tulisannya jelas menunjukkan bentuk kurva penawaran dan

permintaan. Untuk kurva penawaran naik dari kiri bawah ke kanan atas

dinyatakan oleh nya sebagai jika petani tidak mendapatkan pembeli dan dan

barangnya, ia akan menjualnya pada harga yang lebih murah.

Al-Ghazali juga telah memahami konsep elastisitas permintaan:

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
Mengurangi margin keuntungan dengan menjual pada harga

yang lebih murah akan meningkatkan volume penjualan dan ini

pada gilirannya akan meningkatkan keuntungan.

c. Ibnu Taimiyah

Masyarakat pada masa Ibnu Taimiyah beranggapan bahwa peningkatan

harga merupakan akibat ketidakadilan dan tindakan melanggar hukum dari

pihak penjual atau mungkin sebagai akibat manipulasi pasar. Anggapan ini

dibantah oleh Taimiyah dengan tegas ia menyatakan bahwa harga ditentukan

oleh kekuatan permintaan dan penawaran. Selanjutnya ia menyatakan bahwa

naik dan turunnya harga tidak selalu disebabkan oleh tindakan tidak adil dari

sebagian orang yang terlibat transaksi.

Perubahan dalam penawaran digambarkan sebagai peningkatan atau

penurunan dalam jumlah barang yang ditawarkan, sedangkan permintaan

sangat ditentukan oleh selera dan pendapatan. Besar kecilnya kenaikan harga

bergantung pada besarnya perubahan penawaran dan atau permintaan. Bila

seluruh transaksi sudah sesuai aturan, kenaikan harga yang terjadi merupakan

kehendak Allah. Ibnu Taimiyah menentang peraturan yang berlebihan ketika

kekuatan pasar secara bebas bekerja untuk menentukan harga yang kompetitif.

d. Ibnu Khaldun

Dalam bukunya Al-Muqoddimah ia menulis satu bab berjudul Harga-

harga di Kota yang mana Ibnu Khaldun membagi jenis barang menjadi dua

jenis yakni barang kebutuhan pokok dan barang pelengkap. Menurutnya bila

suatu kota berkembang dan selanjutnya populasinya bertambah banyak (kota

besar) maka perdagangan barang-barang kebutuhan pokok mendapatkan

prioritas. Supplay bahan pokok penduduk kota besar jauh lebih besar dari pada

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
supplay bahan pokok penduduk kota kecil. Menurut Ibnu Khaldun penduduk

kota besar memiliki supplay bahan pokok yang melebihi kebutuhannya

sehingga harga bahan pokok dilkota besar relatif lebih murah. Sementara itu

supplay bahan pokok di kota kecil relatif kecil, karena itu orang-orang khawatir

kehabisan makanan, sehingga harganya relatif mahal.

Naiknya disposable income dapat meningkatkan marginal propensity to

consume (MPC) tehadap barang-barang mewah dari setiap penduduk kota

tersebut. Hal ini menciptakan permintaan baru atau peningkatan permintaan

terhadap barang-barang mewah, akibatnya harga barang mewah akan

meningkat pula.

Pada bagian lain dari bukunya, khaldun menjelaskan pengaruh naik dan

turunnya penawaran terhadap harga, ia mengatakan:

Ketika barang-barang yang tersedia sedikit, harga-harga akan

naik. Namun, bila jarak antar kota dekat dan aman untuk

melakukan perjalanan, akan banyak barang yang diimpor

sehingga ketersediaan barang akan melimpah, dan harga-harga

akan turun.

Dengan demikian Ibnu Taimiyah dan Ibnu Kahaldun juga sudah

mengidentifikasikan kekuatan permintaan dan penawaran sebagai penentu

keseimbangan harga.

2.5 Penetapan Harga Menurut Pandangan Islam

Setelah perpindahan (hijrah) Rasulullah SAW ke Madinah, maka beliau menjadi pengawas

pasar (muhtasib). Pada saat itu, mekanisme pasar sangat dihargai. Salah satu buktinya yaitu

Rasulullah SAW menolak untuk membuat kebijakan dalam penetapan harga, pada saat itu harga

sedang naik karena dorongan permintaan dan penawaran yang dialami.

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
Mekanisme penentuan harga dalam islam sesuai dengan Maqashid al-Syariah, yaitu

merealisasikan kemaslahatan dan menghindari kerusakan di antara manusia. Seandainya Rasulullah

saat itu langsung menetapkan harga, maka akan kontradiktif dengan mekanisme pasar. Akan tetapi

pada situasi tertentu, dengan dalih Maqashid al-Syariah, penentuan harga menjadi suatu keharusan

dengan alasan menegakkan kemaslahatan manusia dengan memerangi distorsi pasar (memerangi

mafsadah atau kerusakan yang terjadi di lapangan).

Dalam konsep islam, yang paling prinsip adalah harga ditentukan oleh keseimbangan

permintaan dan penawaran. Keseimbangan ini terjadi bila antara penjual dan pembeli bersikap

saling merelakan. Kerelaan ini ditentukan oleh penjual dan pembeli dan pembeli dalam

mempertahankan barang tersebut. Jadi, harga ditentukan oleh kemampuan penjual untuk

menyediakan barang yang ditawarkan kepada pembeli, dan kemampuan pembeli untuk

mendapatkan harga barang tersebut dari penjual.

Akan tetapi apabila para pedagang sudah menaikkan harga di atas batas kewajaran, mereka

itu telah berbuat zalim dan sangat membahayakan umat manusia,maka seorang penguasa

(Pemerintah) harus campur tangan dalam menangani persoalan tersebut dengan cara menetapkan

harga standar. Dengan maksud untuk melindungi hak-hak milik orang lain., mencegah terjadinya

penimbunan barang dan menghindari dari kecurangan para pedagang. Inilah yang pernah dilakukan

oleh Khalifah Umar bin Kattab.

Konsep mekanisme pasar dalam Islam dibangun atas prinsip-prinsip sebagai berikut:

1. Ar-Ridha, yakni segala transaksi yang dilakukan haruslah atas dasar kerelaan antara masing-

masing pihak.

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
2. Berdasarkan persaingan sehat (fair competition). Mekanisme pasar akan terhambat bekerja

jika terjadi penimbunan (ihtikar) atau monopoli. Monopoli setiap barang yang penahanannya akan

membahayakan konsumen atau orang banyak.

3. Kejujuran (honesty), kejujuran merupakan pilar yang sangat penting dalam Islam, sebab

kejujuran adalah nama lain dari kebenaran itu sendiri. Islam melarang tegas melakukan kebohongan

dan penipuan dalam bentuk apapun. Sebab, nilai kebenaran ini akan berdampak langsung kepada

para pihak yang melakukan transaksi dalam perdagangan dan masyarakat secara luas.

4. Keterbukaan (transparancy) serta keadilan (justice). Pelaksanaan prinsip ini adalah transaksi

yang dilakukan dituntut untuk berlaku benar dalam pengungkapan kehendak dan keadaan yang

sesungguhnya.

2.6 Urgensi Penetapan Harga

Drs. H. Asmuni Mth., MA Mengutarakan bahwa Ibnu Taimiyah membedakan dua tipe

penetapan harga: tak adil dan tak sah, serta adil dan sah. Penetapan harga yang tak adil dan tak sah,

berlaku atas naiknya harga akibat kompetisi kekuatan pasar yang bebas, yang mengakibatkan

terjadinya kekurangan suplai atau menaikkan permintaan. Ibnu Taimiyah sering menyebut beberapa

syarat dari kompetisi yang sempurna. Misalnya, ia menyatakan, Memaksa penduduk menjual

barang-barang dagangan tanpa ada dasar kewajiban untuk menjual, merupakan tindakan yang tidak

adil dan ketidakadilan itu dilarang. Ini berarti, penduduk memiliki kebebasan sepenuhnya untuk

memasuki atau keluar dari pasar. Sedangkan penetapan harga yang adil dan sah sebagaimana pada

penjelasan di atas yaitu penetapan harga diberlakukan apabila ada kedzaliman dalam penentuan

harga atau karena ada ketimpangan harga yang kiranya diperlukan adanya tasir. Dan sah jika untuk

kemashlahatan bersama.

Tak dapat dielakkan lagi bahwa penetapan harga sangat penting dan dibutuhkan sekali pada

saat terjadi monopoli, ketimpangan atau kedzaliman dalam penentuan harga pada suatu pasar.

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
II.7 Penetapan Harga Pada Ketidaksempurnaan Pasar

Berbeda dengan kondisi musim kekeringan dan perang, Ibnu Taimiyah merekomendasikan

penetapan harga oleh pemerintah ketika terjadi ketidaksempurnaan memasuki pasar. Misalnya, jika

para penjual menolak untuk menjual barang dagangan mereka kecuali jika harganya mahal dari

pada harga normal (al-qimah al-marifah) dan pada saat yang sama penduduk sangat membutuhkan

barang-barang tersebut. Maka mereka diharuskan menjualnya pada tingkat harga yang setara,

contoh sangat nyata dari ketidaksempurnaan pasar adalah adanya monopoli dalam perdagangan

makanan dan barang-barang serupa.

2.8 Musyawarah Untuk Menetapkan Harga

Jadi, meskipun dalam berbagai kasus dibolehkan mengawasi harga, tapi dalam seluruh kasus

tak disukai keterlibatan pemerintah dalam menetapkan harga. Mereka boleh melakukannya setelah

melalui perundingan, diskusi dan konsultasi dengan penduduk yang berkepentingan.

Dalam hubungannya dengan masalah musyawarah penetapan harga, Ibnu Taimiyah

menjelaskan sebuah metode yang diajukan pendahulunya Ibnu Habib, menurutnya Imam (kepala

pemerintahan) harus menjalankan musyawarah dengan para tokoh perwakilan dari pasar (wujuh ahl

al-suq). Pihak lain juga diterima hadir dalam musyawarah ini, karena mereka harus juga dimintai

keterangannya. Setelah melakukan perundingan dan penyelidikan tentang pelaksanaan jual-beli dan

pemerintah harus secara persuasif menawarkan ketetapan harga yang didukung oleh peserta

musyawarah dan juga seluruh penduduk. Jadi, keseluruhannya harus bersepakat tentang hal itu,

harga itu tak boleh ditetapkan tanpa persetujuan dan izin mereka. Untuk menjelaskan tujuan

gagasan membentuk komisi untuk berkonsultasi, ia mengutip pendapat ahli fikih lainnya Abu al-

Walid, yang menyatakan, Logika di balik ketentuan ini adalah untuk mencari dengan cara itu-

kepentingan para penjual dan para pembeli, dan menetapkan harga harus membawa keuntungan dan

kepuasan orang yang membutuhkan penetapan harga (penjual) dan tidak mengecewakan penduduk

(selaku pembeli).

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
Jika harga itu dipaksakan tanpa persetujuan mereka (penjual) dan membuat mereka tidak

memperoleh keuntungan, maka penetapan harga seperti itu berarti korup yang mengakibatkan stok

bahan kebutuhan sehari-hari akan menghilang dan barang-barang penduduk menjadi hancur. Harga

itu perlu ditetapkan melalui musyawarah bersama dan diciptakan oleh rasa kewajiban moral serta

pengabdian untuk kepentingan umum.

2.9 Penetapan Harga Dalam Sistem Perekonomian Modern

Sebagaimana yang dimuat zonaekis.com (web khusus membahas ekonomi Islam) bahwa

secara teoritis tidak ada perbedaan signifikan antara perekonomian klasik dengan modern. Teori

harga secara mendasar sama, yakni bahwa harga wajar atau harga keseimbangan diperoleh dari

interaksi antara kekuatan permintaan dan penawaran (suplai) dalam suatu persaingan sempurna,

hanya saja dalam perekonomian modern teori dasar ini berkembang menjadi kompleks karena

adanya diversifikasi pelaku pasar, mekanisme perdagangan, instrumen, maupun perilakunya,

yang mengakibatkan terjadinya distorsi pasarDistorsi pasar yang kompleks dalam sistem

perekonomian modern melahirkan persaingan tidak sempurna dalam pasar. Secara sunnatullah

memang, apabila persaingan sempurna berjalan, keseimbangan harga di pasar akan terwujud

dengan sendirinya. Namun sunnatullah pula, bahwa manusia dalam hal ini sebagai pelaku

pasar tidaklah sempurna. Maka dalam praktek, banyak dijumpai penyimpangan perilaku yang

merusak keseimbangan pasar. Di Indonesia misalnya, secara rasional keseimbangan pasar

dirusak oleh konglomerasi dan monopoli yang merugikan masyarakat konsumen, penimbunan

BBM maupun beras dan kasus terakhir bebas masuknya gula dan beras impor yang dimasukkan

oleh pelaku bermodal besar, sehingga suplai gula di pasar menjadi tinggi dan akhirnya turunlah

harga jualnya di bawah biaya produksinya. Kasus ini jelas merugikan petani tebu dan pabrik gula

lokal. Dalam ekonomi liberal atau bebas, kasus ini sah dan dibenarkan atas prinsip bahwa barang

bebas keluar masuk pasar dan kebebesan bagi para pelaku pasar untuk menggunakan modalnya.

Dan pemerintah atau negara tidak berhak melakukan intervensi terhadap pasar.
ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II
HALUOLEO 2015 |
Pada kasus-kasus di atas, bisa diselesaikan secara adil apabila negara melakukan

intervensi pasar, misalnya dengan memaksa penimbun untuk menjual barangnya ke pasar dengan

harga wajar, menetapkan harga yang adil sehingga pelaku monopoli tidak bisa menaikkan harga

seenaknya. Para ahli ekonomi modern pun menganjurkan negara untuk menetapkan harga dalam

kasus-kasus tertentu seperti di atas.

Secara pasti di Indonesia pernah dilakukan penetapan harga seperti yang pernah

ditetapkan Presiden Abdurrahman Wachid pada harga gabah di negara ini. Penetapan harga

tersebut tertuang dalam Inpres RI No. 8 Tahun 2000 Tentang Penetapan Harga Dasar Gabah

Serta Harga Pembelian Gabah dan Beras.

Kenaikan harga yang disebabkan oleh ketidaksempurnaan pasar dalam suatu

perekonomian modern, terdiri atas beberapa macam berdasarkan pada penyebabnya, yakni harga

monopoli, kenaikan harga sebenarnya, dan kenaikan harga yang disebabkan oleh kebutuhan-

kebutuhan pokok. Untuk itu adalah peran pemerintah untuk melakukan intervensi pasar dalam

rangka mengembalikan kesempurnaan pasar, salah satunya adalah dengan menetapkan harga

pada keempat kondisi di atas.

Dalam rangka melindungi hak pembeli dan penjual, Islam membolehkan bahkan

mewajibkan melakukan intervensi harga. Ada beberapa faktor yang membolehkan intervensi

harga antara lain :

a. Intervensi harga menyangkut kepentingan masyarakat yaitu melindungi penjual dalam hal profit

margin sekaligus pembeli dalam hal purchasing power.

b. Jika harga tidak ditetapkan ketika penjual menjual dengan harga tinggi sehingga merugikan

pembeli.

c. Intervensi harga melindungi kepentingan masyarakat yang lebih luas karena pembeli biasanya

mewakili masyarakat yang lebih luas, sedangkan penjual mewakili kelompok yang lebih kecil.

Mekanisme tasir telah dibicarakan diatas, sedangkan secara konkretnya adalah pemerintah

berupaya menyediakan komoditas dimaksud dan menyesuaikannya dengan permintaan pasar.


ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II
HALUOLEO 2015 |
Sebaliknya, apabila stok barang cukup banyak di pasar, tetapi harga tetap melonjak naik, maka

pihak pemerintah perlu melakukan pengawasan yang ketat. Apabila kenaikan harga ini disebabkan

ulah para pedagang, misalnya dengan melakukan penimbunan barang dengan tujuan menjualnya

setelah terjadi lonjakan harga, pemerintah berhak untuk mematok harga.

BAB III

PENUTUP

3.1 Kesimpulan

Jadi hargasuatubarangadalahtingkatpertukaranbarangitudenganbaranglain.Dimana

harga terbentuk untuk memenuhi tujuan dua pihak, yaitu produsen dan konsumen. Produsen

memandanghargasebagainilaibarangyangmampumemberikanmanfaatkeuntungandiatasbiaya

produksinya(atautujuanlain,misalnyakeuntungan).Konsumenmemandanghargasebagainilai

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
barangyangmampumemberikanmanfaatataspemenuhankebutuhandankeinginannya(misalkan

hemat,prestise,syaratpembayaran,dansebagainya).

DalamkonsepperspektifIslam,hargadisiniditentukanolehkeseimbanganpermintaandan

penawaran. Dimana keseimbangan ini terjadi bila antara penjual dan pembeli bersikap saling

merelakan.Akantetapiapabilaparapedagangsudahmenaikkanhargadiatasbataskewajaran,

merekaitutelahberbuatzalimdansangatmembahayakanumatmanusia,makaseorangpenguasa

(Pemerintah)haruscampurtangandalammenanganipersoalantersebutdengancaramenetapkan

hargastandar.

Dengan kata lain, bahwa penetapan harga (tasir) pada suatu perdagangan dan bisnis

diperbolehkan jika di dalamnya terdapat kemungkinan adanya manipulasi sehingga berakibat

naiknya harga. Jadi praktek tasir di Indonesia sudah pernah dilakukan seperti penetapan harga

dasar gabah dan beras pada zaman pemerintahan Presiden Abdurrahman Wachid yang tertuang

dalam Inpres RI No. 8 Tahun 2000 Tentang Penetapan Harga Dasar Gabah Serta Harga

Pembelian Gabah dan Beras.

3.2 Saran

Dari penyusunan makalah ini, ada beberapa hal yang dapat dipertimbangkan sebagai

masukan untuk meningkatkann khazanah keilmuan terutama yang berkaitan dengan rujukan

referensidalamkaitannyadenganperspektifsyariahterhadappenetapanhargadisini.Jadidalamhal

inisarantersebutantaralain:

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
1. Kurangnyakontribusiilmiahsecarateoritisyangmenjadirujukanataureferensiyang

relevan dengan kondisi ekonomi masyarakat masa kini, baik secara hukum Islam

maupunsecarahukumpositif.
2. HendaknyaPemerintahmelaluiBdanPembinaanHukumNasionalsesegeramungkin

mengaturjualbelidalamrangkapenetapanhargadasaryangsesuaidenganmekanisme

syariahyangrelevanterhadapiklimekonomidiIndonesia,sehinggamasyarakatdapat

mengimplementasikannyadenganbaikdanbenar.

DAFTARPUSTAKA

AbdulWahabKholab,KaidahHukumIslam,Jakarta:RajawaliPress,1993
AdiwarmanAzwarKarim,EkonomiMikroIslamEdisiKetiga,Jakarta:PT.Raja

GrafindoPersada,2008
AdiwarmanAzwarKarim,SejarahPemikiranEkonomiIslamEdisiKetiga,Jakarta:

PT.RajaGrafindoPersada,2006

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |
Asmuni. Penetapan Harga dalam Islam: Perpektif Fikih dan Ekonomi di

http://shariaeconomy.blogspot.com/2008/07/penetapan-harga-dalam-islam-

perpektif.html
As-Suyuthi, Imam Jalaluddin. Al-Asybah wa An-Nadhair. Maktabah Ats-Tsaqafi Li An-

Nasyri WA At-Tauzi : Kairo di

http://www.eramuslim.com/konsultasi/fikih-kontemporer/pematokan-harga.htm

Inpres RI No. 8 Tahun 2000 Tentang Penetapan Harga Dasar Gabah Serta Harga

Pembelian Gabah dan Beras yang diunduh dari

http://www.tempointeraktif.com/hg/peraturan/2004/04/07/prn,20040407-03,id.html
http://zonaekis.com/penetapan-harga-dalam-sistem-perekonomian-modern#more-327

ANALISA PEMBENTUKAN HARGA DALAM PERSPEKTIF SYARIAH, UNIVERSITAS II


HALUOLEO 2015 |